(data stored in ACNUC7421 zone)

EMBL: CP000504

ID   CP000504; SV 1; circular; genomic DNA; STD; PRO; 1826402 BP.
XX
AC   CP000504;
XX
PR   Project:PRJNA16743;
XX
DT   22-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Pyrobaculum islandicum DSM 4184, complete genome.
XX
KW   .
XX
OS   Pyrobaculum islandicum DSM 4184
OC   Archaea; Crenarchaeota; Thermoprotei; Thermoproteales; Thermoproteaceae;
OC   Pyrobaculum.
XX
RN   [1]
RP   1-1826402
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Meincke L., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Cozen A.E., Fitz-Gibbon S.T.,
RA   House C.H., Saltikov C., Lowe T., Richardson P.;
RT   "Complete sequence of Pyrobaculum islandicum DSM 4184";
RL   Unpublished.
XX
RN   [2]
RP   1-1826402
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Meincke L., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Cozen A.E., Fitz-Gibbon S.T.,
RA   House C.H., Saltikov C., Lowe T., Richardson P.;
RT   ;
RL   Submitted (13-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 53b4cf271fb5f9d376090a43e3259a8d.
DR   BioSample; SAMN02598374.
DR   CABRI; DSM 4184.
DR   EnsemblGenomes-Gn; EBG00001072802.
DR   EnsemblGenomes-Gn; EBG00001072803.
DR   EnsemblGenomes-Gn; EBG00001072804.
DR   EnsemblGenomes-Gn; EBG00001072805.
DR   EnsemblGenomes-Gn; EBG00001072807.
DR   EnsemblGenomes-Gn; EBG00001072809.
DR   EnsemblGenomes-Gn; EBG00001072811.
DR   EnsemblGenomes-Gn; EBG00001072815.
DR   EnsemblGenomes-Gn; EBG00001072816.
DR   EnsemblGenomes-Gn; EBG00001072817.
DR   EnsemblGenomes-Gn; EBG00001072818.
DR   EnsemblGenomes-Gn; EBG00001072820.
DR   EnsemblGenomes-Gn; EBG00001072822.
DR   EnsemblGenomes-Gn; EBG00001072824.
DR   EnsemblGenomes-Gn; EBG00001072826.
DR   EnsemblGenomes-Gn; EBG00001072828.
DR   EnsemblGenomes-Gn; EBG00001072829.
DR   EnsemblGenomes-Gn; EBG00001072830.
DR   EnsemblGenomes-Gn; EBG00001072831.
DR   EnsemblGenomes-Gn; EBG00001072832.
DR   EnsemblGenomes-Gn; EBG00001072834.
DR   EnsemblGenomes-Gn; EBG00001072836.
DR   EnsemblGenomes-Gn; EBG00001072837.
DR   EnsemblGenomes-Gn; EBG00001072838.
DR   EnsemblGenomes-Gn; EBG00001072839.
DR   EnsemblGenomes-Gn; EBG00001072840.
DR   EnsemblGenomes-Gn; EBG00001072841.
DR   EnsemblGenomes-Gn; EBG00001072842.
DR   EnsemblGenomes-Gn; EBG00001072843.
DR   EnsemblGenomes-Gn; EBG00001072845.
DR   EnsemblGenomes-Gn; EBG00001072846.
DR   EnsemblGenomes-Gn; EBG00001072847.
DR   EnsemblGenomes-Gn; EBG00001072848.
DR   EnsemblGenomes-Gn; EBG00001072849.
DR   EnsemblGenomes-Gn; EBG00001072850.
DR   EnsemblGenomes-Gn; EBG00001072851.
DR   EnsemblGenomes-Gn; EBG00001072852.
DR   EnsemblGenomes-Gn; EBG00001072853.
DR   EnsemblGenomes-Gn; EBG00001072854.
DR   EnsemblGenomes-Gn; EBG00001072855.
DR   EnsemblGenomes-Gn; EBG00001072856.
DR   EnsemblGenomes-Gn; EBG00001072857.
DR   EnsemblGenomes-Gn; EBG00001072859.
DR   EnsemblGenomes-Gn; EBG00001072861.
DR   EnsemblGenomes-Gn; EBG00001072863.
DR   EnsemblGenomes-Gn; EBG00001072865.
DR   EnsemblGenomes-Gn; EBG00001072866.
DR   EnsemblGenomes-Gn; EBG00001072867.
DR   EnsemblGenomes-Gn; EBG00001072868.
DR   EnsemblGenomes-Gn; EBG00001072870.
DR   EnsemblGenomes-Gn; EBG00001072872.
DR   EnsemblGenomes-Gn; EBG00001072874.
DR   EnsemblGenomes-Gn; EBG00001072876.
DR   EnsemblGenomes-Gn; EBG00001072878.
DR   EnsemblGenomes-Gn; EBG00001072879.
DR   EnsemblGenomes-Gn; EBG00001072880.
DR   EnsemblGenomes-Gn; EBG00001072881.
DR   EnsemblGenomes-Gn; EBG00001072882.
DR   EnsemblGenomes-Gn; EBG00001072883.
DR   EnsemblGenomes-Gn; EBG00001072884.
DR   EnsemblGenomes-Gn; EBG00001072885.
DR   EnsemblGenomes-Gn; EBG00001072886.
DR   EnsemblGenomes-Gn; EBG00001072887.
DR   EnsemblGenomes-Gn; EBG00001072888.
DR   EnsemblGenomes-Gn; EBG00001072889.
DR   EnsemblGenomes-Gn; EBG00001072890.
DR   EnsemblGenomes-Gn; EBG00001072892.
DR   EnsemblGenomes-Gn; EBG00001072893.
DR   EnsemblGenomes-Gn; EBG00001072894.
DR   EnsemblGenomes-Gn; EBG00001072896.
DR   EnsemblGenomes-Gn; EBG00001072897.
DR   EnsemblGenomes-Gn; EBG00001072898.
DR   EnsemblGenomes-Gn; EBG00001072900.
DR   EnsemblGenomes-Gn; EBG00001072901.
DR   EnsemblGenomes-Gn; EBG00001072902.
DR   EnsemblGenomes-Gn; EBG00001072903.
DR   EnsemblGenomes-Gn; EBG00001072905.
DR   EnsemblGenomes-Gn; EBG00001072906.
DR   EnsemblGenomes-Gn; EBG00001072907.
DR   EnsemblGenomes-Gn; EBG00001072908.
DR   EnsemblGenomes-Gn; EBG00001072909.
DR   EnsemblGenomes-Gn; EBG00001072910.
DR   EnsemblGenomes-Gn; EBG00001072912.
DR   EnsemblGenomes-Gn; EBG00001072913.
DR   EnsemblGenomes-Gn; EBG00001072914.
DR   EnsemblGenomes-Gn; EBG00001072915.
DR   EnsemblGenomes-Gn; EBG00001072916.
DR   EnsemblGenomes-Gn; EBG00001072917.
DR   EnsemblGenomes-Gn; EBG00001072918.
DR   EnsemblGenomes-Gn; EBG00001072919.
DR   EnsemblGenomes-Gn; EBG00001072921.
DR   EnsemblGenomes-Gn; EBG00001072922.
DR   EnsemblGenomes-Gn; EBG00001072923.
DR   EnsemblGenomes-Gn; EBG00001072924.
DR   EnsemblGenomes-Gn; EBG00001072926.
DR   EnsemblGenomes-Gn; EBG00001072927.
DR   EnsemblGenomes-Gn; EBG00001072928.
DR   EnsemblGenomes-Gn; EBG00001072929.
DR   EnsemblGenomes-Gn; EBG00001072930.
DR   EnsemblGenomes-Gn; EBG00001072931.
DR   EnsemblGenomes-Gn; EBG00001072932.
DR   EnsemblGenomes-Gn; EBG00001072933.
DR   EnsemblGenomes-Gn; EBG00001072935.
DR   EnsemblGenomes-Gn; EBG00001072938.
DR   EnsemblGenomes-Gn; EBG00001072941.
DR   EnsemblGenomes-Gn; EBG00001072943.
DR   EnsemblGenomes-Gn; EBG00001072944.
DR   EnsemblGenomes-Gn; EBG00001072945.
DR   EnsemblGenomes-Gn; EBG00001072946.
DR   EnsemblGenomes-Gn; EBG00001072947.
DR   EnsemblGenomes-Gn; EBG00001072949.
DR   EnsemblGenomes-Gn; EBG00001072950.
DR   EnsemblGenomes-Gn; EBG00001072951.
DR   EnsemblGenomes-Gn; Pisl_R0001.
DR   EnsemblGenomes-Gn; Pisl_R0002.
DR   EnsemblGenomes-Gn; Pisl_R0003.
DR   EnsemblGenomes-Gn; Pisl_R0004.
DR   EnsemblGenomes-Gn; Pisl_R0005.
DR   EnsemblGenomes-Gn; Pisl_R0006.
DR   EnsemblGenomes-Gn; Pisl_R0007.
DR   EnsemblGenomes-Gn; Pisl_R0008.
DR   EnsemblGenomes-Gn; Pisl_R0009.
DR   EnsemblGenomes-Gn; Pisl_R0010.
DR   EnsemblGenomes-Gn; Pisl_R0011.
DR   EnsemblGenomes-Gn; Pisl_R0012.
DR   EnsemblGenomes-Gn; Pisl_R0013.
DR   EnsemblGenomes-Gn; Pisl_R0014.
DR   EnsemblGenomes-Gn; Pisl_R0015.
DR   EnsemblGenomes-Gn; Pisl_R0016.
DR   EnsemblGenomes-Gn; Pisl_R0017.
DR   EnsemblGenomes-Gn; Pisl_R0018.
DR   EnsemblGenomes-Gn; Pisl_R0019.
DR   EnsemblGenomes-Gn; Pisl_R0020.
DR   EnsemblGenomes-Gn; Pisl_R0021.
DR   EnsemblGenomes-Gn; Pisl_R0022.
DR   EnsemblGenomes-Gn; Pisl_R0023.
DR   EnsemblGenomes-Gn; Pisl_R0024.
DR   EnsemblGenomes-Gn; Pisl_R0025.
DR   EnsemblGenomes-Gn; Pisl_R0026.
DR   EnsemblGenomes-Gn; Pisl_R0027.
DR   EnsemblGenomes-Gn; Pisl_R0028.
DR   EnsemblGenomes-Gn; Pisl_R0029.
DR   EnsemblGenomes-Gn; Pisl_R0030.
DR   EnsemblGenomes-Gn; Pisl_R0031.
DR   EnsemblGenomes-Gn; Pisl_R0032.
DR   EnsemblGenomes-Gn; Pisl_R0033.
DR   EnsemblGenomes-Gn; Pisl_R0034.
DR   EnsemblGenomes-Gn; Pisl_R0035.
DR   EnsemblGenomes-Gn; Pisl_R0036.
DR   EnsemblGenomes-Gn; Pisl_R0037.
DR   EnsemblGenomes-Gn; Pisl_R0038.
DR   EnsemblGenomes-Gn; Pisl_R0039.
DR   EnsemblGenomes-Gn; Pisl_R0040.
DR   EnsemblGenomes-Gn; Pisl_R0041.
DR   EnsemblGenomes-Gn; Pisl_R0042.
DR   EnsemblGenomes-Gn; Pisl_R0043.
DR   EnsemblGenomes-Gn; Pisl_R0044.
DR   EnsemblGenomes-Gn; Pisl_R0045.
DR   EnsemblGenomes-Gn; Pisl_R0046.
DR   EnsemblGenomes-Gn; Pisl_R0047.
DR   EnsemblGenomes-Gn; Pisl_R0048.
DR   EnsemblGenomes-Tr; EBT00001676314.
DR   EnsemblGenomes-Tr; EBT00001676315.
DR   EnsemblGenomes-Tr; EBT00001676317.
DR   EnsemblGenomes-Tr; EBT00001676318.
DR   EnsemblGenomes-Tr; EBT00001676320.
DR   EnsemblGenomes-Tr; EBT00001676322.
DR   EnsemblGenomes-Tr; EBT00001676323.
DR   EnsemblGenomes-Tr; EBT00001676324.
DR   EnsemblGenomes-Tr; EBT00001676325.
DR   EnsemblGenomes-Tr; EBT00001676326.
DR   EnsemblGenomes-Tr; EBT00001676328.
DR   EnsemblGenomes-Tr; EBT00001676329.
DR   EnsemblGenomes-Tr; EBT00001676331.
DR   EnsemblGenomes-Tr; EBT00001676333.
DR   EnsemblGenomes-Tr; EBT00001676335.
DR   EnsemblGenomes-Tr; EBT00001676336.
DR   EnsemblGenomes-Tr; EBT00001676338.
DR   EnsemblGenomes-Tr; EBT00001676340.
DR   EnsemblGenomes-Tr; EBT00001676342.
DR   EnsemblGenomes-Tr; EBT00001676344.
DR   EnsemblGenomes-Tr; EBT00001676345.
DR   EnsemblGenomes-Tr; EBT00001676346.
DR   EnsemblGenomes-Tr; EBT00001676347.
DR   EnsemblGenomes-Tr; EBT00001676348.
DR   EnsemblGenomes-Tr; EBT00001676349.
DR   EnsemblGenomes-Tr; EBT00001676351.
DR   EnsemblGenomes-Tr; EBT00001676353.
DR   EnsemblGenomes-Tr; EBT00001676355.
DR   EnsemblGenomes-Tr; EBT00001676356.
DR   EnsemblGenomes-Tr; EBT00001676359.
DR   EnsemblGenomes-Tr; EBT00001676361.
DR   EnsemblGenomes-Tr; EBT00001676363.
DR   EnsemblGenomes-Tr; EBT00001676364.
DR   EnsemblGenomes-Tr; EBT00001676365.
DR   EnsemblGenomes-Tr; EBT00001676367.
DR   EnsemblGenomes-Tr; EBT00001676369.
DR   EnsemblGenomes-Tr; EBT00001676371.
DR   EnsemblGenomes-Tr; EBT00001676372.
DR   EnsemblGenomes-Tr; EBT00001676373.
DR   EnsemblGenomes-Tr; EBT00001676375.
DR   EnsemblGenomes-Tr; EBT00001676376.
DR   EnsemblGenomes-Tr; EBT00001676379.
DR   EnsemblGenomes-Tr; EBT00001676381.
DR   EnsemblGenomes-Tr; EBT00001676385.
DR   EnsemblGenomes-Tr; EBT00001676387.
DR   EnsemblGenomes-Tr; EBT00001676390.
DR   EnsemblGenomes-Tr; EBT00001676391.
DR   EnsemblGenomes-Tr; EBT00001676392.
DR   EnsemblGenomes-Tr; EBT00001676393.
DR   EnsemblGenomes-Tr; EBT00001676395.
DR   EnsemblGenomes-Tr; EBT00001676396.
DR   EnsemblGenomes-Tr; EBT00001676398.
DR   EnsemblGenomes-Tr; EBT00001676400.
DR   EnsemblGenomes-Tr; EBT00001676403.
DR   EnsemblGenomes-Tr; EBT00001676404.
DR   EnsemblGenomes-Tr; EBT00001676406.
DR   EnsemblGenomes-Tr; EBT00001676407.
DR   EnsemblGenomes-Tr; EBT00001676409.
DR   EnsemblGenomes-Tr; EBT00001676412.
DR   EnsemblGenomes-Tr; EBT00001676415.
DR   EnsemblGenomes-Tr; EBT00001676417.
DR   EnsemblGenomes-Tr; EBT00001676418.
DR   EnsemblGenomes-Tr; EBT00001676420.
DR   EnsemblGenomes-Tr; EBT00001676422.
DR   EnsemblGenomes-Tr; EBT00001676424.
DR   EnsemblGenomes-Tr; EBT00001676426.
DR   EnsemblGenomes-Tr; EBT00001676427.
DR   EnsemblGenomes-Tr; EBT00001676428.
DR   EnsemblGenomes-Tr; EBT00001676430.
DR   EnsemblGenomes-Tr; EBT00001676432.
DR   EnsemblGenomes-Tr; EBT00001676434.
DR   EnsemblGenomes-Tr; EBT00001676435.
DR   EnsemblGenomes-Tr; EBT00001676436.
DR   EnsemblGenomes-Tr; EBT00001676437.
DR   EnsemblGenomes-Tr; EBT00001676438.
DR   EnsemblGenomes-Tr; EBT00001676440.
DR   EnsemblGenomes-Tr; EBT00001676441.
DR   EnsemblGenomes-Tr; EBT00001676443.
DR   EnsemblGenomes-Tr; EBT00001676444.
DR   EnsemblGenomes-Tr; EBT00001676445.
DR   EnsemblGenomes-Tr; EBT00001676446.
DR   EnsemblGenomes-Tr; EBT00001676447.
DR   EnsemblGenomes-Tr; EBT00001676448.
DR   EnsemblGenomes-Tr; EBT00001676449.
DR   EnsemblGenomes-Tr; EBT00001676450.
DR   EnsemblGenomes-Tr; EBT00001676451.
DR   EnsemblGenomes-Tr; EBT00001676452.
DR   EnsemblGenomes-Tr; EBT00001676453.
DR   EnsemblGenomes-Tr; EBT00001676454.
DR   EnsemblGenomes-Tr; EBT00001676455.
DR   EnsemblGenomes-Tr; EBT00001676456.
DR   EnsemblGenomes-Tr; EBT00001676457.
DR   EnsemblGenomes-Tr; EBT00001676458.
DR   EnsemblGenomes-Tr; EBT00001676459.
DR   EnsemblGenomes-Tr; EBT00001676460.
DR   EnsemblGenomes-Tr; EBT00001676461.
DR   EnsemblGenomes-Tr; EBT00001676462.
DR   EnsemblGenomes-Tr; EBT00001676463.
DR   EnsemblGenomes-Tr; EBT00001676464.
DR   EnsemblGenomes-Tr; EBT00001676465.
DR   EnsemblGenomes-Tr; EBT00001676466.
DR   EnsemblGenomes-Tr; EBT00001676467.
DR   EnsemblGenomes-Tr; EBT00001676468.
DR   EnsemblGenomes-Tr; EBT00001676469.
DR   EnsemblGenomes-Tr; EBT00001676470.
DR   EnsemblGenomes-Tr; EBT00001676471.
DR   EnsemblGenomes-Tr; EBT00001676472.
DR   EnsemblGenomes-Tr; EBT00001676473.
DR   EnsemblGenomes-Tr; EBT00001676474.
DR   EnsemblGenomes-Tr; EBT00001676475.
DR   EnsemblGenomes-Tr; EBT00001676476.
DR   EnsemblGenomes-Tr; EBT00001676477.
DR   EnsemblGenomes-Tr; EBT00001676478.
DR   EnsemblGenomes-Tr; Pisl_R0001-1.
DR   EnsemblGenomes-Tr; Pisl_R0002-1.
DR   EnsemblGenomes-Tr; Pisl_R0003-1.
DR   EnsemblGenomes-Tr; Pisl_R0004-1.
DR   EnsemblGenomes-Tr; Pisl_R0005-1.
DR   EnsemblGenomes-Tr; Pisl_R0006-1.
DR   EnsemblGenomes-Tr; Pisl_R0007-1.
DR   EnsemblGenomes-Tr; Pisl_R0008-1.
DR   EnsemblGenomes-Tr; Pisl_R0009-1.
DR   EnsemblGenomes-Tr; Pisl_R0010-1.
DR   EnsemblGenomes-Tr; Pisl_R0011-1.
DR   EnsemblGenomes-Tr; Pisl_R0012-1.
DR   EnsemblGenomes-Tr; Pisl_R0013-1.
DR   EnsemblGenomes-Tr; Pisl_R0014-1.
DR   EnsemblGenomes-Tr; Pisl_R0015-1.
DR   EnsemblGenomes-Tr; Pisl_R0016-1.
DR   EnsemblGenomes-Tr; Pisl_R0017-1.
DR   EnsemblGenomes-Tr; Pisl_R0018-1.
DR   EnsemblGenomes-Tr; Pisl_R0019-1.
DR   EnsemblGenomes-Tr; Pisl_R0020-1.
DR   EnsemblGenomes-Tr; Pisl_R0021-1.
DR   EnsemblGenomes-Tr; Pisl_R0022-1.
DR   EnsemblGenomes-Tr; Pisl_R0023-1.
DR   EnsemblGenomes-Tr; Pisl_R0024-1.
DR   EnsemblGenomes-Tr; Pisl_R0025-1.
DR   EnsemblGenomes-Tr; Pisl_R0026-1.
DR   EnsemblGenomes-Tr; Pisl_R0027-1.
DR   EnsemblGenomes-Tr; Pisl_R0028-1.
DR   EnsemblGenomes-Tr; Pisl_R0029-1.
DR   EnsemblGenomes-Tr; Pisl_R0030-1.
DR   EnsemblGenomes-Tr; Pisl_R0031-1.
DR   EnsemblGenomes-Tr; Pisl_R0032-1.
DR   EnsemblGenomes-Tr; Pisl_R0033-1.
DR   EnsemblGenomes-Tr; Pisl_R0034-1.
DR   EnsemblGenomes-Tr; Pisl_R0035-1.
DR   EnsemblGenomes-Tr; Pisl_R0036-1.
DR   EnsemblGenomes-Tr; Pisl_R0037-1.
DR   EnsemblGenomes-Tr; Pisl_R0038-1.
DR   EnsemblGenomes-Tr; Pisl_R0039-1.
DR   EnsemblGenomes-Tr; Pisl_R0040-1.
DR   EnsemblGenomes-Tr; Pisl_R0041-1.
DR   EnsemblGenomes-Tr; Pisl_R0042-1.
DR   EnsemblGenomes-Tr; Pisl_R0043-1.
DR   EnsemblGenomes-Tr; Pisl_R0044-1.
DR   EnsemblGenomes-Tr; Pisl_R0045-1.
DR   EnsemblGenomes-Tr; Pisl_R0046-1.
DR   EnsemblGenomes-Tr; Pisl_R0047-1.
DR   EnsemblGenomes-Tr; Pisl_R0048-1.
DR   EuropePMC; PMC1974809; 17504473.
DR   EuropePMC; PMC2222616; 18042280.
DR   EuropePMC; PMC2223247; 18039820.
DR   EuropePMC; PMC2738675; 19671140.
DR   EuropePMC; PMC3035369; 21304741.
DR   EuropePMC; PMC4751853; 26637598.
DR   EuropePMC; PMC6009581; 29771354.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01355; CRISPR-DR26.
DR   RFAM; RF01722; Pyrobac-1.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000504.
DR   StrainInfo; 158684; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002681
CC   Source DNA and bacteria available from Todd Lowe
CC   (lowe@soe.ucsc.edu)
CC   Bacteria available from DSMZ: DSM 4184
CC   Contacts: Todd Lowe (lowe@soe.ucsc.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1826402
FT                   /organism="Pyrobaculum islandicum DSM 4184"
FT                   /strain="DSM 4184"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:384616"
FT   repeat_region   complement(103..1225)
FT                   /rpt_unit_range=103..128
FT                   /note="CRISPRs"
FT   gene            1492..1857
FT                   /locus_tag="Pisl_0001"
FT   CDS_pept        1492..1857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0001"
FT                   /product="paREP9"
FT                   /note="KEGG: pai:PAE3185 paREP9, associated with SRSRs"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87185"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF3"
FT                   /protein_id="ABL87185.1"
FT                   /translation="MYLYFGRMKIGPLVGYLWLLGRRLYLKLGWRPRDTVYLGSVDDLL
FT                   GVAVRVRRLVPRPLPVRQLVAALVDALKKAYYVASRCRDSPRWKIRAWEAAMAIEYAAS
FT                   ALAMYWPSAAKKILDDG"
FT   gene            1869..2660
FT                   /locus_tag="Pisl_0002"
FT   CDS_pept        1869..2660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0002"
FT                   /product="protein of unknown function DUF62"
FT                   /note="PFAM: protein of unknown function DUF62; KEGG:
FT                   pai:PAE3627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87186"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF4"
FT                   /protein_id="ABL87186.1"
FT                   /translation="MGFCFVVAVVALLTDFGFRDYFVAVMKGVILSINPGARIVDITHE
FT                   VPPQDVFTGAFILKAAYRWFPPGTIFVAVVDPGVGTERAPLILKTRRYFFVGPDNGLLA
FT                   PAAEEDGVLEAYRIEVRLPQLSSTFHGRDVFAPAAAYLSLGVEPRLIGSPISQWKRLEI
FT                   PEARVVDGVVYSRVVYIDRFGNVYTSARSLQGVSYGEVMCVETPRGVLRARYVETYGRV
FT                   SPGEAVLLINSEGYLELAVAMGNAAATYGLRPGDEIKIYRC"
FT   gene            complement(2758..2868)
FT                   /locus_tag="Pisl_R0001"
FT   rRNA            complement(2758..2868)
FT                   /locus_tag="Pisl_R0001"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(3000..3623)
FT                   /locus_tag="Pisl_0003"
FT   CDS_pept        complement(3000..3623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0003"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87187"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF5"
FT                   /protein_id="ABL87187.1"
FT                   /translation="MKHLLAALFLAIAAAALGVRDWNDRPLAYGTAAVFDEEGSLVALT
FT                   YIFGGETLYGLPWRPGYVLRVAWGIASPREIAAGQVIWIYDSAVLRDIVELGEPTGGKI
FT                   RTWAYPVTVVVKEAGGRPAAGCYARVIDAATRGRWVDVFISTASDGSIRLYQAPATDYL
FT                   VNIYCGGYLTASTKFSIQRGAPSTAWNYEITIDYITSVRVENAP"
FT   sig_peptide     complement(3567..3623)
FT                   /locus_tag="Pisl_0003"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.834 at
FT                   residue 19"
FT   gene            3668..4570
FT                   /locus_tag="Pisl_0004"
FT   CDS_pept        3668..4570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0004"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: pai:PAE3631 NAD dependent
FT                   epimerase/dehydratase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87188"
FT                   /db_xref="GOA:A1RQF6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF6"
FT                   /protein_id="ABL87188.1"
FT                   /translation="MRILIFGGLGFIGANLAEALSEYELYVAHRPGSREAKPQVARFVA
FT                   QYATLLEYTDPATAFEKTRPHVVINLVGQYYGRSQELWQANAEFPRLLCDAARRAGWRG
FT                   KVVHFSAATVRGPVGAIIEEEELHLHGVVPDNDFDRSKAAGEEAVANCFNDWVIVRPAL
FT                   VYGRFNTHPEWVTLTRFVKRGVAPMLKARVSAISVRELAKVVKASLALARQYFFATECQ
FT                   PRPLSEFVRAIAKALGRRVVPIPIPTAVLHIAASPEFKRHLPYLDKAFSCEKMRRLLGL
FT                   EPRPNFETEVREMVESINV"
FT   sig_peptide     3668..3727
FT                   /locus_tag="Pisl_0004"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.627) with cleavage site probability 0.483 at
FT                   residue 20"
FT   gene            complement(4829..6109)
FT                   /locus_tag="Pisl_0005"
FT   CDS_pept        complement(4829..6109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0005"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE2522
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87189"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF7"
FT                   /protein_id="ABL87189.1"
FT                   /translation="MYAYRTLKVEIPWKLIEERPDVLDLVTRMHLAAEEYVKRLLKELT
FT                   GQEEPRLTAEELDRHLTPDRRELAHRIIEEIFPKYGLGRALVRYAKFLWHDTVFQQAIP
FT                   LSTQLRVENEKDMSRAVFVDLKSGVLRVRKLGIPPFAVELKKGSISWIRERLQEGAKLK
FT                   LAYLGVDVRRGKDPTYGGLYIALVFAREVAPVEPKALVVVDVNRLDHYVKVGLVADGRV
FT                   VELLKFPKKERIRKLEKIHAHISQLSRALARVDEDRDPRRALDIQRQLWKLETKRYGVI
FT                   RDVVINAAREIIKLAREHQAAVVVDAVEDDTYRELKERGGNGVKKHFLDGLGQLRRRLQ
FT                   ALAQWYGLPYVEERLYSTICPKCGAKMEELRNRRMHCPSCGFGAHRDNVPMIWAEKKYQ
FT                   ELIEKTKQPTFPTPNHHTFNLVTTFYS"
FT   gene            complement(6216..6506)
FT                   /locus_tag="Pisl_0006"
FT   CDS_pept        complement(6216..6506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0006"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87190"
FT                   /db_xref="GOA:A1RQF8"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF8"
FT                   /protein_id="ABL87190.1"
FT                   /translation="MSRGSGKWCVVALFRGVGGLKNGFTAIIAVSAVGTAVGIAGMNWT
FT                   WGRQQRRITPAGVNTLLMTTIALVAAKISNMAGTRLSTPGKKGGGSVFRRL"
FT   gene            6710..6877
FT                   /locus_tag="Pisl_0007"
FT   CDS_pept        6710..6877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3634 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87191"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQF9"
FT                   /protein_id="ABL87191.1"
FT                   /translation="MLDLRRYIEGKFVVLVGDRELAERLGVAHATVEEVERFLAWLSRE
FT                   VPLVFKPYLQ"
FT   gene            6907..7482
FT                   /locus_tag="Pisl_0008"
FT   CDS_pept        6907..7482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87192"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG0"
FT                   /protein_id="ABL87192.1"
FT                   /translation="MSFEKNLLERIASYIPGYAGYKEKEVRRETDALVRRHVASILSAA
FT                   AAQLTLGPAEARAVAANPEARFLWDSVKAALDRVTQKIDKAQHGYSGFFDLAKVDESVL
FT                   EEVYRHDLTLVETAKKVAETVSSLKALRPLSQEWLDALRQILAQLQSLDSAVDERNRIL
FT                   DAIKTPPQPQWESGGRKRGLLDRLFKRT"
FT   gene            complement(7469..8215)
FT                   /locus_tag="Pisl_0009"
FT   CDS_pept        complement(7469..8215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0009"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: pai:PAE3636 zinc
FT                   transporter, ZIP family"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87193"
FT                   /db_xref="GOA:A1RQG1"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG1"
FT                   /protein_id="ABL87193.1"
FT                   /translation="MDPLVLNALILIMGTLAGVAAGVLPFRKWGEGLVDLGLGFTGGVM
FT                   LVASFTSLILPAVERWGFWQVGLGIAGGVAFIRLLDVLLPHEHLVKGYEGPAVLAGKLK
FT                   KSWLIALAITIHNIPEGLAVGVSTIYNAELGFVTALAIAIQDVPEGAAVVMPLLRFRLL
FT                   KTAVLIGVISAVVEGGAALASALFLSAVPLAMGAAMGLAGGAMMYVTAAELYPDIYAED
FT                   KRKDLPTYGFVAGVLTMLYLDVAMSS"
FT   sig_peptide     complement(8153..8215)
FT                   /locus_tag="Pisl_0009"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.391 at
FT                   residue 21"
FT   gene            8263..9234
FT                   /locus_tag="Pisl_0010"
FT   CDS_pept        8263..9234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0010"
FT                   /product="zinc finger, RanBP2-type"
FT                   /note="SMART: zinc finger, RanBP2-type; KEGG: pai:PAE3638
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87194"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR033880"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG2"
FT                   /protein_id="ABL87194.1"
FT                   /translation="MPQVIQWVNPKEGEIIWRYPVDRIEWGAQLIVEEWQAAVFMRDGK
FT                   VYDVFRAGRHTLTTLNLPLLTQALSRVAGFDKSPFVAVVIYVSLKQHQLPFGGRGQTAE
FT                   LAPIQFYGSAWFRVADPALFVTQVVGGQNIYTTEDLQKFLRGYFNELLMAELSRQSIFT
FT                   IYGNLDQVSFIVKNAIDPHFRRLGLELVDVRFEGLDVTDQVWRDRLFFIRATGVNPAEY
FT                   LRMETVQKAAAELGKSPGAAAGTGIVLIPPLLWPQQQAAPPPQPAQPAAQQGVVCPQCG
FT                   YVNPPGAKYCINCGYMLGKKCPQCGYVNPPEAKFCMNCGAKL"
FT   gene            9231..9527
FT                   /locus_tag="Pisl_0011"
FT   CDS_pept        9231..9527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87195"
FT                   /db_xref="GOA:A1RQG3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG3"
FT                   /protein_id="ABL87195.1"
FT                   /translation="MTPGERAAALATLAFGLYLIAASLGAAPLALNIAVGLPLAVFGVV
FT                   YAAFGGSREALLWGGVLAIAGVATAAGGAASPLLVAGVALVFISLFALLAGRR"
FT   sig_peptide     9231..9311
FT                   /locus_tag="Pisl_0011"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.706 at
FT                   residue 27"
FT   gene            9524..10444
FT                   /locus_tag="Pisl_0012"
FT   CDS_pept        9524..10444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0012"
FT                   /product="protein of unknown function DUF1152"
FT                   /note="PFAM: protein of unknown function DUF1152; KEGG:
FT                   pai:PAE3641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87196"
FT                   /db_xref="InterPro:IPR010581"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG4"
FT                   /protein_id="ABL87196.1"
FT                   /translation="MTLFLAIGGGGDVIMAAAIAGDDAVGQIPWERYVVDPTPGPVPPD
FT                   ALREVVELGGGLYLATPRSYVERGGRRFKTQGMCAAGALGKSIYIVDPYRKPSELAKAL
FT                   ARFGKVVGVDVGGDVLGVGCEESLGSPLADAYGLAVLAKLAEAGAAAELLVMSPGADGE
FT                   LDRRYIMQRVAEVAREGGLLGVVGLSREQAAVLERLVERCVTEASAVALRALRGEYGVY
FT                   TLRGGLRRVEVDICAAVGLRLEPRVLLKFNRAARVIYEGDLPIDKAADVLLEEGIPTEL
FT                   HLERLLASGLEPRQAIEELRKYKRC"
FT   gene            complement(10441..11241)
FT                   /locus_tag="Pisl_0013"
FT   CDS_pept        complement(10441..11241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3642 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87197"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG5"
FT                   /protein_id="ABL87197.1"
FT                   /translation="MRKAAYIVLAVLIIGAALYFIHTAPRHGLETISTSQLPTTTTTQT
FT                   SPAVNTPAVGAVRPSFDIKNYEVNYTVVITVAVGDVSISMRGWSVEGSGALGNYSFGEL
FT                   YATVPPHGPIKLVFKVATEGRVAYIVTCAGGQCQTEVRPANYSTIYLLRGVETSRVEKG
FT                   PCTYLGYGGVEVEERGRISQEAVAQILGNLAGNGTGVYTTKICEVNGVPLKTAGTAYLN
FT                   ITVYGQRLALTVSIESAAVSAGPFNEDRYRQVLRETKAAQTAKA"
FT   sig_peptide     complement(11155..11241)
FT                   /locus_tag="Pisl_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.859 at
FT                   residue 29"
FT   gene            complement(11280..12122)
FT                   /locus_tag="Pisl_0014"
FT   CDS_pept        complement(11280..12122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0014"
FT                   /product="Zinc finger, TFIIB-type domain protein"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein; KEGG:
FT                   pai:PAE3643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87198"
FT                   /db_xref="GOA:A1RQG6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG6"
FT                   /protein_id="ABL87198.1"
FT                   /translation="MIVQCPYCGARYEAPPGRKFYVCPYCGTVVSEGRTYERVYIFKPS
FT                   VDKTAAFRTALNFRPVGAPEDLPTASPTGAELHFLPLYLYHITFEPLPELETYAAALAL
FT                   SKPPFRLPKGYVFPARWRTPFKPSLERAGVFHQPDLEPEEAFRSLDEVVDEAKTYASVF
FT                   KTRVEINWSFEGIVYYPFWLLIYQYGGRSYSALVDGAEGSLLYLEYPLSKRGRAGGLAL
FT                   GLAAASGSAAVGALAAFFLGLPPEPGAFGGGLAGLGAFIRLTTFAAARKGQYEGETRL"
FT   gene            complement(12119..13117)
FT                   /locus_tag="Pisl_0015"
FT   CDS_pept        complement(12119..13117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3644 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87199"
FT                   /db_xref="GOA:A1RQG7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG7"
FT                   /protein_id="ABL87199.1"
FT                   /translation="MRCSYCGAPLDVTPDSVVVVCRYCGRANFLAGEPRDVLAVPTLPA
FT                   SEIVRRAVERTRRDLNLRWRISEINFASPDLYYLPFYLVDVKLSATYQATVVVTYTKTV
FT                   YMRGQPRTQIVTKVVRVGGRVALADVVAVLARRAAWGLSVDRLTSHFFKTGPEPKPLAE
FT                   VASGGQASAFMAGEFTAERAKAKAVRALIPRLLAAVDRDAEERARAAVGVFTAAAYVRD
FT                   KTVDYEVERLVASPLTYLPLWVMPYFYRGSSFRYYIAGWDGEVVLAEEPVFVEHKAASL
FT                   LAAAAAGGLAGGLGYAALGVDPYVGAAVVAAGGALSYMAAGGFLKSRRVEK"
FT   gene            13170..14108
FT                   /locus_tag="Pisl_0016"
FT   CDS_pept        13170..14108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0016"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pai:PAE3645 aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87200"
FT                   /db_xref="GOA:A1RQG8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG8"
FT                   /protein_id="ABL87200.1"
FT                   /translation="MFKWIRERPAEYDLASSGVAKIEVKPADEPPVEEILTSLYKISPR
FT                   ELALTAGAQEGLFLAFHAVRPKAVVTVAPEYEPIWRLPGAMGVRHVEVRDVWEAPLGPE
FT                   TVLVFSNPNNPTGRFLGRGELWELADEARRRGAVLIVDIIFSDFVTDDLGGLPLENAVY
FT                   VHSTDKFYTSDYRLGWAFGDSRIVEKIRVFKDLANPGPRDLEKKAAAALLSRREEVKKR
FT                   NLAVIDKNAAALLSAFPNAIYNPHMPIALVEVGCDDVAFAEGLLKRGVRVMPGTFMKAP
FT                   RAVRVGLGVEPPPRFAQALGIFGEAFGNCRT"
FT   gene            complement(14031..14945)
FT                   /locus_tag="Pisl_0017"
FT   CDS_pept        complement(14031..14945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0017"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: pai:PAE3646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87201"
FT                   /db_xref="GOA:A1RQG9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQG9"
FT                   /protein_id="ABL87201.1"
FT                   /translation="MISIRVPTREVDLDTYRRRVFETIRRYRLVEIRDVIYVAVSGGKD
FT                   SCAALALLKEYIEEYRIDAEVRAFHINLGFRTSAKIEEAVRTLAEALGVGIHVVYARDY
FT                   LDIEAAARATGRPICSVCGAVKRYLMNKVPRELGATKVATGHHAYDFLTYYIKNLVGRN
FT                   HLWNFKILPRVEGGGLLVTKIRPLIFARPEENEEYCRRRGLPVSAVCCEYGLCGAAHAE
FT                   VYEMLAAARRRDPDFDLKLIGGVVDFNMKFGRAEVEQLHKCKICGEPASGEICAVCKLR
FT                   AAVAKSLAKDSQSLREAGRRLYA"
FT   gene            14984..15613
FT                   /locus_tag="Pisl_0018"
FT   CDS_pept        14984..15613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0018"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   pai:PAE3647 probable RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87202"
FT                   /db_xref="GOA:A1RQH0"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH0"
FT                   /protein_id="ABL87202.1"
FT                   /translation="MRDIRRCAVCGAYVEEEVHCGAPTAVVLDGATRLKISKLLSLALR
FT                   HSPHVLGITLDVEGWADINAVVEGLRRAGLPASPQVLKAVAQLDDKGRFEIRDGRVRAR
FT                   YGHTIKVQIRYEVDLDTRLLYHGTALYVLPSILSQGILPMRRLYVHLAVDVETACLNAR
FT                   RRQNPAVVEVDADCVRKSGNPIYKATEKIRLTPYVPPTCVKKWAIC"
FT   gene            complement(16178..17203)
FT                   /locus_tag="Pisl_0019"
FT   CDS_pept        complement(16178..17203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2498 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87203"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH1"
FT                   /protein_id="ABL87203.1"
FT                   /translation="MSKKAMEKKLIPVIALAALAALAQAASVNASDFHLWLKCKAIELY
FT                   VNVTGANFTLPQCDVLLSQLNKTFIITTPTARPLPMIGVGELKMLNVSDPKAVFQQIRE
FT                   IRLAAIKELGKHLNRTVDRVYAHINASADIDNATERGLRTLMRVRALLGLVNASRTAIG
FT                   AIDRNIERLKLLREVYRWANVSDLVRNMNMSELDKAIDRLEKVMERLRELQSHLEKMKM
FT                   AQLSQILALRARIINETISILQELKTLTPEERGKVVSKIASQRGAEIREIIKEIIKQRK
FT                   APIGGASGEAGGSGQSSGGGQGGAGGQASGGGSGGWSGGQGSGGGSGSGQGNWGGGGRG
FT                   R"
FT   sig_peptide     complement(17111..17203)
FT                   /locus_tag="Pisl_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.628 at
FT                   residue 31"
FT   gene            17273..18145
FT                   /locus_tag="Pisl_0020"
FT   CDS_pept        17273..18145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3650 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87204"
FT                   /db_xref="GOA:A1RQH2"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH2"
FT                   /protein_id="ABL87204.1"
FT                   /translation="MLVILNLTAPPVLILLLPAAMFGNYTLPAPPASDVAAFTPSGAAL
FT                   PTWVVGGNLYILQGGDPAVAIYVPRFENSSGVYKVSLGRGDIIIQAPPGVMIQDVNPLP
FT                   RQTKLNKTGLYLYLTGPATVTYYFFKVEIKPPPTPPPPTTPATPTATTPPVTTPPATTP
FT                   PATTPTPQPTPTATATPTPPSGAGAQVPMWLVGVAVVAVAAVAVVAYLLTRRGGGGGDC
FT                   GDLHETDIAILKELEKRGGSAERGELQEALGLPKTTLHRHLHKLSKYGFVRLVQLGGSQ
FT                   RVELVRGCR"
FT   gene            18145..19062
FT                   /locus_tag="Pisl_0021"
FT   CDS_pept        18145..19062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0021"
FT                   /product="Predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /note="KEGG: pai:PAE3680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87205"
FT                   /db_xref="InterPro:IPR014426"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQH3"
FT                   /protein_id="ABL87205.1"
FT                   /translation="MDFSPVGEESLGVRSMCFYVETRDVRILFDAGVSLAPRRFGLPPH
FT                   PRELERARAVRAEILRLAEAADVVTVSHYHRDHFTPWYPSVYMATDGEMYKRVYRGKKV
FT                   LMKSPQDLNWSQRRRHYGLSKALQETGAEAVYADGGEWTFGETRVAASPPLWHGPAGSK
FT                   TGRVVGFAVSDGEERLVFLPDVEGPLEPEPIAFAREARPTVVVVGGPPTYLGWDLEKAI
FT                   KNLAELVELRPHTLVLAHHLLRDMQWREKVAPLFELAERRGVEVATYASLAGRPEELLE
FT                   ARRRELYAKEPAAAVETGEGEEED"
FT   gene            complement(19059..20141)
FT                   /locus_tag="Pisl_0022"
FT   CDS_pept        complement(19059..20141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0022"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE3672 pyruvate
FT                   formate-lyase activating enzyme homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87206"
FT                   /db_xref="GOA:A1RQH4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH4"
FT                   /protein_id="ABL87206.1"
FT                   /translation="MIYSWPEVVYKVDESLLRLPNVRPSPYFETAGGAVVCKLCHRRCR
FT                   LRDGAMGACGMRFSLGGRLYTAAYGLLTAAESRPMEIKPLYHFYPGTSAMTISTWGCNF
FT                   PCAWCQNWHISKVASPVGRYVQPEEVVKWAVENGDSGVNISFNEPTLLAEYAEDLFKLA
FT                   RAAGLHTSINTNGYLTEEVLARLASAGMEGMNIDIKGGRQTYKRWLGADLDKMLSTARA
FT                   AKRLGIYIEFTYLVIPGVNDDEADEVVNAVASFGRETPLHITAYHPAHRLYNPPTPPDL
FT                   LESIWRRARRELDYVYVGNVPGHPGQHTYCPKCGYPVVKRYGDRAVRIELREGRCPRCG
FT                   HEIPVRGRPGRYGNLYRAYL"
FT   gene            20302..20532
FT                   /locus_tag="Pisl_0023"
FT   CDS_pept        20302..20532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3666 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87207"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH5"
FT                   /protein_id="ABL87207.1"
FT                   /translation="MSLLILFKGDVPPHWKSLKAEGLEVKSLKEGLPPLEGKFVVVVGD
FT                   RELAERLKVGYMTEEEAEDFYKFLIQRLSSS"
FT   gene            complement(20507..22588)
FT                   /locus_tag="Pisl_0024"
FT   CDS_pept        complement(20507..22588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0024"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87208"
FT                   /db_xref="GOA:A1RQH6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH6"
FT                   /protein_id="ABL87208.1"
FT                   /translation="MDKRVFLAAALALIAYGQTTVASPTVDYLWLGARWTQLPKFPGDV
FT                   GVLSLSFYLSAQYVDVSVSLTPRCPYLAPLETVSLPSAGPGVVTIALRASASALNVTCP
FT                   VNVAIRATYKTVGSSLTTGIEKLEYAEVYIPPYPTANVTAAGVTYLGLPSQINLTISSP
FT                   YALVGVLTIQGQGARVVSPTGPVAISGRQAVVSVVVAADSPSASLQATIQTRDWLGNPV
FT                   VLAYAVPLSVTPPPPPLLYITPTVLYANRYNRVNLTVVLPTPADGQAVITASGAVMPQS
FT                   SVSIPIRGGRGSASLDVYPVSSVVTFTAQVMYQIAGVSKIDQVLASAAVQQPAGGASRL
FT                   DVRPTRLIAGVANNVTLYVSAPGPFNATVSMSNAAVDKPMPYTFGGVDKAAANLVVMPL
FT                   SNQPVVIAVIIYHRQGTDQYMVSLPVPSSSIFTVVPSPSLVKSGGNRTVVVTIINSGDV
FT                   VVQKAVVTISPATSALLAPTYTFQIGRLAPLESAQLPISFIVPATYSGAIAFTYNIIYT
FT                   TELGTAGTAQGNFYLQALQTPVVNITSISVVPQIVEPRRTFYISITVVNKGFAPVTNLQ
FT                   VEAKPPRGIRPITAPIYFAGQLDPQQTATIPLSFNATAPGNYDIQLLLSYTDQYGNLYT
FT                   MPYIVTVSVTNSTKRPPPTRESLQQETAAPPAAYVIAIATAVATAGGYLYIKRRKASG"
FT   sig_peptide     complement(22520..22588)
FT                   /locus_tag="Pisl_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.788 at
FT                   residue 23"
FT   gene            22660..23862
FT                   /locus_tag="Pisl_0025"
FT   CDS_pept        22660..23862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0025"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pai:PAE3663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87209"
FT                   /db_xref="GOA:A1RQH7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH7"
FT                   /protein_id="ABL87209.1"
FT                   /translation="MVGVLLEILRLSWQALWERKGRTVGAIVGVVIAFSALSYALLLGQ
FT                   TFKDYTTRYFTSNFQTNVVYVTGTQFTDADVGTLSTIDGVEAAIPIASARGVVRISGQA
FT                   APIPVTVYGVDPALLRQLLPSNVVYDGEMVVGSSMVLIGYYVAFDRSTGQQRISVGSPL
FT                   SLSIGRRSINAIASGILATGALGYIDTARGVVMDISSFRQATGVTTYSVVVLVLRDPSL
FT                   VEQVANDVRAAFPNVDVISPQTVLQTINSFLTSFQLFLGLIAGVSTIITALWLYDTMSI
FT                   GVVQRTKEIGVLRALGYKRRHVLAMFLGEAAIVALLGVAIGVALLFPLSQMGLPFGSQS
FT                   ASAATPRTAPHPTFNISHIEVDPLIVAATAALVIGINLLGALLPAYRASRINIVAALRY
FT                   E"
FT   gene            23859..24401
FT                   /locus_tag="Pisl_0026"
FT   CDS_pept        23859..24401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0026"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87210"
FT                   /db_xref="GOA:A1RQH8"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH8"
FT                   /protein_id="ABL87210.1"
FT                   /translation="MILFVADLTTAALATYIAYRVFQAWQSLYDRRLSLYFFGMILLAA
FT                   ALVLEAVVDIYLGLLRETEPGRFVARQEAVFRAVVNLLLLAALTPIAIAVTPAMFYAIA
FT                   PLFILAPVNAILAIYIAAVMFIKTAERKAPPYVPLAFTALTISLLFPISSNIATVSRLL
FT                   TAVFLALGIWHGRGAPG"
FT   gene            24374..24631
FT                   /locus_tag="Pisl_0027"
FT   CDS_pept        24374..24631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87211"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQH9"
FT                   /protein_id="ABL87211.1"
FT                   /translation="MARKRRTRLEIIADILEILSTGCRPPTRLATEANLAYDRMAKIVE
FT                   ALVKKGLVKEDYGVFCITQEGYRLLETYRQWRCFLDTLGI"
FT   gene            complement(25003..26415)
FT                   /locus_tag="Pisl_0028"
FT   CDS_pept        complement(25003..26415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87212"
FT                   /db_xref="GOA:A1RQI0"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI0"
FT                   /protein_id="ABL87212.1"
FT                   /translation="MWRLAASLLLLALSVSSATVLTRADQLSIDAAYPILRKYIPDIRI
FT                   IPADPTQWRGLIERGDVDFLWAGAPVLYEALLREGYLAPMPDVPELRQMPERAGGILLK
FT                   RMGPDGKTYYVVYGLLGYVIGYSNEALAKAGVQLACSWAALASPNLTKYYLQTGAKPVV
FT                   LARPTKSTSTAAMMQLVTEIYGWEEGWRLLTAMAAHSRFVDSSGAVRDVVKRGEALFGP
FT                   MVDYYVFIAGLDYCIPADGTDILFDPIAVPRGANATAAALLTRVFLTELEKRLIDRYIL
FT                   PGNLALLDSPDVNQTKAAVLKRHLDKLMKAKVLAVPPEKSASYYYSFIYYYEATLVDLQ
FT                   DQLTSVWAKLVDAYYSGRISRQQFERLWRLLGAPVNYTDPATGQTRAFTYQDAVAINDK
FT                   IAGDPTYRDRLVQAWREAARAKYQRVEAELEKLLTQTQATPPEQSIAITTLAAAVVVIL
FT                   AVALFLIKRRRT"
FT   sig_peptide     complement(26341..26415)
FT                   /locus_tag="Pisl_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.401 at
FT                   residue 25"
FT   gene            complement(26445..27653)
FT                   /locus_tag="Pisl_0029"
FT   CDS_pept        complement(26445..27653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0029"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: pai:PAE3656 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87213"
FT                   /db_xref="GOA:A1RQI1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI1"
FT                   /protein_id="ABL87213.1"
FT                   /translation="MSAVGKRLENVYIVAFARTAFTRFSRKEPQKDDFWDVRPEELAAV
FT                   PVRAILEKTGVKPEDVEDLLTGTALPVGEQWLYGGRHVVFAAKLPYTIPAAHIDRQCAS
FT                   SITTVAFGAMEVATGMADVVIAGGVEKMSKTPMYENPHIEINPKFLTDEEYVRLYNLPI
FT                   GYVMGLTAERLAEVSGIKREEMDMWSLRSHRRAAEAYEKGYFKDEIVPVAVEKDGQRKV
FT                   VDRDQSVRPDTSLEALAKLPPVFKPDGVITAGNSSPLNSGAAYIMLVSGEVVKKHGLQP
FT                   LAKIRAVAFAGVPPEVMGMGPVPASKKALEKAGLTVKQIGRWEINEAFAVVTLYAIKQL
FT                   GLDPEIVNTRGGAIAIGHPLGATGARIIGTLARQMQIDGVDYGVATLCVGGGQGAAVVL
FT                   ERV"
FT   gene            27724..28878
FT                   /locus_tag="Pisl_0030"
FT   CDS_pept        27724..28878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0030"
FT                   /product="methionine synthase (B12-independent)"
FT                   /EC_number="2.1.1.14"
FT                   /note="PFAM: Methionine synthase, vitamin-B12 independent;
FT                   Cobalamin-independent synthase MetE, N-terminal domain
FT                   protein; KEGG: pai:PAE3655
FT                   5-methyltetrahydropteroyltriglutamate-- homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87214"
FT                   /db_xref="GOA:A1RQI2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI2"
FT                   /protein_id="ABL87214.1"
FT                   /translation="MSLPRAFITSVVGSWPRPTWLIEAFEKFEKGQMDQQTFNQYLDDA
FT                   VKLAIKDQEEAGLDVITDGEQRRTSFVAFVGQKIRGFKIVRVEELHPNAKEIMKRYKAP
FT                   LTLWRPVIAGYIEDSVLAVDEVQYAKKVTQKPLKVTLPSPYLIMWEAWHAKISAPYYPR
FT                   PEDAAEAYVKVLRNEIARLIDAGVAFIQLDEPMLGDLIEAEQDKPDRYKQVASELYGQK
FT                   YRGLKDEIQLAVDLVNETVKGYTTSVRIGMHLDRWPTEESPIVGYERLAPQLFDVKVKQ
FT                   YVVEYKHPRMGNPEEFAKILPTDKEIGLGSIDVRDPKRVETVDEVVAHVEKIVKYVDPT
FT                   RIWLNPDCGFAPGMYRAFPRAVAIEKLKVMVKAAQILRQRYWWA"
FT   gene            29216..30181
FT                   /locus_tag="Pisl_0031"
FT   CDS_pept        29216..30181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0031"
FT                   /product="tRNA (guanine-N1-)-methyltransferase"
FT                   /note="PFAM: tRNA (guanine-N1-)-methyltransferase; KEGG:
FT                   pai:PAE0001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87215"
FT                   /db_xref="GOA:A1RQI3"
FT                   /db_xref="InterPro:IPR016742"
FT                   /db_xref="InterPro:IPR028564"
FT                   /db_xref="InterPro:IPR038459"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI3"
FT                   /protein_id="ABL87215.1"
FT                   /translation="MTPLWKIFFQFLAQRGVDSLCLPLHFKCRWEIPQCVAVGVLVGRY
FT                   AVCRWEGRGEFLGRWEGVEVLRGRGVGVCRWVLAKRCVGERLEVGFSPPERPRIVVDLS
FT                   LWGEHTPGEKHELVEQILATLDAVRRVLWDGNLWVTNAPGEFLELLGLHARGLVHRMNI
FT                   SGGPPPLEKPVVLDPEGDCLFTEETARSHSEFIIGGIVDKERTAKSGTRRLAELLGVEK
FT                   RCRIELRGSLVGVPDRINKIAEIVLSVLAGVPLEEAILRAQAKRDRVYRLMWEIQKRAR
FT                   RLPDGRLAITRDALAEANWLGAPPGEVELALRKTHAVVLG"
FT   gene            complement(30173..31096)
FT                   /locus_tag="Pisl_0032"
FT   CDS_pept        complement(30173..31096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0032"
FT                   /product="peptidase M19, renal dipeptidase"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   pai:PAE0005 peptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87216"
FT                   /db_xref="GOA:A1RQI4"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI4"
FT                   /protein_id="ABL87216.1"
FT                   /translation="MFIDLHEDIAHYFLTSLSPQPFDVDAEWRQSDLPKLRRAGAELVV
FT                   AAVFPFVNSYSGWSPSLQLALEGFKVYYALSETHGIKIVERRGDLAAPGLKFLIVLEGA
FT                   DVLSSADDLRLFYRLGLRALGLTWNLSNRWGGSCCGGRDRGLSEEGYGLVETAQRMGVL
FT                   VDLAHAGERTALDVLEAARRPVVVSHANAVAVYSHRRNVGDEVLKKLRDVGGVIGLTFI
FT                   PSTISSDPTPRDLAKHARYIRDKFGVEILAIGTDYLGISTTPQGLESVDKIPRLAEALI
FT                   EAGFRREEVEAVMWRNAARVLREVLP"
FT   gene            complement(31096..31230)
FT                   /locus_tag="Pisl_0033"
FT   CDS_pept        complement(31096..31230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87217"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI5"
FT                   /protein_id="ABL87217.1"
FT                   /translation="MSEKLARRLREVVDLLESAVEEGDCKLVEEAIDELRSIIDELEE"
FT   gene            complement(31259..31909)
FT                   /locus_tag="Pisl_0034"
FT   CDS_pept        complement(31259..31909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0034"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE0010
FT                   coenzyme PQQ synthesis protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87218"
FT                   /db_xref="GOA:A1RQI6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI6"
FT                   /protein_id="ABL87218.1"
FT                   /translation="MKFRVVEIFASLQGEGVNLGKPAVFIRLAGCPIRCRYCDTKYSWD
FT                   PLGGVEIDAEEVVQRAAAYGQLGHVVITGGEPLIWRNLHELACPLRRLGTVEVETSGVY
FT                   PPTPQLDACVDFYDVSPKLSNARVDALLHPHYPRSPKAWFKFVVGGEEDVEEAVRYVEK
FT                   HGIPRERVFLMPLAETPEQHAEVLRRIWDAAVKHKLRVTPRLHVEAWGNVRGR"
FT   gene            complement(31906..32358)
FT                   /locus_tag="Pisl_0035"
FT   CDS_pept        complement(31906..32358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87219"
FT                   /db_xref="InterPro:IPR016618"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI7"
FT                   /protein_id="ABL87219.1"
FT                   /translation="MSRVNGRTMKLKLPPRIKVLEALGAVADGRVKMLGPGRCEVLSSE
FT                   GDRVYHVEISGRRVYSDDNGTVYRGYVGYPIIACLMAEGRLPTDPQLAEKLKTIPWRKL
FT                   NEQYKKYEEVLRHIYTERAINRAEAERYIDAVLKQLAQMQLEYSPP"
FT   gene            complement(32578..33774)
FT                   /locus_tag="Pisl_0036"
FT   CDS_pept        complement(32578..33774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0036"
FT                   /product="SufBD protein"
FT                   /note="PFAM: SufBD protein; KEGG: mst:Msp_0312 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87220"
FT                   /db_xref="GOA:A1RQI8"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI8"
FT                   /protein_id="ABL87220.1"
FT                   /translation="MASQGWFEKIRERAKAALNKPAPHGPDVDVTQFGDGRTPTSEEAV
FT                   VAVANKVGVSMGAPAYYIQGDSAYFRYLSRIPGVEVYRVEEFADAYPDLAREYLWRLVP
FT                   PDLDKYTAVAALRGVGGYVIRVKAGAKVRDPILACLSIVRGGLQAPHNVVIVEEGAEAV
FT                   VYTGCVIAPEVVGLHVGISEFYVLRGAKLRYIMVHNWTKAAHVRPRTGVLVEEGGEYVG
FT                   YYANLQEVNSLQTSPRIVLREGARAHATSILLGLGSAQIDVGTTAVLEGDGAAVELTTR
FT                   ALATDRSNITMRALVEAHKLSRGHVECSGLLLSGSANIVTIPQLAAYHQDAMLTHEASI
FT                   GRLAEEEINYLQAKGFTYEEAVSLLVRGFVTTDIHRYLPEQARRYVESIEKVIVEKAM"
FT   gene            complement(33752..34438)
FT                   /locus_tag="Pisl_0037"
FT   CDS_pept        complement(33752..34438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0037"
FT                   /product="Iron-regulated ABC transporter ATPase subunit
FT                   SufC"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sto:ST1201 hypothetical ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87221"
FT                   /db_xref="GOA:A1RQI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQI9"
FT                   /protein_id="ABL87221.1"
FT                   /translation="MFTVENLSVAVGGRALLGGVSFSISPGEVFYILGPNGVGKSSLLK
FT                   AIMGIPGYEVVGGRVLLDGEDITKLKPFEKASRGLALAFQIPPRLQGVRVGVLLSNICR
FT                   KTKCDYREVAKVVEVDHLLDREIGKLSGGEGKRVELATVLAQRPRVALIDEPDSGVDVE
FT                   SLVIVARALKELVKDAALIIVTHGAHIARHLPPDKVCVLYGGGFKKCGGREVLDAVFTY
FT                   GFAGLV"
FT   gene            complement(34482..34907)
FT                   /locus_tag="Pisl_0038"
FT   CDS_pept        complement(34482..34907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0038"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: pai:PAE0013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87222"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ0"
FT                   /protein_id="ABL87222.1"
FT                   /translation="MAPPPWAFISRRGLREVVLWLLSDKPMNGAEVIRAVEELTWGFWK
FT                   PSPGSVYPLLKQLEAEGLAKRREDGRYELTEAGRRAVKLIPWAKIPRPGAPRNIEEVVE
FT                   ELESWSMYLADVATTEPDRIAPYRERIRKIAEILQKV"
FT   gene            34968..35900
FT                   /locus_tag="Pisl_0039"
FT   CDS_pept        34968..35900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0039"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pai:PAE2688 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87223"
FT                   /db_xref="GOA:A1RQJ1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ1"
FT                   /protein_id="ABL87223.1"
FT                   /translation="MYINDGQRHVVKLLTFRRGEVRKVGLFKNGRILDLPEAYKAVFNT
FT                   EEAPDFLYDMRRLIALGEPALEIVKKLDERARGPFYKPEEIKWEPPVPNPEKILCVAVN
FT                   YREHGAETGIEPPDKPYFFPKFPNALVGHEGYVVKHRVVQKLDWEVELVVVMGRPGKYI
FT                   EPERALDYVFGYTVGLDMSMRDWQNPDEKTARQYGKNWIWGKTMDTAAPVGPYIATRDE
FT                   VPDPNRLGLRLWVNGQLEQEGNTSQLIFNIQQLIYWASQGITLRPGDLIFTGTPPGVGW
FT                   AKGKFLKGGDIVEAEVESIGRLRAYIIEE"
FT   gene            complement(35901..36635)
FT                   /locus_tag="Pisl_0040"
FT   CDS_pept        complement(35901..36635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87224"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ2"
FT                   /protein_id="ABL87224.1"
FT                   /translation="MRCFCGRPARESGFCPYHDPNCVKDLACRRKLVFTADCERCHLPG
FT                   GEVSDVAPRLREARVHGPLFIYYVTGDVDLRGAGGIDLFIYSVRGNIYLEGARFRHIYI
FT                   DQVVGDVDFRGGRAELFAVFSVRGEISAAGAKIGGHLQVVESSGRLDLTGAGVVGEIIV
FT                   ERFRGGVVARAGAYSITICGSRGDVDLSGARTTGDIVLVESEGGRLDLSGVEVGGRVFI
FT                   LASKFGGVRIDRPEVVRKIVVL"
FT   gene            36773..37198
FT                   /locus_tag="Pisl_0041"
FT   CDS_pept        36773..37198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87225"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ3"
FT                   /protein_id="ABL87225.1"
FT                   /translation="MAVYLMSIKPKFGEEILGGAKKCELRKLVGPLIQPDDVVYLYFTK
FT                   PTAAVVGYFTAGLVFIVPTHNLSKLLSELGGCGVGEEDLKYVEGARYSMLIEARGPARC
FT                   LTPVKLTEIGLRPPPSYRKLDGKTAAKLKALCEGKKI"
FT   gene            37219..38229
FT                   /locus_tag="Pisl_0042"
FT   CDS_pept        37219..38229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0042"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pai:PAE0583 porphobilinogen synthase (delta-aminolevulinic
FT                   acid dehydratase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87226"
FT                   /db_xref="GOA:A1RQJ4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ4"
FT                   /protein_id="ABL87226.1"
FT                   /translation="MKFPTVRPRRLRTNKIIRDAVAETALDPSDFIYPIFVKEGPGREA
FT                   IPTMPGQHRWPVGEELIKHVEEALALGVNKFILFGVVPEEQKDPHGSRGYDPEGPVPKA
FT                   LRLLKETFGDKILLFADVCLCEYTDHGHCGVVKTTGGRWHIDNDETIKLYAKEALVYAD
FT                   AGADFVAPSGMMDGQVAEIRKALDAHGFHHVGIMAYSAKYASAFYGPFRTAAASAPKFG
FT                   DRRTYQMDPRNAHEALKEVAMDLEEGADIVMVKPALAYLDVIRLVKQHYPWAPLAAYNV
FT                   SGEYAMVKAAAAAGYIDERVVTLEILTAIKRAGADLILTYHAPEAAKWLKDGTPF"
FT   gene            complement(38226..38609)
FT                   /locus_tag="Pisl_0043"
FT   CDS_pept        complement(38226..38609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0043"
FT                   /product="paREP9"
FT                   /note="KEGG: pai:PAE3185 paREP9, associated with SRSRs"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87227"
FT                   /db_xref="GOA:A1RQJ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ5"
FT                   /protein_id="ABL87227.1"
FT                   /translation="MGFVAGVYLYFGRMKIGPLVGYLWLLGRRLYLKLGWRPRDTVYLG
FT                   SVDDLLGVAVRVRRLVPRPLPVRHLVAALVDALRKAYYVASRCRDSPRWKIRAWEAAMA
FT                   IEYAASALAMYWPSAAKKILDDG"
FT   repeat_region   complement(38866..39842)
FT                   /rpt_unit_range=38866..38890
FT                   /note="CRISPRs"
FT   gene            39940..40938
FT                   /locus_tag="Pisl_0044"
FT   CDS_pept        39940..40938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0044"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="KEGG: pai:PAE0581 heme biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87228"
FT                   /db_xref="InterPro:IPR040523"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ6"
FT                   /protein_id="ABL87228.1"
FT                   /translation="MFLCASGFSGMDSRLVDVLMEVQYDFPLVERPFAVVGERVGLGEG
FT                   EVVEVLRGAVRAGVLKRIGAILNYRARGMEAALVGMAVPEDVIEVVAAEVNRDPYVSHN
FT                   FQRDFKPYNLWFVTKARSREELEGKVAAVAGRFGLDYVILYSLRSYKVDVRFDLRRGVS
FT                   WTKGEVMPESPPSVESLGVPQAFFSRVKSLPLVPEPFREVAEALGTSVGEALAKIRELI
FT                   RLGVLRDLHGTLDGEAVGFRENAMVVVREPVCEAAARLNITTHVVLRNTVPGKWEYPCY
FT                   FMVHGVSRQVLEDYIRDAVRKLGVSDYRVLYSVRGFLSGREMGRRVEQVAD"
FT   gene            complement(40935..41828)
FT                   /locus_tag="Pisl_0045"
FT   CDS_pept        complement(40935..41828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0045"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: pai:PAE0019
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87229"
FT                   /db_xref="GOA:A1RQJ7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ7"
FT                   /protein_id="ABL87229.1"
FT                   /translation="MRFVTELRVEVGDASLGVDVFKALLAIDMTASMKRAAQTLGMPYT
FT                   TLWNLVARAERALGARLVETSRKGGTKLTEEGRRSLRLYMAEAARRGIVLGLSDFIYAG
FT                   SHDPAVEEALRGGEAYFVGSLQGLLMVAGGLAHFGGVHLGDNLQAVAAYAPHLCLVQGF
FT                   RREVGVATRRPIADLSQLANMRLVNRPPGAGTRIHIDRLLRQLGLAPREAPGYYNIALT
FT                   HDEAAAKVAAGEAEYTVTTRSTAERYGLHFKKLWEEDFDFVCKPEACGKTANFAANLKL
FT                   GSGSQAKENIGRVVCP"
FT   gene            41861..42790
FT                   /locus_tag="Pisl_0046"
FT   CDS_pept        41861..42790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0046"
FT                   /product="binding protein, putative"
FT                   /note="KEGG: pai:PAE0020 binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87230"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ8"
FT                   /protein_id="ABL87230.1"
FT                   /translation="MSKIGYLIIVVVLIAAAALFIASQRPQAAAPQQTATAIAAPRQHV
FT                   VLYMATTTSVKDTGLLDVLIPDFERWAAERGYDVEVRYSAVGTGQALLMAARGDVDVVL
FT                   VHAPALERRYLENGTLKCRDVVAYNFFIVVGPRGDPAGARGTSAAEAFKKIAEAKAPFV
FT                   SRGDRSGTHLKELSLWREAIGREPDPKVDTWYISAGAGMGQTLLLANEKRAYALTDVGT
FT                   WLRYRDKLDQLEVVVPAAPDLINIYSFAIVKPSPAARLMAQYMLTRGQEVIGNLTVAGQ
FT                   PLFTPISRADPKALEWIKPAIFGPSCVG"
FT   sig_peptide     41861..41947
FT                   /locus_tag="Pisl_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.886 at
FT                   residue 29"
FT   gene            42780..43424
FT                   /locus_tag="Pisl_0047"
FT   CDS_pept        42780..43424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0047"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE0022 sulfate
FT                   transport system, permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87231"
FT                   /db_xref="GOA:A1RQJ9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQJ9"
FT                   /protein_id="ABL87231.1"
FT                   /translation="MSAELVGIVLNSVYVSAVPALISAVVGTPAALWLHMRGGRLAAAL
FT                   KALFNGLVGVPTVLLGLLLYLLLARSGPLGGLGILYTLEAVVVGHTLLVLPLYLSYALT
FT                   ALEGVDPRVRELAEMFGLGKATLLKIYLREAAGGLAGAVAASYGRALGELGIALMLGGD
FT                   IRYKTRVLTTAVAHETMLGNWDVAIQLGVILLVMAVAVSAVVTALGFKYRG"
FT   gene            43421..44020
FT                   /locus_tag="Pisl_0048"
FT   CDS_pept        43421..44020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0048"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE0023 sulfate transport system, ATP-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87232"
FT                   /db_xref="GOA:A1RQK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK0"
FT                   /protein_id="ABL87232.1"
FT                   /translation="MIKAVRLGKKYGGVWVFRGVDLELPEVGMAVVVGPNGSGKTTLLK
FT                   ILAGLLEPDEGEVYIMGMPPAVAIRRMRRAVLYAHQEPLVLAGAVEDNLFCRNDEVFDA
FT                   LGLGGLLGRKARELSGGYKKLLTIARVLSCRPKVALLDEPTAYLDAEKRKALMEYLWQY
FT                   SKRALVVWTTHYIAEVPPGVPLYELRDGRLRNLATP"
FT   gene            complement(44006..44341)
FT                   /locus_tag="Pisl_0049"
FT   CDS_pept        complement(44006..44341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2605 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87233"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK1"
FT                   /protein_id="ABL87233.1"
FT                   /translation="MHIKWLERHTRHFQQALAAFETGDEAAACYNAYVSIEALIKGALG
FT                   FDPYGEVHNVKRLPALVREAFRGQPPRDVEKCAYCLERQAFSGDGATCIKCAELISEAI
FT                   YQLLGRG"
FT   gene            complement(44350..45255)
FT                   /locus_tag="Pisl_0050"
FT   CDS_pept        complement(44350..45255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0050"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: pai:PAE0580 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87234"
FT                   /db_xref="GOA:A1RQK2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQK2"
FT                   /protein_id="ABL87234.1"
FT                   /translation="MKIRVATRGSKLSLIQTEELLAQIKAVEPDVQFEIVVVKTTGDLI
FT                   QDKPLFQIGVKGIFEKEVNLAVLRGEADMAVHSLKDLPSELTPGLVLAGFSKRAPPHDV
FT                   LISRGGYTLETLPKGAVVGTSSVRRAEFLKAVRPDVEVKPLRGNVDTRVGKVLSGQYDA
FT                   AVMAAAGLQRLYGSSPPVSIVPLRVEEVPPPPGQGIVVAVVKEEDSWLIDLLKKASDKT
FT                   AAIEATAERAFLAGVGAGCHVAIGGVAKLTPQGSLEFTAGYAAGGAKYVVKVFGEDPVE
FT                   VGKRAAQLIAEVRQKFKQRD"
FT   gene            complement(45252..46421)
FT                   /locus_tag="Pisl_0051"
FT   CDS_pept        complement(45252..46421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0051"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE0579 metallo cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87235"
FT                   /db_xref="GOA:A1RQK3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR034391"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK3"
FT                   /protein_id="ABL87235.1"
FT                   /translation="MKNDIYGNAPFSMIPISVMVAGVGTTSFKVKGRFGIDKPSNFSAP
FT                   LRPIVSWNITRRCNLKCLHCYIDAGAEDPRELTTAEALALVDQMAEVGVPLILFTGGEP
FT                   LVRQDFFEIAERARDAGIKLVLSTNGTLITPEVARRLKEVRIVYVGVSLDSIDPAFHDQ
FT                   FRGTPGSFAAALAGIKNAIAAGLDVGLRFTVTAKNIHEVGAYVDFAASLGVKRITFYHL
FT                   SAAGRAQKLPPDWWYTPQQYREFIETLISKARQYAGKLEIETTLAPYDGIYIAQTVGGG
FT                   DERYLKFVESTGGCGRKIISIYPNGDVYPCQFIDFYKLGNVREKPLREILTPEKLEPFI
FT                   NTERYLRGPKCSTCKFKQYCKGGDRARAYYLSGDMFGDDPLCPIPHLFK"
FT   gene            46476..47822
FT                   /locus_tag="Pisl_0052"
FT   CDS_pept        46476..47822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0052"
FT                   /product="RNA-binding protein AU-1"
FT                   /note="PFAM: protein of unknown function DUF402; KEGG:
FT                   pai:PAE0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87236"
FT                   /db_xref="GOA:A1RQK4"
FT                   /db_xref="InterPro:IPR007295"
FT                   /db_xref="InterPro:IPR016730"
FT                   /db_xref="InterPro:IPR035930"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQK4"
FT                   /protein_id="ABL87236.1"
FT                   /translation="MFKARIRGIYATALTKLALDWGFEIVQPTQQIINRFGLKPDYSPP
FT                   DITVKDHESKTGVVTIGECQAVDYFLERLRQYVDPVIAKASAGLHDVFIGRVVGEGLVE
FT                   APGGQLMEVPRRYVVQPGSTSVFTVVKPPMGPFRGVAVPEIVVEGKLLELNTTGRVSYS
FT                   RHIAEQERLRLRILAETKLKNYASIGLRFKSSAKYASEDELAKEAEELYKEMLKISQGG
FT                   PPGTLLRRGKCIAVVLFDRQAKFKLDEARAAVVPTIRGHHALRGQGLGKCLDLLDYAGA
FT                   DVYEKAVEFLARGRVVIYHVKPWGEVIKMRGEVVKISDDVLVVKRPLRPGGVLDGIGAK
FT                   IEPGTYALTCVPKSGGYVVHSYYSASGVYLGTYVNINTDPEWGRRIIYIDLLVDKAYGL
FT                   DGVERVLDADELQRYAHMLPERLRRPEAPGGKICTSEGLTSALPQSSSA"
FT   gene            complement(47788..48063)
FT                   /locus_tag="Pisl_0053"
FT   CDS_pept        complement(47788..48063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87237"
FT                   /db_xref="GOA:A1RQK5"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK5"
FT                   /protein_id="ABL87237.1"
FT                   /translation="MVKVVKRDGRVEEFIPEKVVVSVLKAGAPADVARKIAKKVECAVM
FT                   DRENVTAQELTRMILAELKKINEQWYRNWIIFDQAVKRRKTEEELR"
FT   gene            complement(48082..48978)
FT                   /locus_tag="Pisl_0054"
FT   CDS_pept        complement(48082..48978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0054"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; GHMP
FT                   kinase, C terminal domain protein; KEGG: pai:PAE0034
FT                   homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87238"
FT                   /db_xref="GOA:A1RQK6"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQK6"
FT                   /protein_id="ABL87238.1"
FT                   /translation="MRAPSTSANLGSGFDVVAVAHDAYFAEAYIKLTSGCGVDIKFRGF
FT                   NPGSDNTVKRAFQHLFERLGRCWGVEAEVVNNIPIARGLGSSGASAVAALAAFIREAGL
FT                   RVEPAVVVEAAGLGEVAAAGSPHFDNVAAAALGGAVVIASVKPLELVKFMPKLIFVIGV
FT                   PDVPPMPEKTKVMRSVLPREVSFRTYVAQLARVSALVAGFAKSDPRLVALGMSDEVVEP
FT                   ARAPYVPAYGRVKRYALEAGALAVSISGAGPSIIALVEEKNSDVVKAAVERAYIEEGLR
FT                   AEVKVASITEGALAQNI"
FT   gene            complement(49391..50677)
FT                   /locus_tag="Pisl_0055"
FT   CDS_pept        complement(49391..50677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0055"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pai:PAE0556 amino acid permease; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87239"
FT                   /db_xref="GOA:A1RQK7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK7"
FT                   /protein_id="ABL87239.1"
FT                   /translation="MVLTRAWLRRRLGVFDMYALVHSDSQSTYYFLLGFIALYAGQYAF
FT                   FGAIYGVLLMAAIAVTYGEMGSRFPETGGSYLYVKSAFGSTLAYISAWLIAFDQIVMVA
FT                   YGAIDAAKIINKTLGLGIQEVALAAAITTALFVLTVLGIRESANFAKAVAVVDLVVMPA
FT                   LIIWALATHPSWPPYFNWAGVEGASLLFAFSLLSRGFTGVDAIGQLAGEAREPLVQVPK
FT                   ATALVVAIGAFFGLGLTAALMSALRPEELVDPAIAPLYLAAEINPALTYAVAINLFLVM
FT                   ITAALAGYVSFSRLTYMLAEEGLLPGVFRRLHKRFRTPHLSLLLVYIISLVLIAPGEIE
FT                   IILAIYAVGSLINYLMVAVALAKFSRSGTLYSAFKTPVVAGVPLSSAIAMALLPVGIGL
FT                   TILEKYRYLWALLLWLAAGLALLYFRKRR"
FT   gene            50737..51762
FT                   /locus_tag="Pisl_0056"
FT   CDS_pept        50737..51762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0056"
FT                   /product="egghead-like protein"
FT                   /note="KEGG: pai:PAE0042 egghead homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87240"
FT                   /db_xref="GOA:A1RQK8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR027389"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK8"
FT                   /protein_id="ABL87240.1"
FT                   /translation="MFDLAYLILNTIGGIYLFILALGAVKKPGGRPAGPIDNYLVVVVT
FT                   VGNERVLPALRETVAQLERLGLRYVVVSSNPLNMRNVLVVPREEDGTKYKAIRWFVLNY
FT                   ARPDTWYIFLDDDSYPLDTEFLRDIAYYGARGYVAGNGVIVPRPGRSKLAYALDWIRHF
FT                   DDLTRYRFALEVLRRPIFGMHGELLIVRGDVLREIWPAMGDTITEDFRFAMELLKRRYK
FT                   TFQTKTRVSIRSPNSLLDFIRQRARWAAALGEAVRYRNPIPPASAAVAIFLAAAGPLTA
FT                   LYGPTLATAVAAVYAAVYIYGSLRARRYIIDVLLASTLELLAMAAGVFHRQRHFYIIDK
FT                   T"
FT   gene            complement(51821..51892)
FT                   /locus_tag="Pisl_R0002"
FT                   /note="tRNA-His1"
FT   tRNA            complement(51821..51892)
FT                   /locus_tag="Pisl_R0002"
FT                   /product="tRNA-His"
FT   gene            complement(52005..52658)
FT                   /locus_tag="Pisl_0057"
FT   CDS_pept        complement(52005..52658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0057"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE3571 ABC transporter ATP-binding protein,
FT                   putative; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87241"
FT                   /db_xref="GOA:A1RQK9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQK9"
FT                   /protein_id="ABL87241.1"
FT                   /translation="MAIEVRGLRARRGRFQLEVERLSVNSVTVVLGRNGSGKTTLLDAI
FT                   AGAIPAEGSVTACGREVSRLPPEERGLVYIQSTPVDPPGGPRRFLKWVAARWGRGERDV
FT                   EEVAGLLGIRELLDRGGLSTGQKQLVNIAAGLLAGACGFLMDEPTSHLDWFNKRLVDDA
FT                   VRRLGKPVLYVTHDPYEAAYIGDVICVIEGGRLKKCIENKPADLAEPVVKKLFS"
FT   gene            complement(52643..53344)
FT                   /locus_tag="Pisl_0058"
FT   CDS_pept        complement(52643..53344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0058"
FT                   /product="tungstate/molybdate transport system permease
FT                   protein"
FT                   /note="KEGG: pai:PAE3570 sulfate ABC transporter, permease
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87242"
FT                   /db_xref="GOA:A1RQL0"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL0"
FT                   /protein_id="ABL87242.1"
FT                   /translation="MLFSVALALAAVVFVALLLFILPIAYLGAPPPGFGEAFLLTALFS
FT                   GAAAGLGLLPGLAVAVWGRGGWQAAVAQILYAPAVVPPTAVGVLLLAAFRNPLLPEWLY
FT                   GFFVNKAAGVLLAMFVMALPVSYAVFDGALKDVRAELYFRSLGLGGLRLLVALLLSLKR
FT                   ATAAAFLLSFLRGFGELGVLLIFASYPPTMSIYIYQAFLQEGLGATVAASMAVAALGVS
FT                   TAYLLRLWLSR"
FT   sig_peptide     complement(53258..53344)
FT                   /locus_tag="Pisl_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.705 at
FT                   residue 29"
FT   gene            53569..55635
FT                   /locus_tag="Pisl_0059"
FT   CDS_pept        53569..55635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0059"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: pai:PAE3569
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87243"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL1"
FT                   /protein_id="ABL87243.1"
FT                   /translation="MRRAVLIGALILVTIAFLLQIQQPPQKMQETAATTATPPLKSPEA
FT                   AAPGATATKACSGSPLGYVAPTLVKVVKDAAAAAGLGTEGIQSVGSVEGLRRIQGGAKP
FT                   DLFGSVDIELRPDAERAGALQTYSLGRFKLALVCRAPTTLEELASAKTVFPDPNKAPIG
FT                   YRELAAAWMLSRDLGVNLTAKYTALGVRFVYNGTLYVYIPSSLPNTEAVDVAPNLDGSW
FT                   AKFEAGAGRCMFAYVPFLLGKGLQLRPAGGGTSYWEPYTAEAGGRTYYVYVFKPPYDFA
FT                   EDPPIKAVAVLLGPPVKTIRVGHFEAFVASYTELGNCVIESLKKMDLSKYGFITTARAT
FT                   AGASKSAVVEVVDVLGRRVSVKAPVSRVVALGPGALRLVVYLNATDKLAGIEEIEKRPP
FT                   RGRDYGYILWTKNLTSLPVVGRGGPGSPVDYERILSVRPDVIIMSPLVADAPDKIQEKT
FT                   GIPVVVVSAFIDSGEGWVNFTSLYKSLRTVGVLLGREERAEELVRYMEGLIKDLKRRTA
FT                   NITQRPKVYVGAISYKGGQPFEATQSYFPPLVLLNTPGVADRYGIKGVAKIDWEALLKE
FT                   QPDVIFIDLGNYMFVVQDFNKSRDKYCALKAFREGRVYGILMYNWYGTNIATLFADAYF
FT                   MGKVLYPEAFRDVDPVAKADEIYREFLGTPLYTAIAKDFKGGFRQLTEFKCGS"
FT   sig_peptide     53569..53631
FT                   /locus_tag="Pisl_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.671) with cleavage site probability 0.247 at
FT                   residue 21"
FT   gene            55655..56473
FT                   /locus_tag="Pisl_0060"
FT   CDS_pept        55655..56473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0060"
FT                   /product="modD protein"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: rpb:RPB_1056 ModD protein; TIGRFAM: modD
FT                   protein; PFAM: Quinolinate phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87244"
FT                   /db_xref="GOA:A1RQL2"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL2"
FT                   /protein_id="ABL87244.1"
FT                   /translation="MRSRLEAWLLEDLGSYDLTTEVLGIGGLRGVAQLFAREEAVVAGS
FT                   EEAAEVYRLAGCGEVEVVKRSGQLARRGDVVLRAVGEARCLHAAWRTAQEVVAWASGVA
FT                   TKTRRLVELARRVNPRVVVAATRKTPPGLRALYHKAVLAGGGMVHRCCLSDGVLVFRNH
FT                   LVFLGEGALQKAAKAAAVRPAGVEVSTVEEAVEAAKAGFSYIQLERMTPEEVAEAAARV
FT                   RSVNPRVVVGASGGIDEHNIASYAPHVDVVVTSAPYRAPPIDLGTEMTPL"
FT   gene            56646..57761
FT                   /locus_tag="Pisl_0061"
FT   CDS_pept        56646..57761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87245"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL3"
FT                   /protein_id="ABL87245.1"
FT                   /translation="MRWLFVLVVLAAALYAQQVVRVVYPLQLPPADIFSLYVDFKKAVP
FT                   ICPPYCNNTEIVSVTLNGVLDVRSGGGYSVVLYYDRGGGWRALCTLPVVHNAFSGSCAV
FT                   PSDAKSLGIALWQGGRWLQSVDIHNLRFWTACLCVPRPPTIEGVDHPSVAKVGEDVRFH
FT                   VWLNWCGNRQEEVRLQIGGVEVVKKASINYTCPLRVRVDFGPFRFEKPGVYNWTVRTQA
FT                   DVRSGSIKIEDVKVCPPILWPPRIINYSVPSVVYVGEPFDVKAVVEGNVPALVVFRLGN
FT                   TTTSRYVELGKDGCVEKREIVFKPPPLSRPGTESWTIEVWMNRTKTDEKRGVLEVRSRC
FT                   SPRVSVEGPQRVYLGSSFNMTPATVELAAAS"
FT   sig_peptide     56646..56696
FT                   /locus_tag="Pisl_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.805 at
FT                   residue 17"
FT   gene            57764..58216
FT                   /locus_tag="Pisl_0062"
FT   CDS_pept        57764..58216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0062"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87246"
FT                   /db_xref="GOA:A1RQL4"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL4"
FT                   /protein_id="ABL87246.1"
FT                   /translation="MSFSPFEFVDVRPGDLLGRDPLVGKREVSGGSLIYAVARVGPTQA
FT                   PTPPGVFIAIRFKAVAPGEAETRVEKASFADEKFNDAAVLAKNAKVVVTAQVTTPTTPA
FT                   PTTPSKPQQETATTTAHYQIPPEAAALAALAAVSAAVVVLMARRKT"
FT   gene            complement(58583..59410)
FT                   /locus_tag="Pisl_0063"
FT   CDS_pept        complement(58583..59410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87247"
FT                   /db_xref="GOA:A1RQL5"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL5"
FT                   /protein_id="ABL87247.1"
FT                   /translation="MATIGFHDVLELDFTTVVVSKSTNLCWSVGIMRVWKAVVLFLLGF
FT                   FLALFAFPVAWATSALLGYLFAIAGIVIGAYMVAKRESAKLPLILGVVLMIFSLLALLG
FT                   TFIVHIALWSLAEAAREASKVVNLTGTLGRGVKAGDWVITAVDVREAAYIRSDSSYYKA
FT                   KEGHKLVVVRLRVENVGRETNSPPIYGFVLVTDARRSYERIYPFSLDFVWRVSDEVVKS
FT                   AVEFRALDTTARVAPGSAAEGDVLFQIPTGERPERLHIRTGIVGGYEIVIKFG"
FT   gene            complement(59966..60250)
FT                   /locus_tag="Pisl_0064"
FT   CDS_pept        complement(59966..60250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0064"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87248"
FT                   /db_xref="GOA:A1RQL6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL6"
FT                   /protein_id="ABL87248.1"
FT                   /translation="MGCGAGALAVVLIGSLARGDYTAFSDADVVIVLREDGRRPMDRIP
FT                   DFLDSSFPIDLEPGSTRWRSSERWRAPGSPRRSPAAYSWPETPRPSAKP"
FT   gene            complement(60312..60497)
FT                   /locus_tag="Pisl_0065"
FT   CDS_pept        complement(60312..60497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0065"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0633 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL7"
FT                   /protein_id="ABL87249.1"
FT                   /translation="MGQLYLLAGLPAHVKPPGDLVDAAKGLDKFYIPSRYPNAHPERTP
FT                   MDYFTRGMRRAPSRGL"
FT   gene            60983..61315
FT                   /locus_tag="Pisl_0066"
FT   CDS_pept        60983..61315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0066"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0506 paREP15, putative coiled-coil
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87250"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL8"
FT                   /protein_id="ABL87250.1"
FT                   /translation="MAENLIAAVLGKAAEEALETAVQAYLQKKISREDFQTALLLVIVK
FT                   MMGDMNKKLDDTNKKLDDVDRKLDNIGKDLAEVKQILAALNENVAQTYEELAKLMANLM
FT                   RRSVRI"
FT   gene            61701..61976
FT                   /locus_tag="Pisl_0067"
FT   CDS_pept        61701..61976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87251"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQL9"
FT                   /protein_id="ABL87251.1"
FT                   /translation="MSLDLKREFLRLLREDEEFRYAVMGLLGVADLRTSLDNLIKAGAK
FT                   HGEVIDKLRSSVKELRKTIEALARPIKELRKDALSEDVRDTAKLYS"
FT   gene            complement(62931..63833)
FT                   /locus_tag="Pisl_0068"
FT   CDS_pept        complement(62931..63833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0068"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87252"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM0"
FT                   /protein_id="ABL87252.1"
FT                   /translation="MLTLFDRRIGRWTLRELAWELYRGGAYRPPRSELELAQLVQIQRR
FT                   ISGGVPVPKMPYVPGNRKVGRIWTFDLPPVLTCPYATFCGRPGSAGLYRGRGLVCYDIN
FT                   IARYNPLHLLREYINFIHVVREGYSWLRDWTRFIVEFRGAEIIRFHVGGDVFSDWYWGY
FT                   LKKLASDFHHVTFYLYTRSFPIVAASPERPRNLVVLMSLDGANYKAYEKYGAYFDHITY
FT                   LAAGEDVKSQIPAIEALAKWAAKNGKRLIIFLEHRRLSQLRQALEKYSQYICPNELGVN
FT                   TTCEKCKHCFAPQTKNQTY"
FT   gene            63862..65289
FT                   /locus_tag="Pisl_0069"
FT   CDS_pept        63862..65289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0069"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: sto:ST1151
FT                   hypothetical 5-methylcytosine-specific restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87253"
FT                   /db_xref="GOA:A1RQM1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM1"
FT                   /protein_id="ABL87253.1"
FT                   /translation="MSISQERCYVILGSPENWHYAISEISKENELTPKYSGECDPQCLM
FT                   VLREKKKNGKILWAFPNTKDYKELENNFKTYNEIYILAVSTARFGDTTPEEDKKNAEVY
FT                   LSKIVALGKVTKDDLIGGCSCQYWPNKDNNWYYKFFIEVLAYLDPQNGRDGFILKGFQP
FT                   GSLKEVDCRLLFNILDLAVKSGIYKVPRCRGESDVKLFRKAIDELKGQFQGMSEVVEKV
FT                   GAALYAGNVLLIGPPGVGKTTLAVEFAKRLTEGDYILATANALWFRRDVVGGETIREGS
FT                   VVWKSGLLIKAYNRAARNCGRPLLLIIDEINRADADKAFGEFFSIFRSPSPEDWEIPKT
FT                   LVEEIEGYGDKADEEARAFLRNYREMGDTPLKRIRVLATMNTRDVRNLFLLGEALLRRF
FT                   TIVRFEKIGEDVLKADGELYSAYQNMNRGGDIPPSALIHAKRLRDAYKALGLAEPRAEE
FT                   LIEMSSGGFALRKRHRT"
FT   gene            65293..66447
FT                   /locus_tag="Pisl_0070"
FT   CDS_pept        65293..66447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_1988 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87254"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM2"
FT                   /protein_id="ABL87254.1"
FT                   /translation="MGSAEWRRRDRRLLELAARWYVKHYVGGRNIMKLLGLSEEERYGV
FT                   ASALLAVFVNAMTGVVKAALRDLLVYREFAVVYGDEIFGALDVGRTVAVLPAGVYASLT
FT                   YLPSLQAPEYGILRRMALKVAKWEREAAVDEEMRKDAERLRRIAKRLPKAYGRAAVDVR
FT                   EGPPWLRQGWAIYRAAKALVEGEIYVGERRGVGKALKFVNWRLYEMYIAMLVLEALRRL
FT                   GWRTVGVDVEKRAVLVERDGKTLAVYLNRALPHHSIIEEVAGDEVRGRPDLTVANADVK
FT                   AVVECKYSDRPGYIARGRFQVMTYMCEYGAKIGILVYPAVSEEEAEDEEEETAVRWANS
FT                   GKPIRMKDGRAIYPLRIDPADGATADEARKKHLGDVMRLLERSL"
FT   gene            66475..66819
FT                   /locus_tag="Pisl_0071"
FT   CDS_pept        66475..66819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87255"
FT                   /db_xref="GOA:A1RQM3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM3"
FT                   /protein_id="ABL87255.1"
FT                   /translation="MDLLRVGVALVGVALLIIALVALAFYLDVRGRMAAPQVPFSAFCY
FT                   GGYVVVSAYVDLRNVTVADGSGRVLCAFDFLRAGSERVCRVGNGTVAVVEAGGYSRVVV
FT                   CPGPPRPVRD"
FT   sig_peptide     66475..66549
FT                   /locus_tag="Pisl_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.974 at
FT                   residue 25"
FT   gene            66841..67050
FT                   /locus_tag="Pisl_0072"
FT   CDS_pept        66841..67050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87256"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM4"
FT                   /protein_id="ABL87256.1"
FT                   /translation="MLKVERQGPVARLVYKSGDREAVAVGPVSDLPTLLGLFVAQMARE
FT                   GFTAEDMCSALRKVLEELGQFSPS"
FT   gene            complement(67268..69127)
FT                   /locus_tag="Pisl_0073"
FT   CDS_pept        complement(67268..69127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0073"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pai:PAE0055
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87257"
FT                   /db_xref="GOA:A1RQM5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM5"
FT                   /protein_id="ABL87257.1"
FT                   /translation="MKPLFQILLTVALVFAASITDPRWAVPTYVTPGGVFNITLDAPTV
FT                   VKSVALAAPGMEKPLELRFNVSGNVITAYVPADAPLGLYDIVINGGEIYEPKAVWVGNV
FT                   TGPLRIIQLTDIHVGVELDMASVYRLIHGALYASSGPYDVVFLTGDLADVGGQPWQYAL
FT                   LVRYASTITKPIFAIPGNHDHAGDDPLNNYRRYVGPPYWYRVVGPYLIIGLDSGHDGYL
FT                   TEEQVKFYGDILRRYPDKVKIVLIHHPPFYLRDAYIVETYRGPQDIDRLNRDPTGRRPY
FT                   YIVYTSYLYNRPTYERFLNLTIRYRVALVMAGHVHSGNSTVVINGTYFVTTRTLGGSID
FT                   KSHGFRTYVVYPDGRVQIDPETLTYKNYAVVTWGTKAAQIYIDSDLLPGTIAIDLPGQY
FT                   QGLKTLNGTAQLVEAKKHPLAKYTRYYISIVGKPVWLAIGDYAPAPAVAIEKIMPRFPT
FT                   PGDVVTVTIKAEDPNVGIPFLTVDGKKILASYPSEQPVYQYRFKYDKPTTLQIQAPGGQ
FT                   PTTIQIGQATPSPTTPTPTATPTPSPTPSKTPTPTTPTATPTPTPSPTPTPTLTVAPAP
FT                   APFPTEAVVLVIIAAVGAALLAALAKTGKKKAETGGTRVYGEK"
FT   sig_peptide     complement(69050..69127)
FT                   /locus_tag="Pisl_0073"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.621 at
FT                   residue 26"
FT   gene            complement(69124..70401)
FT                   /locus_tag="Pisl_0074"
FT   CDS_pept        complement(69124..70401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87258"
FT                   /db_xref="GOA:A1RQM6"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM6"
FT                   /protein_id="ABL87258.1"
FT                   /translation="MKSKLVVVLLAAALAAAQQLYVPVLVDVAHGEATKGLDFWVNSTA
FT                   NPLAITDFAMLYVLVPPDAKLDPTLSKLNATKMATIIRGDFSTIDLSKFNVIILGQPPK
FT                   PLSEAELAALKKWFESGGKVLWCAADSDYPAQGSEESQAVCNDIAEYLGAHIRVDYVSV
FT                   EDPQYNARAGYRVIGVVDPPPQLAFLGFLAQRVLFHGPGVIAVVLPDGRWVPATSPETQ
FT                   KAYGNIYVIARTTERGTIVEHRTSADGKGRDGKAHKAGDRGVFALMAAEIMPSGSVLIL
FT                   SGETPYGGYEPMTAPIYYRVQLDGPRFLRNLLLWATGNYRELTTMVYQVRQMAQITSDV
FT                   SSLKNTAAALQNEVSAVKNAVSQVSTKVDAVGGQVAALSQKIDQLAQQLNAAVAEANNA
FT                   KTTAFVGTALALIFAIVAAALALRRK"
FT   sig_peptide     complement(70348..70401)
FT                   /locus_tag="Pisl_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.807 at
FT                   residue 18"
FT   gene            70496..71992
FT                   /locus_tag="Pisl_0075"
FT   CDS_pept        70496..71992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0075"
FT                   /product="extracellular solute-binding protein, family 1"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pai:PAE0061 extracellular solute binding protein,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87259"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM7"
FT                   /protein_id="ABL87259.1"
FT                   /translation="MRIGLLVGAVAVVVIALIAALLATQQAPAPSPTTPTPTATPTPSP
FT                   TPSKTPTPTPTTTPTPTATTPQVCTTLVVITRHPTDILDVTRTLFLQSDVARRYGIRDV
FT                   VFRPVAAAQWRAIIQTGQADVAWGGGPTLFDSLYKDGLLLPLEGEEVKNALAQIPKTIA
FT                   GMPMTRTGPDGKVYWVAWAVSSFGITINTKVLKSLGLPEPKSWTDLASFEYGKAVLRGS
FT                   PAAGLSQLTKSTSNTRIAEIILQAYGWDEGWRVITLTAANGKIYGGSEAVRDAVIAGDI
FT                   GAGWTIDFYGYTAQLQNPDTKYVVPPDTSVNGDPIAVVKGTKCREAAEAFVAWVITQGQ
FT                   VVVFDPKVNRMPVNPNAFNTPEGRKRADLKAVYDYMLNLKTINFNDTLALATENVVMYY
FT                   FDAAITDNAQLLQDVWAKLVKAYLAGKIDKATAEALAKRLGELVTFVDPDTGQPVKLTM
FT                   EYAMKINDRIANDAAFRDKIYAAWRDAARKKYQEIASQIP"
FT   sig_peptide     70496..70567
FT                   /locus_tag="Pisl_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.603 at
FT                   residue 24"
FT   gene            complement(72004..73806)
FT                   /locus_tag="Pisl_0076"
FT   CDS_pept        complement(72004..73806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0076"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE0062 molybdenum
FT                   transport system permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87260"
FT                   /db_xref="GOA:A1RQM8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM8"
FT                   /protein_id="ABL87260.1"
FT                   /translation="MRFIKLSTTLGYTYLGLFLVAPIVFIFWQVLAGIGEIYTSITDPF
FT                   YINLSPDAFSNAIYIRPTDPPTLVIRGPDLGVIINSLWVALLVAAVDTTLGFALAYVLA
FT                   KYVFPGRTALGLLATLPLIVMPFATAYVVRKFLDPRWGTLNWILSAFLPLRIEISGLAA
FT                   VAIVQILMFLPIAYLNIYAALTRVDPTLEEVAANLGADERRTIRDVVLPLSTPGLAAAF
FT                   VLVFIFAIDDVAAPIIFQDDPAARKLLSYQVYSKFLDQLRGQISPTAAFLALILLTISI
FT                   TAFLAVRKYVGLRQYAMLIRQLRPRVYRPGPLGKAAIYLIAFPLVLTAAAPLIGAIALV
FT                   FAERWTTTPLPEAPSLQNAADRIAEVFQNSLFLRGVINTVYYGVTATLIMVGIGLLIAL
FT                   AAARSRGPAADALDALATMPIAIPGLVVAYAYFLTSLQLSTFLKPTAPALAQALDPLRH
FT                   PELYLIVGYSVRKLPFVVRSIYAGLQQIHPSMEEVAMNLGDGYFGVLRKILVPLLKTNI
FT                   LSGALIGFVYVTSEVSLSITLGVLKGVGQDTAMPITAFMRERFESGLYGVQEAATLGLI
FT                   LVLIQVAAITLTTRVLKTRYGFIL"
FT   sig_peptide     complement(73708..73806)
FT                   /locus_tag="Pisl_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.745 at
FT                   residue 33"
FT   gene            complement(73803..74846)
FT                   /locus_tag="Pisl_0077"
FT   CDS_pept        complement(73803..74846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0077"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: pai:PAE0063
FT                   transporter ATP-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87261"
FT                   /db_xref="GOA:A1RQM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQM9"
FT                   /protein_id="ABL87261.1"
FT                   /translation="MTIVRLEKLRKVFDNRVVAVDDVDLVINDGEILAVLGPSGCGKTT
FT                   LLRLVAGLEEPTSGRIYFNDRDVTKIPTQQRNTAIVPQTWALWPHMTVFENVAYGLRLK
FT                   KNQFNLTEREIKRRVEEVLELVGLAELSNRRPFQLSGGQQQRVALARALVVQPEVLLLD
FT                   EPLANLDAKLRVELREEVRKIAKKLSITTLYVTHDQEEAMAVADRVAVMNAGRILQVGT
FT                   PEEIYHKPQNFFVATFLGRSNLFRGRVVEARGEVAVIDIGFIITAETPQKVSQGDEVYV
FT                   VIRPEDIYMGFGGVRCSVEDVVFLGRFYQTTLRCSNKTLKAEGPKPPARPGEEIQIEIA
FT                   RAWAFKT"
FT   gene            74920..76155
FT                   /locus_tag="Pisl_0078"
FT   CDS_pept        74920..76155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0078"
FT                   /product="translation initiation factor 2 subunit gamma
FT                   (aeIF-2g)"
FT                   /note="PFAM: protein synthesis factor, GTP-binding;
FT                   elongation factor Tu, domain 2 protein; KEGG: pai:PAE0064
FT                   translation initiation factor aIF-2 gamma subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87262"
FT                   /db_xref="GOA:A1RQN0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN0"
FT                   /protein_id="ABL87262.1"
FT                   /translation="MTFVYPDAIISTAGHVDHGKTQTTYALSGVWVMKHSEEIKKAMTI
FT                   KLGYAQVGIYDCGEEYYYTDGILINNKCPNGSEPKLVRRISILDVPGHEVLVATMVSGA
FT                   AVVDGAVLVVDASQPAPQPQTVEHFAVLDIIGVRRLVVAQNKIDLVVKEKALENYEQIK
FT                   KFLAGTWAEGAKIVPISALHRVNIDVLATYIAKTVPPREAELGKPARFSVLRSFNVNPP
FT                   GTPPEKLRGGVLGGTLLQGVLKVGDEIEIRPGLKVDKPKPGYQPIMTKVLSIEYGGYKV
FT                   DEARPGGLVGIMTGLDPALTKADALAGAVAGKPGALPPVWTTVEIDTKPIPRSIEGKTE
FT                   PFRQGEVVLIAVGPATVFGVVQAVKKDLVTIALKKAVCAEQGSKVVVIRQVRNRWIVTN
FT                   YGVLKGGTVALE"
FT   gene            76263..76736
FT                   /locus_tag="Pisl_0079"
FT   CDS_pept        76263..76736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0079"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pai:PAE0163 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87263"
FT                   /db_xref="GOA:A1RQN1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN1"
FT                   /protein_id="ABL87263.1"
FT                   /translation="MCLLRVNHAGGPDWAAVGVLLRSGKVLLIKRVERDGDPWSGHVAF
FT                   PGGRWRPGEDLLGTAVREIEEEVSIQVTDVAGALPPFSPGNAPWLKVVPFIFTGWVGEP
FT                   RPNPREVREARWVGRDELREITWGGEAAFETGGWIIWGLTYRILKKLIDCGLF"
FT   gene            complement(76737..77858)
FT                   /locus_tag="Pisl_0080"
FT   CDS_pept        complement(76737..77858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0080"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pai:PAE0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87264"
FT                   /db_xref="GOA:A1RQN2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN2"
FT                   /protein_id="ABL87264.1"
FT                   /translation="MLPDLARLAWQSVRERAGRSALAAMGVFVAFLALAVALSVGEMAK
FT                   SAVESAFQQLGLNTVWVMAQRGYFTEADAATATAVAKEGVVIPIAQDFGRLRLPDGTER
FT                   AVTVYYIPPQYLGLLLPKEALRSGQLYVGGPLVMVNSRVRTAGDMPVAPGSPMTLTRSD
FT                   GSVVEVVAAGVFESTGFIGAADVLADNALYPERRYIILYIVARSPQAAEALAQALRPYF
FT                   PDAVVITPQTLARQIGRLASVAQIGLGALAGISSLVTAMWLYDTVTISILQRTKEIGIM
FT                   RAVGFKRRHVMAMLLLETFIVVGAGVLAALPILAAASAIPISLGPGVYLKLAISPIAVG
FT                   AAAAVVIGANILGVLVPAYRASRLNIVDALRYE"
FT   sig_peptide     complement(77751..77858)
FT                   /locus_tag="Pisl_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.569 at
FT                   residue 36"
FT   gene            complement(77839..79830)
FT                   /locus_tag="Pisl_0081"
FT   CDS_pept        complement(77839..79830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0040 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87265"
FT                   /db_xref="GOA:A1RQN3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN3"
FT                   /protein_id="ABL87265.1"
FT                   /translation="MPRAVLVLLAGVFLALGQAVAFQPAMERLFLGGQWVDVPKYPGDV
FT                   GLLKLSYYLADQHVDVSISLSRCGLKAEPYRAASAGPGVFEAVLKVRADRLGQREGCTV
FT                   VFKSRYRYKSGVLTDGVEWVDYLEVEVPNYPSPKAEAVGSLYLGARGRILLRVWDSYRY
FT                   LGVVEVSAVGARLYSPAVYYGDIGNLTAYLDVAPLDYSASLVVTVKARDALGREVAVSR
FT                   QVPLSVQPRPAPRLEAYPPWLPAGGCGRVRISVSYPIPLNGTVYVPDGSAPLAGGHGVV
FT                   YTTVCAAGGHATVPVTVQLDTGAVDRAELQLPVYPISPFPLNVTAQPGVLTAGDVNKVS
FT                   IYVTAPGPYVGELSVAGAASLTGTPVRFSGNGTTRVDLLLIPTSGVVTIDVAVSAGGYT
FT                   ARSSVALVASQKAPLEVYVEPREVAAGGSHVVKVTVTPRVNISHLVITLYPVSGAVFPQ
FT                   TTFRLGARGGAVELPIQIPADVVGNVAIGYRAAYTLASGVSGEYSGTLYLVALQRPQLY
FT                   IQTSVVPETPTAGEPFYLAVRLFNAGGVDARDVVVNVTGARVVKAPPPLGAIQPQGSKD
FT                   AVFTLVADGAGLRNITITAIYKDVLGRSYAARSAVALYVNASAPSAATPLQQSGGSEQT
FT                   WLVLAAFTALGAAVVAVGLWRGRVARPR"
FT   sig_peptide     complement(79765..79830)
FT                   /locus_tag="Pisl_0081"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.982 at
FT                   residue 22"
FT   gene            complement(79823..80302)
FT                   /locus_tag="Pisl_0082"
FT   CDS_pept        complement(79823..80302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87266"
FT                   /db_xref="GOA:A1RQN4"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN4"
FT                   /protein_id="ABL87266.1"
FT                   /translation="MKISTGVKWGLVAGLIVGLATGIVDYFGIDAIKNQLADYIYREAI
FT                   AQGASPEIARRAAQTAVEILPLLTIVGGVIVGLIIYIIVGVVLAVLWERLKMPWYAKGA
FT                   LFGVVLLLIFAAPSLIVHPPPGVPTPPVAYLYAKWALDLAGPIFLAWLLERKSRA"
FT   gene            complement(80306..80605)
FT                   /locus_tag="Pisl_0083"
FT   CDS_pept        complement(80306..80605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87267"
FT                   /db_xref="GOA:A1RQN5"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN5"
FT                   /protein_id="ABL87267.1"
FT                   /translation="MRLLVYAALAFLIYFDALLTYIAVGHLGAYEVMLRFVNHHPESIW
FT                   LVAAGKNAGVLYLALRRRRYPWLDYAALALALWHSAAVYNGVMQLAKVIYTGAY"
FT   gene            80653..81708
FT                   /locus_tag="Pisl_0084"
FT   CDS_pept        80653..81708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0084"
FT                   /product="Wyosine base formation"
FT                   /note="PFAM: Radical SAM domain protein; Wyosine base
FT                   formation; KEGG: pai:PAE0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87268"
FT                   /db_xref="GOA:A1RQN6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN6"
FT                   /protein_id="ABL87268.1"
FT                   /translation="MSCETEALGRYHILEGPKIKIRASAARALIERHYGVAGHATVELC
FT                   KWTKDALETGRSCYKVKFYNAPAGGSHRCVEMSPVGLVCSNRCVYCWRPTEEFDTFQLE
FT                   ERFYMEPEEIVREVLEERRRLLSGYWGHPQGRYRIKEALEPTHWAISLSGEPTMYPKLP
FT                   QLIKLVKSLPSTKSVFLVTNGQHPEMLRRLVEEDALPTQLYLSTNAPNRELYYLINVPV
FT                   YRREDAWERWLESLDLLAKMPTRTVLRITLIRSLNYDERYIPEFAQIVKRGNPHFVEVK
FT                   SYMHLGHSTQRLKREDMLSHQEVREWAFKLLAELEKIGARFRYMDEDEASRIVVIQNMD
FT                   RYVDRWIVPPR"
FT   gene            complement(81737..82041)
FT                   /pseudo
FT                   /locus_tag="Pisl_0085"
FT   gene            82100..82540
FT                   /locus_tag="Pisl_0086"
FT   CDS_pept        82100..82540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2822 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87269"
FT                   /db_xref="GOA:A1RQN7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN7"
FT                   /protein_id="ABL87269.1"
FT                   /translation="MVGAVSAATAFFTAAVVLALAALALYLRRGFAELKAVDSSFALSH
FT                   LGVKLMLYSLAAIGASIAISGAYRGDPPTFPRDLNTPRGAAGLAALALLLASLPLGIAG
FT                   YALVFILGALRLYDRFRDKRMLAAGLLYAVDMPALAIKAGGR"
FT   sig_peptide     82100..82165
FT                   /locus_tag="Pisl_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.782 at
FT                   residue 22"
FT   gene            82590..82931
FT                   /locus_tag="Pisl_0087"
FT   CDS_pept        82590..82931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87270"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN8"
FT                   /protein_id="ABL87270.1"
FT                   /translation="MRPNLVETLAKRVREYPQRFAQCVRAIVKRYGGEVSVFLFSSRAA
FT                   GMHGAVSDFDILVVIPSYGDYFDTAAELRRLCRGVPVDIVVDGVLAQMLRGCKTLHDGL
FT                   GLGLCVEHK"
FT   gene            82953..83375
FT                   /locus_tag="Pisl_0088"
FT   CDS_pept        82953..83375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0088"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pai:PAE0252 diadenosine
FT                   5'5'''-P1,P4-tetraphosphate pyrophosphohydrolase
FT                   (MutT/NUDIX family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87271"
FT                   /db_xref="GOA:A1RQN9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003565"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQN9"
FT                   /protein_id="ABL87271.1"
FT                   /translation="MEYDEVSAGAVVFYRGEEVEYLLLHYPAGHWDFPKGNVEPGETPE
FT                   QTALREIREETGLEVELIPGFREEVEYVYTRGGRRVRKKVIFFLARAKSKEVKLSWEHT
FT                   GYAWLPFDKALARVTYETSRRVLAKAHRHVKTLDGV"
FT   gene            83512..84225
FT                   /locus_tag="Pisl_0089"
FT   CDS_pept        83512..84225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0089"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sai:Saci_1536 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87272"
FT                   /db_xref="GOA:A1RQP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP0"
FT                   /protein_id="ABL87272.1"
FT                   /translation="MGCIRAEGLVKRFGSVAALSGVSFEVGCGESVALLGPNGAGKSTT
FT                   LRILAGLLKPDAGRAAVCGYDVQARPREAKACLGFLPEDAVPFLNLTVRENLQYMAVLR
FT                   GLPDSAVDEALKLLGIEELADRTAASLSRGNRQRLAIALAVMHKPRVLLLDEPLNYLDI
FT                   PAQQDSVKLFQSLKSSGSAIFVSTHIMSVAERLADKALVINRGRIVWQGPMDELREKAA
FT                   DAGERIEDVVARLMR"
FT   gene            84222..85721
FT                   /locus_tag="Pisl_0090"
FT   CDS_pept        84222..85721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0090"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sai:Saci_1535 conserved archaeal membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87273"
FT                   /db_xref="GOA:A1RQP1"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP1"
FT                   /protein_id="ABL87273.1"
FT                   /translation="MRFLKLVYYTIKQTHSKWSLAFEIGMFALISANTLWEVYHNPQQG
FT                   TASLPMSVPFVLLSLYLGFSIVAIFGGITASKQDLDFVFATPVDPRAVHLAKVLSASID
FT                   LALFYFIVSFPVMALNFSPVGLLFYLATWLSLSFTSAFAVLTASYLSSRLARVFYVGIL
FT                   PALVLLLLVAPEMSPFRGLYYPSPLHALEAIMLTVAYLATAPYKRIEEVATNAYGILAK
FT                   EQALRLGGRGERPQALPKTFWGVIWHTSVNAVVDVYYTSPEGSIVRREKSFNVLKTFMP
FT                   ISAAAAAVYAFLSTAHITSGVDLSIAGFIVVNFLLLFVFSALHQAVAHERLWISVLSGG
FT                   LKYLRYRMAARTIITALLLVPWIAVFLAQSAVFPPSAFLAVVLASAALVAPSATWLMAS
FT                   VKPPPQIRELEIPITTPKLSLWNILQLLAALLYYSFSLSPYALAVVAYFLKLEFLWQIA
FT                   LIDAAVVLSLSAAFFYVVVLSERGAPLWSWAVSKLSENGYV"
FT   gene            complement(85712..86221)
FT                   /locus_tag="Pisl_0091"
FT   CDS_pept        complement(85712..86221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0091"
FT                   /product="PaREP1/PaREP8 domain containing family protein"
FT                   /note="PFAM: Archaeal PaREP8; KEGG: sto:ST1303 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87274"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP2"
FT                   /protein_id="ABL87274.1"
FT                   /translation="MEFVEIKIPKPVYELLSRRGVDVEAEVLDRLLSELDPPEEAAERV
FT                   RLAERFYAEAMQYVERGNPVQASGKLYKAAEECIKALATWFKTPEAAEARREGRWWTKL
FT                   LARAAKTLSAMLNQPQINIGWSVAYDLHVWGFHEATLAVEHVKAAASQIEKLLETTKAL
FT                   LRSSHT"
FT   gene            86345..86959
FT                   /locus_tag="Pisl_0092"
FT   CDS_pept        86345..86959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87275"
FT                   /db_xref="GOA:A1RQP3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP3"
FT                   /protein_id="ABL87275.1"
FT                   /translation="MDWGRIALWFYARFFAGALSTASREGAYANIVLFPVLIFAGEDPL
FT                   AVLLGFAIAAAVAIALNLAASRRAIQGPIFRVGSLTALAGVVAGFLTFLLLPLPILKYL
FT                   VAAAMFATGGKLLADAAWGKREFYLKHPAARAVLNFVVGVLDVFIGTAASFALARAFVR
FT                   ELEALLPAARVGEAALSVELKHRVAVGASWRGWGYSLANVS"
FT   gene            complement(87116..87625)
FT                   /locus_tag="Pisl_0093"
FT   CDS_pept        complement(87116..87625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0611 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87276"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP4"
FT                   /protein_id="ABL87276.1"
FT                   /translation="MFSYWQRREDPLTRCIEDVVFNIGVEGDKCFLAAVEYLCKKRLGE
FT                   ATSIDKIAVKYGVSLLCVYKWYAKLYQEGVRYPRDRVEQLLEQVRGKYGVAIAEEVKNL
FT                   YNFLKSKGALDGLKPEGVIAALLYYAAKKHGLRYDSIRTAEEFGVHPETVEKNIVIFQW
FT                   YLHGKI"
FT   gene            87632..88699
FT                   /locus_tag="Pisl_0094"
FT   CDS_pept        87632..88699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0094"
FT                   /product="Protein of unknown function DUF1297"
FT                   /note="PFAM: Protein of unknown function DUF1297; Protein
FT                   of unknown function DUF1246; KEGG: pai:PAE0608 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87277"
FT                   /db_xref="GOA:A1RQP5"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQP5"
FT                   /protein_id="ABL87277.1"
FT                   /translation="MLRQTYIFVAIQKFKSLQHLEHMSVLKRYDLEKLAVATVASHTAL
FT                   QILRGAKKYGFRTIAIAGRADVAEFYQQFNFIDEVWTVDFRNFVKAAEKLVEANAVFIP
FT                   HGSYVEYVGWRQALEAPVPTLGCRELIKWEADQYKKMELLQRGGIPTSRVYKTPEEVDR
FT                   PVIVKLFGAKGGRGYFLARDREELRRRLAGLSDYIIQEYVFGVPAYYHYFSSPVYGRVE
FT                   VFGADIRYESNVDGRTFGWVEPTFVVVGNLPLVLRESLLPTIWKYGVQFAKAVEEVVGC
FT                   RLAGPYCLESIIRDDMSISVFEFSGRIVAGTNIYMGYGSPYSVLYFDRPMDMGERIAHE
FT                   IREAARRGRLEDLFT"
FT   gene            complement(88692..89762)
FT                   /locus_tag="Pisl_0095"
FT   CDS_pept        complement(88692..89762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0095"
FT                   /product="Protein of unknown function DUF1297"
FT                   /note="PFAM: Protein of unknown function DUF1297; Protein
FT                   of unknown function DUF1246; KEGG: pai:PAE0604 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87278"
FT                   /db_xref="GOA:A1RQP6"
FT                   /db_xref="InterPro:IPR009720"
FT                   /db_xref="InterPro:IPR010672"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR023656"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP6"
FT                   /protein_id="ABL87278.1"
FT                   /translation="MSINCCLLLSMVSVAVLASHSALDVLDGARDEGLKTVAIAKKGRE
FT                   RAYREFPVVDKLIVLDDYRDILKIVDLLKAEEAVFVPNRSFAVYVGYDAIEREFPVPIF
FT                   GNRFLLRWEERTGPQNYYRLLDEAGIRRPRTFRPDEVDRPVIVKMPEAERRVERGFFIA
FT                   RDRDDLYRKAKRLADAGVIKLEDLERSSIEELVLGAHFNANYFYSVMRRRLELHSFDRR
FT                   IQSNLDGVFRLPARDQLEVDPEVRYIEVGHEPATIRESLLEKVFDVGYRFVEAARRLVP
FT                   PGVIGPFTLQFIVTPQLDLVVYDVAPRIGGGTNVYIGIGGQYSKLYFGKPISIGRRIAM
FT                   EIREAAEQGRLPEITT"
FT   sig_peptide     complement(89697..89762)
FT                   /locus_tag="Pisl_0095"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.748 at
FT                   residue 22"
FT   gene            89809..90990
FT                   /locus_tag="Pisl_0096"
FT   CDS_pept        89809..90990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0096"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; UBA/THIF-type NAD/FAD
FT                   binding protein; NADP oxidoreductase, coenzyme
FT                   F420-dependent; Shikimate/quinate 5-dehydrogenase; KEGG:
FT                   pai:PAE0601 glutamyl tRNA reductase (hemA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87279"
FT                   /db_xref="GOA:A1RQP7"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQP7"
FT                   /protein_id="ABL87279.1"
FT                   /translation="MDLLSPLSAIVLTYREVDTDTLGKIGEEMRKCLEQMGRGTPIYVL
FT                   HTCGRVEAYLYGASPEEVQTVAETYRKYVNSVRIIAGVEAARHLFRVAAGLDSMLIGET
FT                   DVLGQLEEAFDRQVRAGYTRGLLKTIVERAVRVGKRVRTETAISRGPRGLGSLSIIYVS
FT                   RLLDMRQAKVAVLGAGAVGAGLAMELAARGVKKLYILNRTLEKAKEVAAKTGGEARPLT
FT                   KEEVERCLRECDVVFSSVHSMEYIIDKIPEGASVKVVVDLGVPQTVASGLPVKVVRIED
FT                   LREIAEQYNAERASEIAKAEAIVEEELAILPKLLARRYIEETVSTFIETAMLAAEEEGA
FT                   RAGCNTATLAARTTVKRILLPLVERLKKMAEDGQIEEAVKLAQMLSQTIGRKI"
FT   gene            91013..91084
FT                   /locus_tag="Pisl_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            91013..91084
FT                   /locus_tag="Pisl_R0003"
FT                   /product="tRNA-Leu"
FT   gene            91241..91708
FT                   /locus_tag="Pisl_0097"
FT   CDS_pept        91241..91708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0097"
FT                   /product="PaREP1/PaREP8 domain containing family protein"
FT                   /note="PFAM: Archaeal PaREP8; KEGG: pai:PAE2673 paREP8"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87280"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP8"
FT                   /protein_id="ABL87280.1"
FT                   /translation="MAITLSPAVAELLKRAAGDRDVEAFLADLLAGRLDPPERVELYLR
FT                   LHEKYLREAEELYRGGDLVQAGERYWGAVTALLNALAKKRGEPHYSHRDYAVLIDRLYR
FT                   ETKDRELVTAFAMAERLHANFYRNFLSPEGFEVHRESALRLVEKLKKLAET"
FT   gene            complement(91705..93033)
FT                   /locus_tag="Pisl_0098"
FT   CDS_pept        complement(91705..93033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87281"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQP9"
FT                   /protein_id="ABL87281.1"
FT                   /translation="MGWGITRRRLLTLGVAGAVAAVGGWQLLGVLKNAARPQTRSYWFE
FT                   RVSEFASNDDVVELKFVDEFDRPVDFNALLVWEPDGVVEEVAVKDGVLRLDKRRVKRQA
FT                   ESWVEEQLRRDNPTSTEHALFTILPTAPAEPLFYTDVIERPALRSRVYRVRGAARRSTG
FT                   HRFATCPEAKVFYISDVNLTDPDYVPAVALKDSSSKAFGEDIWFGYKVDGSALKLNAYG
FT                   ALSLKWGTELRITGEYSWGTGNLISQGSGGYAPADGQSAAVMFYSSIWRVIGYDVYDIY
FT                   TCNVVDTRASLYMLNLAFENGNIALRSVGYIPKMPTSISPAETRTYTGIDGKLGDYNTL
FT                   WYLEIMKNEPLLDVGGTLGVGLPVGDLIANKVPSTVASLIKKLYAGFNFQAYGAVANYI
FT                   AKVSTDAAPGAKYALRVYRAAFVHYLKDYVFKPLVTIAEVVDA"
FT   sig_peptide     complement(92962..93033)
FT                   /locus_tag="Pisl_0098"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.492 at
FT                   residue 24"
FT   gene            complement(93081..94157)
FT                   /locus_tag="Pisl_0099"
FT   CDS_pept        complement(93081..94157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0099"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide
FT                   synthase"
FT                   /EC_number="4.1.1.21"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; KEGG: pai:PAE0232
FT                   phosphoribosylaminoimidazole carboxylase ATPase subunit
FT                   (AIRC)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87282"
FT                   /db_xref="GOA:A1RQQ0"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ0"
FT                   /protein_id="ABL87282.1"
FT                   /translation="MRLLVLGGGQLALMMSWAAARLPLDFVVYDPDPRAPAYKYAIKAS
FT                   DPLREVERADYVTFEFENVEWEVAEYAHKLGKLRPHLDYLRVKKSRIWEREALGELGVP
FT                   TPRWAVARDGAEAMELAAKWGRAIAKVPSGGYDGKGQYLLPRERPPAEGPLLVEEYVNI
FT                   AREFSIIAARSEDGDVYFYPPAQNYYVQGILVWNYAPAEAPPEAYRYVEKILEWRRYVG
FT                   ILAVEFFEDRSGRILVNEIAPRVHNTGHWTLETDASQFENHVRAAVGLPLRRPRALAPT
FT                   AMVNLLGVASPPIRELERLGKVYWYGKAEARPRRKMGHVNITADTTAEAIAKAREAMRI
FT                   IYGRKFPELVLKNYGSRQ"
FT   sig_peptide     complement(94101..94157)
FT                   /locus_tag="Pisl_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.703) with cleavage site probability 0.553 at
FT                   residue 19"
FT   gene            complement(94228..94710)
FT                   /locus_tag="Pisl_0100"
FT   CDS_pept        complement(94228..94710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0100"
FT                   /product="5-(carboxyamino)imidazole ribonucleotide mutase"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: pai:PAE0250 phosphoribosylaminoimidazole
FT                   carboxylase catalytic subunit (AIRC); TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87283"
FT                   /db_xref="GOA:A1RQQ1"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ1"
FT                   /protein_id="ABL87283.1"
FT                   /translation="MKVAVIMGSINDLEVMKEALEVLKMLEIPYEARVVSAHRTPDFMA
FT                   EFAKKAEQEFDVIIAGAGGAAHLPGMTAAYTPLPVIGVPIPTKHLGGLDSLLSIVQMPR
FT                   GTPVATVAIGGAANAAFLAARILGIKYPEVKEKVKKHMAQMRDEVLSKSFLGDFKP"
FT   gene            94853..96934
FT                   /locus_tag="Pisl_0101"
FT   CDS_pept        94853..96934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0101"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: pai:PAE0225
FT                   phosphoribosylformylglycinamidine synthase II (FGAM
FT                   synthase II)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87284"
FT                   /db_xref="GOA:A1RQQ2"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQQ2"
FT                   /protein_id="ABL87284.1"
FT                   /translation="MGLTQRELEIIRERLGREPTAAELAFFTSHWSEHCSYKSTKMWLR
FT                   ELPGSAPWVVRGRGTDAPLVEVAHGLYVSFKIESHNHPSAVDPYNGAATGVGGIIRDIL
FT                   TVGATPIALLVNLHFGPPEDPHAKWIFSNVIKGISDYGNRVGVPVVGGETWFDEDFTYT
FT                   PIVLATCVGVVEAEAVPKGYVEPGDYIVVAGLGADRSGLGGSAFASKTLEGGEDLGAIQ
FT                   VADPLMGKKLIDVVKEVSRCVKFIKDLGGGGLATALAELSHWFSLGVEFHLDKLHVRDA
FT                   SALPEELLISETQERLIFVISPRDLPCLEEALRKYEVPYSIPGRFVKSDRVLVMWKGVK
FT                   IVDIPISLADGAPEILWPQEPYQPSDIPEIPEPPIDKAIDIVLSSPNVAKKESIYMRFD
FT                   FDVGVRTAVKPGEGDAAVLKLYQRGQLGLVVKGDANPRYTFLDPRLGAANAFVKAYRNV
FT                   AVVGGVPLAAVDSINVGSPERPQVYWRFVQAVQGLKEAATELEVPIVGGKVSLYNEYMG
FT                   RPIKPTVAVVVLGKIDDVSKANRALWHDGDKIYIWGVTKGEVGGSEYLKRVHGILAGRP
FT                   PSIDYAAEKEIVAVIQSWLGKISGATDVGLGGLITALAKMAINSGIGGEIDVCKAPAET
FT                   TRLDYLLFSESNGRFIATGAEGPGVAIGEAYGEEFVVKCGGTLIYKRGVEELKRLMSL"
FT   gene            96936..98204
FT                   /locus_tag="Pisl_0102"
FT   CDS_pept        96936..98204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0102"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   pai:PAE0226 amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87285"
FT                   /db_xref="GOA:A1RQQ3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ3"
FT                   /protein_id="ABL87285.1"
FT                   /translation="MCGIGAAWGKGAGAAVVKIGLWLSHRGHEGVGYAYLENGAVKLGK
FT                   PPEDTQAALVHVRYSTSGPYGVSLQPVYVKYRDLEIAVAFNGTIVNFRQLDNTASFDGE
FT                   ALAKSLAREMWERGVVEGVQEVYKRIVGAASLVALTPWGILAVRDPHGIRPLALSHDID
FT                   GVKIASETVALENGIELAPGIAIMYGDRISTWKIDPKPMRLCALEYVYFAHPASKLGGR
FT                   LVADVRKALGRALAEDETEEGDVVTYVPETARHAALGFAKRLGLEVVDAVVKNRFSGRL
FT                   FIRPPSERKPEEAFYVVRDFIEKKRVFLIDDSLIRGTNIKAIIWMLKKAGATKVHVRIA
FT                   SPPIRWPCFYGMDFQKRTELVAWGRDVEEVREIIGADTLRYISMEKFRAILGDVVCYSC
FT                   FTGVYPHGIDIDWAERELSRNFK"
FT   gene            98272..99111
FT                   /locus_tag="Pisl_0103"
FT   CDS_pept        98272..99111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0103"
FT                   /product="formyltetrahydrofolate-dependent
FT                   phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="PFAM: formyl transferase domain protein; KEGG:
FT                   pai:PAE0219 phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87286"
FT                   /db_xref="GOA:A1RQQ4"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ4"
FT                   /protein_id="ABL87286.1"
FT                   /translation="MIVKIGILASWRGTNAKAIFDHVKLGVLRGVEPVLLIYTDENAPV
FT                   RKIAEAYGVEAVYIQHRGVARARREQELADLLRQYGVDLVILAGYDYILGSSFIEQFRW
FT                   RILNIHPSLLPFAGGKGMYGLRVHMEVYRAGVKISGPTVHLVDESVDGGPILDQWPVYI
FT                   GDIYGLDLPYEEKLAILADRVLIYEHRLYSRVIQAVADGLLEVISERVKYPKVIEEGGR
FT                   IKYEEEEVEVARAVLKTGEGWLREWRERQRVYVEHQLREWRESGKPMHLICPHGCLD"
FT   gene            99095..100030
FT                   /locus_tag="Pisl_0104"
FT   CDS_pept        99095..100030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0104"
FT                   /product="methenyltetrahydrofolate cyclohydrolase /
FT                   5,10-methylenetetrahydrofolate dehydrogenase (NADP+)"
FT                   /EC_number="3.5.4.9"
FT                   /EC_number="1.5.1.5"
FT                   /note="PFAM: tetrahydrofolate dehydrogenase/cyclohydrolase;
FT                   KEGG: pai:PAE0220 methylenetetrahydrofolate dehydrogenase
FT                   (NADP+) / methenyltetrahydrofolate cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87287"
FT                   /db_xref="GOA:A1RQQ5"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQQ5"
FT                   /protein_id="ABL87287.1"
FT                   /translation="MVVWIKGDRLHTETLEWARRHVKELERYGVTPKLAVLLLNDDPIE
FT                   LETQHKYVSLKARDIKSIGGEVELFELYKEPPEKREVAALKLIERLNNADDVTGILVQK
FT                   PLPPYVDETKIFERLSPLKDVDGLTPENKKRLVTGFDLDRDILPCTPAGILELFRQYKI
FT                   DVRGKDVVVVGKGTLVGFPLSIMLMQLDATVTVLHALSKDRKYYVRNADIIISAVGRPP
FT                   ELYSDNPWKLTGDFIKEGAVVVGVGGKVDPVTKKWYFDVDEKSVAEKASYLTPNIGGVG
FT                   LATRARLVKNLIITSYMVATRVASPRLLAL"
FT   gene            complement(100011..100730)
FT                   /locus_tag="Pisl_0105"
FT   CDS_pept        complement(100011..100730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0105"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="PFAM: SAICAR synthetase; KEGG: pai:PAE0215
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   (purC)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87288"
FT                   /db_xref="GOA:A1RQQ6"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ6"
FT                   /protein_id="ABL87288.1"
FT                   /translation="MELVYEGKAKRVYSRGDTLVLVFKDEVTAFDGARRDTAPNKGALS
FT                   AALSAILFKYLSREGVENHFIQMVDLNALEVYKTDVIPLEVIVRFKAYGSYLRRMPLVA
FT                   PLQEFRKPLVELHLKDDRLHDPLILPQDAVEAGILKESEIYEIAEIATKAAETLRKLYS
FT                   KANCDFIDIKFEFGRRSGKFLLIDEISGDTFRLLCNGEHLDKEYYRKTGDVKGLLQRYE
FT                   QLLILTRELLGIKEREV"
FT   gene            100844..102280
FT                   /locus_tag="Pisl_0106"
FT   CDS_pept        100844..102280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0106"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: pai:PAE0216 phosphoribosylglycinamide
FT                   synthetase (GARS) (purD); TIGRFAM:
FT                   phosphoribosylamine--glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87289"
FT                   /db_xref="GOA:A1RQQ7"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ7"
FT                   /protein_id="ABL87289.1"
FT                   /translation="MDKVLVVGDGAREHAIAWSLEKSGVAVGAVISHLNPGLVDIIKRT
FT                   GGRVFLGSPVDPHFVVKAAEEFSPDLVIIGPEEPLFAGVSDALREKGFRTLGASKRLAI
FT                   IEMRKDVARALQWKYGIPGRLIYGVFKNIEEAYSFSKALGAVAIKPIRQAGGKGVRVIY
FT                   GDAKYLEFDEAYRKSAEDIMKQLSNFRDVDAAVLVEEAVWGIEFTIQALTDGETLFFFP
FT                   PVQDNPHAYEYGVGPECGGMGTISPLPFLEEGEVEEAKKAVEFTVKALREEFGERYVGV
FT                   ISGQMMLTTRGPVIIEYYSRLGDPEALNALYLYEGDAYSLFSLAADGKLHKAERRFKEE
FT                   YTVVKALAPLGYPHKRDIAKGRRVYIDWDVIKREGCLVFFSSVEERDGAYVTLGSRALE
FT                   ILAPGKTAEEAYLKSERCMSAVRGDGVYYRRDIGSPEYMSYMATKAGKVRAVYKWRRER
FT                   GLDGKIAIWEPGVGLREYKL"
FT   gene            102277..102531
FT                   /locus_tag="Pisl_0107"
FT   CDS_pept        102277..102531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87290"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ8"
FT                   /protein_id="ABL87290.1"
FT                   /translation="MRYLVYLNIAYKRGIRDPEGETIQREIFERRGVSIEVRAGKCLVL
FT                   TIEASSPEEAREKALKLAWDMRLGNPNVHMVEVVRVEYV"
FT   gene            102524..103165
FT                   /locus_tag="Pisl_0108"
FT   CDS_pept        102524..103165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0108"
FT                   /product="phosphoribosylformylglycinamidine synthase
FT                   subunit I"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   I; KEGG: pai:PAE0222 phosphoribosylformylglycinamidine
FT                   synthase I (FGAM synthase I)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87291"
FT                   /db_xref="GOA:A1RQQ9"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQQ9"
FT                   /protein_id="ABL87291.1"
FT                   /translation="MYRVAVLKFPGTNGDYDVLRALNLVGLQGEIVWYRDYAAGKYDAV
FT                   VLAGGFSYGDRLRAGAIAAQTEAIEQLRRDVEREIPVLGICNGFQILVEAGFLPGALAP
FT                   NEPPGFISKWIQVAVVDVKTPFTHLYEPGEVVYMPIAHGEGRYIPSGPYTQAFRYVENP
FT                   NGSHNATAGVSNGNVLGLMPHPERAVDRDISRGGVGGLKLWLSLKSWLKG"
FT   gene            103167..104285
FT                   /locus_tag="Pisl_0109"
FT   CDS_pept        103167..104285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0109"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pai:PAE0218
FT                   amidophosphoribosyltransferase (purF)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87292"
FT                   /db_xref="GOA:A1RQR0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR0"
FT                   /protein_id="ABL87292.1"
FT                   /translation="MSVGLFAIYSFGGPVELWSMVYYGLKALTNRGDFAEAYVYNGGVE
FT                   RVEVDLSREVERSLRGSAAVGCVSPNGGCCREVEGGVRCSTNDGGTYVELRRDGVVAAR
FT                   RGESLWHLTLGAHGFDYAIISTESAAIEILGGEIRRSLRPGEIIEVSELYLRSRGGGAS
FT                   GPLCALEFIYMARPDSRIDGVEVASVREKIAKKLVEKISYTPDVVVGIPETGSYYAAHI
FT                   AAALGRPYLPAFVATARGRSALLDEVRDRMAVIQLKANVIESAVRGKRVLLVDDSMISG
FT                   ITIRLVAQMLRQKAGALEIYVAVVAPPLRRTCPHGVKMPPESHMIYNAVPPDEVKYALE
FT                   VDGIFYLSADELEETLKEAGVSVCTLCMRPRR"
FT   gene            104282..105205
FT                   /locus_tag="Pisl_0110"
FT   CDS_pept        104282..105205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0110"
FT                   /product="phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /EC_number="6.3.3.1"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: pai:PAE0221
FT                   phosphoribosylformylglycinamidine cyclo-ligase (AIRS)
FT                   (purM)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87293"
FT                   /db_xref="GOA:A1RQR1"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR1"
FT                   /protein_id="ABL87293.1"
FT                   /translation="MRYRDAGVDLDKHWAVHKAVSQYLGGARGIYTSSLEVGGARLTLH
FT                   VDGVGTKAVLALELDRLEVAGRDCVTVNVNDIVCDGFKPLAVVDYVAVEPQHLDKVPRV
FT                   VAGVASKAGEVGAQLLGGETAVLPGVIYGIDVVCTVLGIKAAYTRPPAPGDVLIGLPST
FT                   GPHANGYSLLRRLFKPEEEVCGRPAAELLLAEVADYSPVLKAMEEDTVAGAVHITGGGY
FT                   RKLKKALGGLGAEVAFDVPCLFREIVKRGVEPHEAYQVFNMGIGMVVYTTKDRLGEALR
FT                   ALEPLNPRPIGEVKQGGGLLVNSIII"
FT   gene            complement(105395..106018)
FT                   /locus_tag="Pisl_0111"
FT   CDS_pept        complement(105395..106018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87294"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR2"
FT                   /protein_id="ABL87294.1"
FT                   /translation="MEIYLIYIIREVVVDATREIIKLAGEHQAAVVLIFHGSRDSIHNT
FT                   QVAEIAKALGVSYAFLEAAEPRYRGGGLGVPIFITEGNDYRKALEVAAVKAPPLLGWPG
FT                   FVDYLRGLGADLYIFHGPDAGEQIRHTGLPVVFLYGEPNIDSAPCVTTAAPVVLTRGVI
FT                   YNEIARRYSRCKTQLLPPLAEQPGFIEYLRRALPVVLDLYTVYQ"
FT   gene            106307..106555
FT                   /locus_tag="Pisl_0112"
FT   CDS_pept        106307..106555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0112"
FT                   /product="paREP12"
FT                   /note="KEGG: pai:PAE1827 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87295"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR3"
FT                   /protein_id="ABL87295.1"
FT                   /translation="MVDATREIIKLAGEHQAAIVVDTMEDESYREPKEGDSSGVKKHFL
FT                   DGLGQLRRRLQHLAQWYGLPYLEERLYSTVCPAVARR"
FT   gene            complement(106854..107966)
FT                   /locus_tag="Pisl_0113"
FT   CDS_pept        complement(106854..107966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0113"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: pai:PAE0596 metallo cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87296"
FT                   /db_xref="GOA:A1RQR4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR027634"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR4"
FT                   /protein_id="ABL87296.1"
FT                   /translation="MREVKKLIERFHSAPLIVFWESTKACPLACKHCRADAILKPLPGE
FT                   LNTEEGKRLIEQVASFGDPKPLLVITGGDPLMRNDLFDLIDYANQLGVPTSLAPAVSPN
FT                   LNQEALKAVREHGVKSISISLDGAREETHDELRGVAGSFRDTVAVIKTAVDMGIQVQVN
FT                   TVVWRKSLTELPEVAKLITDLGVRTWEVFFLIVAGRAKEELDITPEEYEAAVQFLVDVS
FT                   TYGLQVRTVEAPFYRRAKLERLEGKTYDSPLYRKLVGRLRELMGPPRRGIDPTIVPTRD
FT                   GFGIIFVAYDGTVYPSGFLPYPLGNVRRRSLVEIYREHPLLQKMRRGEFGGRCGVCKYK
FT                   DICGGSRARAFAYFKDPLAEDPACIYSPPL"
FT   gene            complement(107969..109243)
FT                   /locus_tag="Pisl_0114"
FT   CDS_pept        complement(107969..109243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0114"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: pai:PAE0594
FT                   glutamate-1-semialdehyde aminotransferase (hemL)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87297"
FT                   /db_xref="GOA:A1RQR5"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQR5"
FT                   /protein_id="ABL87297.1"
FT                   /translation="MLFERARGVFPGGVNSPARALKHLAAPLVAKGASGPYLYTDRGRL
FT                   VDYCMAFGAIILGHAHPRVKNAVTQQLERGWIYALLTEEEVAYAERIKAHVPSIEKMRI
FT                   VNSGTEATMNAVRLARGYTRRDVIIKFDGNFHGSHDYVLVKAGSGAATWGIPTSAGVPQ
FT                   DVIKLTAVVPYNDVDAFVKTVREIGGRLAAVIVEPIAANYGLIIPDREFIKALKEETER
FT                   VGALLIFDEVVTGFRVGLSGAQGHFGVRPDLTTLGKVVGGGFPIGIFGGRADVMDMVAP
FT                   SGPVYNAGTYNAHPVSVAAGLAVIEELEKGEPYKIANEAAERLAKGIEDIAGRAGFDVV
FT                   VKQIASMFQLYFKRGDVKTPQDVRESDEKLYLKLHELAIKHGVYLAPSQYETNFTSAAH
FT                   TQDVVETTLAALEKAFTELKSQVGK"
FT   gene            109288..110022
FT                   /locus_tag="Pisl_0115"
FT   CDS_pept        109288..110022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0115"
FT                   /product="uroporphyrin-III C-methyltransferase"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: pai:PAE0590 uroporphyrin-III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87298"
FT                   /db_xref="GOA:A1RQR6"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR6"
FT                   /protein_id="ABL87298.1"
FT                   /translation="MGRVYVVGAGPGDPELITVKGLRLLENADVVLHDRLVAPELLKRV
FT                   KPGAVVIDVGKRPGGAGPTQAEINEILFKYAQLYNTVVRLHGGDPLVFGRGFEECEYLV
FT                   ARGVPCEFVPGVTSGFAAPARYYIPPVVRGTASSVALVTGREDPSKGLRQVNFRRLANA
FT                   VDTIVIYMGASSAGEIAIELIEGGLSGETPVAVIKSAYFKDEEFYTTTLSRLGPVPNPS
FT                   IIVVGRVVERGARLWEAARRLL"
FT   gene            109995..110642
FT                   /locus_tag="Pisl_0116"
FT   CDS_pept        109995..110642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0116"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   pai:PAE0589 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87299"
FT                   /db_xref="GOA:A1RQR7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR7"
FT                   /protein_id="ABL87299.1"
FT                   /translation="MGGGTEIVVVRIKEGRCPSGAYCISIGRIIPRPDVVIPDGDYLVI
FT                   MSPSVAYSINLSNVVKKFKCVICVGPSTAEAVGNCIVPREYTSYGVARLLKELAPGRVV
FT                   VLRSSAGNEVLKTLVPNVIEVPVYDIVLDRDRIEEAAKAIVMAKAVVFTSSTAVEAVAK
FT                   AVDLTGKTVVAIGAVTSQKLTQLGIPHITAGEATIEEAVKTAKKELELFKPK"
FT   gene            complement(110625..110816)
FT                   /locus_tag="Pisl_0117"
FT   CDS_pept        complement(110625..110816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2015 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87300"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR8"
FT                   /protein_id="ABL87300.1"
FT                   /translation="MRGSILVEEVLLLLVAVALVSAFALTVTGVVQNAVNQILGFKNAT
FT                   SSITSQLIDAVRQLLGLK"
FT   sig_peptide     complement(110742..110816)
FT                   /locus_tag="Pisl_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.524 at
FT                   residue 25"
FT   gene            111061..111645
FT                   /locus_tag="Pisl_0118"
FT   CDS_pept        111061..111645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0118"
FT                   /product="Protein of unknown function DUF1225"
FT                   /note="PFAM: Protein of unknown function DUF1225; KEGG:
FT                   sso:SSO0794 transposase ISC1476"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87301"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQR9"
FT                   /protein_id="ABL87301.1"
FT                   /translation="MPSARTVRLRLLPTTAQERKLHKLADAAARAWNEVNYLRRRQFFA
FT                   KQGVDLRGTYNEIYNRYKRILAPAALQQILNKNDEAWRSFFALLARLKAGELHMKKVSP
FT                   PSYWKDRLLGKRVKRLIVRSDQYYVEPINDGEGYIVLKDFGMRIRWEDKVVWEAGQAGD
FT                   CIRAGEVARLPPHRGRRLVACQQPQRDVQPR"
FT   gene            112044..112895
FT                   /locus_tag="Pisl_0119"
FT   CDS_pept        112044..112895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0119"
FT                   /product="siroheme synthase"
FT                   /note="TIGRFAM: siroheme synthase; KEGG: pai:PAE0585
FT                   siroheme synthesis protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87302"
FT                   /db_xref="GOA:A1RQS0"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS0"
FT                   /protein_id="ABL87302.1"
FT                   /translation="MNHTSSPGGGRALRLSQPAPRSSTMRLRAQAPWRLGHHKGVTYFI
FT                   KLGDVCKGAQRYKNKVDVRDVRIPLWVEASRLKVLILGGGSVGTRRAKYFHTAGAKVRV
FT                   IARDVTPELKSMGVEIKYADLNVYEPAEDIKWADIVVIAVDDQRLAEKLFRQAEALGKL
FT                   INDATDATRTHVVVPYEREIAGLRVAVTSEGAAGTPARLSLDIIEGCIKESWIPVFYSV
FT                   YRELKNEAKTLIKNTKTRLHFYQKLVEDEKFMKYVKEKDEKAAIKRGRELLHSILNEEK
FT                   AA"
FT   gene            112978..113304
FT                   /locus_tag="Pisl_0120"
FT   CDS_pept        112978..113304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87303"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS1"
FT                   /protein_id="ABL87303.1"
FT                   /translation="MLLNAQDKHHYGHGHHGKPKSRTDSQWRSPCDGSRRGVGEPTVAV
FT                   RQTYKVVEREVWTGLRQLFYDCGGMGSVLFCPKCGAKMAEERRRVMHCPACGFKAHRDN
FT                   VSVI"
FT   gene            complement(113866..114330)
FT                   /locus_tag="Pisl_0121"
FT   CDS_pept        complement(113866..114330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87304"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS2"
FT                   /protein_id="ABL87304.1"
FT                   /translation="MFSIVTNCTAEKLRVAAPARELYRGPSVRRIVKVLDEVRSAGVPA
FT                   ALYIISARYGLVHENQVLEPYDVTLSGRSPEEIKKWARSVGLLNAIAELIENSTVILVV
FT                   SKPYYIAVEEAVCSHGVYILAPYRACGRWIKTGNFNKHIVLRELLYKLAK"
FT   gene            114366..115172
FT                   /locus_tag="Pisl_0122"
FT   CDS_pept        114366..115172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0122"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /note="PFAM: Bacitracin resistance protein BacA; KEGG:
FT                   pai:PAE0576 undecaprenyl-diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87305"
FT                   /db_xref="GOA:A1RQS3"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RQS3"
FT                   /protein_id="ABL87305.1"
FT                   /translation="MDFLTAIVLGVVQGVSEWLPISSKTQVMFVSQLLLSATPELAYSL
FT                   GLFLEAASVLAALIYFRLVYLKILRGFLGDAEGRKWLTYVIVTTAATGAVGIPLYMAAK
FT                   RYLLLGASAGWLMVVLGVAVIFNAVLLQRARSVAGLKTFDDMTLGHMALVGLAQALSVL
FT                   PGISRSGITTTTLLLLGYRPDEAFKSSFVLVPIAGLGATALAYLSEGGAVATPEVITAM
FT                   LIGLVVSLVTIKALLEFAKSKHVTLVNIVVGTLAIAGGITRILLSS"
FT   gene            complement(115158..115823)
FT                   /locus_tag="Pisl_0123"
FT   CDS_pept        complement(115158..115823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0123"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   pai:PAE0573 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87306"
FT                   /db_xref="GOA:A1RQS4"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS4"
FT                   /protein_id="ABL87306.1"
FT                   /translation="MLAVFQAWAYGVILYLIYLLLIWLWKEKIDTVLVGLFFGTLTAAQ
FT                   FIANKLVDYGIGVAPAGTVIFMTNVAVLDAMAIFYGRQFAMRAVRLGFFFQAAVAFAAW
FT                   AAAQLPPPAWFAERAAVVDSVIAPSARIALASLAAYLISSTVDVYIVTKWPRLHILARV
FT                   YSSSLISQVVDTAVFISLAFGPEAQIILGQILVKWAQIPLEALLIYGVRRYVSTLRTK"
FT   gene            115878..116627
FT                   /locus_tag="Pisl_0124"
FT   CDS_pept        115878..116627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0124"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   pai:PAE0570 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87307"
FT                   /db_xref="GOA:A1RQS5"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS5"
FT                   /protein_id="ABL87307.1"
FT                   /translation="MDFLTAVRKTVELRLATEPPPPTRTTPLLDFTKALGDFGIIAEYK
FT                   RASPRGVVRLDLPPWAYFAELYSYASAFSVLTEPFWFLGDYRFIPIAKTFKPVLMKDFV
FT                   IDKRQIEMAYGYGADAVLIIYRLVDREKAMELAEYAQRLGLTPLVEVDNVQDAKEVATW
FT                   GGRVVIGINARDLRTLETNLIRAFEIAKSLRGDVDYIIESGISKPEEVEKACLLYARGV
FT                   LIGTALMKNPALAKELKTVAENCVARR"
FT   gene            116628..117581
FT                   /locus_tag="Pisl_0125"
FT   CDS_pept        116628..117581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0125"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: pai:PAE0568
FT                   cation efflux system protein, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87308"
FT                   /db_xref="GOA:A1RQS6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS6"
FT                   /protein_id="ABL87308.1"
FT                   /translation="MDKLKAALTSLIAGIAVTALKITAWLQSFSVAVLADAVHSAVDLL
FT                   AVAITYLAVKTSVKPPDEEHPYGHYKAETLGGIGGSLAVMASATFIAYEAFTRLVRWEP
FT                   YTPSLAGVVTMAIAIAVDFNRVVVLRKFRGVSRALEADALHFSTDLASSSAILALLIFG
FT                   VISEKYAPEVFTRWSPAIDIALATAITIYFIKLSLALLKSSIIELLDYAPPDVVIKTRQ
FT                   LVQRVAGVQAVKTVKVRKAGGVYHADVTIAVDENLTVKEAHEIADQVEKTLKEELGGDI
FT                   AVHVEPHKPSQRPEETPSAASRSPQEPSGPPSRSPR"
FT   sig_peptide     116628..116693
FT                   /locus_tag="Pisl_0125"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.406 at
FT                   residue 22"
FT   gene            complement(117496..117777)
FT                   /locus_tag="Pisl_0126"
FT   CDS_pept        complement(117496..117777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0126"
FT                   /product="HTH DNA binding domain protein"
FT                   /note="KEGG: pai:PAE0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87309"
FT                   /db_xref="GOA:A1RQS7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS7"
FT                   /protein_id="ABL87309.1"
FT                   /translation="MHRDKAIGLGLVVAGVVGIVLYGWLVFFSPWQLFILQLTAFAAVA
FT                   AVLGILAWVGYALATTPPPKPIEEIEKEVQKALEEIEKQLKESPQASG"
FT   gene            complement(117816..118796)
FT                   /locus_tag="Pisl_0127"
FT   CDS_pept        complement(117816..118796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0127"
FT                   /product="sodium/calcium exchanger membrane region"
FT                   /note="PFAM: sodium/calcium exchanger membrane region;
FT                   KEGG: pai:PAE0566 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87310"
FT                   /db_xref="GOA:A1RQS8"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS8"
FT                   /protein_id="ABL87310.1"
FT                   /translation="MAEVSLVPSIGPFGVVVGILLTILAGVLIEQLVHYISWRYRRAAV
FT                   GVAAIFAPIITSSPELAVFTVALLRGQIEIAWGSIVAQPFMAATVIYPVVILTSITAWA
FT                   LGRRRYKLPHVHRIVAVPLLVFTIPLLPILFLHPERYGVFGQLYGVFLLVLYFLYAKFM
FT                   LREEEVEKAGVSLWLRNPAVQTAAALLAMAFGAEWLVGGIKDLGAAAGLDKLALSIILV
FT                   PIATVIPESIVGLIFIAKGKDDEGVSVIVGEKALYSTFYPGLAMALGVYTLEEAAATAL
FT                   ILAVLVSIFEVVAIWFGYFGLTAPIGLAGYLYYVLCYTLHQSCPL"
FT   gene            complement(118830..118901)
FT                   /locus_tag="Pisl_R0004"
FT                   /note="tRNA-Ala2"
FT   tRNA            complement(118830..118901)
FT                   /locus_tag="Pisl_R0004"
FT                   /product="tRNA-Ala"
FT   gene            119032..120018
FT                   /locus_tag="Pisl_0128"
FT   CDS_pept        119032..120018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0128"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   pai:PAE0564 putative zinc / manganese transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87311"
FT                   /db_xref="GOA:A1RQS9"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQS9"
FT                   /protein_id="ABL87311.1"
FT                   /translation="MATKTLYLAAALLAIAAAAQTTPKIVVSFPAYNVVLSEAFPNADV
FT                   ILITKGASDPHEYQLTAEDLQMLASLTPRDVVVLSMHAPFEQKIAEMARDSQIKAKVID
FT                   LTKIQQYLTYDNGAVNPHDHGIYPPNVLKLVAAVANATGLKPDPTFLQKLRELNSTYCC
FT                   RFSGKAVALTPAAQYILHWLGYRDIAVLIKEPGVPPTPQDLQKALQYAKEGAPVLAAVV
FT                   RGEALRIVDQFRQKAQEAGVNPHIITADFSKNYIQTLEATVRQIAAVAQMSSAAETTAK
FT                   QATQQNTAATQTTHPAAGPELTIPIAVAATAIVLFAAALLLLRRKKQ"
FT   sig_peptide     119032..119091
FT                   /locus_tag="Pisl_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.904 at
FT                   residue 20"
FT   gene            complement(120025..120384)
FT                   /locus_tag="Pisl_0129"
FT   CDS_pept        complement(120025..120384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0129"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: Archaeal PaREP1; KEGG: pai:PAE0489 paREP1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87312"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT0"
FT                   /protein_id="ABL87312.1"
FT                   /translation="MPNTSNCEIYCGVCRVLERSLPKSTNEDYATARLLETLVEARPAL
FT                   DFLRRGLVRNAAGKAFQVWKAYIAAVINIERRALAEGRVPPGPMPNDPTPEVSWIPMTA
FT                   WARRKSLGVGTGGRR"
FT   gene            120607..120942
FT                   /locus_tag="Pisl_0130"
FT   CDS_pept        120607..120942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dvu:DVU0595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87313"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT1"
FT                   /protein_id="ABL87313.1"
FT                   /translation="MYKLLLHVDSDDPAPMSIALSNAENFLAAVGQGEVALVANGPGVR
FT                   HFVKGSQFGSRIASLARRGVKFYVCNNALRNLGIDPTSLVAEAEVVPAGIVKIVELVQQ
FT                   GYIYVKP"
FT   gene            complement(120939..122492)
FT                   /locus_tag="Pisl_0131"
FT   CDS_pept        complement(120939..122492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0131"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG: pai:PAE2028
FT                   N-methylhydantoinase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87314"
FT                   /db_xref="GOA:A1RQT2"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT2"
FT                   /protein_id="ABL87314.1"
FT                   /translation="MRWEIIYKATEYIAEEAGIALRNSAFSPNIRERMDHSVAVVDAEG
FT                   RIVAQAEHIPVHLGSFHIGIINLLKALEGEGLEEGDAVLTNDPYIAGTHLNDVLVLYPV
FT                   YWRERLVAYIASKAHYVDVGGPLPASLNPRAKTIYEEGVVIPPVKILKRGQLNREALSF
FT                   ILENFKTPEVAKGDLEAQLAASRVGAARVRELFERYGEKVLDAWREAVEYGRRLTLGEI
FT                   SKWPRGRFDAVDYLDWRGELLPMRVTLEVGDGGVRTDFTGTARQVDAPINAVFGVTYSA
FT                   VSFAVRAALAADVPTNHGFYSVIKVEAPLGTIVNPVKPAAVGAGNLETSQRVADAVFMA
FT                   LSKALPGRIPAAGSGTMMNVMIGGVWRGRYWSYYETIGGGTGGRPNSPGVSGVHVNMTN
FT                   TLNTPIEIAERTYPIKFTAYRIREGSGGSGRYRGGDGIVRAFKTLAPATLSIIASRFDT
FT                   RPWGLEGGCPGKPARVVVKRRRGGEVAIRSDTVELDEGDEVIIETPGGGGYGSAGQLCD
FT                   "
FT   gene            complement(122489..124432)
FT                   /locus_tag="Pisl_0132"
FT   CDS_pept        complement(122489..124432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0132"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: pai:PAE2030
FT                   N-methylhydantoinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87315"
FT                   /db_xref="GOA:A1RQT3"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT3"
FT                   /protein_id="ABL87315.1"
FT                   /translation="MKIVAVDVGGTFTDFVAVDERGDIITLKILSTPREPEKAVIMGLS
FT                   QMGFNEVLHASTIGTNALLGQVGLELPKVALFTTRGFRDVIEIGRQNRPRLYDLYFAKP
FT                   RQLVPRELRFEVDERTLADGTIEKAVNPAEVETLAARAKAMGAVSAAVAFLHSYVNPSN
FT                   EKAAKEVLQRWFSYVTASYEVAHEPREYERFSTAVVNAALMPLVSRYLSRLREFVEGRG
FT                   GALYVMSSSGGLVTVEEAARRPVQLVESGPAAGVVAAAELAKLAGEARVISFDMGGTTA
FT                   KAGTVVDFQPSITTEYEVGGESHRGRLVKGSGYPVRFPFVDLAEVSAGGGTIIWRDAGG
FT                   ALRVGPISAGADPGPVSYGRGGTQPTVTDANLALGRIPEVLAGGALKLNTKAAVEALGK
FT                   LGDPVDVAADAIKLVNVEMARAIRLVTVERGLNPEDFVLMAFGGAGPQHAAELAEEVGI
FT                   SRVVVPPLPGVFTSLGMLMADFRFEARMAYPRDLEGGFRRLEEELARYSPDYYVRYADV
FT                   RYVGQGWELTIPLGQDLTPEAVRRAFEEKHKATYGFVLDKPIEVVTIRVFAIVKRQKPK
FT                   LPQPPERGSPAPWEKEAYFDGWTKAAVYNRAELPLGYRVRGPALIVEDYSTTVVPPRWE
FT                   AEVKRYGLELRL"
FT   gene            complement(124429..125214)
FT                   /locus_tag="Pisl_0133"
FT   CDS_pept        complement(124429..125214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0133"
FT                   /product="permease (major facilitator superfamily)"
FT                   /note="KEGG: tvo:TVN0810 permease (major facilitator
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87316"
FT                   /db_xref="GOA:A1RQT4"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT4"
FT                   /protein_id="ABL87316.1"
FT                   /translation="MPLGLLLAAGVMLILTYVLGDAAVSAWGWRVAFLLSLVLVVIGLF
FT                   FRFKFGETLEYIEARKTVMQIENPVAAVFTKYWKELLVGILLAGAAGAVFYYGNTFLPN
FT                   IASALKLVDAPTRFLAIVLFAVFDLLGIIASGFVAEKVGNVVPITLGIILFIIGALLIN
FT                   QALSNVPMFFAVAILTGLAHGIVYTPEAAFLAELFPTLVRTTDVSSAYQIGNTVFAGTA
FT                   PYVMTVIMGVDRLLAGVYLAILATLGLVGVLTYALRVKK"
FT   sig_peptide     complement(125152..125214)
FT                   /locus_tag="Pisl_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.685 at
FT                   residue 21"
FT   gene            125938..127149
FT                   /locus_tag="Pisl_0134"
FT   CDS_pept        125938..127149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0134"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase, IS605 OrfB; KEGG: pab:PAB2077 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87317"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT5"
FT                   /protein_id="ABL87317.1"
FT                   /translation="MYVVTHTVAVPSPRLSWRKFNTLKELVEKYRELVVHLVDYGFKHG
FT                   VTGQISLRKALYEELRRRHPDLPSHYVYTAAQDAAARVKSFMALKREGKAKTEKPEIRR
FT                   ISIWLDDHLWIREGFTAVRVSTHRGWVTIPLWPTRQFWRHINEGWRLKTQPRLKLDEKR
FT                   RIAYVYFVFEKVVEEKPAKGVVSVDLNENNVAVKAGGRVYILETGIRDITLGYNSRREV
FT                   MQSLKGNRYVSRALKKNELNKKNDIRRKVANFVVREAERLGAAIAVENLPREVPKNMIK
FT                   NVDDPKLRDRIYKAGFRSMLREIIQKAREHGIPVIKVDPRGTSSTCPRCGGRLVRGPAP
FT                   RLLLCPHCGWEGGRDVAAVINIERRALEEGRVPPGPMPNDPTPEVSWIPMTAWARRKSL
FT                   GAIA"
FT   gene            complement(127132..127497)
FT                   /locus_tag="Pisl_0135"
FT   CDS_pept        complement(127132..127497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1162 major facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87318"
FT                   /db_xref="GOA:A1RQT6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT6"
FT                   /protein_id="ABL87318.1"
FT                   /translation="MASRSIGPGLIIGVASGTVLEWYDAFLFAVAATYVGAAFFPSKDP
FT                   IVQLANVFLTFALGFFARPLGALFFGWVGDRFGRRTAIFWTLLTAGLATALIGLVPSYK
FT                   EWGVAVANTALSLGYCA"
FT   gene            127810..129072
FT                   /locus_tag="Pisl_0136"
FT   CDS_pept        127810..129072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87319"
FT                   /db_xref="GOA:A1RQT7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT7"
FT                   /protein_id="ABL87319.1"
FT                   /translation="MERAVKSAAWITAATVVTTVSGLVFWSLAARLGGRAGLGAAAYEV
FT                   AAANVASALLNIGLQSYTLRFVSDRGGSALATAYTAAALLSLAGGAALAALGFDWAPLL
FT                   LASSLFFAASAGALIASGFSAGYFYSALTGAVLKLALPFFAAPLFAFTVASIASAAVAG
FT                   VYAARRVGLSKPGGWGDFLAAGLSNYAVNFSVSFAVSLGVVIAGALGNTGQAGVLYLLA
FT                   MAVLAASSVAGALAQASVPVMVEGGTSLAERGVRIAVGINVPLAIAAAGASYVLMSLLG
FT                   REYVEDAPSLAAAMPAVVELSAISMASAIYNVEKRWLDLAILGVVGSASVAVSSALLPP
FT                   GVALAVGFIPPFLISLRAVPQAPLLIGLGLTVVFTPVAYISGVLGGLLAAAGAASVLHV
FT                   LGVFNVKDYIRLAKIVLSRSP"
FT   gene            129069..130172
FT                   /locus_tag="Pisl_0137"
FT   CDS_pept        129069..130172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0137"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87320"
FT                   /db_xref="GOA:A1RQT8"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT8"
FT                   /protein_id="ABL87320.1"
FT                   /translation="MIFFALLGGLAAGGRWGAAYGVLATYILYVLYGLSPPLGVVGALV
FT                   VIAAARGLRLDKLTLYALATAFGKFLLLPHLASRPIPYYEALWYAAQVSPEWRTYAPLT
FT                   YLPHMPPLELALEGTLFVVGAAALASRALAEVWGRGAVFWPLLAPEPLVFGHFAMAMPL
FT                   AWIAAYFARLRRWEWALVSVAFAAGFHIYGGAVALLFVALYGTPWVLLLAPLALLTPQS
FT                   WVLISLLWRIPGTDLLSVLEKVAFRAEWFWYIKLAVELAVVLAAAVSAGRAGVVALVGI
FT                   LGALLTARAPQEYAGFVYRHFAVVLPFSRPRPLWAFALLAFVPYLMQVYFFGLDWGWAV
FT                   RYAQSFACGCPVEGPVESAYRLIYLKD"
FT   sig_peptide     129069..129134
FT                   /locus_tag="Pisl_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.472 at
FT                   residue 22"
FT   gene            130187..131356
FT                   /locus_tag="Pisl_0138"
FT   CDS_pept        130187..131356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0138"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE0437 glycosyltransferase (type 2)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87321"
FT                   /db_xref="GOA:A1RQT9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQT9"
FT                   /protein_id="ABL87321.1"
FT                   /translation="MCITVVLPVLNEAEALPKVVEELRAAGFNNILVVDGGSTDGSVEV
FT                   AKRLGVRVISQMGRGKGMAVRTALMYVDTPYVAFLDADYTYPAEDLKKLLPLLRHYDVV
FT                   LGARRGEMPLIYRLGNKALGWLFRLLFGVDIRDPLTGMYAARTEVLRDAALEARGFDLE
FT                   VDLLAKALANGARVAEVEIGYRRRVGKKKLKPWHGLSIALKSLSLAYRLNPTLSLSLLG
FT                   SFLLVPGVALGSWVAYRFFYQGVPHYMLGLFSLILIMLGALSIALLPLATAVLRLQAAV
FT                   RRRDLRLPTDCLPPLPEPTPLATPALAKSEGGETETPLLHVGRGLVLSFMALLATAAYY
FT                   LGVGDTTTANKLAEWAYYALAGAVVALLIDAAVVSRREQRESQTLGSHG"
FT   gene            complement(131307..131834)
FT                   /locus_tag="Pisl_0139"
FT   CDS_pept        complement(131307..131834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87322"
FT                   /db_xref="GOA:A1RQU0"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU0"
FT                   /protein_id="ABL87322.1"
FT                   /translation="MRGHLITAVTAVAFTATALIVVLAPPIDLLERLRAGIYTAYFPWG
FT                   FVAADGSHAYGVVHGYKFAVNLWRVVVCDPGGRCTSQEINAISLYLKLKAEGRLNIEDL
FT                   GGGCYRVVLRPTQLASRTLAFEGKLCLAPDGSPREVSGVLQIDGRPLDISGSPQRVIHD
FT                   FPMSDFLAVHGG"
FT   sig_peptide     complement(131763..131834)
FT                   /locus_tag="Pisl_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.604 at
FT                   residue 24"
FT   gene            131845..133104
FT                   /locus_tag="Pisl_0140"
FT   CDS_pept        131845..133104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87323"
FT                   /db_xref="GOA:A1RQU1"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU1"
FT                   /protein_id="ABL87323.1"
FT                   /translation="MLLLYIPYLYFYLQQLWLNASWLPRGDDYPIHVYFALLLRSELVS
FT                   LFTSPGEYPGIPHLLGLLWGDPLALGRAFAVYAAALAVLGVALYGLYFRAVGIPAPFLA
FT                   SFYLVTASVRTLAGLIDGQIADKTVLLVFVPLSLYLYARGRPAAAVAALAPSIFTNYLG
FT                   VAYGGLLLVMYAIYGGRRARLALMIYIALVAVFLWHKALSVLELAGQAASVPPMPWDPA
FT                   WGLVYAFYGPSPAILIPLAILGLRKRAVAPLAIASLLLLVIGAASSAYGERLYRIAALL
FT                   LPASAVASGWAGLAVAAYSALPAAGGWAWALGAVPGLYQLVDRITPSQLDAYHAVLETL
FT                   PSNSTVEVQWSLDPWLLPLAYAYRPDIKVYLTACRWTQADFYVYTPPDPRQWYMPCIRE
FT                   VGPPPGVKIASWGNTTLYKR"
FT   gene            133101..134225
FT                   /locus_tag="Pisl_0141"
FT   CDS_pept        133101..134225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0141"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pai:PAE0431 glycosyltransferase (type 1)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87324"
FT                   /db_xref="GOA:A1RQU2"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU2"
FT                   /protein_id="ABL87324.1"
FT                   /translation="MKVAIFSESLWPLGEGGAELATYLYARLLTKLGVKIRVYVRRGGA
FT                   RWEGLEVVELGGAGTRKFHAPPLGARRALEWCDVAYFASAYWELVPLAKRMGKRTVVHI
FT                   HSYDPACPVGTLFNTPAGSVCRPEMRRCWGCIYLQERSLGRPFWRAVASQVLNGLSSPL
FT                   FTKAVRSTDALVFVSEAQRRLFAEHFGDMPKSHVVYNPAPPLPHLPPGGRAVGYFGGLS
FT                   PWKGVYVLLRAWARLGGRARLYMTRASALRNRPPGVVVLGDLTPGELEEVHKAVSVVAV
FT                   PSLWWEPFGYAALEGLVRGRIVVASDVGGLPEVVGGAPGARLVPPGDVEALAEALEWAL
FT                   GVDVAELGVRNREYALRKFDGVRLAERLLKVLEG"
FT   gene            complement(134185..135570)
FT                   /locus_tag="Pisl_0142"
FT   CDS_pept        complement(134185..135570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0142"
FT                   /product="glutamate synthase (NADPH) GltB2 subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; ferredoxin-dependent glutamate synthase;
FT                   KEGG: mka:MK0550 glutamate synthase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87325"
FT                   /db_xref="GOA:A1RQU3"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU3"
FT                   /protein_id="ABL87325.1"
FT                   /translation="MLLLAKLILRLRGLYFGIRGFREFFKDYPVDEIAYRALRGKEAVY
FT                   PFGLLASYGSAVLGAGVHRRGCPRFYTLDDILLMPPAFTPLRLKKAAELLREPTFADVN
FT                   TETLVGGFPASMPVVVGSMGSTDVASKTAIAIAKAAAKAGIPLGIGENVATVRGYSRRI
FT                   TRGHPSFKERLLAYLTNMGKHGGVFIQESVEDAYDELWNRVYSDKDLEQYVEEGRIGFE
FT                   IKVGQGAKPGLGGVIKIPKEQAEKLRRKYLIDYDGGKYATRYSVPGTFTREILTGAIRF
FT                   MKTAYPKAKIWIKLGPFRDAAEVIEVASREGADAVVIDGKEGGTGMAPTVALKDLGYPT
FT                   VVGLKYIKAAREAGVKTSLLIAGRLYNGGHVVKAVALGATAVYMARPFLIAALTKGEEG
FT                   VSKYIESLKLEIQMAVSALGKYDVRDLAPEDVAAATKELAEMLSIPYIYASPPKPLEAV
FT                   QQA"
FT   gene            complement(135701..136363)
FT                   /locus_tag="Pisl_0143"
FT   CDS_pept        complement(135701..136363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0143"
FT                   /product="glutamine amidotransferase-like protein"
FT                   /note="KEGG: pai:PAE3441 conserved hypothetical protein
FT                   part 1, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87326"
FT                   /db_xref="GOA:A1RQU4"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU4"
FT                   /protein_id="ABL87326.1"
FT                   /translation="MCRILFSLGKPPRDILLDFVQVSRRDRTMGWSHGSGWGALWTRPG
FT                   SYGLYKSIRPIWEDYVEPPDGYILYILHSRLASVGEPTLENTHPIVRGRYAIAHNGTID
FT                   RERYKAALREEGVEVGELDGSTDSELLLKAIIALGGDETAVRKAAKLAKPYLDPQEPVL
FT                   NFVFVDLAGLAIFYTYRGSEHPHFVPVEKDGIIASEPLGQREGWKPLENGKTVVVKF"
FT   gene            complement(136363..137658)
FT                   /locus_tag="Pisl_0144"
FT   CDS_pept        complement(136363..137658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0144"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region;
FT                   glutamine synthetase, beta-Grasp; KEGG: pai:PAE2556
FT                   glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87327"
FT                   /db_xref="GOA:A1RQU5"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU5"
FT                   /protein_id="ABL87327.1"
FT                   /translation="MQVEGLDIWRVLKGAGVKYIYFVIVDIYGRPRVDIMPIDMARDAF
FT                   IDGVPYDGSSIPAYSTVNRSDFVAVVDPSAVYVESWNGGKAAYVFTNTLDGNAPSPLDP
FT                   RNVLKQALERAEKRGYQFKIGVEIEYFIVRGNPPELPERAGYFDVPPGATRKVVEEIME
FT                   NFAAAGLGETKTHHEVAPSQFEVNIPYGNPLKVADSILVFKIMAKAIAAKYGYIATFMP
FT                   KPFWGMNGSGAHTHISVWKDGKNLMASVKEPTQELKWVVGGILNNAISISAIVAPTVNS
FT                   YKRLVPHHEAPTRVVWGLGNRSAMVRVPYYGGKINRIEYRHPDPSMNPYLAFAAMVLAG
FT                   LEGLENKIEPPPPVQEVAYDLQGVRETPPNLGAALKYMEEGKIARELPSEIVKAYLGVK
FT                   QAEWQSYVQQYQWEKTWNTITPWEYEQYLTTV"
FT   gene            complement(137811..138698)
FT                   /locus_tag="Pisl_0145"
FT   CDS_pept        complement(137811..138698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0145"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: pai:PAE3527 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87328"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU6"
FT                   /protein_id="ABL87328.1"
FT                   /translation="MWEVVAIAFFIFLLLSQDGVFVGLRWGFPVFLPLDRHVVILGPTR
FT                   SGKSRLAKKIVKRSGLPALILDWVGEYDVGLRVDARLLKYDFRNFDKKLLTEIIGLSLN
FT                   LNEPSIYFLYRAIRNAEIRKIGDVLEALESFLVTSRAEVEMRAAIARRLEYIVEVLERG
FT                   KIPLDLLLKLKRTVVIDLSKLRLYEEKVMISLFVLALLYDRMQREGVSHRPRKLLIVDE
FT                   AQNVLKRGEVVRHLVFESAKFGLRVILVTNEVPPDDVLIHSYIVITKPHVMYKFQLKKS
FT                   AVVIDNRVIELKIV"
FT   gene            complement(139629..141032)
FT                   /locus_tag="Pisl_0146"
FT   CDS_pept        complement(139629..141032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0146"
FT                   /product="CRISPR-associated protein, MJ1666 family"
FT                   /note="TIGRFAM: CRISPR-associated protein, MJ1666 family;
FT                   CRISPR-associated protein DxTHG motif; KEGG: pai:PAE0117
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87329"
FT                   /db_xref="InterPro:IPR013383"
FT                   /db_xref="InterPro:IPR019016"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU7"
FT                   /protein_id="ABL87329.1"
FT                   /translation="MRVFVVSVWGYPPAWKRARYVAEELGGRAFGGRSARFVGCTSAGS
FT                   LLKYLTGLDVDLLVVGSDSVVNPREGGDLRRRAVEQYMKWAEELGVKARVISVPGMGLY
FT                   YGWKFEGTPEAIFVDVFKAVWEGAEGASFIFLDLTHGLNFVIVSALYAVVAAAIGRGME
FT                   NRLVLVNSEPYPADVEEKTCISSVRPPRVETTPELKILDVSGLQTVLQRVREVSALRNL
FT                   TAVGKARCTRFGRMIWLMSNGAAALGFPGAIYDGWEPTFGLPEQPPRLMESRPVLENHV
FT                   VRYEHQRAEVVVDVVMYQVWKELGHIFSGEAAASLVDYLAAVAREYERRGAIYISEVLK
FT                   TATQEVALLQKVVATMYGLDAVVWPELWLAVWRHKEEVLKHLEDKSYVDVLSESLAEAK
FT                   KEVEEERRRLAERGVDQRTARNFLAHGGLSPAFIKRLELKNGKIARVVYDGGLVEKLVK
FT                   YLEGRVPAC"
FT   gene            complement(141537..141812)
FT                   /locus_tag="Pisl_0147"
FT   CDS_pept        complement(141537..141812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0147"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE1827
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87330"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU8"
FT                   /protein_id="ABL87330.1"
FT                   /translation="MGEEKVPRRRDRRRGHSVSLRQSLDTPLDGLGQLRKRLKELSQWY
FT                   GIPYLEERLYSIVRPRRGAKMAEEKGRFMRCPSCGFRAHRDNVSVI"
FT   gene            complement(142400..143323)
FT                   /locus_tag="Pisl_0148"
FT   CDS_pept        complement(142400..143323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afu:AF0701 A. fulgidus predicted coding region
FT                   AF0701"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87331"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQU9"
FT                   /protein_id="ABL87331.1"
FT                   /translation="MISVVFTPQRTEYVGYFVELAEQYDVVIAEVPNVEGVGKFLRGEI
FT                   DLDSLFYEIEYFDPIYTREFYNSLRRLESRGVQVIPSDPYGTIAMKIRMAALMGRLDVN
FT                   DPTEKYIAYIESALGNVFKNYNAALLRKDFENIVVYTAKYARLDASRIKFRSELRAREI
FT                   ARVLKYASGDVLIHSDWYHETIAEYLAKKLGCRVNVVHLHKAVGRKLSVDIPKPPGLAL
FT                   TLAHLKEARLKPEEEKALAAATTLYVLLRPRVVGPLVIRGRYDRAILADAALAKFTYRL
FT                   SYIEAKKIYQKIFMQDLFKIRFTRYI"
FT   gene            144165..144596
FT                   /locus_tag="Pisl_0149"
FT   CDS_pept        144165..144596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0149"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87332"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV0"
FT                   /protein_id="ABL87332.1"
FT                   /translation="MEFKPVYYMVLESLARGAKSVDELADELGLEPHDVEAVLNTLMVA
FT                   GFVEKGERGLLLKRVVYSLTPQGWKTLAEWRQRAKAELEKAAELRKAGREEEAEQILQL
FT                   YEPAIPLMFAAGILDTALLTALALEELEAADGWDQDVAF"
FT   gene            complement(144693..145775)
FT                   /locus_tag="Pisl_0150"
FT   CDS_pept        complement(144693..145775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0150"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; KEGG: pai:PAE2540 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87333"
FT                   /db_xref="GOA:A1RQV1"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV1"
FT                   /protein_id="ABL87333.1"
FT                   /translation="MLFKEGPVERPDELFDREAELEELRRALRERRVVALLGVRRVGKT
FT                   SLAKATTWDLPRVYVDVREFEWRTYVTWDDFYGVLKSALPRSRRLLEALSRISGVSVAG
FT                   LEISFAVGKRRPPPAELLKALDKWAESEGVRVVFVIDEAQELYKLKGGSFTPVLAWAYD
FT                   NLSNVVFLLTGSKVGLIHRLLRPDDPPSPMYGRYIYTIQVRPLPRDRAKEFLTKGLEEA
FT                   GVRYTKEALETAVDKLDGVIGWLAYLGLEAVRAGRLTESLIAEVLEKAARLAWGEFCRF
FT                   VQLRQSRRYIYIMQAAAEGATWSEIKRYLEIKEGPVYDAELSRLLKTLVEEGWLEKEDD
FT                   VYKPADPLLRHAAKTAVSCQ"
FT   gene            complement(146045..146401)
FT                   /locus_tag="Pisl_0151"
FT   CDS_pept        complement(146045..146401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87334"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV2"
FT                   /protein_id="ABL87334.1"
FT                   /translation="MDWLKNGFVLWRFYRERRQRRGGYRRYEQGLGVATAAYDAGEVGK
FT                   LLATALAAKVMAMPPNAALRRCSAPPRRAKTRWRRVDSTQRSPQTAAVVNTSAGAAYVA
FT                   VSASARGGGGFRWL"
FT   gene            complement(146625..147155)
FT                   /locus_tag="Pisl_0152"
FT   CDS_pept        complement(146625..147155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87335"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV3"
FT                   /protein_id="ABL87335.1"
FT                   /translation="MFILRFLTRLMPHYSGDKLQVLDKAGADGFAVYGVLLRYLAKTRG
FT                   VVHKRELEEVEKPLLKKFGVLPAMAYNDLRRLGVISVGRSGDWDSETPATLTQLGAFAV
FT                   RCVWIEDNVKLGAILPIFCRVKNWPLDPGEAGYCIKLYNQQDAWLVEAIKLARPYILPC
FT                   LPYGAETKALTGL"
FT   gene            complement(147206..148096)
FT                   /locus_tag="Pisl_0153"
FT   CDS_pept        complement(147206..148096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0153"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   ape:APE2156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87336"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV4"
FT                   /protein_id="ABL87336.1"
FT                   /translation="MKIVRVLEGVYKIDLEPGGFSNLVSVYVVDAGRNLAVFEGGPACS
FT                   KADLVTAVKTLGKPPSHIFLTHVHIDHYGGSGALAELNPEALFYVHPRGAKVLPNPDII
FT                   WVPAREAMGWLGELYGRPLEVPSRNAKITEDGEIVNIGDIEVEVVHTPGHASHHQSFII
FT                   KPWDILVVGDAAGIYVKSLDYIIPTTMEPLRLDMYIESVKKLISKRPRYVAYTHHDLLD
FT                   NAVDLLNRHLSQLETWSRSAEEAAREKLTPAELESILAERDQDLRRVYPELKKLKAHYH
FT                   LFQMAVQGILKYYSS"
FT   gene            complement(148154..149079)
FT                   /pseudo
FT                   /locus_tag="Pisl_0154"
FT   gene            complement(149061..149456)
FT                   /locus_tag="Pisl_0155"
FT   CDS_pept        complement(149061..149456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0155"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pai:PAE2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87337"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV5"
FT                   /protein_id="ABL87337.1"
FT                   /translation="MPFEVRFYIYWSQTDAAGIVHFSEFFSLVEHAEEEFYRARGVLEI
FT                   HSRMPRVEAYAVFKSPLRRGDVARVVLKPLEIREKAVKYGFEIYNETTGALSATGHIVA
FT                   VCVENEGGRLKSTRCPQELVDVWRSIE"
FT   gene            149600..150184
FT                   /locus_tag="Pisl_0156"
FT   CDS_pept        149600..150184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87338"
FT                   /db_xref="GOA:A1RQV6"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV6"
FT                   /protein_id="ABL87338.1"
FT                   /translation="MSRPMSLMPKVVKRSSAEEEYIEGKVYNSLLKAGATDEVTKEIVK
FT                   ELGEWVKKRRKVFSDEIRRSVLTRLRKLEPEAADAWEFYDRVFKGGVTFDNGKVVVVEK
FT                   GRLYLGRKIKDVGGKGLSNAEEVREILDELREDMDYGLSPKVINARLYALFMGVLHKKD
FT                   MPKEEKEKAIELINEFRKQLGWKPYELKKPL"
FT   gene            complement(150498..150851)
FT                   /locus_tag="Pisl_0157"
FT   CDS_pept        complement(150498..150851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0157"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sto:ST1560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87339"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV7"
FT                   /protein_id="ABL87339.1"
FT                   /translation="MSCHPCSGARRLGRRRHDPALGCSKRLQAGPEPPGKAGSRKGGFM
FT                   PTGYMLAVAKVLEDAARMRLYDLTNVSINLYKFQYNGLDKSGFGGYPHIDLVVDDIERL
FT                   VEAVFSYLRQLES"
FT   gene            complement(150964..151200)
FT                   /locus_tag="Pisl_0158"
FT   CDS_pept        complement(150964..151200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0158"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE1827
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87340"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV8"
FT                   /protein_id="ABL87340.1"
FT                   /translation="MVELAKPWQNAESNGEKKRLYDGLGQLRRRLQALAQWYGLPYLEE
FT                   RLYSTVCPKCGAKMAEEKNRVMKCACGFSDHRD"
FT   gene            complement(151237..151905)
FT                   /locus_tag="Pisl_0159"
FT   CDS_pept        complement(151237..151905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0159"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; KEGG:
FT                   pai:PAE0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87341"
FT                   /db_xref="InterPro:IPR019267"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQV9"
FT                   /protein_id="ABL87341.1"
FT                   /translation="MYNFFLTALRRVAEPKGRVFAHPLYHGGAPVLSGLNGSQKAFEPG
FT                   AAFELRALLLEHDARLLLDSLAAEPRVEVGCVLEVSGIDIVPADGKLEERHGMAVVELV
FT                   FYPTVFMFHGRDVLYPSPQRLAYSLAKTYYQLYGVSLKELADRAPTALELVGMRIKTGW
FT                   LNIGEARKVPVFYGRARLAIYGDVGMWLSLLKLGELTGVGISRAIGLGKYRIEKVEILI
FT                   "
FT   gene            complement(152357..153133)
FT                   /locus_tag="Pisl_0160"
FT   CDS_pept        complement(152357..153133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0160"
FT                   /product="formate dehydrogenase, cytochrome b556 subunit
FT                   (formate dehydrogenase gamma subunit)"
FT                   /note="KEGG: pai:PAE2660 formate dehydrogenase, cytochrome
FT                   b556 subunit (formate dehydrogenase gamma subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87342"
FT                   /db_xref="GOA:A1RQW0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW0"
FT                   /protein_id="ABL87342.1"
FT                   /translation="MASGEGRREKIIEKFLNFYLVLYMDRVEVVSIGYRVAHQWNLLLF
FT                   TVLAITGGALFAIEVLAPLVYAVGAPLAAAVGTDAVTAGVQLFRIAHRFLGHIWGALLL
FT                   VYAVNLLLFKKVRIFDAFRKPLGQQIREAKALAGHYLFGKPLPEDVKASMERHNVFVAY
FT                   MALVLIASVVLLSISGVALVYRDALGLSLAEARLMLLLHDVGFALGLLFVALHIFAVLH
FT                   PTNRPLLNAMFSDGTIPLDWAKTHMPNYLRRRGIAV"
FT   gene            complement(153100..153762)
FT                   /locus_tag="Pisl_0161"
FT   CDS_pept        complement(153100..153762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0161"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE2860 molybdopterin oxidoreductase,
FT                   iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87343"
FT                   /db_xref="GOA:A1RQW1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW1"
FT                   /protein_id="ABL87343.1"
FT                   /translation="MTRLVLLWDRSRCVACGACVAACNAANYNSSGEMNKVWGWLKSDI
FT                   KMVEVKSGPKPTLYLVYCQHCDKPYCVATCPTNALYKDRDGLVKLRESSCIGCRYCLAA
FT                   CPYGAVWWDEKNNKPAKCMGSECLRRVSEGLRPVCVEVCPSGALVFGDIESPSSEVSQK
FT                   FTKGEYIKPPEDEGTKAVIETRSTLKSLTTAGGAALAGVLAVLGFVAWRRARVEEKK"
FT   sig_peptide     complement(153685..153762)
FT                   /locus_tag="Pisl_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.936) with cleavage site probability 0.832 at
FT                   residue 26"
FT   gene            complement(153759..156176)
FT                   /locus_tag="Pisl_0162"
FT   CDS_pept        complement(153759..156176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0162"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: pai:PAE2859 molybdopterin
FT                   oxidoreductase, molybdopterin binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87344"
FT                   /db_xref="GOA:A1RQW2"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW2"
FT                   /protein_id="ABL87344.1"
FT                   /translation="MSTNRRDFIKLSATTLITTSTLGVFTYGSIHETTSSLTFEKVVPV
FT                   MCGACGAGCGLLYIERGGRRYLLPNSGHPSPGLCARAASALQMWNHPLRLKRPLKRVES
FT                   GFVEVDWDTALNEIAAKLKDIVSKYGPESVVITRHDVHSWFLPLFAALIGTPNLIGHEG
FT                   TCHSASTAARRAVLGASGPPTVDPDYGNVKYLVLLGRVLDAAMGHVRSLAKARERGAKI
FT                   VVIDPRAPNIAFGAVEWVPIIPGTDAVFLASMAYVIISKKLYDVEFLKFYTNAPMLIKP
FT                   DGKPLGGKEIGVEADYVVWDNATQALAPLGKAKDPALELTDEVRQRLGGAKTVFELFRE
FT                   RVSKYPPEKASEITGVSAEIITKIAEEFAKNKGVIEDGWYTSRNGNEFDTYRLVLILNA
FT                   LVGNIDKQGGLCFQESAKYPNVCDPVGPDIVTVTGMKIPRPTAKRIDTSKYPLAVSTFN
FT                   AVYDAILAGENIKALFIVGTAPLQRDTNYQRAVEALKKLELVVAIDIFPHDHVDYAHYI
FT                   LPDLMFLEREEVAVVKWTLHAAIQMSHKALDPPPGVDARHAPWILMEIVRRAFPERAKL
FT                   VGYDERYADPHAFEEWERQLVEAALKKVADAFKMPLDEIKRQLEEKGFVVLKRKEYGVR
FT                   PYKTKLGTPTGLVEIYSLTALKYGLDPLPDYRPPLYTPPKAPNEFYLVNGKDQVVSAHF
FT                   AFTPNARFLADRSVWMNPKDAERLGIRDGDVVELEGIDTGFKAVARVKVTNRVREGVLF
FT                   TYSFIGGRRSGFINGDFAWLREGVNPQWFATGKIEPVVGSAPTNATVRVRRL"
FT   sig_peptide     complement(156096..156176)
FT                   /locus_tag="Pisl_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.718 at
FT                   residue 27"
FT   gene            156347..156874
FT                   /locus_tag="Pisl_0163"
FT   CDS_pept        156347..156874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87345"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW3"
FT                   /protein_id="ABL87345.1"
FT                   /translation="MLGLIRYFWQDLMPPLPDGWRPVLKRYVERWPKPLTPYAVAKEVE
FT                   LSTSAVYRAVYALAKNRLILPAGRGYQATVKGAIALLVEEEDPRWLDAVRKIWGIGIDD
FT                   TTATFYLAALGAAIRKLGFTIREAYICNWVASQAYIITQLDRLRLPSAVEETIKPLLKF
FT                   PEGTHHSCSRYK"
FT   gene            156891..157457
FT                   /locus_tag="Pisl_0164"
FT   CDS_pept        156891..157457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87346"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW4"
FT                   /protein_id="ABL87346.1"
FT                   /translation="MSRSTVPVEGDVAREVASLAKSHGFSVVRLATDSLKLAIELMKRG
FT                   VTPVNALEMYKLLEKIIAFDVVPVPLSFLELLAKKWDICNNPEIEHYLKEIGEKFGKTL
FT                   LSEFKNFNEFVRVASLLFAQFPTTRFTINKTGNVWRIYFAPAGPLSARCLARFAEEVIK
FT                   QFGCVTKTQYNPVIAAEVECPGKTL"
FT   gene            157477..157929
FT                   /locus_tag="Pisl_0165"
FT   CDS_pept        157477..157929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2842 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87347"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW5"
FT                   /protein_id="ABL87347.1"
FT                   /translation="MVREYSRLALRKDLAEEFYRAVKNLGRKPSEVLEFIIQAAVDSIN
FT                   HGVDPIDMVHICRLARSLGLGRGGYEVGKEAGVLLRAYYSPEEFLEILTRVGPKVFHAN
FT                   RVGPNAFRVNNATIRETLRGVLEGIGYKVRVEGDMVFLDNVPEYTK"
FT   gene            complement(158162..158815)
FT                   /locus_tag="Pisl_0166"
FT   CDS_pept        complement(158162..158815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0166"
FT                   /product="3-Cys thioredoxin peroxidase"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pai:PAE2085 peroxiredoxin, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87348"
FT                   /db_xref="GOA:A1RQW6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW6"
FT                   /protein_id="ABL87348.1"
FT                   /translation="MPEVKGPYLGMKIPEDLCFDTDAGRRCFRDYKGRWLLLFSHPGDF
FT                   RPVCTTEFIAFAKKYEEFKKRGVELLGLSVDTVYSHVEWKRQIKQLWGVEIPFPIISDV
FT                   PDFQVANLFNSIPPGTTATVRMVALIDPELKLVWFALYPLAVGRGVDEILRVIDAIQFN
FT                   YKHGYLAPVDWRPGDPVIVPPPQRYEGAEKRLKETGIECKTWWFCTKKYEEVVG"
FT   gene            complement(158894..160297)
FT                   /locus_tag="Pisl_0167"
FT   CDS_pept        complement(158894..160297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0167"
FT                   /product="conserved hypothetical protein 698"
FT                   /note="PFAM: conserved hypothetical protein 698; KEGG:
FT                   noc:Noc_1683 conserved hypothetical protein 698"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87349"
FT                   /db_xref="GOA:A1RQW7"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW7"
FT                   /protein_id="ABL87349.1"
FT                   /translation="MSQPRKIDWSSLYKKEDWWALWLGLALFFYAFIGFYAYRDALGWV
FT                   PMWKVWTDISSPVAVPNPKMVFGSPWVNLIVAWIVLMLLLMGPAKLIGIKPSDWVRGFT
FT                   VIYWLWWICAIITGYKPIASVVTTEFAFTLALFIGILIGNLPKLPQWLLGSARGEWFIK
FT                   TAIVLLGAKILFTDWIRYGGSVLTMVLIGFPLFMLLAFPIFRLFTKNTDLSVVSAVGVG
FT                   VCGVSASIAAAGAIGAPAIYPTMVSAAILIYAAVELIILPWVAISLVKSGVISEAAAGA
FT                   WMGLSVKTDGAAAASAEIIARGIGSDTPLKIGVMSKVLIDIWIGVIAFVLALIWVFLVE
FT                   PRRAAAATQRKPSPLELWFRFPKFVLGYFFTSLVASALILSLAGSVYAKAANPVDEATK
FT                   AVVPILVGGGTDPFRVLLFGLTFVAIGINTRFSLMKQYKVWNLFIAYGIALLVIIGVAY
FT                   LLATAFFPK"
FT   gene            complement(160481..160816)
FT                   /locus_tag="Pisl_0168"
FT   CDS_pept        complement(160481..160816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0168"
FT                   /product="DsrC family protein"
FT                   /note="PFAM: DsrC family protein; KEGG: pai:PAE2566
FT                   siroheme-sulfite reductase gamma subunit homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87350"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW8"
FT                   /protein_id="ABL87350.1"
FT                   /translation="MPVKCPGEYKVDDVTIILDEECFLSNPEVWNEKVAEWMARELEGI
FT                   QKMTEDHWKVVKYLREYWETYGVCPPIKMLLKETGFTLEQIYQLFPSGPANGACKVAGA
FT                   PKPTGCV"
FT   gene            complement(160854..161156)
FT                   /locus_tag="Pisl_0169"
FT   CDS_pept        complement(160854..161156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87351"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQW9"
FT                   /protein_id="ABL87351.1"
FT                   /translation="MYIISDLSPSSYTLSFIWYGVKIQGEKETAIEFTVDNIPWVGRKT
FT                   KFVLVLFPTEGGYLPLLRVEIPPGDAMFHWDRIAYAILQERLHDLLGDGYIVSQI"
FT   gene            complement(161239..162375)
FT                   /locus_tag="Pisl_0170"
FT   CDS_pept        complement(161239..162375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0170"
FT                   /product="dissimilatory sulfite reductase beta subunit"
FT                   /EC_number="1.8.99.1"
FT                   /note="KEGG: pai:PAE2571 sulfite reductase beta subunit;
FT                   TIGRFAM: sulfite reductase, dissimilatory-type beta
FT                   subunit; PFAM: nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87352"
FT                   /db_xref="GOA:A1RQX0"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011808"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX0"
FT                   /protein_id="ABL87352.1"
FT                   /translation="MSAIQLNIPNELDKFLPDIVKRNYGKWKERKFHGPGIIEHISETG
FT                   ERVFTVKAALPPNARVSVDTLEKFADIADKLGVGALRITIAGNVEFITDSLDKALKIKE
FT                   ELEKLGFPVGGWGGALWGINTCTAFLTCQIAVIDAPSIGKALGDALKPYFTGEEKLPAK
FT                   LRVFISGCPSGCAGGTAIDIAIVGMWGAPPKIREEVLPLCMPPPKALAKIPESQVFLVQ
FT                   VCPTGALTLRREGEKIKLVLVGEKCINCGRCKDNCDAFDYDPKDVGAAILIGGKMANTG
FT                   VGPRLARVLIPWIPANPPRYEEIVAVVKKVIDVWKTHGKPGERLADFVERIGWAKFVEL
FT                   VGAPKMAAQYLWWPDAARTYLTYRARGEVIFKGFRDAP"
FT   gene            complement(162372..163610)
FT                   /locus_tag="Pisl_0171"
FT   CDS_pept        complement(162372..163610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0171"
FT                   /product="dissimilatory sulfite reductase alpha subunit"
FT                   /EC_number="1.8.99.1"
FT                   /note="KEGG: pai:PAE2572 sulfite reductase alpha subunit;
FT                   TIGRFAM: sulfite reductase, dissimilatory-type alpha
FT                   subunit; PFAM: nitrite and sulphite reductase 4Fe-4S
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87353"
FT                   /db_xref="GOA:A1RQX1"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011806"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX1"
FT                   /protein_id="ABL87353.1"
FT                   /translation="MAAPPNLPPPDKLLEMAEQYLKELEKGPWPSHVAEMRKTGYPLHV
FT                   YGVGLVARKSPWGPSAVKAKRLTGVLARIARDWVPKGGEEVHFRVFHTPGRFLPTSYLR
FT                   GIIKVAREYGIGLVEVVGQTGAMVINVKSKEVGDAMIEALRQVGTDVGGSGDAIRELNT
FT                   CVGPALCEFALYDTLKWFTEFRKDKKIHDAIAVPGFPYKFKIKFSGCPMDCGRANRADL
FT                   GFIGTWKGAPEVDQELLRKKIEAGEADPNDLVSKCAGGAISWDAEKKELKIDGSRCKKC
FT                   MYCIRKAYPAIKPGKERRVAVLVGGGSKGRYGPKLGWFVGYLKPDEVQKGIELVFKVIE
FT                   PWDKEAQAKVRIGDYILMTGLYQFIEKAGIQLEDTPKLVEKLPDNVPYRVLPEEERKKY
FT                   AQFAEELRRAVGI"
FT   gene            complement(163648..164415)
FT                   /locus_tag="Pisl_0172"
FT   CDS_pept        complement(163648..164415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0172"
FT                   /product="respiratory nitrate reductase gamma subunit"
FT                   /note="PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   pai:PAE2614 nitrate reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87354"
FT                   /db_xref="GOA:A1RQX2"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX2"
FT                   /protein_id="ABL87354.1"
FT                   /translation="MLDAVLFIGVPYLALVILIVGVLAKIGAWISPRGLTSLASVAVVS
FT                   YNWSAGARAGEVLKRILTFYTLKYTNDKLLYWGALLFHWGIFLTLFLGHTALFFSPEQL
FT                   AAMGIDPATRKIIAIGLGTLFGIVVIIGLILLWARRLTKPEVKSFTFADDWFALVLITA
FT                   IVLVGLVNTAVIHPHYDKTVTPWLQNLLTGNVAAALEAITKAEPLVKLHIFLAEVLMIY
FT                   VPFGKMIHPFTIFFEPTITSPPYKVSGSEVILK"
FT   gene            164601..165506
FT                   /locus_tag="Pisl_0173"
FT   CDS_pept        164601..165506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0173"
FT                   /product="cofactor modifying protein (cmo)"
FT                   /note="KEGG: afu:AF1615 cofactor modifying protein (cmo)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87355"
FT                   /db_xref="GOA:A1RQX3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX3"
FT                   /protein_id="ABL87355.1"
FT                   /translation="MKLMDFDLYKRFLAEVEEAEYIHLQGWGEPLLHPRLVEMAASAKK
FT                   IANVGITTNGTLLREEVTRALVEIPIDILAVTFAGARAETHNRYREGNDFNVVFRNVEY
FT                   LLRIRRGKPEVVAIYMLLGDNYRELPGFVRMAARLGVDRVKVSNLNYLFNTEGASLKAF
FT                   SDTWEKPREVERAIVEAQQIAREVGVGFVTDNIAPFELAECPETPTKAVFITVDGDVCP
FT                   CVYLGLPWPEIPRLFNIRLFKIPRTCWGNLKMESLRKVLNSEKAREFRSRFEYRKYNMD
FT                   VGAIGEPPDVCKTCYRLFGV"
FT   gene            166556..167971
FT                   /locus_tag="Pisl_0174"
FT   CDS_pept        166556..167971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0174"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE1331 conserved iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87356"
FT                   /db_xref="GOA:A1RQX4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX4"
FT                   /protein_id="ABL87356.1"
FT                   /translation="MHAAEFKLGDTSAIKPLKAPESLVKKLHERIGLKIPEDKYKYFLD
FT                   RLREEYKKNRNIKIAVDTCVHCGACIDACPTYLTTKDLKNSPVGRAELIRRVLKKGSVT
FT                   DAELEEIYTYYWQCLTCRRCGYVCPFGIDQADITRFVRGVLYEIGMVNRFAAMTIDAHE
FT                   TTGNAMRITPAAAINILNYFAEEIKSEKGVEVTYYVYRHDQKKMIKFVGKNAVGEIARD
FT                   SPEWPEAILFLSSADLFLNTETLKGYLTFLNAVKIRFAVHTGCSEVANFGLWTHEKHME
FT                   YIGNIYYNAAKELGVKYAIFGECGHGWRAFKNVVAPRLEKEGIKVYHIHHLVVKAIKEG
FT                   KIKLNPEANGDKVYMYQDPCQYSRGGDLYEEPRFIMNHVVKKWVECPQNRQLNWCCGGQ
FT                   AGMLADEMKPLRLQYAKLWYECAINAGAQHVVRPCSKCKGTLNGIIGDLNKIYGRNITY
FT                   GGLMDLVYRALVI"
FT   gene            168063..168665
FT                   /locus_tag="Pisl_0175"
FT   CDS_pept        168063..168665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87357"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX5"
FT                   /protein_id="ABL87357.1"
FT                   /translation="MAYETLDHFTIKILDTVLSEELRGEPGLTPYQIMRKLGVYPSFLY
FT                   KNIKVLERRNYLVCKEAGRGKICSTTVGGLLAFLKVVKDYDKYVYLFFRKLGFGSPPMD
FT                   LRDAKTLLSLIIDGGTTPKDIYDLFVWSLLHCENSVVAKFLKALSGVLGITLVMTPHMV
FT                   YVKRNGTEICTCRYSNCGLEMCKLKLAVREFLEIQKS"
FT   gene            complement(168662..170266)
FT                   /locus_tag="Pisl_0176"
FT   CDS_pept        complement(168662..170266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0176"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: afu:AF0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87358"
FT                   /db_xref="GOA:A1RQX6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX6"
FT                   /protein_id="ABL87358.1"
FT                   /translation="MSRKEVVKINDISKPVKRLVQLKLEDLMPLPPPYDKSGSEPPLTT
FT                   PKPEWEETYVTELDGYIAIDLPWKPKTKEEEERLIQKFLEGLKKLTSRESNWTFLQPLL
FT                   LSLEYCAKCQNCAEACPIYIASGRKDIYRPTYRAEVLRRIYNKYIAKKPGGDIELNIFT
FT                   LMRLAELAYRCTLCRRCVQVCPLGIDNGLIAREIRKLFSQELGIAPKNLHEKGTVQHLK
FT                   VGSSTGMTPKALLKMVKYIEDFIYEKTGKRIKIPVDQKGADILLIHNAGEFLSWPENVA
FT                   AFAIIFEEAGLSWTLSSEPLGYDVVNYGAWYDDVQLARIALKHIEIARKLEVKKIVVGE
FT                   CGHATKALVVVADRILTDENRIPRESALPLLRDIVMSNKLNLDPSKNNFPVTLHDPCNI
FT                   VRLSGIVEPQREILRKIAPMFREMVPHGVYNYCCGGGSGFAIMQSLNFPEWRNKVASRM
FT                   KFKQILEAFKDVLDPKIPKYVCAPCSNCKGAIRDVLAHYRATELYNIHYGGLVELIVNA
FT                   MVDLKEPYLDFLKEKKS"
FT   gene            complement(170263..171171)
FT                   /locus_tag="Pisl_0177"
FT   CDS_pept        complement(170263..171171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0177"
FT                   /product="Nitrate reductase, gamma subunit"
FT                   /note="PFAM: Nitrate reductase, gamma subunit; KEGG:
FT                   afu:AF0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87359"
FT                   /db_xref="GOA:A1RQX7"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX7"
FT                   /protein_id="ABL87359.1"
FT                   /translation="MSYNIESIIFYTSYITFTIFIIGIIYKWSRWASMPIHLRWELYPV
FT                   PHEKKAEYGGSYLEEVDWAKKTREVTKIGELKEMLEEMLFIKRIYLMNKRLWFLSWFFH
FT                   FGIYLILVWFLALFLSAIIMSLGVQIPSSNPWAYFLYYVTLITGGLGAIMTIIGGIGLL
FT                   IRRLSDPVLRDYTTWPDYLNTVLVLITVATGLAAWIYDPAFDLARKFMLSLVTFSQPPP
FT                   LPTITTVNIALIQLLLVYIPFSKITHFIGKYFTYHKILWDDEPNTGQLDGRVSELLKLP
FT                   LRWSAPHIRSGETWEKNAAGL"
FT   gene            171280..172623
FT                   /locus_tag="Pisl_0178"
FT   CDS_pept        171280..172623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0178"
FT                   /product="cobyrinate a,c-diamide synthase /
FT                   hydrogenobyrinic acid a,c-diamide synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.-"
FT                   /EC_number="6.3.5.9"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: pai:PAE2587
FT                   cobyrinic acid a,c-diamide synthase (cbiA) part 2,
FT                   authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87360"
FT                   /db_xref="GOA:A1RQX8"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX8"
FT                   /protein_id="ABL87360.1"
FT                   /translation="MIPRVVISSFRGMSGKTIISLALIYGLFRQGLRVAPFKVGPDYID
FT                   PSYHTAAAGRPSRNLDVVLMGERGVVERFVKFSRGADIAVVEGVLGLYDSFDGVSELGS
FT                   TAQVAKLLKAPVLLVLNGERVNRTLRAIVRGLRQFDPEIKIPGVVLTNVTRSQAEKLKK
FT                   SLPEEGVEVLGAVPKSEKLAEVFSYRHLGLTPVGERGDVPRIFEVVEKYVLPYIDLDGV
FT                   IAIAKSAGDFAVDIKEEDPGGLGGCRIGIVFDRAFTFYYPEVFEEAKSLGEVVFLDSLK
FT                   MQELPQVDVVFIGGGFPESLAEELERNKPFKSSLLKFIERGGKVYAECGGLMYLTSSIV
FT                   VEGSEYEMVGAIDGITVMMKRPVGKGYAWGVVERRTPIAPPGTRLVGHEFHYSKIILRE
FT                   EVETAIRLERGVGIGGGRDGIVKGNMHAQYLHIHPYTYSVLRTLCRST"
FT   gene            172608..173276
FT                   /locus_tag="Pisl_0179"
FT   CDS_pept        172608..173276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0179"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: pai:PAE2573
FT                   uroporphyrin-III C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87361"
FT                   /db_xref="GOA:A1RQX9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQX9"
FT                   /protein_id="ABL87361.1"
FT                   /translation="MPLYVVGAGPGDPKLLTIRARELLEEADVVAYGDLVPEEVVKIAK
FT                   KARVVKIGHRRVEHDAAIEALIEEARWRNVVILKNGDPTIFGRGVKVCKMARERGVPCE
FT                   IVPGVSSFTAAAALFQIELTDGENLRHIALLSYPHFSADILREIKADTLVIFMMGDKLQ
FT                   EVSQVLAQVCNPERVYLCVGVSLGGYCEEVSPEVLGEKKGLRPTLVIVQRCTSSKSIKM
FT                   "
FT   gene            174314..175555
FT                   /locus_tag="Pisl_0180"
FT   CDS_pept        174314..175555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY0"
FT                   /protein_id="ABL87362.1"
FT                   /translation="MERVFREVIEEWLSWKPPPMVERELEVPLETGLATAVIGPRRAGK
FT                   TYLLYQLAVRHGRSLYINFEDVRFVGLRPRDFSVFLKTLAEHGDFNLLLLDEVQNVPHW
FT                   GRWIRSLLDRGYLVAVAGSTSKLGAREVPTELRGRYLSRLLLPFSFREYLKAVGIPALA
FT                   GHAPASRGRLLGALREYLERGGYPEAVLRPQLARELLRTYRDTVVYRDVVERHRVRDAR
FT                   GFEVFLSMVESSFCNVFSISSAHRRLASLGLEKSKKTLANYLKYLEEAFYVVAVPKWGP
FT                   GKTPLTQPHKIYPVDPGYIPEGQIGRKMEAAVAVELLRRGAKFYYYRGRREVDFVVEGE
FT                   PPLLIQVTYASAPDEVDRRELDALSEAAAAVGGRPLLITWDLEGQIARSGLRVDAVPLW
FT                   QWLLGGWAKSPAST"
FT   gene            complement(175582..176430)
FT                   /locus_tag="Pisl_0181"
FT   CDS_pept        complement(175582..176430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sai:Saci_1065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87363"
FT                   /db_xref="GOA:A1RQY1"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY1"
FT                   /protein_id="ABL87363.1"
FT                   /translation="MGLARYLVVRTLKNRWVLLWGGLWPLFWVAMGAFIFTKGFAKSPY
FT                   AAQYARSYVAGWLDGVVITVVAAVSVALLYSMIYSTAAVPYLLRFGRLRPLKYVASYYG
FT                   AMFTTSLILVAAVGAANWLLMWRGLNDSGISVSLADAAPKDALALLHTAGAVAVFTAFA
FT                   AALLFLLSLLALKAVKAASWLPFTPLIFNMLFYFSYLYVEQSPLSLAANPFTAAQALII
FT                   TAYAGLERPYAAIASSNTLDVPAWALATSISGWAAALSLAAALLVSKVRYAPPELLREG
FT                   I"
FT   gene            complement(176433..177200)
FT                   /locus_tag="Pisl_0182"
FT   CDS_pept        complement(176433..177200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0182"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sto:ST1066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87364"
FT                   /db_xref="GOA:A1RQY2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY2"
FT                   /protein_id="ABL87364.1"
FT                   /translation="MIEIRGVKVRAGTFEVLADGAEVVGKAVLLGPNGSGKTTLLRAVS
FT                   GVIPYEGSIKIDGVEVDSARGLLTVSSNLPEIYRIAYDVAGLLEVFEDLKGVDRGEFEA
FT                   LMGRLGLGREVMRRPVHALSAGQWSLVRLALALSSRPKTILVDEPFENVDPARRGAVLK
FT                   LLVERGESGIVATHDLDALKAMRGWDAYFMLEGRLYGPVLVDDLLASGLVRGRAGGALL
FT                   TLKVGGVEYSVVKGAGVKFSEMGTVNKIYGLVE"
FT   gene            177331..177861
FT                   /locus_tag="Pisl_0183"
FT   CDS_pept        177331..177861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sso:SSO2115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87365"
FT                   /db_xref="GOA:A1RQY3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY3"
FT                   /protein_id="ABL87365.1"
FT                   /translation="MSREILRRELRKALGLYYAAWGTYPMAAVVLYYVVENLVAGAPKS
FT                   AVALSAAVPYIVLTGRIFASFFKAMRLPSRRRKGGIAWSIMILAYFAVLLFAMAFIKTL
FT                   AFATTAAYAASVTLLTYLLFRSNATEPRWYDHLALISFSVLLPLGVYVVALYYVIGIIW
FT                   VYAGIKSLLDAME"
FT   gene            177858..178181
FT                   /locus_tag="Pisl_0184"
FT   CDS_pept        177858..178181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0184"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein, ArsR; KEGG: sai:Saci_1068
FT                   transcriptional regulator ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87366"
FT                   /db_xref="GOA:A1RQY4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY4"
FT                   /protein_id="ABL87366.1"
FT                   /translation="MTEFDELMRLLGTRALSSGVRLGILIALYVVDGYITFADFQRALD
FT                   IPKSTLHEHLQILAREGYIEYKRAITERGVRAVAKITDKGRGIVRRYLDLLRRIYQKQG
FT                   EPP"
FT   gene            178693..179454
FT                   /locus_tag="Pisl_0185"
FT   CDS_pept        178693..179454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0185"
FT                   /product="paREP7"
FT                   /note="KEGG: pai:PAE0906 paREP7"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87367"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY5"
FT                   /protein_id="ABL87367.1"
FT                   /translation="MSVDRDALKRVVLDLLRSDEEFRLAVAGLIGLGAVLEELRKLRED
FT                   FNRFAKEQATRWEENDRRWEENNKRWEENNKRWEETYRRFETIELELKKLREDFNKFVK
FT                   IEEKRWEEAENKFRWLISALDDIRRALGGGFEYYTARVVSLLLRERGIECDVRVNVTLP
FT                   IDGFKEVDLICYDPLVVGEVTIAVRNIEEADREIGKLLEAERAAERFTGRKTYMRVLAV
FT                   EFASQDVAEYLRKKAQEMGILLLLGREYEKL"
FT   gene            complement(179462..179824)
FT                   /locus_tag="Pisl_0186"
FT   CDS_pept        complement(179462..179824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87368"
FT                   /db_xref="GOA:A1RQY6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY6"
FT                   /protein_id="ABL87368.1"
FT                   /translation="MFSISSVLGSLTLILSIVELLGFILLPRVKADLLCNLSLVSAYYL
FT                   LLAVVEALTYNNVIVSITYKLILLPYFFLCLDVREFTIGVSIVSRGAKVVEFKKLYNLR
FT                   MCLCLLRMQIKNSSLV"
FT   gene            180569..180808
FT                   /locus_tag="Pisl_0187"
FT   CDS_pept        180569..180808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87369"
FT                   /db_xref="GOA:A1RQY7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY7"
FT                   /protein_id="ABL87369.1"
FT                   /translation="MIVLISLLRNLLLILAATYAAGVAYFTYQFFRIAEAKAKWFDHLA
FT                   LISFSPALLAEVLFYVLSLIWIYAGVKSLLEVVS"
FT   sig_peptide     180569..180631
FT                   /locus_tag="Pisl_0187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.360 at
FT                   residue 21"
FT   gene            180860..181120
FT                   /locus_tag="Pisl_0188"
FT   CDS_pept        180860..181120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0188"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: sai:Saci_1068 transcriptional regulator ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87370"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY8"
FT                   /protein_id="ABL87370.1"
FT                   /translation="MRLGILIALYVVDGYITFADFQRAFDIPKSTLHEHLQILAEEGYI
FT                   EYKRAITERGVRAVAKITDKGKGIIRQYIVKCIYQPQEELS"
FT   gene            complement(181190..182251)
FT                   /locus_tag="Pisl_0189"
FT   CDS_pept        complement(181190..182251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0189"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE2153
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87371"
FT                   /db_xref="GOA:A1RQY9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQY9"
FT                   /protein_id="ABL87371.1"
FT                   /translation="MEAWRRKLGVVEKLRTMVDIKRVERDHHAKRLPRPCGITIHTGVG
FT                   CPLACAYCYIYDMGFPGSVRPYPLTPLEMAYAIAANPHVAVGERGTLVAVGSVTEPFLP
FT                   ETRELALGYIAAVVEHLGNPVQVATKYPPPLELAKYRADVLISVTDVEGRLEPKAPKPV
FT                   ERIRGAGELVKRGGSATLFVRPIVPGVTDRDLERLLALAWDAGIRRVVFGTLRATPAIA
FT                   ARLRSFGVDITPYIRRLEEGRQVPIKYPKERLVETARKWGFEVLPASCASNILAHGQKC
FT                   ALCSWGPCGGVPEVDVEDVRDFLEYRGYRGADPHFDGRRVVVKVRLKRGDKIFLEQALR
FT                   VPVVSQGKARHLS"
FT   gene            complement(182834..183430)
FT                   /locus_tag="Pisl_0190"
FT   CDS_pept        complement(182834..183430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87372"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ0"
FT                   /protein_id="ABL87372.1"
FT                   /translation="MSLVYSSSYLFWAIYGSEVDIPAFLNKLVGLGYEVGKAYYRSGSI
FT                   QVEPLPGGYAARRVYEEGEVKIYIDTARWAVGTSGDNYQLTMRGVADISRAFIELSFPE
FT                   PPRAEFHTSIGLKAENCRRQTVKIGDVEMAVDGYILTTGQPQGGEGIYIAITPTGGGRY
FT                   IAYIIVGGSWSYVVTYAKRIGDIINGAIHFFTSCN"
FT   gene            complement(183427..184152)
FT                   /locus_tag="Pisl_0191"
FT   CDS_pept        complement(183427..184152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sto:ST1045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87373"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ1"
FT                   /protein_id="ABL87373.1"
FT                   /translation="MRPLLERARDNLRDKEVVAVMSGKGGVGKSTVATLLAFLHKDTAL
FT                   IDLDIFGMSIPRLFGVVGRLHEVEKEGIKPFEIGGVKLFSLGGIVGDRYVVLPGANEGG
FT                   VVEALLAFADLDGVKRVVIDMPPGMGEALLALERVAKFKPVLVSTPSKMSIKVVGHLAD
FT                   YLSERGVKPPLFVLNMAYVECGGVKVYPFGRGEEARQLAERLGSTIVELPIDPDFENYV
FT                   GKIHEYRGPIYRELQKVRL"
FT   gene            complement(184149..184559)
FT                   /locus_tag="Pisl_0192"
FT   CDS_pept        complement(184149..184559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0192"
FT                   /product="hydrogenase expression/synthesis, HypA"
FT                   /note="PFAM: hydrogenase expression/synthesis, HypA; KEGG:
FT                   sto:ST1046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87374"
FT                   /db_xref="GOA:A1RQZ2"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ2"
FT                   /protein_id="ABL87374.1"
FT                   /translation="MHEWSLALSVIQTVDKWAREHNVEVRKISLSVPIVSQLDISILRE
FT                   AFDMLKKESRLEKAELEVKVRTPRYRCRACGYMFGHEEVASQIEALVGKYGEEYPLHLV
FT                   PELLPAFVKCPKCGSHDIEADLSIQVEQIETV"
FT   gene            complement(184589..184987)
FT                   /locus_tag="Pisl_0193"
FT   CDS_pept        complement(184589..184987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0193"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="KEGG: pab:PAB0960 putative nickel responsive
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87375"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ3"
FT                   /protein_id="ABL87375.1"
FT                   /translation="MVRRISIVLDDELYKEMERYMTEIGEVNRSRFIASLIAEKVGEAA
FT                   KTPVASLIAIVYDHEVGDVAKHLTEVQHDFNDIIRVATHVHLDERNCLEVIHAVGDAQR
FT                   IRELTSRISRIGRGIRYLKVVNIPREAL"
FT   gene            complement(184980..185300)
FT                   /locus_tag="Pisl_0194"
FT   CDS_pept        complement(184980..185300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87376"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ4"
FT                   /protein_id="ABL87376.1"
FT                   /translation="MTVFKMDDGVAPRDLKIDIITEGLREIRKMYVECISRSKPGICYA
FT                   KAAGELISMFGSLLPNVWHDQELRYFVLRGTDGVLLAYDAETGKYVTLEIGKAVQVLLK
FT                   YG"
FT   gene            complement(185297..185551)
FT                   /locus_tag="Pisl_0195"
FT   CDS_pept        complement(185297..185551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87377"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ5"
FT                   /protein_id="ABL87377.1"
FT                   /translation="MSEFKEIGKALGVLKKDLLGPVEEILKPAQELFSIFTKPLEDALR
FT                   DTIGEVVYRQLTTFGEAHKLDSNVDPAKLLETVKRQLRV"
FT   gene            complement(185538..186053)
FT                   /locus_tag="Pisl_0196"
FT   CDS_pept        complement(185538..186053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0196"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; PFAM:
FT                   peptidase M52, hydrogen uptake protein; KEGG: aeh:Mlg_2026
FT                   hydrogenase expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87378"
FT                   /db_xref="GOA:A1RQZ6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ6"
FT                   /protein_id="ABL87378.1"
FT                   /translation="MLLVVGLGNVVYGDDGFGSCLAQVLSHYNDFVFDGNAHGIGVLGT
FT                   LADYDILVFLDIDVRLPPGAVAIERVEGSLTLQETRLIDAHRTPPSLLVGYLRAMGRDP
FT                   KAYIIAVGPKTLEPFSPPSQEVIKAVPIAVEELKKLLAQFGVELKIGENVVEEFKNCYR
FT                   RALRYERV"
FT   gene            complement(186053..187969)
FT                   /locus_tag="Pisl_0197"
FT   CDS_pept        complement(186053..187969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0197"
FT                   /product="nickel-dependent hydrogenase, large subunit"
FT                   /note="PFAM: nickel-dependent hydrogenase, large subunit;
FT                   KEGG: sma:SAV7367 putative cytochrome C3-like hydrogenase
FT                   (NiFeSe) large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87379"
FT                   /db_xref="GOA:A1RQZ7"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ7"
FT                   /protein_id="ABL87379.1"
FT                   /translation="MSTVKIWIDPITRIEGHLALYAEIDTGTRAVKTARTTVMAFRGFE
FT                   VFLRGRPPEDAPHIVSRTCGVCGAAHANASVIACDIAAGMTPYPMGSVLRTLAYSMTDY
FT                   IYDHPLILNMLEGPDYSEVIISKLTPSVWKVAQETPANYTAIHGYRTIADIMKDLNPIT
FT                   GKIWQLTVKYQRIAREAGALIYGRHAHPSTLIPGGISTDITNLPSLLQEYYARLSQLTA
FT                   WVKFVWAVWQDLYEFYRDHVTTPDGKPYATTQGKTHDPPVMLAGGFADDPEVYSNITDE
FT                   ARGNWRELYARLDQAYNARGEKPGFAIGHDIYSKNPTEIQLGYVEFADSSFYEDWVKSN
FT                   VAPPTGWIKEDPIGRPLVNGTELFKYHMWNRTTIPKPGAINFAEKYSWAAEPRLVLKDG
FT                   RIAPIETGPISQLWLDTLHATKFELAGFKAWESNGSQMKIYLPGGTVAPDLPPGTKDEL
FT                   VITWNLPKYSTTFERLLARAVHLAVVNAIAWANLLYGLQLVNAGKVQTSRPWSYGKWPD
FT                   FSYSFGWWQVPRGNCMHWLVQKGGRIVNYQYEAPTTPNVSPSNNRCTDPWKGQCAGPFE
FT                   MSVRNSVVTEELPPDQWTGLDQVRAIRSFDPCLACAVHFEAKGEGGRVMNVIEKVIWNA
FT                   CAI"
FT   gene            complement(188031..189326)
FT                   /locus_tag="Pisl_0198"
FT   CDS_pept        complement(188031..189326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0198"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: afu:AF0547 reductase, iron-sulfur binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87380"
FT                   /db_xref="GOA:A1RQZ8"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ8"
FT                   /protein_id="ABL87380.1"
FT                   /translation="MLTVPKLNSVTLHYFENCVGCAACAPSCPYFYVDERYSPVEKAEF
FT                   LREMLRAKYTLAGRLFGRFVGARMPKSEDEMWKILEFAYRCTNCGHCYVTCPFGIDSGA
FT                   MVRLLRQALYSTGIAPTLMKQFAGFEGSGQYLQHPSVKAMWEAFMTEVAKLGAPVDKKG
FT                   ARVLLMISVMDVVLLKDTVLNTIKILKKVGEDFTIPSRPLGVRPPIGAVVGDPAAQKTA
FT                   IEDVVKYAESISPQILVTIDGGFVYPNLRFEATNLLRRKFSFKVYHITELLAEYLREGK
FT                   LKLKKTGAKVTWHDPCQLGRRAGVFEEPREVLKAFTDYRDLPHNRANSLCCGGGDGINC
FT                   LTKEMHMAMGKLLGMDIWGMLSAREKEFVEKSEDAYKKAIRRKMDDVKKSGAEVVVTAC
FT                   PVGIETIRLGTQLYGVNAKVVHIVDLVAEALE"
FT   gene            complement(189376..190149)
FT                   /locus_tag="Pisl_0199"
FT   CDS_pept        complement(189376..190149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87381"
FT                   /db_xref="GOA:A1RQZ9"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:A1RQZ9"
FT                   /protein_id="ABL87381.1"
FT                   /translation="MKELLELSLWVFLPAALVIFAFGATYRILRYVFLYQKGVYIHRKT
FT                   GAGAKIKGLIMSFLNPIIFNIRTKPIDFFAGLLALHFVGLILLIFLLAQHVAYLSAIIP
FT                   FYSLLWPFALPISSITGTLTVTSPIGGEIRVSPIWGPLTIVLNGDILTIFSLIGIGYKI
FT                   VEKLWEKAHGAKNVRVGDLLIWPLLFTIVVTGWLAAHHYPPGIENYRLVLGLHIAASAL
FT                   FVAVWPFTKFFHFLWGYWYGKLHEWYDVVIKRGAH"
FT   sig_peptide     complement(190078..190149)
FT                   /locus_tag="Pisl_0199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.729) with cleavage site probability 0.581 at
FT                   residue 24"
FT   gene            complement(190146..191462)
FT                   /locus_tag="Pisl_0200"
FT   CDS_pept        complement(190146..191462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0200"
FT                   /product="Nickel-iron dehydrogenase small subunit,
FT                   N-terminal domain protein"
FT                   /note="PFAM: Nickel-iron dehydrogenase small subunit,
FT                   N-terminal domain protein; KEGG: fal:FRAAL2392 uptake
FT                   hydrogenase small subunit precursor (hydrogenlyase)
FT                   (membrane-bound hydrogenase small subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87382"
FT                   /db_xref="GOA:A1RR00"
FT                   /db_xref="InterPro:IPR001821"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR027394"
FT                   /db_xref="InterPro:IPR037024"
FT                   /db_xref="InterPro:IPR037148"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR00"
FT                   /protein_id="ABL87382.1"
FT                   /translation="MKITRRDLIRAGSLAAALSALNWPALVKAAGEAVKEGLVNIVWFE
FT                   AQSCTGDTVSIIQATDPSLLDVLLGTTPLVGPGMVRLIFHEAVMPQWGTYHIKETTDVA
FT                   DHKILENYVTKQPPPGDAMKLLEEIAEGKYGPYVLVLEGSFPQEYGIPGTNIEQKGGYY
FT                   CHVGHRTCTEWAKLLFKNAIAVVTVGNCSSYGGLVANKVLEPPPGFKYPSWSPSPTGAV
FT                   GMFDDPVRGTKGMIHISYFQPEVEPFRKYIDEGGVPDFKTMKPAVAVPGCPANGNGILR
FT                   TLALLTLVAAGLLKPDVLERKAFLDQYARPRFIFENTVHEQCPRAGSYAAGDLRPYPGA
FT                   GDYRCLFAVGCKGPIANCPWNKVGWVNGVGGPTRTGGVCIGCTMPGFTDAFEPFYAPLN
FT                   APRLPTLETLGVALGGAALLGVAGAYLASKAAKPKEEKK"
FT   sig_peptide     complement(191373..191462)
FT                   /locus_tag="Pisl_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.867 at
FT                   residue 30"
FT   gene            complement(191449..192072)
FT                   /locus_tag="Pisl_0201"
FT   CDS_pept        complement(191449..192072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87383"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR01"
FT                   /protein_id="ABL87383.1"
FT                   /translation="MCKLEEKDVEILRVAFYKRGAKFYGIYKEVRLPLATAWRRTNKLV
FT                   MLGFLTERESQLYITDKGLIALAYAGDSVALSELARRYGEPPEAVKYVIDEICNAVALE
FT                   YIPLEKFSDVVKLLDIGNLYRYKNTVAERLAAKLMLEFCKPCRIETEKGSYVLGNGFIV
FT                   AAYCKLCNGGTYELLPDCPHVAEIFSNVKKVFINKGGGKSHEDN"
FT   gene            complement(192059..192556)
FT                   /locus_tag="Pisl_0202"
FT   CDS_pept        complement(192059..192556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87384"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR02"
FT                   /protein_id="ABL87384.1"
FT                   /translation="MYIYTVKLRYMRVLVGYIGYLFKGDCAVGLRAGELLRSKGVEAVE
FT                   LSGDVFTMVDELMKLKPDKLILIGAVQRGRRPGTVEVYKFTPRSFGSPLEINDALRPSL
FT                   EGRISLEDLLIGLSVLGRPTDEIYVVECEPPRPDPVIGLSPEGEKCAEELAKRAEELYV
FT                   QA"
FT   gene            192610..193641
FT                   /locus_tag="Pisl_0203"
FT   CDS_pept        192610..193641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0203"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: mth:MTH205
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87385"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR03"
FT                   /protein_id="ABL87385.1"
FT                   /translation="MIKLSHGSGGVETAEIIEKLFLKRLPESLKKVAGGLGLDFPDDAA
FT                   AIPMGDGRYLVVTIDAYTVNPPFFPGGDIGVLAASGSINDVLMLGGRPVAMLDSIIAEE
FT                   GLPYETLDRVVKSFLSVLETEGVALIGGDFKVMPKGQLDKIVITTVGIGVAERVIVDRP
FT                   RHGDKIVVSDFVGDHGAVILMLQMGDVDKPEQLKLKSDVKPLTKLMVPLVEKYGEYIHA
FT                   ARDPTRGGLAMVLNDWAKAGGGVIVVEEESLPVRPEVASYAGMLGIDPLYLASEGVAVL
FT                   AIDPSVAEEVVKFVRGLGFQNARIVGEFREAKQHRGYVLLKTLAGGLRILEPPRGDIVP
FT                   RIC"
FT   gene            193635..194207
FT                   /locus_tag="Pisl_0204"
FT   CDS_pept        193635..194207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0204"
FT                   /product="beta-lactamase fold-like Zn-dependent hydrolase"
FT                   /note="KEGG: pai:PAE3189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87386"
FT                   /db_xref="GOA:A1RR04"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR04"
FT                   /protein_id="ABL87386.1"
FT                   /translation="MLRLVFRDVRIVRWDYAGVEISAGGESLCIDVLKPPCRHVLYTHI
FT                   HPRHYGGVGGLAPPAVKPGDRLELGPFAVSVVEAYNMTKLINGAPVHPKGFGVGYLVEV
FT                   GGVSLYHPGDTDLIGEMAKIKTDIFLAPIGGDGTMTAEEAAEAVKLIRPKIAIPIHFGE
FT                   MRPYVKFRDISQPYTQVVYLDASPSNI"
FT   gene            194309..195508
FT                   /locus_tag="Pisl_0205"
FT   CDS_pept        194309..195508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0205"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   tko:TK2000 hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87387"
FT                   /db_xref="GOA:A1RR05"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR05"
FT                   /protein_id="ABL87387.1"
FT                   /translation="MAALELAFRRKSKITGMLIQYIKKYAKELKKRDGDYVYKVMDFCG
FT                   THEWTIVHFGLRSVLEMAGVDNVELVAGPGCPVCVTPSYYLEEAIKLAFEGVVIYTYGD
FT                   VFRLPALQRVRGARSLAEAKAMGADVRLIHTFLHAAIDAKRHNKPSLFLGIGFETVAPG
FT                   YSEAILRGLVPPNLKLMSLVKLTPPAMFYALDMVKEKPTDYPISGVIAPGHVSTIIGGK
FT                   AWAPVAEQYRVPVVVAGFEPNDVLTAIAEILRQLKNGEHKVVIEYVRAVKWEGDLKAQS
FT                   SIHTVFETVDTAWRGIGYIPKSGLALREEFKQYDAFEYFGIPDLTPERWRYDLPPGCKC
FT                   AEVNLGKAKPTDCPLFMKACTPDHPVGPCMVSVEGTCAIWARFGGGGLAVEVAKEIGLA
FT                   "
FT   gene            195510..195857
FT                   /locus_tag="Pisl_0206"
FT   CDS_pept        195510..195857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0206"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE0132 Hydrogenase maturation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87388"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR06"
FT                   /protein_id="ABL87388.1"
FT                   /translation="MCWAVPSVVKKIEGGIAFVDPGDGVERPAVIGIEEGQLQVGDLVM
FT                   VHAGVIIAKVDLETLKESMEMWKQMARELAASTGEDPEAAEKIIEEEMWRVLKIAEEVR
FT                   QGRSQALRELA"
FT   gene            195850..198096
FT                   /locus_tag="Pisl_0207"
FT   CDS_pept        195850..198096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0207"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC, N-terminal domain;
FT                   zinc finger, HypF domain protein; KEGG: pab:PAB1560
FT                   hydrogenase expression/formation regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87389"
FT                   /db_xref="GOA:A1RR07"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR07"
FT                   /protein_id="ABL87389.1"
FT                   /translation="MPKAYLIHIIGIVQGVGFRPYVKILADQLGLSGYVKNLGGGEVEI
FT                   YVEGERSREFLDSLLNGRPKAIYIEDIRVIEVAPRGVRGFTIEKSSQEVETVSMIPPDL
FT                   AICDECLREVLEGDERRRRYPFNSCSFCGPRFSIIKKLPYDRENTSWTAFPLCDKCTRE
FT                   YNDPKVGGIRRFYYQGISCKNDGPQVKLLDSTGEPIDVGDPISEASRLINEGYIVAVKG
FT                   VGGFHIFALASDDDVVAKLRKRKKRPTQPFAIMALDLETAGRLAVVNKTAAELLTSPQR
FT                   PIVLLFKREDSPASPLVSPGLDKEGIFLPYTALQYLLLSEIRDKFAIATSGNIHGEPMC
FT                   TDWRCVAKLGVADYILDHTLEIVHRVDDSVVRFTAGRPTLLRRGRGYAPVWIKTPLRLG
FT                   RAAVAFGADLQTAGGVGIGDKAILTQYIGDLDSFKALEDLDRELRWLVQTYRLREFVLV
FT                   CDLNQTYNSHRLCREWAEEFNAEIYMVQHHHAHALATAADVGVAEPFVAVAIDGVGLGE
FT                   DGAAWGGEVLYVDGARYERVRHLAYVPMPGGDLAALRPARMALAYLFKYFGEDWDLVER
FT                   LKLAERLPGGLSEAQIVAREVKKSRLYTSSVGRFLDAVAAALGVAWERTYEGEPAIRLE
FT                   ATAAGGRLIELEAEDQVELFGQLIELYLKGADVKDLAYTAQYKLGQILGKWACETAERK
FT                   GVRHIVVGGGAAVNDYIIAGLESVCGRAALPSKTPPGDGGIALGQLYYLAHLGV"
FT   gene            198077..198784
FT                   /locus_tag="Pisl_0208"
FT   CDS_pept        198077..198784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR08"
FT                   /protein_id="ABL87390.1"
FT                   /translation="MPTLEYKLLCGNSPLRYEGGDGEVKNGTYRLTKSGGTVEVEIDGA
FT                   VVSLKEAVVICGVRDSRVRPGIYLIDVARRWRLPKLLGKLLRRGIPPDRAIDRIDRKLA
FT                   ATAALNQEPLSKIRLGGDEPHVAYYSAKWVAGALEGVLFFGWRGDGGIYEYEPLYFRYR
FT                   DGEVKEVYIRLHYIPARIPPAVIALRDPFDPKNHFLFPAPGDKPIDRFNVSFGLPREPP
FT                   EKKVVGYIFKIPM"
FT   gene            198789..199085
FT                   /locus_tag="Pisl_0209"
FT   CDS_pept        198789..199085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87391"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR09"
FT                   /protein_id="ABL87391.1"
FT                   /translation="MALHLLAQKGGKIYTYGEKIYIYVEETWLSLNLRLLIWRVGERPP
FT                   PRAELIAEGEEAKAIATEFAQLLERYTEAKVMKGTAKEALMRSIKEKTLYVLT"
FT   gene            complement(199077..199748)
FT                   /locus_tag="Pisl_0210"
FT   CDS_pept        complement(199077..199748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0210"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mja:MJ1088 cobalt transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87392"
FT                   /db_xref="GOA:A1RR10"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR10"
FT                   /protein_id="ABL87392.1"
FT                   /translation="MRREVLKAVDVYFGYSEDVLKGVSLSVGEGQFMAVMGPTGSGKTT
FT                   LLLVLAGLLKPRRGEVYFMGEPLEGQLPAARRLMGVVFQNPDDMFFNHTVRDEIAYTAV
FT                   RIYGREEGLKLAEEAAKALGIEGLLDRPPYKLSGGQKRLVTLAAATVHRPRLLLLDEPT
FT                   TYLDEDAYEVVVNYLAKLKAGGVSAVIATHDEELAVRLADSVYKLREGKLTPYTPRRKL
FT                   C"
FT   gene            complement(199729..200313)
FT                   /locus_tag="Pisl_0211"
FT   CDS_pept        complement(199729..200313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87393"
FT                   /db_xref="GOA:A1RR11"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR11"
FT                   /protein_id="ABL87393.1"
FT                   /translation="MLRKLVEDITEAVAAFERIPRVENTPFSILLLVSTAAASFSPSVY
FT                   IAAAFFALGLLFAAAAREVKPWALVAFFSLFFSGLVSLPAALGLLPNKTDPLLFVARTV
FT                   SAASVATGGLLLTGWWGFVRSLRLRGDLRRMFELMPLSVMAIGQAAVVIAAAKEARGED
FT                   KRAVAAAIGDVLIYGIQRGVSLRMAYEARSA"
FT   gene            complement(200294..200605)
FT                   /locus_tag="Pisl_0212"
FT   CDS_pept        complement(200294..200605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87394"
FT                   /db_xref="GOA:A1RR12"
FT                   /db_xref="InterPro:IPR025937"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR12"
FT                   /protein_id="ABL87394.1"
FT                   /translation="MKKLYIFLALMALVSPVFGVWLANLVGYHEPLDVAADMINEVANE
FT                   TLHKVILQDVSDQMNWTPLKDYTVPGLPDWLGYIISAYIGLAIFIALWLVARRVKKTR"
FT   sig_peptide     complement(200546..200605)
FT                   /locus_tag="Pisl_0212"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.801 at
FT                   residue 20"
FT   gene            complement(200602..201210)
FT                   /locus_tag="Pisl_0213"
FT   CDS_pept        complement(200602..201210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0213"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiM
FT                   protein; KEGG: afu:AF1843 cobalamin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87395"
FT                   /db_xref="GOA:A1RR13"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR13"
FT                   /protein_id="ABL87395.1"
FT                   /translation="MHIPDGYLDPISAGVTWAIMLIYGFFAYKKAALGKNLEVVVGLAA
FT                   AIFIAQMFNWPIPGGTSLHLVGGALAAIMLGPFEAFFVLLLVLLVQTLVFHDGGITTLG
FT                   ANVINMGVVAPLVGWAAWRLLSRYNKPLAAAVAGWASITVAGMAAGFEIGVSPYFPYAW
FT                   TISVPVMTTWHALLGIVEGVITAAVVEYLLKRAPQYVRV"
FT   gene            complement(201283..202035)
FT                   /locus_tag="Pisl_0214"
FT   CDS_pept        complement(201283..202035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0214"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: chy:CHY_2191 iron compound ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87396"
FT                   /db_xref="GOA:A1RR14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR14"
FT                   /protein_id="ABL87396.1"
FT                   /translation="MVSIRIEGVEFSYPSRPALRGVTVEIPPRSFTAVLGPNGAGKSTL
FT                   MKIMASVLKPRRGAVYFDGRIPRREELYKMVGYVPQRATPGGRLRVIDLVVSSRKPYFR
FT                   FFPTARDYKAAEEALKRVGVSHLRDRFLEELSGGEFQLVLLARALAVEPRVLLLDEPFN
FT                   NLDLRHQLEVASLLRKLSSDVTVVAVLHDLNMALRYADYAIFMSRGEVYAAGPTKAVFR
FT                   EDVIYDVYGVKTKILWEIPAVIPQQPPG"
FT   gene            complement(202022..203038)
FT                   /locus_tag="Pisl_0215"
FT   CDS_pept        complement(202022..203038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0215"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   afu:AF0431 iron (III) transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87397"
FT                   /db_xref="GOA:A1RR15"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR15"
FT                   /protein_id="ABL87397.1"
FT                   /translation="MRVLASYLLLVGVLAALFLYSLSVGAYSYGPLDVLKAALWGSGPE
FT                   ALVAKMRLARAVASVAVGAALAVAGAALQAVLRNPLASPFTLGIPQAAALGVAVAVMVA
FT                   GAGTVTRGLLDISNPYLVVGLAFLSALLNGLLVLFLASLTGFSVASVVLAMVVVSSVYQ
FT                   AALALLQYLYLNDIQTAAVVFWTFGDVGRPGYWESFMLLAVAAASALYFLANSAGYNLV
FT                   AVGEEVAKTSGVDPARLRLTTLVAVTLAVAVLVSFTGVIGFVGLAAPHIARLLVGGNHT
FT                   RLIPASAAAGAALVLGADIVGRLAKPPVIIPVGITLSFVGAAFILALLFRLRRYGEY"
FT   sig_peptide     complement(202958..203038)
FT                   /locus_tag="Pisl_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.900 at
FT                   residue 27"
FT   gene            complement(203026..204207)
FT                   /locus_tag="Pisl_0216"
FT   CDS_pept        complement(203026..204207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0216"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: tte:TTE1869
FT                   ABC-type Fe3+-siderophores transport systems, periplasmic
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87398"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR16"
FT                   /protein_id="ABL87398.1"
FT                   /translation="MRKAIYLGIAVFVILALSAYYLSQQPGAVPQTTVPTAQTTAAATT
FT                   TTTPPSTAGAVEVVDVLGRRVSVKAPVSRVVALGPGALRLVVYLNATDKLAGIEEIEKR
FT                   PPRGRDYGYILWTKNLTSLPVIGQGGPDSPVNFEAIMKVGPDVIVMSPVLANSPDQVQE
FT                   KTGISVVVVSYSNAVGGVNFTTLFQSLRTLGVVLGREERAEELVRYMEGLIQDLKRRTA
FT                   NITQKPKVYVGAISYKGGQPFESTMSKFPPLVLLNTPGVADRYGIQPGAKIDWEALLKE
FT                   QPDVIFIDLGNYALVAQDFNKSRDKYCALKAFKEGRIYGILPFNHYWSNIATLFADAYF
FT                   MGKVLYPEAFRDVDPVAKADEIYREFLGTPLYTAIAKDFKGGFRQLTEFKCGS"
FT   sig_peptide     complement(204136..204207)
FT                   /locus_tag="Pisl_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.676 at
FT                   residue 24"
FT   gene            complement(204230..204955)
FT                   /locus_tag="Pisl_0217"
FT   CDS_pept        complement(204230..204955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0217"
FT                   /product="protein of unknown function DUF364"
FT                   /note="PFAM: protein of unknown function DUF364; KEGG:
FT                   tko:TK0710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87399"
FT                   /db_xref="InterPro:IPR007161"
FT                   /db_xref="InterPro:IPR025251"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR17"
FT                   /protein_id="ABL87399.1"
FT                   /translation="MLVKKIAEYVSQMAEGLEIVDYCVCFSGVYVVVKGPRGKALGFAH
FT                   IPREDLHELGEVRPPALEEMADFVVDLHPINRALGVAMVNAVSQYHLGPVEPGDLMKYY
FT                   AGDPVCLIGNMRPLAEALRRRGHQVYVFEKSPHLRFGAYSEVEERILLPRCKTVIITGM
FT                   TLLNFTIDDVLAVSRGVNILTGPTAGVHPDALRGTGVHVVASIKFNIEPTIRHLKLGHY
FT                   ISLALHKDLGIPYTIPINT"
FT   gene            complement(204998..206716)
FT                   /locus_tag="Pisl_0218"
FT   CDS_pept        complement(204998..206716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0218"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pai:PAE2867 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87400"
FT                   /db_xref="GOA:A1RR18"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR18"
FT                   /protein_id="ABL87400.1"
FT                   /translation="MSSGEAVVPPSLKWKTVDFSLYFKLYGESVRDVFRFWMGEAGRLV
FT                   WRRPPSKAYEGGVWFPDGELSPYENVVGRHRGSWVWDKVALVWESEEGEVRVYTYGDLD
FT                   RLVGEMAGVLRGLGVGRGDWVVFYAPPTPEVVALMLAAVRLGAPFEPVFTGWGWYALAK
FT                   RVANRQPKVVVTVDAFPRRGRPVRVKEAVDKAVPEEVKVLVVPRMGVGVARRRNDVFLE
FT                   EVERAPWEEAVVPSGHPLFGLHAGYPEGPRPLTHRAGGYLTQTYATTRWLGVRPRDTYF
FT                   CTVLPGWITGITYVLFGPLMVGSSVVVYEGGPDYPHWDRWWSIIERYAVTVFVTTAGAL
FT                   RYLSRQDPELLRRHNLDTLRLIITTAEPMEVEIWRWTYQYVGTGTVPTVDSLPEKLSGR
FT                   IPVIHSFIQTEFGTFVTGPLPDYVFTPLKPGSAGPPMPGFVLDVVDELGNSVRGRPGRL
FT                   VAKAPWPAMPVELEFSGVYDTGDLAVMDNDMYIFPLGRRDGVLKVNGYRISPGEIKEAI
FT                   SKTLGVEVEVEKGRDPLKFEVPIVKIRGSYKPEDIKRLVREMVGPIAEPAEVGLS"
FT   gene            206792..207508
FT                   /locus_tag="Pisl_0219"
FT   CDS_pept        206792..207508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0219"
FT                   /product="formylmethanofuran dehydrogenase, subunit E"
FT                   /EC_number="1.2.99.5"
FT                   /note="PFAM: formylmethanofuran dehydrogenase, subunit E
FT                   region; KEGG: pab:PAB0675 molybdenum formylmethanofuran
FT                   dehydrogenase subunit fmdE related"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87401"
FT                   /db_xref="GOA:A1RR19"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR19"
FT                   /protein_id="ABL87401.1"
FT                   /translation="MRFRKQIVELLQRRDLWGLLNKAAELHGHICVGLALGVKTSAVAL
FT                   ERLGVLPADDTDIIAVTDNNTCFADGVQVVMGATLGNNRLIYRDAGRFALILVDRRGGK
FT                   AVRISLAGRLTTPTMENPRYRDYWSRLPQLTEEKRQEFRSLMEKASAEVLEAPDAIFKI
FT                   EEVPPDPILDALKSTTRPSWTVCERCGVATLAERAVVVGGRHYCPDCAGLKTYAVVGRK
FT                   ITEFKPPSSSPTQTAF"
FT   gene            complement(207468..207758)
FT                   /locus_tag="Pisl_0220"
FT   CDS_pept        complement(207468..207758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87402"
FT                   /db_xref="GOA:A1RR20"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR20"
FT                   /protein_id="ABL87402.1"
FT                   /translation="MWSSFYVGKWLLRILKAWVAFGALLLMFIGVLLFPFTLLLGAVSF
FT                   AAGWYILLYVVFSGSEGFRRGFAIGWRCGAGDREACEEFKKLFESARRRGA"
FT   sig_peptide     complement(207618..207758)
FT                   /locus_tag="Pisl_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.915 at
FT                   residue 47"
FT   gene            complement(207768..208562)
FT                   /locus_tag="Pisl_0221"
FT   CDS_pept        complement(207768..208562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfu:PF1905 putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87403"
FT                   /db_xref="GOA:A1RR21"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR21"
FT                   /protein_id="ABL87403.1"
FT                   /translation="MADFVMRWACKIAVAVAAVLVAFVVYVAVGGLQAVGGQRSVSVIE
FT                   GLAVAEWDCRDYFWYIYGRLPKKLNIELDDAVKHILDKPTGVFGTPCGFFNISEKLRQW
FT                   LNNDPVGIEVYERCYGGMFVDAARIYIVVTDHACKEKIAGTIGDLAKQFGTEVVFLKGR
FT                   YTYKQLIQWADALKDRLYREENGGRLSQMCNYTRAFWANFDVARNLVNIYVQPKCLSPS
FT                   VVKELAKLVDELEIPREAVLVEDRPEMGALFVVLPCPTRCPC"
FT   sig_peptide     complement(208479..208562)
FT                   /locus_tag="Pisl_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.546 at
FT                   residue 28"
FT   gene            complement(208845..209332)
FT                   /pseudo
FT                   /locus_tag="Pisl_0222"
FT   gene            209616..210098
FT                   /locus_tag="Pisl_0223"
FT   CDS_pept        209616..210098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0223"
FT                   /product="PaREP1 domain containing protein"
FT                   /note="PFAM: Archaeal PaREP1; KEGG: sto:ST2014 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87404"
FT                   /db_xref="InterPro:IPR010268"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR22"
FT                   /protein_id="ABL87404.1"
FT                   /translation="MGVLPKPWLDLAGYKRVRLEEARAEAELARKFLEQGLLRNAAGKA
FT                   FQAWKALVAALATERREELAKLYPGKVRLRGRRARVDRVDWIIAVMPTTYLKEVAMAIG
FT                   GRVDALTDKALWIHQYQYNGPDPEGVLSPYRSDETARRNIETLLRGIEEILSSLGL"
FT   gene            complement(210696..211301)
FT                   /locus_tag="Pisl_0224"
FT   CDS_pept        complement(210696..211301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87405"
FT                   /db_xref="GOA:A1RR23"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR23"
FT                   /protein_id="ABL87405.1"
FT                   /translation="MGIRTVTILIFVIVFLMVPILFFLPVSVRFSVGEAPPGTCKFVFN
FT                   NTMLNYTMYVEYWNGSLIYRGRGWYLVAMGARNFAMGWLELEYSNGTRRSVEIAGAEKD
FT                   RAFYITGYYQPLIYTLDVACDIYLQYLRGQLPPPYEVKRESGKVVIVTRYSSSGYARYE
FT                   WSGNVLTRFIYDVKYANGVRIVEELTLLEQKPCDQKLY"
FT   gene            complement(211332..212051)
FT                   /locus_tag="Pisl_0225"
FT   CDS_pept        complement(211332..212051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0225"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: neq:NEQ381 conserved hypothetical protein
FT                   containing radical SAM domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87406"
FT                   /db_xref="GOA:A1RR24"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR24"
FT                   /protein_id="ABL87406.1"
FT                   /translation="MLAAGWKGISTVDVHGAVTFTLWLCGCNLRCPFCHNWRIAERQNC
FT                   GELDVERLLGELARAKPYIDYLHVTGGEPLLQAEELRHLFKRAREAGVARSLNTNATLT
FT                   KALEKVIDEVDHLATDLKIPDQMYGVPHWQQLWQNFLTSLKTASSRKIPIELRIPAANL
FT                   PLETYAKRIEEVSNALAETEVTVVIQPLLGPPTTDPRDPQWCRQHCNPPPSHLQQIAKL
FT                   AAALGKVVIKNYGIFTN"
FT   gene            complement(212051..213871)
FT                   /locus_tag="Pisl_0226"
FT   CDS_pept        complement(212051..213871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0226"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: tko:TK2298 anaerobic
FT                   ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87407"
FT                   /db_xref="GOA:A1RR25"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR25"
FT                   /protein_id="ABL87407.1"
FT                   /translation="MQEVIQKYLAWNSLEVNENANRYPSPTGFFSYLLEEHMPVDLPAE
FT                   VAEAHQEGLIYVHKLPYSAYLPYCSGHSISRLLKQGLVTPIIASRPARHLDTFVDHVAN
FT                   FLSTAQHYFTGAQAFSSVEWYAGPFIRNDKLDFKAVRQSVQRLVYNLNYPSRVGFQTPF
FT                   TNFTVTMNAPRKMLDGDRAVYDGKEVEPLGVYEEEAKLFLKALASVLKEGDAEGKPFTF
FT                   PIPTLMTTATWLWEDPEIFEAVFTTAAKRGSFYWLNTRVVDPDGSFAMCCRINIDRNEL
FT                   MYARGARISLKRDVKLATEDLWSRMEKQRFGGVWALPDVTGSVGVIDVNLPRIALDARG
FT                   DDGRFWELYEERLELVKRGLDWLRERYVKLLKTEMYSFVRRYLPEFPTSHFNTIGIIGL
FT                   PEAAAIYMGKPDLWTEGSHRDWAAAADLMKKMVSFAVKKAREWMSEEGTPWNVEEVPGE
FT                   SAAAKLAIKDARRYPELAQYLPDLIYSTSVAPYYAPMELWERVEVEAKVQREFTGGVMM
FT                   HIFLGEEPDPEALAKLARRITETEVVYWSFTPAQTHCPRCGRTYTGLYKRCPSCGYEGV
FT                   EVWSRIIGYYRPLKNWNPYRRREFWLRRHY"
FT   gene            complement(213983..216031)
FT                   /locus_tag="Pisl_0227"
FT   CDS_pept        complement(213983..216031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0227"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: fnu:FN0305
FT                   iron(III) dicitrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87408"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR26"
FT                   /protein_id="ABL87408.1"
FT                   /translation="MKWKIISLLVVILAAIAAVYLLLPKGPSPAQTAPTAAVSPTASPT
FT                   AVATQPPTQTPAVSRQIVVVDFRGKRIVLPKPPERIVVLNSYWAEVLVALGAGDKIVGI
FT                   GRYVDADEYLPPEVRKKPVVGDLFGGVNVEAVVALKPDVVVTDYGYGKADEVIKRLEEA
FT                   GVPVVALFMRGTPDELKAVEVLGNLTGAVDKARELKAFMAKRFEELGAGAAKIKERKRA
FT                   VLIFGSSILAGGPLSLAANSSFGMALVEAGAVNVALEQFPNQAWPKIDMETLMRWDPDV
FT                   VLIAASAEDAGRIFDKIRSDERWRVLKAYKNGEIYLVPWGSKIGDILNWGPRGVVGREY
FT                   IAEVLYPDVYAFDWRGDLKRLGDMYGVSIPPQAYAVYNINWKEVVDLAGNVVKIPSRVE
FT                   RFATFVTYQLPIAFNVTSRLVAVGRDAVQGVFAPLMKAAFPAVVNLPTPGDRFKVNVEA
FT                   LVQLKPQVVFNWVVNPDDIRTMQRANLTLVQVVVNNFTDAERLVWLYGVVFDRLPRARQ
FT                   IVNDMEDIVKFVANRTASVREKARVLYLWVDPLTVAGGASLFSQNIELAGGVNVAAADY
FT                   PTMSTVKVDPERILKWNPDVIIIAWQARYNESAVLNNPVYRGVNAVKNGRVYKKPILSE
FT                   YTPDTALSVLWTATKLYPDLFRDVNFTKVADYYYRRWYGVSYTQVWG"
FT   sig_peptide     complement(215933..216031)
FT                   /locus_tag="Pisl_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.600 at
FT                   residue 33"
FT   gene            complement(216061..219624)
FT                   /locus_tag="Pisl_0228"
FT   CDS_pept        complement(216061..219624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0228"
FT                   /product="cobaltochelatase CobN subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: CobN/magnesium chelatase; KEGG: gvi:glr3328
FT                   magnesium protoporphyrin IX chelatase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87409"
FT                   /db_xref="GOA:A1RR27"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011771"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR27"
FT                   /protein_id="ABL87409.1"
FT                   /translation="MKIVIISTKPSLRTLFDAAKEVEAEAGVSIELQTYYIHSSVDYAA
FT                   VENADVILIDVRGGAPRELINAVEKSRAKVVIPLVGGSPGTLALLRLGGFSGVEIAKRV
FT                   PEQDFDTDRVDFSKISKVLSAVETAGRVLPVGPLRHLRNWIWATKYWAYWGRENLANLF
FT                   KLILAEYFGAGVKYGEPKLVGEFAVYTPGIGFTYKPPETKGPVVLIFTYAGMHFDETLP
FT                   VALKLKEELEKLGVNAFIATGGVTDGLLKQLEALRKYTLVGGRSVDAVINLQWFVINGG
FT                   PYGGSPEPTRELFKERGSLLFNGLVAYTRRISQWEKDPRGLSPVEVVGGVALPEIDGAI
FT                   EPIISAGLDDSIYAEMVVLEERVKKKARRVANWIKLRQKPPSERRVAIVIYNYPPGEHN
FT                   VGNAAYLDTLASLAVILKALREAGYRTRALDKEELRRLIAERFLVNSPQWGSHGDVPKL
FT                   PVSEYLRWFNTLANRDEVIKTWGEPPGGVNVEGDSFLIPGVVLDNVFIGVQPPRGFHED
FT                   PSKLYHSKDIPPHHQYLAFYYWIKEVFKADAIIHVGTHGTLELMPGKEVGLSDRCWPDI
FT                   LIGDTPHIYIYHVTNPSEKTIAKRRSYAYIITHGTPPFTHADLYGEYVELEELLEEAEK
FT                   GGEDVRRLIEEKCRKLNLPCGDLERLHDYLMEMKRAVIPRGLHVFGSRWSVEDVVNYIT
FT                   FVLRREGDVPSLHRLILEERGVNYDGVEKAGGGRLLVEAEEEARRMIKEALSGGDPAKY
FT                   FKKRRREAEEVFRYVRDLAKRILESDEVSSLLKALDGRYVEPRVAGEPLRTPEVFPTGS
FT                   HGYAFDPRLIPTKAAYIRGINLAEELVKRYREKYGRYPESVAVVLWGFETAQTRGETVG
FT                   QILQLLGVRLVRKHGPWAPELEPIPLEELGRPRIDVVVTICGFFRDMFPNLISLIDRAV
FT                   KLVASLDEPLEMNYVRKHYLEIGRITRIFGPKPGTYGTRLPEFIESSSWKNEGELVEVY
FT                   VGDMMYGYGDDIHGEAMRELFVQLLKKVEVVSQVRSATEYDIADLDHYYEFLGGLKKAV
FT                   ETLAGRRVEAYWVDATGEKMRIRTVEEAVDFALRTRLLNPKWAEEMLKHGYDGAREIAK
FT                   RVEYVLGHAALTGTVDRWFWRQIAEMYVKNIEMRERIKTVNPWALYEIIKRLEEAHRRG
FT                   YWEGDEEIRKIAEELEGILEE"
FT   gene            complement(219621..221534)
FT                   /locus_tag="Pisl_0229"
FT   CDS_pept        complement(219621..221534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0229"
FT                   /product="protoporphyrin IX magnesium-chelatase"
FT                   /EC_number="6.6.1.1"
FT                   /note="KEGG: mhu:Mhun_0291 magnesium chelatase, ChlI
FT                   subunit; PFAM: magnesium chelatase, ChlI subunit; von
FT                   Willebrand factor, type A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87410"
FT                   /db_xref="GOA:A1RR28"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR28"
FT                   /protein_id="ABL87410.1"
FT                   /translation="MEEARERRVVYPFAAIVGQEKAKLALLAVSVNPAIGGVLLAGDKG
FT                   TGKSTMVRALADLLPEIEVVEGCPFGCNPHNPAEMCDECYLKWKRGEIKVAKRKMRVID
FT                   LPLSITVDRLVGTLDIKRALAEGIRALQPGLLAEANRNILYIDEVNLLDDYIIDVLLDA
FT                   AAMGWNIVEREGISVKHPARFILIGSMNPEEGELRPQLLDRFGLYVKVEASMNPEERIE
FT                   IIRRVEEFNRDPTAFYRKWEPEQNRLREAISRARQIVNDVQIDEDLMKFIVKTITDLKI
FT                   RSHRAEITVVRTAKAIAALDGRLKVNLDDVKKAMELALPHRLKATPFEPPPPPPASPPP
FT                   SPQQNDGGGDRGPQGGGGGQGGGEAGGGRGGGGKQFGEEKPPYEPRETPVRLRGEEEGG
FT                   GGRRARRAYELKIGGSHGVVTTYAIPRGEAVDIHITATLTAAALRRLGAGLPLAVDNED
FT                   LRINVRRARVPVLRVVLLDSSGSMAALRRIAVAKGLVRKLAESSYRGREYISLIVFRGG
FT                   GAQVVVPPVRKYEEILAALSAVPTGGRTPLPHALETLYRIAKSFRAKYRDAKVVGVLIT
FT                   DGKANVPLYRNVREDLERLSHLLKKAGVELEIYATRGRGFDPAPTYIDLIASITSAKVV
FT                   EV"
FT   gene            complement(221534..225432)
FT                   /pseudo
FT                   /locus_tag="Pisl_0230"
FT   gene            225532..227703
FT                   /locus_tag="Pisl_0231"
FT   CDS_pept        225532..227703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0231"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: sth:STH1935
FT                   iron ABC transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87411"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR29"
FT                   /protein_id="ABL87411.1"
FT                   /translation="MNTRVVIGVLLAVILAVFALYLAKSPTGGGVSNATAPPRAAGPSP
FT                   VSVVDSAGRVVVFDKPPERVVALTHAEFLYVLGVWNRVVGIGKSVADVVSLPASLRNRT
FT                   VVGDTYSGINWEAVAALKPDLVVMGYWGGVFAAGEQQVLEKSRELGYKVLAFGYVAPSV
FT                   NSSWPYENIRIVRVLGKVFNVRDRAEELASWLEERYREALDIARRIPPEKRLNVLVISA
FT                   YSLATSGDIYISGRGSASGELVELVGAHNVAFDYNLSQTRKLDLEKLITLFGNKTDVVI
FT                   VRDFHGGKYVDRAIKRILGDPRWRAIKAVREGRVYGVNFSYYDFSYPYEYSPRFISAIY
FT                   ALGHLIYPQYYPDWRPIHVELLRRFYNMSCHVEGGLRCNVAQLYPVTVMDSMGREVTFE
FT                   SPPRRVIVLYSGWAEALYVLGVVDRVVGISPSVARASFLPKEVRGAPAVGETFSGLNWE
FT                   AVAALRPNLIIMGRWKGGFEPGERQVLEKSRELGYKVLAFGITDVNKTGTKMPYENIRI
FT                   IRALGRVFNVTEKAEALADFLEREYKKALEIARGIPPEKRRNVLVIYPTGVLERGPISV
FT                   SYRGSAYAETVELVGGHNVAFDYNFTVQYPKFDLEKLIALFGNKTDVLIVAWSDYNRTA
FT                   QAVKAILSDPRWRAIKAVREGRVYGVVLSAYSLDFPEIYGPRFVSAIYAFGRAIYPEYY
FT                   PDWRPIHVELLRRFYNVSCTYVGEGLRCG"
FT   sig_peptide     225532..225603
FT                   /locus_tag="Pisl_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.717 at
FT                   residue 24"
FT   gene            227694..228734
FT                   /locus_tag="Pisl_0232"
FT   CDS_pept        227694..228734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0232"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   mac:MA4605 iron(III) ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87412"
FT                   /db_xref="GOA:A1RR30"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR30"
FT                   /protein_id="ABL87412.1"
FT                   /translation="MWVRYLVYGLPLAVFLVSISVGAYPIPIYDVVMVVSAKLASLLST
FT                   AVSVVTFGVVSPAVNLHYPTTYEVVIVGIRMPRVVFSMAVGAALALSGLILQAMFKNPL
FT                   VDSYILGISSGAAFGATLAIGFLAVASVTPIAFVFALLAVFMTYSLARIGGSVTPVSLV
FT                   LAGIIVNALFTALTSLLKFLMEHNRLAAAVYWLMGSFSGVGWDAVVVAVPVISVLGALA
FT                   YLLRWRLDVLSFGEEAKTLGVDVEKLKALFVFVATLLTAVSVAYSGIIGWVGLMVPHIM
FT                   RMAFGPSHRGLVPLTIAGGAAFMGAADTLARTIATFEIPVGILTTVLGVPFFIYLLRKT
FT                   GGRWHA"
FT   sig_peptide     227694..227765
FT                   /locus_tag="Pisl_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.826 at
FT                   residue 24"
FT   gene            228727..229488
FT                   /locus_tag="Pisl_0233"
FT   CDS_pept        228727..229488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0233"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mba:Mbar_A0509 iron compounds ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87413"
FT                   /db_xref="GOA:A1RR31"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR31"
FT                   /protein_id="ABL87413.1"
FT                   /translation="MLEVKGLEFSYGEFTISGVTFSVGKGEVAVLLGPNGSGKTTILKA
FT                   IYGLLKPRARCVYVDGADFHSLPFRRRSQLAGYVPQSHHPPFPYRVIDVVVTGFAPRLG
FT                   LFQSPGRGHYEKALEKLRLLGIERLAERPYTHLSGGQLQLVLIARALVQEPQVLLLDEP
FT                   TAHLDFKNQLRVLSTVRRLAKASGVAVLMTLHDPNLAAAYSDKIIVVKDGRVVAVGAPR
FT                   DVIKDDIIREVYGVSVKVLEVDGRVVVLPHD"
FT   gene            229481..230377
FT                   /locus_tag="Pisl_0234"
FT   CDS_pept        229481..230377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0234"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mja:MJ1556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87414"
FT                   /db_xref="GOA:A1RR32"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR32"
FT                   /protein_id="ABL87414.1"
FT                   /translation="MINPAALLRDVLFLAPSVIGGSLLAAFLMERGVMNKLRPLAAPFV
FT                   KLSGLGPETAAAFITAFFDVRSANTLLVTLHREGRLSRREMYLASLMNAFPAAVRHWDS
FT                   MLPPLLALLGLWGALYFAYFLLVGLAQTLLFALLSRLLVAGSGRVSAVVTEGGGGPNAL
FT                   KRALRRAVKILATSAAALAVVELATSLGLFGVLNSYVKSAVSAFPLSAEELGVAVASMV
FT                   NYAAGAAAAAALINAGLLDGWRAVKAMLLGSAFSFVTALRAVLPYYVGVFGPRDGPLLM
FT                   AISTSVRTALILALVWI"
FT   gene            230368..231132
FT                   /locus_tag="Pisl_0235"
FT   CDS_pept        230368..231132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0235"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmp:MMP0874 SAM (and some other nucleotide)
FT                   binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87415"
FT                   /db_xref="GOA:A1RR33"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR33"
FT                   /protein_id="ABL87415.1"
FT                   /translation="MDIDWAEEWAAWRREVWTPPDFWDRATPRFYRSAKRRRVEVERFL
FT                   DWLLGELGLGGGSSVLEVGAGAGAYAVPLAKRVSRVVAVEPSREMARYLRKYAEEEGVK
FT                   VDVVEKRWEEVSLEEVGRHDLALAAHSILVENLRGAVEKLEEAARCVCVVLHVGVPGWA
FT                   QLYRSLGVERPHRPWFTAFYNFLLQRGVYANVKIFERDVVREYPSVEEAAEDLGVEVER
FT                   VVETLPRLGRRGDGGVVFKYKVKEAAVWWCRR"
FT   gene            231114..232022
FT                   /locus_tag="Pisl_0236"
FT   CDS_pept        231114..232022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0236"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   mma:MM0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87416"
FT                   /db_xref="GOA:A1RR34"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR34"
FT                   /protein_id="ABL87416.1"
FT                   /translation="MVVQEVAGVLLAMLLGFLAAEMLLEHGVLYKLSFLRRVAKLANLP
FT                   DVCGVTFATAFVSPAASNAMLQSLRDRGVLNDREVLLASLLNAAAVPFYETFTVYLPVV
FT                   IPLLGPRLGLMYMSAMWLNGALSFAVVVAAGRLALNRRETGLVEEAARKLGRNYKAALR
FT                   RGLRRFVKTAVVFAATVSTVELLLRYGVLQHLATPLSSYAMGISPQLLPAIGIYVLHPT
FT                   AGMAAVGQLVKTGVVGEVEALAALLLASVFMLPLLYLRVYIPQWVAIFGPRVGLARGAI
FT                   GLSIALAARIIVLASVLALVH"
FT   gene            complement(232261..232920)
FT                   /locus_tag="Pisl_0237"
FT   CDS_pept        complement(232261..232920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sto:ST0863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87417"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR35"
FT                   /protein_id="ABL87417.1"
FT                   /translation="MAFDFVGSISSDIYKLRRSETFFKLTARAIIERASSEFSFHTISH
FT                   DYGVGTVKTAVSYVGLLEKLHLLKTVEAVDPNTGLPMPRKLRKFYLLDPFIYHSFSKWV
FT                   GAVPPDEAKMAEAAVAAHLARLYKLYYLKLNGEVDLVAEVDGELWSVEVKYGRVRKGGR
FT                   RAVGRVKRFIYTSAETKPATPSFQPLLLAILKTPTPSRSERRNPQLTSREMTPSPP"
FT   gene            233663..234007
FT                   /locus_tag="Pisl_0238"
FT   CDS_pept        233663..234007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0238"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87418"
FT                   /db_xref="GOA:A1RR36"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR36"
FT                   /protein_id="ABL87418.1"
FT                   /translation="MQQAGLAKALVYPKPIVKLINMRFNFTVTERGTSRAVLRVYKKGI
FT                   VALPKALREEVGIKEGEEVVAEVVGGAIVLRPLKPRVVDVSPEEVENAVKEEKEEWDRR
FT                   LDALRKEVGT"
FT   gene            233979..234434
FT                   /locus_tag="Pisl_0239"
FT   CDS_pept        233979..234434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0239"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SMART: Nucleotide
FT                   binding protein, PINc; KEGG: afu:AF1385 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87419"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR37"
FT                   /protein_id="ABL87419.1"
FT                   /translation="MRLGKKLVLDTSVLVEYIVAKSPYRGLVESIFQRAARGELELYVN
FT                   AVTLAETLYVASRIYNTAGVEDPNGEARNFVTWVARRADVLDIDIHTSTLAGELKKRLK
FT                   IALPDCLVIATAKRIGGTPLFKKIEAEMRDALDELRRLGTAFLEELR"
FT   gene            complement(234982..235257)
FT                   /locus_tag="Pisl_0240"
FT   CDS_pept        complement(234982..235257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87420"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR38"
FT                   /protein_id="ABL87420.1"
FT                   /translation="MEAEVEWVPEPASPELPHDLPVDYMERYWAVLGTYVEEVVRHMGL
FT                   KVYDDAPIASVELGHVLKRERFYRSSLEFILSAAVTWASAGSTLGR"
FT   gene            complement(235643..236185)
FT                   /locus_tag="Pisl_0241"
FT   CDS_pept        complement(235643..236185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87421"
FT                   /db_xref="InterPro:IPR018700"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR39"
FT                   /protein_id="ABL87421.1"
FT                   /translation="MSSRNSCSSAVAFLARLNAELERRGLGRVVIVGGFAVELYSGGVY
FT                   RTGDVDFVLDTHNPQAALEVFTALANAAGWRRVSRVWEGPSPLYLDLVGLEYLGRVKEL
FT                   WACGSRLYVQSPEDSVVSSLAACVLRNSPADCERAAAVLAAQWEQIDWAYLRERAKREE
FT                   VLEKLVELADKVARLRG"
FT   sig_peptide     complement(236126..236185)
FT                   /locus_tag="Pisl_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.454 at
FT                   residue 20"
FT   gene            complement(236163..236348)
FT                   /locus_tag="Pisl_0242"
FT   CDS_pept        complement(236163..236348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87422"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR40"
FT                   /protein_id="ABL87422.1"
FT                   /translation="MRRFPPQVAEERLKKIVVMAARAGRNVLWLSRDVFTLRSWEPHVR
FT                   YRARYVDGAYVLEEQL"
FT   gene            complement(236602..237858)
FT                   /locus_tag="Pisl_0243"
FT   CDS_pept        complement(236602..237858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0243"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE2522
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87423"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR41"
FT                   /protein_id="ABL87423.1"
FT                   /translation="MHMNQVYRVLKIKIPWRLVEERPDVLDLVTRMHLAVEEYAKTLLK
FT                   EITGQGEPKLTTEEIDRLLTPDRRELAVKIIDVAFPKYGLGRYFVKQAKMFWRETAFWR
FT                   AVPLDAQLRIENERDAGRAVFVGLKSGVLRVRKTGIPPFAVELKKGNVAWIRERLQEGA
FT                   RLKLAFLGIERLKGKKEPTYGKLYIALVFARKVQQVEPKAVVAVDVNRLDHGVMMGLLV
FT                   DGKLRQTLRLLDEDAVRELRRLHEEISRLDEQAAREADPARRRRLEERARHLKSRRFRK
FT                   IRGVVKDIVGEIIKLAREHQAAIVVDTMEDETYRELKEGNWSGEKKHLLDGLGQLRRRL
FT                   QTLARWYGLPYLEERLYSTVCPRCGAKMEELNNRRMQCPVCGFNDNRDNVPLIWAKKRY
FT                   WELLQKQPAFSATTTLLTS"
FT   gene            238004..238624
FT                   /locus_tag="Pisl_0244"
FT   CDS_pept        238004..238624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87424"
FT                   /db_xref="InterPro:IPR008304"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR42"
FT                   /protein_id="ABL87424.1"
FT                   /translation="MGQTQYPTVKQFVKLIETLRKEEGLSDNALIAFESPIVDAGGGVD
FT                   TYYDVSADEVVKSEVVVGKDGLTTPSSASTGGTAKPRGELAEKVNTIVIRGGEVVAYAE
FT                   VFFGRLPYGPWAELFNLRVLGTPVEAELYRLFAKYMEAEDLLYVEYLDDGKTARQLATG
FT                   VPPGESRMRRLLESCGFRVVRDWYRWRAPPSSGPLGYLSLSLR"
FT   gene            complement(238600..239928)
FT                   /locus_tag="Pisl_0245"
FT   CDS_pept        complement(238600..239928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0245"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: pai:PAE2371 NADH
FT                   oxidase (nox)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87425"
FT                   /db_xref="GOA:A1RR43"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR43"
FT                   /protein_id="ABL87425.1"
FT                   /translation="MKTMVVIGGGTAGATAASRAKRLCPQCRVILIEASRYITHAPCAI
FT                   PYAIGDLTQGEIWLYSEEEFESERGVEVYTETRAVDVLGDRVYLEGKLEGVLKFDTLVI
FT                   ATGARPAVPEVEGVELEGVLPVRGVEVVDKAKRLLQGARDVAVVGAGYIGVEMADVLAQ
FT                   MGKRVVLIDGSPRPLAKSLDPDMSAVVARYMGERVELRLGERLVKIGGEGGRARYVETD
FT                   GGRYPADVVFLATGVRPNVDLALRAGARLGQTGAVEVNEYMETAAPAVYAAGDVAEARH
FT                   AVTGEPVWIPLAIYANKMGYVAGTNAGLGRRAISFPPVAGASVTKFLDMYIGSTGLTEE
FT                   EARRRGIYGSSISISATDKARYMKGAVDVTLKAVVDREGRLVGMQIVGRTPSVGGLVDL
FT                   ATQFLGRPVEDMFKAEYSYMPFTASPWHPFTIIARLYLRERLR"
FT   sig_peptide     complement(239878..239928)
FT                   /locus_tag="Pisl_0245"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.763) with cleavage site probability 0.432 at
FT                   residue 17"
FT   gene            complement(239971..240273)
FT                   /locus_tag="Pisl_0246"
FT   CDS_pept        complement(239971..240273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0246"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: pai:PAE0717 succinate
FT                   dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87426"
FT                   /db_xref="GOA:A1RR44"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR44"
FT                   /protein_id="ABL87426.1"
FT                   /translation="MRVKVHVKRGRNGAQYYQSYIVEISENITILDLLLLIREKLDGTL
FT                   SMRYACRMGVCGACAMVINGVPRLACTVKISDLKTDEIFIEPLKGKKVIKDLVTE"
FT   gene            complement(240273..242000)
FT                   /locus_tag="Pisl_0247"
FT   CDS_pept        complement(240273..242000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0247"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="KEGG: pai:PAE0716 succinate dehydrogenase
FT                   flavoprotein subunit; TIGRFAM: succinate dehydrogenase or
FT                   fumarate reductase, flavoprotein subunit; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87427"
FT                   /db_xref="GOA:A1RR45"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR45"
FT                   /protein_id="ABL87427.1"
FT                   /translation="MDLLIYDVVVIGSGLAGLRAAVAAALRGVSVAVVTKTSGPRSHSI
FT                   SAEGGMAAVVHPEKTGDSPELHAYDTVKGGDFLVDQEAAIVLAREAPAEVKFLDSIGVP
FT                   WSRDPDGTYSLRMFGGMSKPRTVFAKDRTGFYIMTALYRYAKSFHNIHFYEEYFVTTLV
FT                   VKNDVFYGLVALDMRRGELVGFVAKAGVIAAGGAGRLYRMTTMGWLNTGEVLGYALKAG
FT                   AALRDMEFVQWHPTALVPSGILISEAARAEGGYLVNRHGERFMKRYAPEKMELAPRDVV
FT                   SRAIITECMEGRGFLHESGLCYVGLDVRHIDRKRLEERLPLLLELSKTYAGVDPTTELI
FT                   PVRPAVHYFMGGIYTDVRGRVLNHRGEWIRGLWAAGEAASTGVHGANRLGSNSLTECAV
FT                   WGRIVGEEAAVYAMGRPALSTTVVRLEIQKEEERIAKLIKNEHGGMTPLSLRAKLQDLM
FT                   ERGAGIVRHGSVTSEALRRLNKLFDMLKEVRITDGGRIYNMELREVLELYGMLYAAQAV
FT                   LTGALLRRESRGAHYRLDFPRRDDDWLVHTVYYLYGDTLHVSTTKVEITRWMPETRRY"
FT   gene            complement(242084..243580)
FT                   /locus_tag="Pisl_0248"
FT   CDS_pept        complement(242084..243580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0248"
FT                   /product="Vinylacetyl-CoA delta-isomerase"
FT                   /EC_number="5.3.3.3"
FT                   /note="PFAM: 4-hydroxyphenylacetate 3-hydroxylase; KEGG:
FT                   pai:PAE2693 4-hydroxyphenylacetate-3-hydroxylase,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87428"
FT                   /db_xref="GOA:A1RR46"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR46"
FT                   /protein_id="ABL87428.1"
FT                   /translation="MGLRTGEQYVEGLRNRRHVKVYVMGKRVEDVTTNLFLKPSLLSFK
FT                   ATFDAAFQEDTRDLARAYSPFINEEINRFVHIHQGPQDLVAKVKLLRALSHKTGTCFQR
FT                   CVGWDALNTLYIITGKMAEKGKPIYRERFFQYLEEVQRRDLALAGAMTDARGVRSLRPH
FT                   EQPNPDAYVRVVEERDDGIIVRGAKANITGVALVDEVIVMPTRAMTEKDAPYAVAFAVP
FT                   LDSPGVTVVVGRQINDVRKAEGDIDGLPYMSHHEGLIIFEDVFVPWDRVFLYQEWQWAG
FT                   PLVEVFSAFHRQGYAGCKSGLGDVIIGAAYNLAKQIGVADKPNIVDKLTEMVFLNESMY
FT                   SAGLAASWEGKKLLKDGGWWVNPMYANVTKHLVSRFPYEIARLAHDIAGGIIGTAPSEF
FT                   DLKNSEIKHLVEKYLQGVPEFTAEDRLRMLRLLENVSISVGFLIESVHGAGSPAAQKIV
FT                   FSRLYDFQGAETIARRLARMRGPEPPGASELHRKSEIEKL"
FT   gene            243704..245125
FT                   /locus_tag="Pisl_0249"
FT   CDS_pept        243704..245125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0249"
FT                   /product="Succinate-semialdehyde dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.2.1.16"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: sto:ST0064
FT                   glyceraldehyde-3-phosphate dehydrogenase, NADP dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87429"
FT                   /db_xref="GOA:A1RR47"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR47"
FT                   /protein_id="ABL87429.1"
FT                   /translation="MKDVKDLIVIVNPATEEVIAELPKATREDVRRAIDAAWDAFASWS
FT                   ALPLRKRTRVLLKTAELAETAREDLLKTLVAESGKPIKDAEAEITRAIEIFRSSAEEAK
FT                   LILEGSVPRVDAYEYPIGNENRLVVAVREPVGVVGGALSYNNPVSTFAHKVAPVIAAGN
FT                   TVVVKPSSYTPLTALKFLEIMKRAGVPEGVVNVVVGSGEEIFDELIQSDKVAGINFTGS
FT                   TAVGLQVAAKAASRGKKFMIAPGGSDPAVVFKDADLDAAAKIIARARYENAGQNCNATK
FT                   RVFVEREVYPKFVELLLGYVKAIRVGDPMDYSTDMGPLISEKMVRAMDSVVKDALEKGA
FT                   KLAAGGRRMNRRGYFYEPTVLLFDGDAEAKALREEVFGPVLPVVPFEGEEEAVRLANAT
FT                   QYGLQSAVFTSDYRKALRVARAIKAGAVMINDSTRVRFDALPYGGVKMSGFGWREGVRS
FT                   TMIYYTEPKFLVFGL"
FT   gene            245127..247016
FT                   /locus_tag="Pisl_0250"
FT   CDS_pept        245127..247016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0250"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pai:PAE2474 acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87430"
FT                   /db_xref="GOA:A1RR48"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR48"
FT                   /protein_id="ABL87430.1"
FT                   /translation="MSAEFIEVYKKSLEDPIGFWEKQAERLYWRERWKKTYDDSNPPFY
FT                   RWFVGGKTNISYNALDRHVKGGRANKAALIWVSADGATRVLRYWDLYREVNRFAVFLKS
FT                   LGVERGDRVAIYMPMIPEAMVAMLAVNRIGAVHTVIFSGFGPQALAERIKDAEAKVVIT
FT                   ADGMRRRGRVIPLKPTVDEALKIVGNDIFTVVYKHTGVEVPMKQGRDLWWQEEIAKIPP
FT                   NTYIEPEWVPGEAPLFILYTSGTTGKPKGILHLHGQYMVWVWYAFNHLTGAEREFREDI
FT                   VFFSTADIGWISGHHYGVHGPLLNGLTVLWYEDAPDYPHPGIWWEIADTYKVTHMLFSP
FT                   TAIRLLMKYGDEWPRRYKLDSLMALYSTGEVLNEEAYNWMRREICRGRSDCQIADIWGQ
FT                   TETACFVTAPGSMNLGGFRYKYGSVGMPYPTLNLQILDDDGKPLPPGAKGHVVAKPPLP
FT                   PAFLHTLWRDPERYVKSYWSRFPGYYYTGDLGYIDQDGHLHIMGRSDDVIKVAGHRLST
FT                   REVEDILTSHPAVAEAAVVGVPDEVRGEVLGVFVVPKQGMKITEEEVVKHLRNSLGPVA
FT                   VVGKVVILDKLPKTRTGKVMRRVLRAMATGQPVGDLSTLEDEEALEELRKKLS"
FT   gene            complement(247142..248230)
FT                   /locus_tag="Pisl_0251"
FT   CDS_pept        complement(247142..248230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0251"
FT                   /product="succinate semialdehyde reductase (NADPH)"
FT                   /EC_number="1.1.1.-"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sto:ST2056 alcohol dehydrogenase / formaldehyde
FT                   dehydrogenase (glutathione)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87431"
FT                   /db_xref="GOA:A1RR49"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR49"
FT                   /protein_id="ABL87431.1"
FT                   /translation="MKAAVLFQYNTPLVIEDIDIEKPKEGEVLVRIKSAGVCHSDLYVL
FT                   EGATPVPTPVVSGHEAVGVVEEVGPGVKNLQPGDWVVTSFVWPCGRCRNCVRGRENLCE
FT                   TFAQVRLKGTLLDGTTRLRKRSGEEVRAFLGGTWAEASVVPATAVAKLPEGLRGRQELA
FT                   MLGCAFLTAYGAVVNSGSVSPGDTVVVVGTGGVGLSAVQVAKAVGARVIAVGRNPDKLK
FT                   VAAELGAEVVNTREGDPVKAVRDLTEGRGADVVVEAVGNDDTIQMAVDMAALGGRVVLV
FT                   GLMPVGHKTPLGLARVVRGGIQIVGSYGARPRVDLPAVVDMVKRGLLKPEKLAGPTYRL
FT                   EEINQAVEALRSGKAIRPLVVP"
FT   gene            248332..249717
FT                   /locus_tag="Pisl_0252"
FT   CDS_pept        248332..249717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0252"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: protein of unknown function DUF557; KEGG:
FT                   pai:PAE3416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87432"
FT                   /db_xref="GOA:A1RR50"
FT                   /db_xref="InterPro:IPR007566"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RR50"
FT                   /protein_id="ABL87432.1"
FT                   /translation="MIPRLMCTQHPDATVKVTANEEVDEALVAYTAYGCDEVMIDYEGK
FT                   TTPYSQPKDITVKAYEAGLPLGEKFFLTPRMPNPRLEEFERSMLTLEAAILANYFSVKL
FT                   MGRQAIRWIVLPMVTDIETLGLVYRMLLHKTEAYIKETGVKLEPPELIPLIEDAIAQLK
FT                   ADELISGLLKQMAQQPQYIRLFLGKSDSAVRHGHLASALAIVATLSKMRSVEKSLGIKI
FT                   YPILGMGSPPFRGGINNPSLSHLETIQYVGYYTVTVQSAVRYDTSYDEYIKVRETILNA
FT                   CCLPSREINLPELEEIITKASSTYKSVVVKFADRIVQMARLIPGTRDRISWTVYGRNIT
FT                   AEDRVVNMPRAIVYTSAWYAMGLPPTFLDAPTVVELAKSDKLDLVLKALPSLRREWEYD
FT                   AQFYDPQVASRYTSEDFVKVVNEMLDYLGINLRANGTYLSLLRMNRNESNILAMGKYRK
FT                   FLG"
FT   gene            249720..250142
FT                   /locus_tag="Pisl_0253"
FT   CDS_pept        249720..250142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0253"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   sso:SSO2588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87433"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR51"
FT                   /protein_id="ABL87433.1"
FT                   /translation="MGDRVKYYIKREPITVPPGTTLKEAVEIMARNNIGLVVIVDQSRR
FT                   PIGVLSERDVIRALAAGKSLNTPVEEVGTIGNLLTVRKDDDIYTAVKAMRSRGIRHIIV
FT                   VNEDGTIAGVLSIRDIVEDRALKAIGDKIWWPPPEE"
FT   gene            250118..250528
FT                   /locus_tag="Pisl_0254"
FT   CDS_pept        250118..250528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0254"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE3588 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87434"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR52"
FT                   /protein_id="ABL87434.1"
FT                   /translation="MVASARRVIELIRREPIVALPTETLVGVAEKMAENNIGAVVVISP
FT                   QDPKKPVGIITERDIVKAVSMHMPLSTPVEAFATNRLITIDENETVEKAAELMLMYNIR
FT                   HLVVVDNVGRLRGVISIRDVLKALYGKELLHR"
FT   gene            complement(250616..251044)
FT                   /locus_tag="Pisl_0255"
FT   CDS_pept        complement(250616..251044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0255"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2382 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87435"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR53"
FT                   /protein_id="ABL87435.1"
FT                   /translation="MKAGDLAKRPPVILINKASIRDAARVMAEKNVGLVVIVDPLDYSH
FT                   IIGVVSERDIVKAVALNINPLEPVEKIMSTPVITADVEEPIQNVARKMRVFNVRHIVVT
FT                   KEGRLYGVISIRDLIREREVLKSLAEYEEPVEIFPSGD"
FT   gene            complement(251104..251655)
FT                   /locus_tag="Pisl_0256"
FT   CDS_pept        complement(251104..251655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0256"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: sto:ST0682
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87436"
FT                   /db_xref="GOA:A1RR54"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR54"
FT                   /protein_id="ABL87436.1"
FT                   /translation="MCLLITCMDYRLSEEVLRRVRPGDLVIRTAGANVRGVARSLAGLP
FT                   VQEVLYLPHTDCAALKLVYSALSQGQPADPQVEEALVSQYRGRRPADLEELERLHVETQ
FT                   VAILRTLFPHARITVETIDVSKIRWPPRKPIYHLLKPQSRYTQDMIGAYIIQAFKIEDV
FT                   KADIKIAEFLGLSLSLNELV"
FT   gene            complement(251779..252333)
FT                   /locus_tag="Pisl_0257"
FT   CDS_pept        complement(251779..252333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2549 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87437"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR55"
FT                   /protein_id="ABL87437.1"
FT                   /translation="MQIFRPYRDHARSAAFLDDRRLGKQRAEAKQVILAILRRRGSTRR
FT                   EESWLNHPIVLMYDAGPYINDLVAYFHAAVEEWRRRGRRNSVSLADVQHLIAQLPSAPG
FT                   TPITHTHEVEYRRILLLKDPCHYLGKMTEEELAEVLETEPTPIPGVNTWIFQIWGRYRE
FT                   FVEALKRGQVDCRGIFPRRGR"
FT   gene            complement(252356..253198)
FT                   /locus_tag="Pisl_0258"
FT   CDS_pept        complement(252356..253198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0258"
FT                   /product="phosphate ABC transporter membrane protein 2,
FT                   PhoT family"
FT                   /note="KEGG: pai:PAE1395 phosphate ABC transporter,
FT                   permease protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87438"
FT                   /db_xref="GOA:A1RR56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR56"
FT                   /protein_id="ABL87438.1"
FT                   /translation="MRRAVNAAGLALFAALGLLSLAPLALVVGDVLYRGLAAMWKLGPG
FT                   FLTALPPTPLDESGGVGPALVGFFLGFPLGVYIGEYRWELAARLARVGVNVLVEFPTIT
FT                   IGLFVYSLSGLLTPALRALPRPPPPFDLFVGPPSVFNAYAGAAALALIMTPYVALFTAS
FT                   AYASVAAGLREAVYSISGGERKALFVAMRKVLSRVITAAALLGTAKIAGETAPLLFTAG
FT                   YSNYYGPFTRETASIPVLIYRSALAPYPIYHEVAYAAAALLLLLVLATYALAQLAAKR"
FT   sig_peptide     complement(253121..253198)
FT                   /locus_tag="Pisl_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.603 at
FT                   residue 26"
FT   gene            complement(253195..254073)
FT                   /locus_tag="Pisl_0259"
FT   CDS_pept        complement(253195..254073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0259"
FT                   /product="phosphate ABC transporter membrane protein 1,
FT                   PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pai:PAE1396
FT                   phosphate ABC transporter, permease protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87439"
FT                   /db_xref="GOA:A1RR57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR57"
FT                   /protein_id="ABL87439.1"
FT                   /translation="MTAEALILLFFLYAASALFLFFTRLRAGLRLLALAVPAVVAAMVA
FT                   VFLAGALPALSREGLSLFTSSLWSSNDERYGLLGALWGTFITTAVALPLAAAMAVSFAV
FT                   FVNDIAPAGLRRGLSAFMDLTAAVPTVVYGLWGVAFLTKFIPPSLLAASLLLAAIITPY
FT                   AAAVIREGYASVPREIAEAIYSLGATKFEAALVKLRYIRNYVLGGVFLALGRAVGETVA
FT                   VSMVVGGNPSSGVTLNLLSSGVTISSLIALQMPYADATAYMKPALMAAALLLAVAGLAI
FT                   NAAAVYLLFKK"
FT   sig_peptide     complement(253903..254073)
FT                   /locus_tag="Pisl_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.822) with cleavage site probability 0.413 at
FT                   residue 57"
FT   gene            complement(254070..255341)
FT                   /locus_tag="Pisl_0260"
FT   CDS_pept        complement(254070..255341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0260"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: pai:PAE1397
FT                   phosphate-binding periplasmic protein, putative; TC
FT                   3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87440"
FT                   /db_xref="GOA:A1RR58"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR58"
FT                   /protein_id="ABL87440.1"
FT                   /translation="MERKILYIGAVVALAIVVAVVGLYLGQQTTQPTTPTPAQQTQTTP
FT                   QPAQTTAQTPQSSPPQTSTQQPQASLPGCGEVSGQIVAGGATFPGPQYDAWIKQFSEIT
FT                   GGRVKITYNYLGSGAGQAGLIKGELAFAGSDLPLAPARFQEQRGKILQFPVVMGGILVV
FT                   YNVPEVAYEKTGKRLNLTAEIIGDIYMGKIRYWDDPKIKAVNPALADRLPRQPITPVHR
FT                   SDASGTTGWFTLFLTKAYPLWNQTVGWGLSVNWPVAQMGVSRAGQGNPGVAQLVLNTPY
FT                   SIGYVEYNYWVTQRQKFDAVGGYALVQNGNDGKFYDPTPEAIAEAASEGLRQVAAKMGG
FT                   FPSASDDWWQVVQLFAYPPRGYPIVGLSFAMIRTDYSGYPDPNTAAVVKCFFRYVLTEG
FT                   QKHLVEGYLPLPPELAQVGLKAVG"
FT   sig_peptide     complement(255261..255341)
FT                   /locus_tag="Pisl_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.611 at
FT                   residue 27"
FT   gene            255486..256325
FT                   /pseudo
FT                   /locus_tag="Pisl_0261"
FT   gene            complement(256290..258002)
FT                   /locus_tag="Pisl_0262"
FT   CDS_pept        complement(256290..258002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0262"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein, HSR1-related; nucleoside recognition
FT                   domain protein; KEGG: pai:PAE0323 iron (II) transporter
FT                   (FeoB-2) part 1, conjectural, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87441"
FT                   /db_xref="GOA:A1RR59"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR59"
FT                   /protein_id="ABL87441.1"
FT                   /translation="MATLRYALAGPANVGKSSLFYALTGIYVRTANYPGTTVEIRRASI
FT                   RRGGVTIEVVDLPGIINIKSPVDEDERVAFREAFEGTYDGVVVVAAPHAIKEAIELAKL
FT                   VSQKKPVIFVYNMVDLAKPPWTEEELSKILGVPVVFTSAVKRVGINKLTELMTKGAGGK
FT                   ITGDVHIEVPAVAALKTGIFARPPFAVATLLSLGLAMLFFLLAFMEGVTPFGEFPYAFI
FT                   PTWDSISESVAEAIKASVGDPVLASLLADGLWDALSTVVSISVYVLVALALVLFFEDSG
FT                   LIGLLTYKLERRLAALGIPPRGVVCLLVGASCNVPAVSTARVLWGHGNRLLTALLVSYV
FT                   PCVARLAIFTAVAVAALTKTPYLIPLAIFLPYAAAFAIVWVASAVYRLMLGVKPAPAGE
FT                   VPPTPLMLPNGRIYLTKLAISMKDFLIKVVLLIAIFVVALWPLTHFGPSGYTEDMAASY
FT                   LAEFGRAIEPLFAPLGLPWNVAASLVGGWVFKEVVLGLMEGLKALDALAALPLPSVLAF
FT                   LVFSAFYSACVATLAAAYRTAGAKATALSAVVQLALAYAAAYLVFVATSVLAH"
FT   gene            complement(258836..260470)
FT                   /locus_tag="Pisl_0263"
FT   CDS_pept        complement(258836..260470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0263"
FT                   /product="propionate CoA-transferase"
FT                   /EC_number="2.8.3.1"
FT                   /note="PFAM: coenzyme A transferase; KEGG: pai:PAE2827 coA
FT                   transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87442"
FT                   /db_xref="GOA:A1RR60"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR60"
FT                   /protein_id="ABL87442.1"
FT                   /translation="MIKKFVSAAEAVSKIPDGAVVVISGFNASTAPFYLIDVLLKRYIE
FT                   TGRPKNLFIISDAIPAVPGFGIDKIGKLILENPGQEFVRGFLLPFYGWAPELQKAVMKN
FT                   LVEAYTWPIGIVTRWLRATAVGIPGVFSRVGLGTFLDPRQDGPYLNDLARERKTVRIDL
FT                   VEIDGREYLLYKAPKPNVALIRATTADEIGNLSMEQEAIYGSVLSIVEAVKAHPGGLVV
FT                   AQVLRVVTLGEIHPKHVFVPGPLVDYVVIARRGTEVEKYHWQTASFDLNPVISGDAPYR
FT                   VVHEPMPLTAEKVVARRVVVELVRLIKNLGRPVIVNLGIGIPALAADVIREERLDDFIH
FT                   MTVESGPWGGVALTDVDFGAAMGHYAVIPMPEQFILYEGGAIDASSLGFLQIDKEGNVN
FT                   PAFLPGRMPGPGGFPIIAIGSPRVFFAGGFTAGRREIKVKDCRLVIEEDGAIIKFVNKV
FT                   YKIVFSGRYAREEGKEVWYITERAVFKLTQNGVELVEVAPGVDVERDIFNKMEFKPIIR
FT                   RVEEIDRRIFCEQRMGLREEALEIVKK"
FT   gene            complement(260989..262122)
FT                   /locus_tag="Pisl_0264"
FT   CDS_pept        complement(260989..262122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: wsu:WS0707 molybdopterin oxidoreductase,
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87443"
FT                   /db_xref="GOA:A1RR61"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR61"
FT                   /protein_id="ABL87443.1"
FT                   /translation="MKPSALLLGMLVIGVILTAIGIWGWFMRYNNMYAGYLWSFMVITY
FT                   AFFAASATGSSLVTAMHTVFGYNGGFKKVARYLIAISLITALPAFPTIIGDLLNPSAFM
FT                   YMFTSVNPESRMAWMGILYVIYSLILLIELILEMRHKMGVGMGIFALAVQLLTLMNLGA
FT                   IFGSSYGVPAWYGVFSPVLFVAAAFLLGFAFQIVGVSIAEKVYYGDVRAEVKDLLFRVH
FT                   AKGIVTVLLVFLFLLFWYFAVGWFSPPVYVAQQEMFNYSLWTIVLGGLISLALASAALA
FT                   KRSLGTLVFTSLVLIVVVFTSLIYYVLYGQIGQAIWLYDFKAPPDVLKMTVEEFFSQYD
FT                   WMPALMSPGLWLLLYPLAVMLLALKEDERPRRLFIFR"
FT   sig_peptide     complement(262057..262122)
FT                   /locus_tag="Pisl_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.420 at
FT                   residue 22"
FT   gene            complement(262119..262817)
FT                   /locus_tag="Pisl_0265"
FT   CDS_pept        complement(262119..262817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0265"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE2837 molybdopterin oxidoreductase,
FT                   iron-sulfur binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87444"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR62"
FT                   /protein_id="ABL87444.1"
FT                   /translation="MRPVFVIDINKCVGCMACVAACSVENGVLFIAAKDTSKYLPIHSK
FT                   TRTVVVWKEEEKEKPARRFVPYLCNHCEKAPCLEVCPTQATYKTKEGIVLIDKDKCIGC
FT                   RYCIMACPYGMRYTPPAMETKELMHLDFMKDAEAGVNYGGVMFQPPVSNKWAVKIRTVD
FT                   KCTFCYHRKTSDDKLWTPACVEVCPTKARSFGDLDNPNDPVADLVRRGIAKPIAPSKGT
FT                   GGLVYYVGGV"
FT   gene            complement(262814..266011)
FT                   /locus_tag="Pisl_0266"
FT   CDS_pept        complement(262814..266011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0266"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: pai:PAE2840 molybdopterin
FT                   oxidoreductase, molybdopterin binding subunit part 1,
FT                   authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87445"
FT                   /db_xref="GOA:A1RR63"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR63"
FT                   /protein_id="ABL87445.1"
FT                   /translation="MSRFFLLMEISRREVLKAGATIGLIGGVSGILLKAAVEQSKAEAA
FT                   SAVTSVPSICGMCMAQCAIYIDVVDGKPVRIRPNTNAPTSAKGICARGVAGTFNAWLNP
FT                   DAIKKPMARRALVDWAQGKISWEEAKRQLVTNRGKYDDMVEVDWNTAIDIIAKKLKELA
FT                   DNNERHAFTFLFGAWGPVASMRAGVPLMRFADTYGGGVITFDNPYCTYPRYLGHWLTWG
FT                   HGHQAHVACIDYGEAEAVLVVRRNVIGAGVVTETWRFMEAVRRGAKLVVLSPVFDETAS
FT                   YADVWLPVKPGTDLAVLLAFIKYVLDNGYYMAEYLRRFTNAPFLIKPDGLPLLASEVDW
FT                   GKYGVKEPAFAYVVWDEAAGGPAPDNAAQRAALFGEYEVALKDGSVVKAKTALQILKEW
FT                   VDANLSALAQKHGVKDYMEAAAREADVDVNDLRRAAEIVAKYRAVSPIGWHDPRYSNSP
FT                   QTWRAVGVLMALLGRIQQPGGLFLLTHLIMPYADVYTKVMKYTKKDVPYKTIRGLTFGE
FT                   YVSANLRGIYVIPIAPPLPGPSDRDAPPVKSLTEVWGEEAEKKGYLYPYDTVQALYESV
FT                   VHGKPFKIKVVFITGSNPIPRIGNSRLVEEIFRNLELVIVHDIQFNDTTAFADVILPDL
FT                   PYLERLDLALPGPFSPFPAISVRFPWYYEEYKKKLAAGGKPGELDKAFRSRDGRTAFEV
FT                   LLMIARRLSQLGVKPRDGTEWSQNMPVGMITEEGIFPIPNLERFINAQLRRVRIVDEAG
FT                   NVRAPTVEDIYKMGGYMVLVPTGRVEAVKDELWSKALGRDVVVRVHVYKPVKYSVDLEE
FT                   WLWRTIHYNSPMARGEVPLPTPSGRVEIYSINLAYDVRRVFGKPATSIDPSDLEGKKSG
FT                   VDPLFSPVPLYAGMARPDYMWATGPATEDVEINGLVPPEPPKRLLLVYRHGPYTHTHSN
FT                   TQNNLLLDTLTSSELLSAWIHPDTAAALGVKDGDWIEVRPAAPKVAKQLESVGVKEVPT
FT                   ARFRVRVTPMVRRDVVAIYHYWLVPRGRLRVKAWKLADVRAGYSDDNYLGPMLAGKLGT
FT                   PGAMGNTVVEVSRVGGL"
FT   gene            complement(266091..266903)
FT                   /locus_tag="Pisl_0267"
FT   CDS_pept        complement(266091..266903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2775 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87446"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR64"
FT                   /protein_id="ABL87446.1"
FT                   /translation="MCTLYGREGYHALFLKPIAAALGCRYVALDYLTLYRRFKSGAEGI
FT                   YYIEEPWVYARDTYAPEPPGQLPPQLGYLRRRMYPLLGNVHVFFTDGLYNYATEAPCGR
FT                   VGLLAKEGEPMVTDLLLPLYLETGSVEKALAAAKRLYRCGLPESRGELVEGVKAGRYAA
FT                   GYIWLAWASGLDVELRPYPTAGWALSGFWGLAFLEAPLYAHGHPPPYLERLRGRARRLV
FT                   EAARPARGRSWMEFVETAHVTMAQYLRGTLQLDVAIKALREIEKHLEI"
FT   gene            266930..267985
FT                   /locus_tag="Pisl_0268"
FT   CDS_pept        266930..267985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0268"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Anthranilate synthase component I and
FT                   chorismate binding protein; KEGG: pai:PAE2460 anthranilate
FT                   synthase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87447"
FT                   /db_xref="GOA:A1RR65"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR65"
FT                   /protein_id="ABL87447.1"
FT                   /translation="MGARAYFEYGGRRLYVEGRAVYSLEEAVAEAQRGRAVVGVFAFDA
FT                   VSPWDDGFRPPPRPGWPTYLFVVGEEGEPPAWGGDYGARLVYEEPRGLFERRVAEAKRA
FT                   LEAGEVFQLVVARFRQYRFAGSPEALFNAVRRAVGGKYYYFVEVDGLFLVGASPETLVS
FT                   CWGGRAVSGPIGGTRPRGRTPEEDAALETELRESVKDRAEHIMLVDSVRNDLGRVCRWG
FT                   AVSVSSMLAVEKYSHYQHLVSYVECQLDKFYRPVDAVRALNPTTTVSGVPKPRALELLS
FT                   QLEEPRGPFAGSVGVVARDGVEFAVVIRSVYGIDGDLYLWAGAGIVTDSKPHAEWEETE
FT                   VKMAPLAKLLT"
FT   gene            complement(268193..270259)
FT                   /locus_tag="Pisl_0269"
FT   CDS_pept        complement(268193..270259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0269"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; General
FT                   substrate transporter; major facilitator superfamily MFS_1;
FT                   KEGG: pai:PAE2866 sugar transporter, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87448"
FT                   /db_xref="GOA:A1RR66"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR66"
FT                   /protein_id="ABL87448.1"
FT                   /translation="MTTVYTFRQLVSVAGISWLGAFLEWLDFYTFATLAPLISGKFFPS
FT                   KDPIAALLSTFVALAIGFLFRPLGAILFGKIGDQYGRKIAFTLAMTLMLVGTLGIGLLP
FT                   TYDQIGILASIGVFVLRIIQGLALGGGFGAALVYLGEFAPEHRRGFITGFLFTTAPAGM
FT                   GTAALLQVIIASMVGKEAFSQWGWRLNFIVAGVVVFVVALVIHFFYKETPIFSMLKAVR
FT                   RVTSAPVREVFSGKYLPFVLLAWIGVVGAHGPVWYTNQLFNSYYVSTFQKYVDSSTANA
FT                   LLSTATYAALWMYPLFGYLSDKIGRKPILLLGIFGNALWFPIAFWLIDKVGPQKDLTAM
FT                   WLLFWSMTLFNGIGYSGAMSAYLLELFPARIRLSAVSLSYNLGYGVTGGLTPTIITALY
FT                   QATHNIYLSTILWSTLVPVLMGLVLLFKGWETLGTRIWAELAAGKFAKKAVVLPPTAPI
FT                   RAATQKMAEGVRAVVIAASKPVGVFGRRQLIRALASGATPEAEVGRFATRVDCVSEDAP
FT                   LTEVFAAMEKYGVRDVPICKGDEVVGIIEARELLNEALALRSIVNKKKALNVSAGDAVA
FT                   RDPITVPPSATLRDVLKIMAEKNIGFVPVVEDGRLVGGISESDFVQILLNNTPLDTPVE
FT                   KVMRRQLITIEKTRPVKEAAELMVKHNIRHLPVVEDGRVVGVLSVRDLLKAVA"
FT   gene            complement(270256..272259)
FT                   /locus_tag="Pisl_0270"
FT   CDS_pept        complement(270256..272259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0270"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: pai:PAE2867 acetyl-coenzyme A
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87449"
FT                   /db_xref="GOA:A1RR67"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR67"
FT                   /protein_id="ABL87449.1"
FT                   /translation="MHQVLKEELPFNEYVINERWKSRLIDINAYKALHTKSLEQLEEFW
FT                   ASIARELEWFKPWDKVLDASNPPFYKWFVGGKLNLSYLALDRHVKTWRKNKLAIEWEGE
FT                   PVDENGNPTEQRKLTYFDLYREVNRAAYMLKHNFGIRKGDRITLYMPMIPELPIVMLAA
FT                   WRIGAVTSVVFSGFSAEALAERINDSQSRIVVTVDGFWRRGKVIRLKEIVDQALEKVGT
FT                   VENVIVYRRLGLKDVPMTEGRDYWWHKVMEGIKANAYVEPEPLESEHPSFILYTSGTTG
FT                   KPKGIVHDTGGWAVHVYATMKWVFDLREEDIYWCTADIGWVTGHSYVVLGPLMIGATQV
FT                   IYEGAPDYPQPDRWWAIIERYGVTILYTSPTAIRMFMRYGEEWPRRHDLSTLRIIHSVG
FT                   EPINPEAWRWAYKVLGNENVAMASTWWMTETGGIVISHTPGLYLIPMKPGTNGLPLPGF
FT                   DVDVFDDNGKPAPPGVRGYLVIKRPWPGMLHGIWGDPDRYIKTYWSKFPGVFYAGDYAI
FT                   KDQDGYIWVLGRADEVIKVAGHRLGTYELESALVSHPTVAEAAVVGVPDPIKGEVPIAF
FT                   VVLKQGVMPSDELRKELRDHVRKTIGPVAEPAHIFFVTKLPKTRSGKIMRRLLKAVATG
FT                   APLGDTTTLEDETSVEEAKKAYEELRREIARG"
FT   gene            complement(272346..273257)
FT                   /locus_tag="Pisl_0271"
FT   CDS_pept        complement(272346..273257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0271"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: homoserine dehydrogenase; homoserine
FT                   dehydrogenase, NAD-binding; KEGG: pai:PAE2868 homoserine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87450"
FT                   /db_xref="GOA:A1RR68"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR68"
FT                   /protein_id="ABL87450.1"
FT                   /translation="MILLFGFGGVGRTYAELLYERTDVRIVAVFDSGGGTLKKGGFTSA
FT                   EIKKLLNAPRGKVSQVFGKPASIDEALEEAEVVVDVSPPNYVTGQPAVDLYRKALASGK
FT                   AVVTANKAPLALYFDEFEGKPIYYKATVMAGTPLLDLISGLLPQKVLKIRAILNGSTNY
FT                   ILTRVYKDGISDQEALEEAKKMGILEPDPALDLGGLDVAAKLTIILNTLGISTRLSDVN
FT                   RKPLAFLGPITKYLAIWESGKAVVEPVRLSPDDLLARVDYTFNAVEITTEVNTIFISGK
FT                   GAGRRETAFVLINDTLKALKKS"
FT   gene            complement(273286..274302)
FT                   /locus_tag="Pisl_0272"
FT   CDS_pept        complement(273286..274302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0272"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: pai:PAE2876 aspartate-semialdehyde
FT                   dehydrogenase (asd); TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding; Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87451"
FT                   /db_xref="GOA:A1RR69"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR69"
FT                   /protein_id="ABL87451.1"
FT                   /translation="MDRLKVYILGATGLVGQRYVQLLAKHPWFEIVGLAASEKNAGKTL
FT                   AQTGWVLEEPPPPHIAEMKIERLDVEKIPRVDFVFSALPSEVAAKVEPQLATRGHMVLS
FT                   NASNMRMDPDVPLVVPEINPEDVSLLERQRVERGWSGGVVKKPNCTTTILNLPLKPILD
FT                   EWGIERIHVVTMQALSGAGYSGVPSVAIVDNLIPYIRGEEEKVAAETKKILKTDFEIYV
FT                   TTTRVPILDGHTEVVYVDTRKDFDPTAVADALAKFKGLPQELKLPTAPERPIEVRPQID
FT                   RPQPRLDRWAGGGMAVVVGRIRKLAPRKLAFVVLGHNTVRGAAGNSILTAELLVKMR"
FT   gene            complement(274290..275297)
FT                   /locus_tag="Pisl_0273"
FT   CDS_pept        complement(274290..275297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0273"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="PFAM: aspartate/glutamate/uridylate kinase; KEGG:
FT                   pai:PAE2877 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87452"
FT                   /db_xref="GOA:A1RR70"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR70"
FT                   /protein_id="ABL87452.1"
FT                   /translation="MKPVVKIGGSLLRTAGDFLKAAEFISLFKEPPVVVVSAIKGVTDM
FT                   LLELEKTRSYLLYEEILHKHLAVARLLGVEEKITPMLKELEEALKLPRAEWTADYFASF
FT                   GERLSATILYAVCEKKGIPAKLFIAPIRTNSRFGNAEPLQLEQKEEIADGNTVAVVTGF
FT                   IGRDGEGRYTTVGRGGSDYTATYIGKEIGARKVSLVTDAPGVMTADPKEVEDAEVLPLM
FT                   SIQEAIEAAKAGAKNFHPRTFIPVIEADMSVEVRSYNSRGTLISNIYSPPPYKIVIRCG
FT                   QGSCVIGLAAYELTKLGGVPLGAYSIKIDIPPRQAHEYLIKPYIKHIKSYIWTA"
FT   gene            complement(275294..276505)
FT                   /locus_tag="Pisl_0274"
FT   CDS_pept        complement(275294..276505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0274"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   KEGG: pai:PAE2878 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87453"
FT                   /db_xref="GOA:A1RR71"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR71"
FT                   /protein_id="ABL87453.1"
FT                   /translation="MRGCYVFAYIEKIIKSCFLNRYGGDFGDSSYLRCVNCGAVYASNF
FT                   RLYRCPKCGGLLDVVVRDKYWAPKGRGVWRYASMLPLKNGVSLGEGMTPLVKSNLGENL
FT                   YIKFEGANPTGSFKDRGMALGVTIAKESGASKVVVASTGNTAASAAAYAARAGLKCYVV
FT                   LPRGNVARGKLIQAALHGAELVMVSGLFDKALEYVVTYGTKYAYPLNSFNPWRLEGQKT
FT                   LAFEIYEELGCPDYVIVPVGNAGNISAIWKGFKELGELGLCKKLPKMVGVQAEGAAPLA
FT                   TAWQKGLKTPFFIDEPETVATAIKIGKPINWPKAMAAVRESEGFFTTVSDGEILKAQKL
FT                   LASKDGVGSEPAGAASVAAALKLKLSGTVVAVVTGHALKDPDVVEINAKEVRNAEELVE
FT                   LLER"
FT   gene            276602..277294
FT                   /locus_tag="Pisl_0275"
FT   CDS_pept        276602..277294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87454"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR72"
FT                   /protein_id="ABL87454.1"
FT                   /translation="MGLCGVYGSGARGESGAIYLLTDSPTVSERYIADALTSRGFNTVI
FT                   VNISETPLHRIPGVAFLRIKNPYAAVVYGSLAEHSINPPSGIIAALNRLSWLPKFGPPY
FT                   AVVLSDFSVEKVEIERPWVLLTAWKLALDGSVTSVEGAKSVIEHRMYMRNPLAKVSVVI
FT                   PKPHRLVSIFATIKHASGLAEDILSHLGLFYAKITLGDYGGKLYVVDIDPVPPLETKEE
FT                   AALVAELI"
FT   gene            277291..278349
FT                   /locus_tag="Pisl_0276"
FT   CDS_pept        277291..278349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0276"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: pai:PAE2881 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase / N-acetyl-gamma-aminoadipyl-phosphate reductase;
FT                   TIGRFAM: N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase, NAD - binding; Semialdehyde
FT                   dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87455"
FT                   /db_xref="GOA:A1RR73"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RR73"
FT                   /protein_id="ABL87455.1"
FT                   /translation="MKKVCIVGASGFTGGELLRILLQHRGVEIVCATSRRFKGEYVYRV
FT                   HPNLRGFTQLKFVEPSIDVALKADVVFLALPHGESVKWVPKLYESGVAVFDLSADFRLK
FT                   DPNAYVEWYKWPQPHPYPDLLQKAVYGQPELHRDELVGAKLVAVPGCMATASILMLAPL
FT                   AKFGLLSDTPPVVDAKIGSSGAGAEGSVVDLHSFRTYVVRPYEPVHHRHIAEIEQELTR
FT                   LAGRKVRIAFTPHAVDIVRGIFTTGHVYVEKLPSETDMWRYYRALYGDSKFIRIVKDRL
FT                   GISRYPNVKYVLGTNIVDLGFELDPRLNRVVTFAAIDNLVRGAAGQAVQAFNIAMGFPE
FT                   DEGLRQIPIAPL"
FT   gene            278346..279131
FT                   /locus_tag="Pisl_0277"
FT   CDS_pept        278346..279131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0277"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: pai:PAE2882
FT                   acetylglutamate kinase / acetylaminoadipate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87456"
FT                   /db_xref="GOA:A1RR74"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037529"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RR74"
FT                   /protein_id="ABL87456.1"
FT                   /translation="MIVIKVGGSVVCKDVSKVIQNLPKYADRAIIVHGGGCLVNEMLKR
FT                   LGIEPKFLTHPGGLTSRYTDLETLKVFVMAMSWINKQIVASLHALGVEALGLTGADLGV
FT                   VRAKRKEKVLIVDERGRQRVVDGGYVGRVVHIAADRLKPPPLKVLSPIAVSEKGELLNV
FT                   DGDQLAFDVAKAVGARQLVLLSDVDGLIIGGRVVPHLTAEEAEELVKSEEVRGGMKRKL
FT                   LMAAEAAKSGIEVVISNGLVENPIDVALNGSGTHIVKNL"
FT   gene            279201..279386
FT                   /locus_tag="Pisl_0278"
FT   CDS_pept        279201..279386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0278"
FT                   /product="putative lysine biosynthesis protein"
FT                   /note="KEGG: pai:PAE2883 putative lysine biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87457"
FT                   /db_xref="InterPro:IPR005906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR75"
FT                   /protein_id="ABL87457.1"
FT                   /translation="MATQKLVVKCNVCGTEFELPEDVMDGEITSCPTCGARYIVRIKGG
FT                   AVSLEEFKGDVEDYGE"
FT   gene            279621..280589
FT                   /locus_tag="Pisl_0279"
FT   CDS_pept        279621..280589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0279"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG: pai:PAE2884
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87458"
FT                   /db_xref="GOA:A1RR76"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR76"
FT                   /protein_id="ABL87458.1"
FT                   /translation="MNGMYEGLYPLGTALARPLIAAKAVDVARRVGADAIAHGSTSKGN
FT                   DQVRFDVTVKALAPDLKIIAPARIWGMTRAEEIEYARRHGLPISEEHKKYSIDDNLWSR
FT                   SIEGGPLDDPMAEPGEDAFKWTVSPEKAPQEPVYITIGFKNGIPTSINGEKMDMVSLVT
FT                   TLNHIGGAHGVGRIDHIENRLVGFKSREVYEAPAAVILFHAHRDLEKLVLTPRELRFKH
FT                   HVLDPQWADLVYQGLWVEPLRNALEKAAKEMERWATGEVRVKLYKGSVQIVGRDSPYGG
FT                   YSKELADYSAGWYPSDEEARGFIEIWSLHSLTALRKRQNKL"
FT   gene            280626..280805
FT                   /locus_tag="Pisl_0280"
FT   CDS_pept        280626..280805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87459"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR77"
FT                   /protein_id="ABL87459.1"
FT                   /translation="MYIFLGAMGQRTVVCPNCKRPVKPVECGRKNQTKRYVVVTYCCPK
FT                   CGVELLTERLEIPT"
FT   gene            280817..282106
FT                   /locus_tag="Pisl_0281"
FT   CDS_pept        280817..282106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0281"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="PFAM: fumarate lyase; KEGG: pai:PAE2887
FT                   argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87460"
FT                   /db_xref="GOA:A1RR78"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RR78"
FT                   /protein_id="ABL87460.1"
FT                   /translation="MSFYRSWIGEEGELIKRYTSSIKDDVEIAEEVIKVMEAHVKHLAE
FT                   VGIMPKEAADAILKTLKEATPEQLLSSEFEDIHEALEKWLIDRLGEETAGWVGLGRSRN
FT                   DHVAAAIRLAALRKASALRKNVEKMRCILAKKALEYADCAMPSFTHFQPAQAITFGHYL
FT                   LAVDELAAEFLHVLKAVEKLLKRSPLGAGPAGGTRTPIDRERLAKLAGFEDVVENALYA
FT                   SGSRFFALALASAVVSFLTELSRTVDDLIRWNSPLVGYVAAPDSHVSTSSIMPHKRNLV
FT                   TLEVFRARAAEALGHLTALNAVVMKIGLGYSLDLQEATRHLWAVLNMATEGVEIFIDFL
FT                   EKMSFNCVKAREDAERYHSTSSDTAETIALSGVPFRKAYFQLAKEIKEGTARLMSIEEA
FT                   LQRPTRGSANPEEVKKAASTRLVFCREKPL"
FT   gene            282824..283261
FT                   /locus_tag="Pisl_0282"
FT   CDS_pept        282824..283261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0282"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE1827
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87461"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR79"
FT                   /protein_id="ABL87461.1"
FT                   /translation="MLDDALCGFSPLPSWLRNGDRLLNTAAVVVDAMEDDAYRELKEDS
FT                   WRGEKKHLLDGLGQLRRRLKKLTQWHGLLYLEERLYSTICPKRGTKIVEVENRVMKCAC
FT                   GFKAHRDNVPMTWAENRYWELLQKTKQPTFSTLATIKLLTS"
FT   gene            complement(283532..283828)
FT                   /locus_tag="Pisl_0283"
FT   CDS_pept        complement(283532..283828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87462"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR80"
FT                   /protein_id="ABL87462.1"
FT                   /translation="MASVDKKLVKVVAAIPTGHKHLRMALFFDSGDVIVLTEALAAGIA
FT                   RAYIDIVTHPTRRGVVLCVKEIDGKPGYAKIQLVECGGEEDAIREIDTLIRNV"
FT   gene            complement(283800..284342)
FT                   /locus_tag="Pisl_0284"
FT   CDS_pept        complement(283800..284342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0284"
FT                   /product="Protein of unknown function DUF998"
FT                   /note="PFAM: Protein of unknown function DUF998; KEGG:
FT                   pai:PAE2889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87463"
FT                   /db_xref="GOA:A1RR81"
FT                   /db_xref="InterPro:IPR009339"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR81"
FT                   /protein_id="ABL87463.1"
FT                   /translation="MLGKILLVLGSLQFIVVMLIAEQLYPGYNPMYNYISDLGALKAPT
FT                   STLFNTSVILLGLLGLAAATLLRKELGSLGAAILAIAAMGAVGVGIFPEDYGTPHGVSA
FT                   LIAFLFGAITVIIMGFRKGGIYKLLGIAMGAISLVALMLFIPRTQTPLGIGGLERLIVY
FT                   PVLLYFIRYGLSRQKTR"
FT   gene            284409..285413
FT                   /locus_tag="Pisl_0285"
FT   CDS_pept        284409..285413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0285"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: pai:PAE2890
FT                   spermidine/putrescine transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87464"
FT                   /db_xref="GOA:A1RR82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR82"
FT                   /protein_id="ABL87464.1"
FT                   /translation="MFLQNRVGLSVELKDVAVRYGNFLALKGVDLFIEAGESVVLLGPS
FT                   GSGKSTLLRAVAGLIPLARGRVYIGGRDVTDLPPDKRGVSMLFQDLALFPHLDVFENVA
FT                   FGLRLRKLPESEIRRRVRWALELVRLEPSLFEKRRVHELSGGQQQRVALARALVVEPEV
FT                   LLLDEPFSHIDLDIKNQLLEELKILHNRLGFTIIYVTHDRYEAVEIGDRVALIKDGEII
FT                   QVGKPFELYKRPRNRFVAEFFGEANILPASAVGISSGGYVVIRPEDVVIGGATTYKFKG
FT                   QVIDVTFLWHYLKVEIQSDSHVFKAYVDLETPVSIGDVVEFGFDAKDVYIVGE"
FT   gene            285410..286141
FT                   /locus_tag="Pisl_0286"
FT   CDS_pept        285410..286141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0286"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2891
FT                   spermidine/putrescine transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87465"
FT                   /db_xref="GOA:A1RR83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR83"
FT                   /protein_id="ABL87465.1"
FT                   /translation="MIKKIALVAFASVILLFYTPFLAFGYYISEGGSLKLPSLSMVITT
FT                   FLLAVSTAVISIGLAYPAAYYLAKRGSELEFALITAPLWVGTLLKAYSLLVLFAIVEKF
FT                   SGIALWGSPLGVLIGMVYEYLPYALLTLYAAIEKLSETPVYAARVLGASRLQAFFRVEL
FT                   PLTMPGVVAAFILVFLFAMGEVIMPAVLGAWKVYTFGSYIWDLYFKARDIFSGGVLSLV
FT                   LTALSLLATYVVVKTIRSFSL"
FT   sig_peptide     285410..285487
FT                   /locus_tag="Pisl_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            286138..286908
FT                   /locus_tag="Pisl_0287"
FT   CDS_pept        286138..286908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0287"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2893
FT                   spermidine/putrescine transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87466"
FT                   /db_xref="GOA:A1RR84"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR84"
FT                   /protein_id="ABL87466.1"
FT                   /translation="MKILRIYTWALIAMLYIPVALIVALSFNDSKLPYIWGGFTYKWYL
FT                   ALFQWEQAWQALFNSFVIALAVSLVATLLGVFMAYVLRSDKYLAISQGAVVMPEISEAL
FT                   AFAAALWLVKTYVGVDLFGPVGVFLAHLAYTLPMAHVLLTPYIAYVGKSVVEASRILGA
FT                   SEMKTVAFVILPILMPAFIATFLIVFVNSFDTYIKTAFTTSPGFITAPILLWNYAARGR
FT                   GDPTIYALATLMLVPSIAAAVIYFRAIKRYSLSP"
FT   gene            complement(287073..288335)
FT                   /locus_tag="Pisl_0288"
FT   CDS_pept        complement(287073..288335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0288"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE2522
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87467"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR85"
FT                   /protein_id="ABL87467.1"
FT                   /translation="MYAYRTLRIEIPWRLVEERPDVLDLVTRMHLAAEEYARRLLKEIA
FT                   GQEEPKLAPEELDRLLTPDRRELARRIIDEVFLQYGLGKAFVDYAKFLWRDTVFQRAVP
FT                   LNTQLRTENERDTGKTVFVDLKSGVLKVRKLGIPPFVVKLKKSDISWIKRRLEEGAKLK
FT                   LAFLGVEKRNGEKDPTYGGLYIVLVFAREVTQIEPRAIVVVDVNRLDHYIKVGLVVDGR
FT                   VVELQKFPKRGRIRKLEKVHVHISRLSRALARVDEDRDPRKALDLQRQLWKLKTKRYGI
FT                   IRDIVINATREIIKLARERQAAIVVDTIEDDTYRELKERNWSGEKKHLLDGLGQLRRRL
FT                   QALAQWYGLPYLEERLYSTICPKCNAKMVEENGRFMRCPACGFGAHRDNVPMIWAEKRY
FT                   QELIEKTKQPTFSAAATFLTS"
FT   gene            288384..288686
FT                   /locus_tag="Pisl_0289"
FT   CDS_pept        288384..288686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87468"
FT                   /db_xref="GOA:A1RR86"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR86"
FT                   /protein_id="ABL87468.1"
FT                   /translation="MGAGQKFYKTNPRRRRKGGVERRVPAMLLTFAATRAVAVVSNLPT
FT                   LALSILAIPTAALATLTAKTAANPFLNPPTPLNNATTHHFPLPRFTCLTSSLSGR"
FT   sig_peptide     288384..288500
FT                   /locus_tag="Pisl_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.803 at
FT                   residue 39"
FT   gene            complement(289214..290599)
FT                   /locus_tag="Pisl_0290"
FT   CDS_pept        complement(289214..290599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0290"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: pai:PAE2895
FT                   conserved hypothetical protein, authentic frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87469"
FT                   /db_xref="GOA:A1RR87"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR87"
FT                   /protein_id="ABL87469.1"
FT                   /translation="MSVGNHSSIELIKSFLFPSSVAIVGASPNPSSIGGQILVQLLRGF
FT                   KGRVYAVNPKYSVEKIYGKEIQFYKDISSLPEVPELVVIATPAEVALGILEEAGRSGVK
FT                   AVIVVSGGFAEVGRVDLENELIKIARKYGVRILGPNCIGVYNAFNGLDTMFLPIEKAAR
FT                   PRPGPIAFLSQSGAVMTAVLDWAAGEEIGVGIAVNFGNRSDITEADLIQYLGGVEEIKV
FT                   VAIYLEGFRWRGDAMRFIKAVKSLKKPVVVYKAGRSDDSKRAAVSHTAAMAGDYKMYRA
FT                   LFKQAGVIEAEDLVELFDIAKALALYKPTRIEKALVVSSSGGMAVQIVDALNAVGISVP
FT                   ELPQEAQLELKKHLPPVATTSNPIDLTGSGADVHFGKALEVGLKYVDAAVVAALIHPPG
FT                   YSERVADEILVSYEKYGKPIVVVSFGASQQTKILERRLKERLVVVNTPARAAKVLSSLG
FT                   ALL"
FT   gene            complement(290703..290951)
FT                   /locus_tag="Pisl_0291"
FT   CDS_pept        complement(290703..290951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87470"
FT                   /db_xref="GOA:A1RR88"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR88"
FT                   /protein_id="ABL87470.1"
FT                   /translation="MGPLLLVVGLAAAAISDVVLALPNAVFKDGVVWLLVRDISSLIVY
FT                   IVVFDIFMLPLALTARPKPDADVRIIALYMALTAGGN"
FT   sig_peptide     complement(290886..290951)
FT                   /locus_tag="Pisl_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.694 at
FT                   residue 22"
FT   gene            complement(290993..291445)
FT                   /locus_tag="Pisl_0292"
FT   CDS_pept        complement(290993..291445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87471"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR89"
FT                   /protein_id="ABL87471.1"
FT                   /translation="MEKIIIVPPFAQPAFPGGSGLAPPQSRRNPPLPRDCDIRGAAAVL
FT                   AIVATIAESRLEGLCVHLDKADVTTAAAVLLYAKITGTGKVEIRAKPPHVQELYGLIYA
FT                   PTVSYLKPQPPFFNAHHVFRQPRTPLSTTSAHLPHSDAVRQVCRGS"
FT   gene            complement(291546..292793)
FT                   /locus_tag="Pisl_0293"
FT   CDS_pept        complement(291546..292793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2897 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87472"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR90"
FT                   /protein_id="ABL87472.1"
FT                   /translation="MNKNVLIGVALAVVAIAVAIATIFVYKPPQQSNISTTSPSEKVYV
FT                   YSVKLESAQILQMLAYYIPLKDGLVYGQIANQSATYFFLKNNGIINIIAQSQDRYQKLT
FT                   YYGKLLEICVNSTTSATIAGEHLTIVNHQCTPSASPLPTAKSFDELVLLIQGLPGPTST
FT                   GGWKRSGVSQTPYGQATVYSNTTEVPIMAGLSAILNYEKQVLQDGTIYLLKIQLAYGTN
FT                   VAATLTYTLKNITKITPDLKKVLDNLSRDVSAERGGGLDILKVAQKIGMSFDGKWPAAI
FT                   VFFDLQCPYCARLFVYNYTLFEGHKLVLVDLIVHSEALPAHESLRCLYQSSPASVIPTL
FT                   RELYNRTLALHGNINYTSILPQSRCPIDAKAGMELASLLAGQNVGTPMVVVVYPNGTYA
FT                   TIVGYDPASIAKALKG"
FT   sig_peptide     complement(292728..292793)
FT                   /locus_tag="Pisl_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.588 at
FT                   residue 22"
FT   gene            292853..293203
FT                   /pseudo
FT                   /locus_tag="Pisl_0294"
FT                   /note="aerolysin; authentic frameshift"
FT   gene            complement(293667..294086)
FT                   /locus_tag="Pisl_0295"
FT   CDS_pept        complement(293667..294086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0295"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2898 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87473"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR91"
FT                   /protein_id="ABL87473.1"
FT                   /translation="MNCGELATKPPVTIAPDETVENAAEKMASQRVGLLVVVDKNNPKK
FT                   PIGVISERDIIRAIAKKVPLSTTVDKVGTMHNFIYVYADDPITVAARKMRDHNVRHVVV
FT                   VNRNGELVGVISIRDLIGEKNVLNILAREWAQTME"
FT   gene            complement(294107..295396)
FT                   /locus_tag="Pisl_0296"
FT   CDS_pept        complement(294107..295396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2899 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87474"
FT                   /db_xref="GOA:A1RR92"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR040322"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR92"
FT                   /protein_id="ABL87474.1"
FT                   /translation="MGVLLNVDYNDELTRLRIHEIVRYMQKIGIPLKLTKVSNDAIADS
FT                   FYVHYRTPILKEEPSQDEALWYIFLKSYIASDIYQEVSRISRYNYQVSKSASIKLLRAY
FT                   NSLLSRLERGTLGNFEDRKDYKQLSQDQQLRQEINSLLRFYMGSIKNIEKLRKSVTKAL
FT                   GDEVGKEVAELLFDIDVDPYRARLAKILESLVEIISSLRPEMEQGPITERKGVVSGITR
FT                   IRTFSNLQRATNLSKAIYVQSRELFGYKLATKSLSIYEMSIDAREKIYLLVDKSGSMFY
FT                   TLYDGIAMDMTQKITWATALAIALMKRSKRVILRFFDQMVYPPITNIKEVIRSLLRVLP
FT                   LGGTDITAAVYTAVRDAKQQGLHSYKLIVITDGEDDMVHPEVLKAAKTAFREVKVILVG
FT                   GSNETIESYLPTIKVNTTSLESLKMALKNI"
FT   gene            complement(295396..296502)
FT                   /locus_tag="Pisl_0297"
FT   CDS_pept        complement(295396..296502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0297"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: pai:PAE2901
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87475"
FT                   /db_xref="GOA:A1RR93"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR93"
FT                   /protein_id="ABL87475.1"
FT                   /translation="MEELIAKVVQVRKTLDSLFYRFSDEITASLTAVFVRENFILIGPP
FT                   GTAKTMLVASISKLLKARWFYRLLTKFTEIEEVIGPIDIVELLKGNVKRIYTNSIVEAD
FT                   FALLDEIFNASSAILNTMLTILNERVIYDGGNIIPVKTWTVFGATNRIPDEEELQALYD
FT                   RFPLRVFTKYAQPDETEQLVKTGLKLKKDFEKLTPIMSMDEVKKLNDYIQSYVYENMDT
FT                   VVKHISPIVASYLDHVVISNRTRVKVPLYVVSYLTVLGIKPSDIDVATLRAGTLKVLKY
FT                   LVKDKEDLAEYESFLATHMPGNLSVLYDMVNEIKALITNNALSIAREKIKEAYELLDKA
FT                   LADPVTYRFFQVEMEEIKSTLEMLRSQL"
FT   gene            complement(296716..296937)
FT                   /locus_tag="Pisl_0298"
FT   CDS_pept        complement(296716..296937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0298"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2522 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87476"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR94"
FT                   /protein_id="ABL87476.1"
FT                   /translation="MVRHSVSRGEVISTKYPRCSAKMEKRDRQMQCPACGFKAHRDNAL
FT                   MTWAERRYQELIEKTKQPVFLLRRLSYF"
FT   gene            297674..298945
FT                   /locus_tag="Pisl_0299"
FT   CDS_pept        297674..298945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2902 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87477"
FT                   /db_xref="InterPro:IPR018977"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR95"
FT                   /protein_id="ABL87477.1"
FT                   /translation="MFITSASKKLREYLDSRIYQEYPVGELADRVLKRSITPANKEFRI
FT                   AGVDGGVGVVRLANGHQVILARAVAVGPDFVEREFIIDVATVDSASLPWAYLIMAESLV
FT                   GIKALEKHGVDILLMDGSLYAKSLRLVHNLILTREFQNLYYVPELATALYSLAKLVETA
FT                   RNRGGRLVFVSKDYNFKLLKEHILFEKLSERYREDIFHKGLLWYSILWIRKFRKELLKL
FT                   YKVAKRQDYEGARLMALLVAQSITDSELLSSLLPAGYYTMPMLVGGCDAYINYKGLATV
FT                   DKLVKAAEDRLEDSMIFRLKESFNSDIIGVIREALEAIPKVYFFYVRFNAEDMPILVEV
FT                   PAEDTKMFDGSSVKAFYPAAPIDDVVAILASQYRDPIHYNTWLWYAHTMASFKSSQLSE
FT                   YAVYLKKMTEEVGVARRIKLAWGL"
FT   gene            298933..300768
FT                   /locus_tag="Pisl_0300"
FT   CDS_pept        298933..300768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0300"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   pai:PAE2903 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87478"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR96"
FT                   /protein_id="ABL87478.1"
FT                   /translation="MGIMRIGYVVATATPFEFIATLDPERPVSLYDYVAVDHVEYDATN
FT                   GEYINVRLLGQIVKLFRDPYSAKRDLPLYSVMKEVSDNILEVQIAKVKVLGYIYNGELR
FT                   QPKHPPRIGTPVYLAENEEIAELFKIDGGLCVGRLASRDLEICLDLNGVKRHVAVIAAT
FT                   GSGKTWFSVVFIEELLKKGAKIVVVDPHGEYVPIKDSIYKLGPYSATVVKLSKHHVGDL
FT                   MYKIGVLDSDPDALANAAGVPPGAKKIRYAIYLAWSYAKKVKKTTGKALGLSFLRQVLH
FT                   TALRGETALNKLFQQYKVEGDFPMEDLKQLAKKDRHSIFSALMYLKKLQRLGVFSSKST
FT                   PLSKILADITIVNLAGVNEEVQDYVVSHIVNRIFQARVRHVRSLKGLKIPWPVVLVVEE
FT                   AHRFAPPKTLRKTKSYEALSRVASEGRKFGVYLVIVSQRPSKVDPDVISQCQSQVIMRI
FT                   VNPKDQEAVRESSELLAQEFLENLPGLDVGEAVVLGPLTRLPVVIRLRDRVLEYGGADI
FT                   DLAKVWRIDKTADVLQLWRRIYNTPPSPSVILSASRLKILHKRRERNRIEVLLLDGDRE
FT                   VSVVIEDGRPICSVCGVGKPCPHVYKALEEAVEII"
FT   gene            300765..301925
FT                   /locus_tag="Pisl_0301"
FT   CDS_pept        300765..301925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0301"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pai:PAE2904
FT                   exonuclease SbcD, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87479"
FT                   /db_xref="GOA:A1RR97"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR97"
FT                   /protein_id="ABL87479.1"
FT                   /translation="MKILHISDAHLGRAQYHLPEREEDYFKAFDEALKRGKGADAVLIT
FT                   GDLFDLKRPSTKALVKFVEAIEAVDIPIYIIGGNHDFSYVRYRAEAGKCQRPAECLYDT
FT                   ALRLLDRLKLAKLLCWESVDAGGVYIFGACATPREYTAEYRRALQKMPPGAILAVHQAI
FT                   EGVKARYPAEDDEYTMPQEVYHGLPYIHIAAGHIHDHMAKHPIGAVWAGSLEVWDVGEF
FT                   ETWDYRGGFEKAQDRAEKGAVLIDVAGKAVSLRDIPLSPGRPLYRVRLYVRERKEAYGA
FT                   VEEATKLFDKPGAVVRVEVWGTLEEALRPRQLATLFTKALYVDVVDRTVTPQRAVALRG
FT                   SAVEELWRIMKEKLGQHAEVVLRAMELLRDGEREAAYRLILKTLYD"
FT   gene            301918..304026
FT                   /locus_tag="Pisl_0302"
FT   CDS_pept        301918..304026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0302"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: pai:PAE2905 purine
FT                   NTPase, probable"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87480"
FT                   /db_xref="GOA:A1RR98"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR013134"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR98"
FT                   /protein_id="ABL87480.1"
FT                   /translation="MIRKIELYNFKAHAKAVFKFGEGVNFIYGPNGSGKTSIMEAVSIA
FT                   LFGSQWVRRVGGRWSDYLKRGASVGEVRLFLNHMGQEVLIVRRFGEEGSSTSGTYLAID
FT                   GAVVARGDIDVTNAVVTKLGIRIDEYRHLLYIRQGELRRILQEPEYIDHILRIDEFDKV
FT                   DEVVKDVLKELERRRERVGGRVEELEKRAPQLKAKADALRQRLAEAERKIKELEDAEIK
FT                   FREVEKRFFELRERYISLTKEKESLERGLEETASMALEVEKDIERLEEELEFIRRAEEE
FT                   LSTLPELGDVEREYYEVKQLVATVEKIPPEVRSYDPKLLEETRRKYEEVSRRYVEVRSR
FT                   LGLLRDVLRVAKAAERGRCPVCGAPLTEETVKRHELEALGLEKEEQRLSRLMEQLQTEI
FT                   KQLETLDKTYRAYAQYLSIDLQALKKRLAELETLYQRKREVEKKRAYLSGVVARRGEVE
FT                   RRLEELKARKAALEKRIGEINGRLNAVETELKTLATVLTNIEAEYTALKVKHEEFLAAK
FT                   MFVSELKRQLEDIERELIEVEKELEKNRYEVQKLDKALGIARNIRVVIGELKPLARQIL
FT                   TKAINEELNSIFLKLRHKEVFRSVQLVEIDGKYSIRVNTPAGYIDHRLLSLGEQNLLAI
FT                   SLRVALARALLGGAPFMMFDEPTEHLDEEHRRKIVELIRDLTSIVPTVVVTSHLGEFEE
FT                   VADVVIQL"
FT   gene            complement(304030..305187)
FT                   /locus_tag="Pisl_0303"
FT   CDS_pept        complement(304030..305187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0303"
FT                   /product="peptide chain release factor subunit 1 (aeRF-1)"
FT                   /note="PFAM: eRF1 domain 1; eRF1 domain 2 protein; eRF1
FT                   domain 3 protein; KEGG: pai:PAE2906 peptide chain release
FT                   factor aRF subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87481"
FT                   /db_xref="GOA:A1RR99"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005141"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR020918"
FT                   /db_xref="InterPro:IPR024049"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:A1RR99"
FT                   /protein_id="ABL87481.1"
FT                   /translation="MSFKRPPNGVYYIKTPVELRAFINLLKKFRGYATTLITLYINSER
FT                   PIPDVVNLLRSEWSTASNIKDKTTRTHVQDTLERIINNLKGEAKAPENGMAIFAGFHMI
FT                   NQGNYEWVYYVVVPPQPIYTFKYICDTAFHTEILEDQIHAGVVYGIVVVERGEAVIALL
FT                   KGGQWEVVKTVEFFVPGKHHAGGQSANRFKRQTEHLAETFYKVLAEEVNKIFLQIPTLK
FT                   GIIVAGPGPTKEDFLEEGGLDYRLKDKVLAVVPACCANEYGVIEAIKNAQEQLKESEYV
FT                   HAKEVMEKVMYYAVRKSDYIVYGKERALKALEMGMAEVLVVAEELGEDAVLEVIMKAEE
FT                   KGVKVEVVPKGVEESKTLMQAFGGYVALLSTPVWVLEQQIQAEAA"
FT   gene            305261..305581
FT                   /locus_tag="Pisl_0304"
FT   CDS_pept        305261..305581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0304"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: pai:PAE2907
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87482"
FT                   /db_xref="GOA:A1RRA0"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRA0"
FT                   /protein_id="ABL87482.1"
FT                   /translation="MSLAARRKVRIRLYGTNPADVEQVAREIVDLAKKMGVQVKGPIPL
FT                   PTRRLVVTVRRAPSGQGYHTFDHWELRISKRLIDIEASERVLRRLMTIRVPDTVKIELQ
FT                   LI"
FT   gene            305611..306408
FT                   /locus_tag="Pisl_0305"
FT   CDS_pept        305611..306408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0305"
FT                   /product="3'-nucleotidase / 5'-nucleotidase"
FT                   /EC_number="3.1.3.6"
FT                   /EC_number="3.1.3.5"
FT                   /note="KEGG: pai:PAE2908 acid phosphatase; TIGRFAM:
FT                   stationary-phase survival protein SurE; PFAM: Survival
FT                   protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87483"
FT                   /db_xref="GOA:A1RRA1"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA1"
FT                   /protein_id="ABL87483.1"
FT                   /translation="MILVTNDDGIHSPGLRLLYQFVSSLDEVDVVAPESPKSAVGLGIT
FT                   LHKPLRMYKVDICGFVAYATSGTPSDTIYLATYGLGRSYDLVLSGINQGDNTSLQVILS
FT                   SGTLGAAFQAALLGIPAVAYSAYIEDWGEILNDKTAIEIMETVVRTTAEYVLKRGMPKG
FT                   VDVISVNFPRKLRRGVKARLVKAAKMRYAQQIERRVDPRGAYYYWLYGVNLDPEPNTDV
FT                   YVVLKEGNIAVTPLTLNLNVFDSERYVDLESLKELMELINSVI"
FT   gene            306405..307196
FT                   /locus_tag="Pisl_0306"
FT   CDS_pept        306405..307196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87484"
FT                   /db_xref="GOA:A1RRA2"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA2"
FT                   /protein_id="ABL87484.1"
FT                   /translation="MTTVVNYAIAIAATILIAAVAVLMYILYLQAATSAFGSVTTMPVV
FT                   TTTTPTTPMTTVTTPETSSSHIISTVLYIATPNVTECVNLGRQYIYYFNITVDRKRLED
FT                   PVGHYIFKAVVRNVTYNLTTATLLPLKSVYFKPYSQADVRRLGIINIYLELTSRTPLQI
FT                   DAVEYLGKRYPIDKIVYIVCINGIRFRGAFNKIVSNSTILIPTDIPYAINVALPSGTYR
FT                   IAAPPDVEVSPQMLQGGNITVMIKFVNKPLVYNPLILEVSR"
FT   sig_peptide     306405..306500
FT                   /locus_tag="Pisl_0306"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.958 at
FT                   residue 32"
FT   gene            complement(307174..307416)
FT                   /locus_tag="Pisl_0307"
FT   CDS_pept        complement(307174..307416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0307"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: pai:PAE2911
FT                   P.aerophilum family 453, possible regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87485"
FT                   /db_xref="GOA:A1RRA3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA3"
FT                   /protein_id="ABL87485.1"
FT                   /translation="MARAKSATSLSDPRRAEILKLIEENGPLTQSQIAKAMGMTWGQVQ
FT                   WHLYVLERDRKVRRVVKDGVTYYVSANASIDLLLE"
FT   gene            complement(307460..308113)
FT                   /locus_tag="Pisl_0308"
FT   CDS_pept        complement(307460..308113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0308"
FT                   /product="Protein of unknown function DUF207"
FT                   /note="PFAM: Protein of unknown function DUF207; KEGG:
FT                   pai:PAE2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87486"
FT                   /db_xref="GOA:A1RRA4"
FT                   /db_xref="InterPro:IPR003827"
FT                   /db_xref="InterPro:IPR022908"
FT                   /db_xref="InterPro:IPR036602"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA4"
FT                   /protein_id="ABL87486.1"
FT                   /translation="MGVVDRKVFEARKRVFIERLEREALQERVDGDILPLLRLLNRHPA
FT                   IYTTSSCSGRIMVAEAVRPSYSKGKGFRPVAKWHHPVPPDLVRAAADQVDNAWLMVRGA
FT                   ILHLAAVDAKTAYRLVEVGRETGHKHSGIIAINRGGIFVEILGEERLDVPLKRGGVYVS
FT                   DLETAVDMANKTLVLAKLRLYWLAARLEAELFGLEAPESDEIRRAIRRAANCLG"
FT   gene            complement(308113..309024)
FT                   /locus_tag="Pisl_0309"
FT   CDS_pept        complement(308113..309024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0309"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   pai:PAE2915 dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87487"
FT                   /db_xref="GOA:A1RRA5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRA5"
FT                   /protein_id="ABL87487.1"
FT                   /translation="MSMRIEGVIVATVTPFTKDGVNYESLRTLLSKIVSEGYQGVFPTS
FT                   STGEVTKLTFEERVKVMEVAKEVAGGRALVVAGTGTGDHLSTIEIARRYKDVGVDALLI
FT                   TPPYYIQYDWAAIYAFYKRVLDKVDMPTILYTIPLATGYNIPVEVFELVANEYSQVVGV
FT                   KDSSGDFRYHLDLIHLLGKRLSVLQGLDLLFVPSLLMGAQGGVLAGPNFLGRITLEQYR
FT                   LVKEGKIAEAVALHNKLMPLWRFMGGCGLVGKLGGKWPTLYKVATQIVRGIDMGPPREP
FT                   LPPIDDKDRRELEKLLKDLGLI"
FT   gene            309098..309934
FT                   /locus_tag="Pisl_0310"
FT   CDS_pept        309098..309934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0310"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: pai:PAE3597 cytochrome C
FT                   oxidase assembly factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87488"
FT                   /db_xref="GOA:A1RRA6"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRA6"
FT                   /protein_id="ABL87488.1"
FT                   /translation="MNPYIVLLKPRVIWLLILSSVVGYIYAAQTVDWSKLIALIAVATL
FT                   AVGGSAAFNHYWERDIDAAMSRTARRPLPAGLIPEFNALVYSLALSAAGITLSFYLLGP
FT                   LPGLFVALGWFFYAVVYTIWLKRKTWLNILGGGFAGNATFLGGYALGKGTVDLPAVLIS
FT                   FAIYLWIPSHIWALAYKYRHDYRKAGVPMLPAIIDEKKSVVIISILNIASAVYILWLYL
FT                   AFGQSLLGLALVFAGVAGTVATSILALKEKSDRAMWKMYKASSPILTLFLLALVFS"
FT   sig_peptide     309098..309181
FT                   /locus_tag="Pisl_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.901 at
FT                   residue 28"
FT   gene            complement(309929..310873)
FT                   /locus_tag="Pisl_0311"
FT   CDS_pept        complement(309929..310873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87489"
FT                   /db_xref="GOA:A1RRA7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA7"
FT                   /protein_id="ABL87489.1"
FT                   /translation="MWHVIGKSDESAFFKATLDLVLSTRIALFLSGALFILGVSTAGHM
FT                   QQLHGYLMIAGLLAFYHAVMYMQLPGFINATPRRVVTWLLLALFFLGLIGYISFGYLAY
FT                   LPYSLLHIVLYLRGLWGKPTYYPNVITAAGLFLLPLSTSHLDAVFSFPLASVYSLLYRI
FT                   ELSRARKRFTAPSALLLTALYLAAYVATKVGLSWAMALPSLALTLYARPRLNDAYGIGA
FT                   FFFRWAIALAPLGAHFVYMAFAVVMSALCVPYFIPAILYRQVPNYKWELVATAAVAFLL
FT                   RNIEVMWASALLTIALVIYVAVRSLREKYYPPL"
FT   gene            310923..312296
FT                   /locus_tag="Pisl_0312"
FT   CDS_pept        310923..312296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0312"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   pai:PAE2918 TldD, putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87490"
FT                   /db_xref="GOA:A1RRA8"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA8"
FT                   /protein_id="ABL87490.1"
FT                   /translation="MELLVKALDYGRSLGATYVEVRWQKDYGSVAAVRNGQFEFLATFS
FT                   SEGIAIRAIAEGGLGFAATPELELDKVLKAVEKAVKLAKAAGRVRKTPVTLSEEKLAKI
FT                   NYSLPELDLDPLDLVKTLDSHTAPGLSVRRFYTSVWITEKHILTSDGADVYSRVPRVYL
FT                   FGMFIAHEPSLGSLQRDIFLGGTSPDSLRNAEKIVEEESKKTLVLLEKARSVSPGRYDI
FT                   VFGPEMTGILVHESVGHPFELDRIYGREGAEAGESYIKPNNLKVRIGSEFVNITDYPAV
FT                   PGTYGFYLVDDEGVVARPKKLVSNGWATEFITNRQYAAAIGAHSNAGARASAFDREPIP
FT                   RMSNTYLEPGDWRPDEIIRDTRRGIYVVSYTEWNINDTRYSGRYGIFEGYLIEGGELKQ
FT                   PVKGFIEVDTPELWGGVDAVGRDFQLFIGTCGKGNPPQGVPVTMGGPTFRSRGLRVVV"
FT   gene            312293..313579
FT                   /locus_tag="Pisl_0313"
FT   CDS_pept        312293..313579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0313"
FT                   /product="peptidase U62, modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62, modulator of DNA gyrase; KEGG:
FT                   pai:PAE2919 PmbA, putative modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87491"
FT                   /db_xref="GOA:A1RRA9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRA9"
FT                   /protein_id="ABL87491.1"
FT                   /translation="MMLLKLIRERVDEAAVVKTVVENYMARFANNEITVFKNWTIENTY
FT                   LYLAKGRKTTFLSATGSLSVDQVEKAISRLMSLPEDPLYVPVGGPKPSDYSEPPEDFEK
FT                   IPDLVKKAIDAAEGVERNAGVIHLTYTKAWYEDTTGREGSYSVNRVYMTVRSFLGELSA
FT                   TGAIAGRRLSEIRAEAVGRENSQILSLARGLPHIRVESGVVDLVLSPLVLGHLIGQVVQ
FT                   MWANGLEILSGSSRYSKEDLGKEAASPLLTVVEKTYDPSVYGYVPFDFEGITPRLVEVY
FT                   KRGILGGFIHNRRTANAFGTESTGHALYGWARPAAGHIDIAPGDGPRELDALFLDLKNG
FT                   FYIHNNWYTRYQNVKTGQFSTVGRDIALQIKNGKPAAVVKYIRIADTLENVVKNVAELS
FT                   KEARQIYWWDMPVPSTAPYAVLRNIGVTT"
FT   gene            complement(313572..314276)
FT                   /locus_tag="Pisl_0314"
FT   CDS_pept        complement(313572..314276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0314"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE2080 branched-chain amino acid transport
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87492"
FT                   /db_xref="GOA:A1RRB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB0"
FT                   /protein_id="ABL87492.1"
FT                   /translation="MIKTVNLEAGYGKLQVLFDVNFEAFPGEITAVLGPNGSGKSTLLK
FT                   AIFGIARVYNGRIYIGDRDVTKLPTHERARLGVAYVSQLRNVFSTLTVLENLRMAAYQM
FT                   SSVEFEERLREVSDIVPLREILNRRAGELSGGWRQLVAIAMALVRRATIFMLDEPTAQL
FT                   APKMANQVLDVVLKLREAGYTVVLVEQNAKKALEVSDKAYLLVSGRVHWVGPADKLLEE
FT                   KELGRLYLGFIK"
FT   gene            complement(314273..315013)
FT                   /locus_tag="Pisl_0315"
FT   CDS_pept        complement(314273..315013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0315"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE2081 branched-chain amino acid transport
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87493"
FT                   /db_xref="GOA:A1RRB1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB1"
FT                   /protein_id="ABL87493.1"
FT                   /translation="MHSGHLLVASDIVKKFGGLTALDGATIAVPLNSFVILAGPNGSGK
FT                   TTLLNVISGIYQPDRGKVIFEGRDITYTKPYIRAQLGIARTFQTPRVAYKMSVLDNVIF
FT                   GYVSKDAPLDFRWKARERELVKRAFEVLKLVKLDHMWDRPASQLSGGQLKLLEIARALM
FT                   ANSKLILMDEPGAGLNPTLAHELFQFMRDLSRRGFSLLVVEHRLDIAADYGDYMYVLYN
FT                   GRVLAEGEPAEVLSNPQVIQAFML"
FT   gene            complement(314985..316163)
FT                   /locus_tag="Pisl_0316"
FT   CDS_pept        complement(314985..316163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0316"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pai:PAE2082 branched-chain amino acid binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87494"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB2"
FT                   /protein_id="ABL87494.1"
FT                   /translation="MYIASQDRVIYGEPQPVTPPQGVLTPVIVNITVTPADKFIDIGVL
FT                   QPLSGRLGSLGELARAAAELAAEDVNRYLTKIGAPFRVRILADDTQADPALALEKLKSL
FT                   HAKGVKYYIVRTSGEVRQMKPYANENKLVLISVSSTAPGLVTSSDYVFRLPPDDTRQAK
FT                   ALAAVLKQQGAKAVVLIFRNDDWGRGIATQLQNLLKDEMEVIAAAAYDPQKSEFSAEVS
FT                   TLAEKVSYAVNKYGADKVAVVAPGFAELQAIFLTAANYPVLSQVRWYGTDGSTGLKELT
FT                   DPKVCQFALKVGGFVSTKFAPAKSQYYDRVRNYILSKYGREPDAYAYNAYDAVWLITYT
FT                   ILQNGGDSDTTKFFAKFPEVAANYFGASGLTKLNQNHDRDTADYALWALVGS"
FT   gene            316388..317359
FT                   /locus_tag="Pisl_0317"
FT   CDS_pept        316388..317359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0317"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE2083
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87495"
FT                   /db_xref="GOA:A1RRB3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB3"
FT                   /protein_id="ABL87495.1"
FT                   /translation="MNKSTVFWLIVILLAAGWLFSLIYSTRLAVDGVMYSSILALAAVG
FT                   LTMTYITTKVPNFAHGAIMGVGTLTALALSQKFGISPYVAGLIALPFSIAISVVLYYTL
FT                   MPIYKRGASPTILMMASMAYNIIILGALNAIADYLGRIWGIFTRGYTLRSMDFNIGDFP
FT                   GLAIIGPLSVALTSAVLYIFLVKTKLGIALRAAVENEELARSLGIDVDRAYLVAWIIAG
FT                   VLAGYSGAVLTLYLSVEPDTGWMILANIFAASIAGGLSNIFGAVLGAFFMGFVEVPLAT
FT                   YIASIVAIEPYVVLQYRPLLPLIAVALFLIIIPQGLTSLRRR"
FT   sig_peptide     316388..316477
FT                   /locus_tag="Pisl_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.948 at
FT                   residue 30"
FT   gene            317356..318480
FT                   /locus_tag="Pisl_0318"
FT   CDS_pept        317356..318480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0318"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE2084
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87496"
FT                   /db_xref="GOA:A1RRB4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB4"
FT                   /protein_id="ABL87496.1"
FT                   /translation="MKPLSLIGLYIYLLSVLAVALTGLDVVSYVLGTIIDVAIFTIIAL
FT                   SVNLEAGIGGIPNFGKVLTVTAGAFIVGGVISRIAMAMYGVSGDFVYDNPTIVSTLSRV
FT                   MDFQGAFLLLLTSLVISLIVGAVIGVAMSAPAVRLREDYLAITLLAFGDFLFYIGRYYE
FT                   PLVGGTFGVSIPPIFEKIFGGGVARYIGAAALSGAIALLIYLALERIIQSPYGRALKVH
FT                   REDPELVEVFGRKATALRLWAMAIGGAVSAVAGALYALYAGAVHPSSFTRITFTFYPWL
FT                   IMILGGMGNNLGVVNGVFIFVTMRRLVDMYKYELSAVLGFDPVWLAYMVFGALALAIIA
FT                   IKPEGLVPEESTPLAVKRKVTKLDRQGGGAAAGI"
FT   sig_peptide     317356..317418
FT                   /locus_tag="Pisl_0318"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.765 at
FT                   residue 21"
FT   gene            complement(318459..318551)
FT                   /locus_tag="Pisl_R0005"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(318459..318551)
FT                   /locus_tag="Pisl_R0005"
FT                   /product="tRNA-Phe"
FT   gene            318717..319169
FT                   /locus_tag="Pisl_0319"
FT   CDS_pept        318717..319169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE0620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87497"
FT                   /db_xref="GOA:A1RRB5"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB5"
FT                   /protein_id="ABL87497.1"
FT                   /translation="MYLDEFLNRSLRDTMLWVFLVTTVLLVAAVLKTRDNVLASISLTF
FT                   LGVVVAGAVWAFHPALSIAFILIALVYIVAALTLVIIAAASIAEDRRPTEARAIALASL
FT                   AAIPLVLLPTYPIQKTPNVTLDIWLIPLLAVLLLYSFIIAARLTHD"
FT   gene            319162..319398
FT                   /locus_tag="Pisl_0320"
FT   CDS_pept        319162..319398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87498"
FT                   /db_xref="GOA:A1RRB6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB6"
FT                   /protein_id="ABL87498.1"
FT                   /translation="MIEVALIIVLLVGGMAVVATAVSLVRVIIGVEMAVMAGILGAAMS
FT                   EDISLVAIASVAGVAETVLMVAALFKMAKEGYV"
FT   sig_peptide     319162..319227
FT                   /locus_tag="Pisl_0320"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.888 at
FT                   residue 22"
FT   gene            319391..320668
FT                   /locus_tag="Pisl_0321"
FT   CDS_pept        319391..320668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0321"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: pai:PAE1576 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87499"
FT                   /db_xref="GOA:A1RRB7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB7"
FT                   /protein_id="ABL87499.1"
FT                   /translation="MYSELFILATALSVLLALVALRLGHLAALVSIALMLLFLTPGSAV
FT                   LTTLPYVGQVTVAMDGHKLPFIATAILLGLLVTFYAPRYLKHLGAPNWYYGVHALYVLS
FT                   FVYIILFENLFFVFLALELSIVTSFLLIWYFGYGNRRFVGLLYFIWAQIGSILFLIGVA
FT                   LTGRFTAGEFTATSLASFLVLLGLLVKMGTAGVHFWLPYAHAEAPTPLSALLSPIHVGL
FT                   MAYWIWRLKTGAGWPLEALFLYGLATAVYGSLLVFREADFKRALADSTIANMGLLLAAA
FT                   SIKADFGYTAVALLFVGHAFAKAALFMLAGIYIVSLHTREIDAVRWDRHLLAVGILGFV
FT                   ALAGLFGINLLGKAYVAAGVPATFSAVALAVFAFLSTAVYSFYLLNRLYRAGEAQVEYP
FT                   LDMYAATLAAAAAPYVLLAALPLWLH"
FT   sig_peptide     319391..319465
FT                   /locus_tag="Pisl_0321"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.292 at
FT                   residue 25"
FT   gene            320656..322272
FT                   /locus_tag="Pisl_0322"
FT   CDS_pept        320656..322272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0322"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: pai:PAE1568 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87500"
FT                   /db_xref="GOA:A1RRB8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB8"
FT                   /protein_id="ABL87500.1"
FT                   /translation="MATLELLLALAYTAALADLLVSRGYAAVAAGTAFLLGVLLGANPS
FT                   TPYLTAKYLEPAAFVAGVYLAIVVYSHFYMKGFERPGWFWGWMGVFFASMELFLLADHW
FT                   ALLVAGWAGLDLASWGLILTYRDGYEMGYVGDGEYAAGMRWLWPPSASALRAILTVEVG
FT                   TAAILIGLATTAVQYGDYLSRWGPLGDVAAALILLAAFVKAAQLPFTDWLMTAMSAPTP
FT                   VSALLHSSTMVKAGPILLLKLGHVMPHWTAGVALAVGAATAFISGLIALGQREPKLTLA
FT                   ASTASYLGMITALALEKPHEALLLIYAHGFAKATLFMAVGHAIHVSHSRFPQAYPLVAK
FT                   VAIALAMFTLLGITPVGALAKNDAPLWTVAVSVLTAGYLGKLLIKPTEGDWEPMWMPYL
FT                   ALVVVPNFFLFTLPKPILLGSLAGFILAFAGEPNLLRRRLYLPILFDKIAPVFYTALWK
FT                   AVADFDHFVDEVLKRVAPAWRLLTDVVTIGDKLLDTALHGGFVEIVRRVSARVSSLSLD
FT                   YYLYLVGIATAFILLVALWQA"
FT   sig_peptide     320656..320709
FT                   /locus_tag="Pisl_0322"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.588 at
FT                   residue 18"
FT   gene            322260..323360
FT                   /locus_tag="Pisl_0323"
FT   CDS_pept        322260..323360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0323"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: afu:AF1827 F420H2:quinone oxidoreductase, 43.2 kDa
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87501"
FT                   /db_xref="GOA:A1RRB9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRB9"
FT                   /protein_id="ABL87501.1"
FT                   /translation="MASIELVLPTYFAIRVAVGFNRWGVVADVTYITLVAFLMWQNSPL
FT                   YLLSLPFYLAVVAIGGVFRNYAGLASALSISGVYLMFQQPTYLKGLGFLFAILAPAALV
FT                   ATVRDRGSLEGFFRYLVVSTFASSFLFIGLGQRSTAMGEAFILMAVALELGVAPMFLWV
FT                   PDVYGRTHPAGLAILASLPKLSATFALLAIRPETPAVLFYALGALSMAVGNLGALTSVE
FT                   PRRILAYSTVTHTGFAIFIYPIAPEVTLALVLADAFGKMGLFYALNTGTYRWTTRILVL
FT                   HQIGLPPLFGFWPKAALVILVAEKMGTVYALYVLANIVAMAPYYFRLMEVITEGRDVFP
FT                   AAVGIIIAAIGVTAPLWFIYHVSSLL"
FT   gene            323443..324381
FT                   /locus_tag="Pisl_0324"
FT   CDS_pept        323443..324381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0324"
FT                   /product="pyruvate ferredoxin oxidoreductase, gamma subunit
FT                   / pyruvate ferredoxin oxidoreductase, delta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; KEGG: mth:MTH1740
FT                   pyruvate ferredoxin oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87502"
FT                   /db_xref="GOA:A1RRC0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC0"
FT                   /protein_id="ABL87502.1"
FT                   /translation="MRIETLWLGRGGQGIVTATYIIANAAVMDGFYAIANPEFGAERRG
FT                   APVKAFLTIDKNPIEDLEPIKTPDAVIIFDDKLIDSMRFAIDAVKPGGYVIVNSAKQPE
FT                   EVRKIVGRNDVYIVVVDAVGIAMKHVGLPVPNGPLAGAFSKVMGFPRLESIKTAFENQL
FT                   GKAVEENFAATKEAYEVAVVLKPEKVDTSAKPKGVISTTSAFLTGPYELVGWQQVNKGG
FT                   AVGPGSSLQYLTGGWRIEKPIIDHSKCIMCRKCWLYCPDDAIIEAWREAPGPRGRVFRT
FT                   KVIDFDYQYCKGCGICAEVCPTGAIQMVREI"
FT   gene            324378..325586
FT                   /locus_tag="Pisl_0325"
FT   CDS_pept        324378..325586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0325"
FT                   /product="pyruvate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   pai:PAE1042 pyruvate ferredoxin oxidoreductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87503"
FT                   /db_xref="GOA:A1RRC1"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC1"
FT                   /protein_id="ABL87503.1"
FT                   /translation="MTAQALVPREKKIAQKRIALTGNHAVALAVKMCRPDVIAAYPITP
FT                   QTPVVEKLAEYVNNGELDAEYIPVESEHSAMSAVIGASAMGARTFTETSSQGLMHMYEN
FT                   LPIAVGLRLPIVMGVAARTISAPINVWGDYSDVMTMRELGWIIYIVQNAQEAFDTIIQA
FT                   YRVAEDQRVHLPAVVAYDGFWTSHVLQPLDVPEDEEDVIRFSPITRSWVKLDVDKPLQL
FT                   GAVGTPEWYWEIRWQAVEALRESLKVIEEIDREFDKWFGRSYGLFDTYRLEDAELAIVT
FT                   YGSIYGLVKKVVNRLREEGVKAGALRLRVIRPWPGDKLRKALDNIEKVFVIDRAINHGG
FT                   PLIGPMATEVAATLQRPVYNALATIGMRAIDSDMIYEAAVKVAKGLWAPNQTYTIGLRG
FT                   GYE"
FT   gene            325633..326643
FT                   /locus_tag="Pisl_0326"
FT   CDS_pept        325633..326643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0326"
FT                   /product="pyruvate ferredoxin oxidoreductase, beta subunit"
FT                   /EC_number="1.2.7.1"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: mja:MJ0266 pyruvate ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87504"
FT                   /db_xref="GOA:A1RRC2"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC2"
FT                   /protein_id="ABL87504.1"
FT                   /translation="MVKTAVKAAEEYEGQYEYATFELPNEELFLPGHGLCAGCTIGVIA
FT                   RHMLKVFGPDTVIINPTGCAEVSTVVYPRTNWAVPWIHVAFGNGGSVASGIEAAIKALK
FT                   RRGVIDPNRRINVVVFAGDGGTADIGFQALSGMLERGHKVIYVMYDNEGYMNTGIQRSG
FT                   TTPFGASTTTSPAGKVVPGNIRHKKPMAAIAAAHGIPYVATANPAYVHDMVYKFKKAME
FT                   VNGPSFIHILQSCTPGWRFEPKYAIRVLELATETGYWVNYEIENGEFRVTLPVPRRKHV
FT                   KCFLQLQGRFRHLKPDEIEYIQKVIDRDVEEINRLMGREVIGPLDPSLPCLTERK"
FT   gene            326640..327038
FT                   /locus_tag="Pisl_0327"
FT   CDS_pept        326640..327038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0327"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE1580 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87505"
FT                   /db_xref="GOA:A1RRC3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC3"
FT                   /protein_id="ABL87505.1"
FT                   /translation="MITHLKMFGVALKYVFQRPITVRWPEERRDYGDRIRGFIINDRTK
FT                   CISCQLCEAVCPAKAIRFHLEADGKRYPGIDWGRCILCGYCVDACPTGSLRHINNTEIV
FT                   WTDLNVYRKPNEMDPDDVSPIVGTKSLV"
FT   gene            327040..328002
FT                   /locus_tag="Pisl_0328"
FT   CDS_pept        327040..328002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0328"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: afu:AF1831 F420H2:quinone oxidoreductase, 41.2 kDa
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87506"
FT                   /db_xref="GOA:A1RRC4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC4"
FT                   /protein_id="ABL87506.1"
FT                   /translation="MFIPSDIFAAVVFPGVMGVFGFLVVAIWLERKLVARVQWRYGPLY
FT                   VSRRFGGFLQPIADLVKLVFSELVLPTHTNRALFAVAPIILFFAEAIPLVFIAAAPGFV
FT                   VVYHPHGLAIALVLILLVAVLVVAMAWTEADKFTYIGAVREILLTAAYEAPLLLSALAM
FT                   FLLYKSADPFGVVETQRELWGIFLNPLAFVTYFVTLLMATTRLPFEIPEAEPEVVLGPY
FT                   TEYGSTLFIYAFGSNYVKLYTLSLLGTVLFLGGWTPADGLLGVVITAVKMAVFIIPALL
FT                   VRAIYPRYRIDQALELGWGKLLVLSIVAVAWSLVLLWLR"
FT   gene            327990..328337
FT                   /locus_tag="Pisl_0329"
FT   CDS_pept        327990..328337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0329"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: pai:PAE3520 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87507"
FT                   /db_xref="GOA:A1RRC5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC5"
FT                   /protein_id="ABL87507.1"
FT                   /translation="MVALVLFILLFITLLTALVAISYFLAPRRPSEVKQRRFEAGGPPY
FT                   GTIQRRLVMQYIGYIYLVTTVEATLGLAIVAVLTNENMLPLSLSLALLMAILAAIVARY
FT                   LKILADVRKWS"
FT   sig_peptide     327990..328049
FT                   /locus_tag="Pisl_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.326 at
FT                   residue 20"
FT   gene            328458..328901
FT                   /locus_tag="Pisl_0330"
FT   CDS_pept        328458..328901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0330"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit; KEGG:
FT                   pai:PAE2928 NADH-ubiquinone oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87508"
FT                   /db_xref="GOA:A1RRC6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC6"
FT                   /protein_id="ABL87508.1"
FT                   /translation="MRGAISQAVSRVARWGTKWSLWPPHLVTACCGVEFAHTFGPAYDA
FT                   ERFGMLPIGSLRQSNILILEGTITLKMAKFVKYIYDQMPEPKYVIAMGACAIKGGVFYG
FT                   SYHMVPASKVVPVNVYVSGCPPTPEAVLKAVEKIQKQIYHAES"
FT   gene            328888..330111
FT                   /locus_tag="Pisl_0331"
FT   CDS_pept        328888..330111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0331"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 49kDa;
FT                   KEGG: afu:AF1830 F420H2:quinone oxidoreductase, 45 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87509"
FT                   /db_xref="GOA:A1RRC7"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC7"
FT                   /protein_id="ABL87509.1"
FT                   /translation="MQRVEWPFNLQFGNTFYIQNEEELRRGERGLVVVVGPQHPGSGHM
FT                   RLFVVLDGDIIKEVVPDPGFVHRGMEKLAENRPYWTLIPLVEKASIMDSMNITLPITLA
FT                   LEKALGLEPPPRAKYLRTLMAELSRIRTHLYDLALLGIFLGHSTAFMWSFALMDLYAEV
FT                   FAKITGARTTVAYPVPGGVRRDVKREHLEAVERLLKKTEEKLRDLKTIFLDNPVTKARL
FT                   EGVGVIDAKRAAELGVVGPFARAAGIDYDIRKIYPYDAYPEIEFEIATEKEGDALARVI
FT                   VRWREIYESIKIVRQIIKELPQGDVIDEALLFKNPEYRREGIGGVLGVYTYIYPEPGEY
FT                   AAVAEAARGTTYIHLWTTGAQRVYRMRYVTPSWRNLKAMAEAMKGERLANMPTVYMSFG
FT                   YFPPEADR"
FT   gene            330113..330382
FT                   /locus_tag="Pisl_0332"
FT   CDS_pept        330113..330382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87510"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC8"
FT                   /protein_id="ABL87510.1"
FT                   /translation="MQIRLFDLDQRREVIVDIDGKAHITELIKRLKEMGVLRQNEAAMI
FT                   GVPLDEKRIAYVPAANVEQLVAYANQKKTVIAFRRYPLYGLTTT"
FT   gene            complement(330552..331808)
FT                   /locus_tag="Pisl_0333"
FT   CDS_pept        complement(330552..331808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0333"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE2522
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87511"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRC9"
FT                   /protein_id="ABL87511.1"
FT                   /translation="MYAYRTLRVEIPWRLVEERPDVLGLAVRMRLAVEEYARRLLKELT
FT                   GQEEPKLAPEELVCLLTPDRRELARRIIEEVFPKYGLKRYIAEWAKFFWRDVVFHRAVP
FT                   LNAQLRVGNERDISMAVFVDLKSCIVRVRKLGIPPFAVKLKKSNVAWIRRRLEEGAKLK
FT                   LAFLGVEKRDGEKEPTYDKLYVALVFAREVQQIEPKAIVAVDVNRLDHGVVVGLVVDGK
FT                   IVRRMRLLDENVVRELRRLHEEISRLDEQAAREADPARKRRLEDRARHLASKRFRKIRG
FT                   VVKYVVSEIIKLAREHQAAIVVDTMEEETYLERKQSGESGDKKHLYDGLGQLRRRLQAL
FT                   AEWYGQPYREVRLYSTICPRCGAKMEELSNRRMRCPSCGFNDNRDNVPLLWAKKRYWEL
FT                   LQKQPVFSSVSTTITLLTS"
FT   gene            332595..332825
FT                   /locus_tag="Pisl_0334"
FT   CDS_pept        332595..332825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2522 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87512"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD0"
FT                   /protein_id="ABL87512.1"
FT                   /translation="MENERDMSMAVFVDLKSGALRVRKLGIPPFVVKLKKSDIAWIRER
FT                   LQEGAELKLAFLDINRNSPQQTSNPQTQTNR"
FT   gene            complement(333207..333740)
FT                   /locus_tag="Pisl_0335"
FT   CDS_pept        complement(333207..333740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0335"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit; KEGG: pai:PAE2926 NADH-ubiquinone oxidoreductase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87513"
FT                   /db_xref="GOA:A1RRD1"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD1"
FT                   /protein_id="ABL87513.1"
FT                   /translation="MSAKIPPKCPPPADHPLLEKLKAALGDAILNHGVTPEGHLCLMVP
FT                   PGKVREVATKLKELGFDHVLSLSAVDYMAEGKFLVTYVYASYLNPDLKNQLLHVRAEIP
FT                   RNDPKIASIADIYPSADYDERECHEMFGIWFEGNPHMGKRFLLDPDCCIDEKTGKPLYP
FT                   LRKDFKVPDWGLMG"
FT   gene            complement(333742..334293)
FT                   /locus_tag="Pisl_0336"
FT   CDS_pept        complement(333742..334293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0336"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: pai:PAE2928 NADH-ubiquinone oxidoreductase
FT                   subunit; TIGRFAM: NADH-quinone oxidoreductase, B subunit;
FT                   PFAM: NADH ubiquinone oxidoreductase, 20 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87514"
FT                   /db_xref="GOA:A1RRD2"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD2"
FT                   /protein_id="ABL87514.1"
FT                   /translation="MSQALREFLLKKAKLEKLFKWGVRWSLWPVHLVTSCCGVEVAHTS
FT                   GPGFDAERWGVLPFHTMRQSNVILVEGTITKKMAKVLKMVYEQMPEPKYVIAMGACAVR
FT                   GGLFWNSYHVVQVDTVVPVDVYIAGCPPTPEAVIRAFIMLHNKIKGQPGPYVEPTKVDL
FT                   TPYLPPPPKPQPKPMAQQAG"
FT   gene            complement(334617..334877)
FT                   /locus_tag="Pisl_0337"
FT   CDS_pept        complement(334617..334877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87515"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD3"
FT                   /protein_id="ABL87515.1"
FT                   /translation="MEKIARYLKSKRYAKICGAVAQIAGEIVKLVMEYKPARRYGLPCL
FT                   ESYSTVCLRYGAKLQELKNRKTTRPSYSFNDHKDNIPSIWA"
FT   gene            335212..335303
FT                   /locus_tag="Pisl_R0006"
FT                   /note="tRNA-Gly1"
FT   tRNA            335212..335303
FT                   /locus_tag="Pisl_R0006"
FT                   /product="tRNA-Gly"
FT   gene            complement(335307..336362)
FT                   /locus_tag="Pisl_0338"
FT   CDS_pept        complement(335307..336362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0338"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pai:PAE2931 alcohol dehydrogenase (Zinc)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87516"
FT                   /db_xref="GOA:A1RRD4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD4"
FT                   /protein_id="ABL87516.1"
FT                   /translation="MKIPIRIRAALYRSSTRNLELSEIPTPMPGEGEVLIKVAATGVCH
FT                   SDLHILDGEMIPPPDGFILGHEVSGWVVEFGPRCENPHGLSSGDPVVVSWIIPCGKCYW
FT                   CVHGQENYCPYAATRMPGILGLNGGHAEYMVVPETAVFPIPKGLDVYTAAVISCAYGTA
FT                   YRALKEAEVRPGISLVVIGVGGVGLAAVELANALGAYPIIAIDIREMALKKAKELGATH
FT                   VVNAVTEDPTSSIRDILPQGADVVYETKPTPDLKLAIEVVKRGGTILVTGLGSSKIEIP
FT                   ANHLVMNGIKIVGSLGYRPRVDIPELLALAASGKIQPGRLISHRYTPDEINQAYQNLRE
FT                   GKHHRALVIWG"
FT   gene            complement(336359..336805)
FT                   /locus_tag="Pisl_0339"
FT   CDS_pept        complement(336359..336805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87517"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD5"
FT                   /protein_id="ABL87517.1"
FT                   /translation="MYLNKSEFLYMAKFPSKEWAEEFCRALNESAEYRSAATRWEGDII
FT                   FLVTNTPSQLGVGEKSAMKLYLKHGYCHGVEVYTGESISQADAPYILEADYKTWLDVIS
FT                   GKLQPIPAMVLGKIKVKKGSFATLAQYASAALAMIKVAQKVGIE"
FT   gene            complement(337099..337857)
FT                   /locus_tag="Pisl_0340"
FT   CDS_pept        complement(337099..337857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2934 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87518"
FT                   /db_xref="GOA:A1RRD6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD6"
FT                   /protein_id="ABL87518.1"
FT                   /translation="MDLTLLFITTIAVSITILGLIMYRLVKSLEIYLIPLYAEIIRKRE
FT                   RDYILMEFLTSLLVSKGLVTQVEADALKKISTTEPLTVEDLDKIDEILNKDPSQLTFEE
FT                   ITDLKRVAYKLLGRLDKKSVRLGMKLLKYAVGIEETFKTGVELPARSKTEKVEISYDYD
FT                   TCSVYLTTYRRDGTIEKTQGPDLECVTETAMILKALARRSTEVNKELAEKALARYKKCK
FT                   ESDTAGCKALKEALSTLERKSLDLLLERKH"
FT   gene            337884..338438
FT                   /locus_tag="Pisl_0341"
FT   CDS_pept        337884..338438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0341"
FT                   /product="THUMP domain protein"
FT                   /note="PFAM: THUMP domain protein; KEGG: pai:PAE2935
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87519"
FT                   /db_xref="GOA:A1RRD7"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR040183"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD7"
FT                   /protein_id="ABL87519.1"
FT                   /translation="MFYKMSLERSMSWNLVVATGWRQERLCLEELYRVGDIVGRRVEEV
FT                   WFTGFDGLLTAKVEGDPVEFVKMLIDVVKSGYYIPRYILRVTPIMTVVKTDLDEIQKAV
FT                   GELAERYIAPQESFKIELKKRGVKFDRMSVIEYVARAVNRRVDLTKPDKVVWIEMFPSR
FT                   TGISVIREDETFSLMRSRSAT"
FT   gene            338435..339022
FT                   /locus_tag="Pisl_0342"
FT   CDS_pept        338435..339022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87520"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD8"
FT                   /protein_id="ABL87520.1"
FT                   /translation="MREEYVEVGGRRVRYIAGGVGKPLVLLHGWSFNADTWVESGIFPA
FT                   LAKHYTLYAIDMPYGAKTKSERFSAPRREYAEFLRGILDALGLVDPPLVGPSASGEVVL
FT                   WYVARRLPTKAAIVVGPVGLAEELLTAVAEIDVPILAIWGERDEISPPSNAKLLRGKRV
FT                   KIAILKEAGHAAYLDKPGEFIDVVLSFLKEFY"
FT   gene            complement(338996..339895)
FT                   /locus_tag="Pisl_0343"
FT   CDS_pept        complement(338996..339895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0343"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: pai:PAE2937 dihydropteroate synthase; TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase,
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87521"
FT                   /db_xref="GOA:A1RRD9"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRD9"
FT                   /protein_id="ABL87521.1"
FT                   /translation="MHMIAGELGGLKVGDGHPVRIMAVLNISPESFFKGSVAIHNAVEK
FT                   AMELEKYSDVIDIGAMSTAPYLETWIPPEKELERLKAVLPDIIKNVKVPISVDTYRPQV
FT                   AEYALKVGASIINDVTGGKLYPEICRIIADYGASVVVVAREKEARRGVDPVARVVYALR
FT                   ESLEHFEKCGVDQRKIVVDPGIGFPLLPQRDEPYVVRGEYRHGDEQWPWWRWDLYIIAN
FT                   LAKLRALNKPILIGVSRKSFLRKITGVESPDEVLPASLAAETIAVLNGAHVVRTHNPRE
FT                   TRQAVRLAESLVKLFQKA"
FT   gene            339927..340229
FT                   /locus_tag="Pisl_0344"
FT   CDS_pept        339927..340229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87522"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE0"
FT                   /protein_id="ABL87522.1"
FT                   /translation="MQKVIRSKSYVFEGELPEEISTLLEKWGRLVKRGEVAVYMIDSGE
FT                   IKMRKISENPTQVVRRIYIHPSCGCMLEIDETRDFEQGKTTYTLYMKKLCQEHKS"
FT   gene            340253..341500
FT                   /locus_tag="Pisl_0345"
FT   CDS_pept        340253..341500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0345"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /note="KEGG: pai:PAE2939 hypothetical protein; TIGRFAM: RNA
FT                   modification enzyme, MiaB family; MiaB-like tRNA modifying
FT                   enzyme; PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   Radical SAM domain protein; Protein of unknown function
FT                   UPF0004-like; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87523"
FT                   /db_xref="GOA:A1RRE1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE1"
FT                   /protein_id="ABL87523.1"
FT                   /translation="MGRIYVETYGCWLAKADAEILRQRLGYEQVSNVDEADVILVYTCA
FT                   VREDGEVRQLARIRELVKLGKELIVAGCLARLRPYTIKSLAPHAKLIYPSEIEGGKERS
FT                   MKTLPKYERGLIYTVPLQVGCLGNCTFCATKYTRGGAGYVKSADPDDVVRHIKEAVAKG
FT                   AREIYLTGQDVITYGFDAGWRGGWTLPDLLDRILKEVEGEYRVRIGMSEPWIFEKFVDQ
FT                   LLDIIKRDHRVYRYFHLPVQSGSDKVLVAMGRKYTVEEYRGLIRRIRRELGDNVFIATD
FT                   IIVGFPGETEEDFQETVKLVEELQFDKIHVARFSPRPFTEAAVMPRQVPDAEKKRRSKI
FT                   LSEVAMRIAHLRNGAQVGKRDVVLIDEVDHGLVVGRASDYRQVVVKRGAGDGLLGEFVN
FT                   VRIAAASPVYLYGEIL"
FT   gene            complement(341497..343200)
FT                   /locus_tag="Pisl_0346"
FT   CDS_pept        complement(341497..343200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0346"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; KEGG:
FT                   pai:PAE2940 methionyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87524"
FT                   /db_xref="GOA:A1RRE2"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRE2"
FT                   /protein_id="ABL87524.1"
FT                   /translation="MAKYVIGSAWPYVQTVPHLGNLIGSVLSADVYARYLRFRGHDVVF
FT                   VSGSDMHGTPIEVEAIQLGVDPEEYAKKMHQIVAELFKRWDISFDLYTHTHSDTHIKFV
FT                   QNFFLKIYNNGYIFTKEEEVPYCPRDKIYLPDRFIIGKCPYCGYERARGDQCENCGRLL
FT                   DPKQLIEPRCAICGSRPEWRITKHWYLDLRKLEDRIRKYVEENPHLPPNAKEMSLGMLK
FT                   EGLKPRAITRDNKWGIPAPFPGAEGKTIYVWFEAVLGYISAVVELFREDAGKWERYWKD
FT                   PETKIVFFVGKDNIPFHVIILPALLLANGEGYTLPTTTASTEYLLYEGDKFSKSRRWGI
FT                   WIDEALQLMPPDYWRFILIYIRPENRDTSFTWALALEIINKIMNDDVGNYINRVLTFIK
FT                   NRMGGVVPPPGAPTREDEEFINRVIQLFKKAEKHYDAIELKDALHTVVEIAREGNRYLN
FT                   ARAPWELLRRDIEVANAVMYRAYWSLKTIAAGLTPVTPRSAAELWKMLGISQPSWDEAY
FT                   KPPTPGTPLGDVRPLFRKFTEEEVKDMLKKLEELRSQRASKKYPWEQVLL"
FT   gene            complement(343226..343846)
FT                   /locus_tag="Pisl_0347"
FT   CDS_pept        complement(343226..343846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2941 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87525"
FT                   /db_xref="GOA:A1RRE3"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE3"
FT                   /protein_id="ABL87525.1"
FT                   /translation="MDYVGLLGVFLAVFISHFIPFIPLPGYLATVTYVATHSDAVSVTA
FT                   AVLTTALGATLGKVLVFFYGYGIGRVVMGEEFQYAKKFFDKISKWGIDVAVFIFATSPL
FT                   ADDVLYIPLGAAGYSIRRFFLAVFAGKLLLASAIALFTDAALMAVDRYLGDVRLSMAIV
FT                   AVATLVVTILVLRIKWSRVLVAYESGGLKSAIREALRSIVRQK"
FT   gene            complement(343853..344569)
FT                   /locus_tag="Pisl_0348"
FT   CDS_pept        complement(343853..344569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0348"
FT                   /product="Undecaprenyl pyrophosphate synthetase"
FT                   /EC_number="2.5.1.31"
FT                   /note="KEGG: pai:PAE2942 undecaprenyl pyrophosphate
FT                   synthetase; TIGRFAM: undecaprenyl diphosphate synthase;
FT                   PFAM: Di-trans-poly-cis-decaprenylcistransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87526"
FT                   /db_xref="GOA:A1RRE4"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE4"
FT                   /protein_id="ABL87526.1"
FT                   /translation="MWESGSVKIPSHIAVIPDGNRRFAKKAGLDFYHAYKRGVEKVRSF
FT                   LLWALEFREIRNVTFYALSTENLQRSRLELEILFRIFEEEFRKSLEDPLIHENKVRIRF
FT                   IGDRSLLPGRVVKLMEELESVTRSYSSYNLTFALGYGGRAEIVRCIKRLLNGEVKIADI
FT                   NEETLFQCLDTRDLPNPEPDVVVRTGGEKRLSNFLLYQSAYSELIFLDKLWPEIEREDL
FT                   VYIVEEYSRRQRRFGK"
FT   gene            complement(344547..344873)
FT                   /locus_tag="Pisl_0349"
FT   CDS_pept        complement(344547..344873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0349"
FT                   /product="tRNA-binding domain protein"
FT                   /note="PFAM: tRNA-binding domain protein; KEGG:
FT                   pai:PAE2942a methionyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87527"
FT                   /db_xref="GOA:A1RRE5"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE5"
FT                   /protein_id="ABL87527.1"
FT                   /translation="MSLVSIDEFRRIDLRVGKVLEAARVEGSRKLIKLVVDLGAEKRQI
FT                   VAGLAEYYKPEDLVGKYVVVVANLEPKRLMGVESQGMLLATCDKPVLLTIEKGGDEHVG
FT                   ERVC"
FT   gene            complement(344897..345292)
FT                   /locus_tag="Pisl_0350"
FT   CDS_pept        complement(344897..345292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87528"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE6"
FT                   /protein_id="ABL87528.1"
FT                   /translation="MLAVPPAVIVLPLASKEQVLQTVNYVVGRLKQIGASIRHMHLDTP
FT                   LYLECKVTRDVVERVDVYLATANGDFVNVLPPSEEIKEGFVEKRSYIHLVQGVAVYFKY
FT                   ELGAGPKLAEVVIYSVGNAYRDFKLNL"
FT   gene            complement(345298..347709)
FT                   /locus_tag="Pisl_0351"
FT   CDS_pept        complement(345298..347709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87529"
FT                   /db_xref="GOA:A1RRE7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE7"
FT                   /protein_id="ABL87529.1"
FT                   /translation="MYVRRCLIFTVAIVAIVVAVSIEPEYVNAYTYTNLTIRGAKQVEV
FT                   VEGVVVDFNITSGSTIYLGVRPLKTTGDITLRINGKVVKLPVVDKCRIEINAANMTSKI
FT                   SVNMTERGCGTVMLYVNGSKAPTTAFVPQYSGLYYLVATDGVFYQKTKVVVIPNISVVN
FT                   NVFGEVMKINLHPPPRRGLVSIGTFVLPASELIAVDTWSLGAGNYTLTLTMGDIVTTYN
FT                   LTVIKAVPNLQVIHKDEYTYGESINITVRVFVGRRDYRATVSIVMNRSSPILVKSPSSL
FT                   IFRLLDVGVYQLYVAVAEDRNITSIGVNRVLRVSPAPVQLDVKINRTFSNPYVVEYGKL
FT                   LSISAKALSLVEPRGLLTVFVNGAPSGSLVDTLKIGPGLHNLTVVFTPTTRNFRNAKLS
FT                   MLVFVAPSTPEIIVNKTFSTVYGQELDIPIFLRLYGRPINATARVELMGRFHVFNYTVR
FT                   VINGVGVLKIVGIPAGTYLGTVSIAEAPGLLSTKATFNVFVSSAIVKLILDVPKRGVYG
FT                   EALPVRMFLQPSGVAGRLYLIINGTVVYSGNSSSYQGMWLPPRGGVFKITARFDSFDPN
FT                   YSSVENITYVFIDRAQCVIHFVLRGEVVNNTVYVLRRYVVQPLVSFPTYIYINGSVAGP
FT                   QLVFNKTGVYNITVFFPGDDSYYPCWTSQFYLAVKNPAKIEIRAERKMALIDGGLPLVV
FT                   NLESPVGQEEGRVLIYKINKTYNSTDVEDVLVDKSTVVTLRFKNTGVYMIYAEFLGNDY
FT                   LLSNRSNVVVVTVETSYFGIPVFLLAVYLMPLAIGFIAAVATKRILKRGI"
FT   sig_peptide     complement(347644..347709)
FT                   /locus_tag="Pisl_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.473 at
FT                   residue 22"
FT   gene            347771..348523
FT                   /locus_tag="Pisl_0352"
FT   CDS_pept        347771..348523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0352"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pai:PAE2947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87530"
FT                   /db_xref="GOA:A1RRE8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE8"
FT                   /protein_id="ABL87530.1"
FT                   /translation="MAKIITIDVWGTLVPVEPAIKAVVDVLHKSLGGRIPYQTVQALIN
FT                   EERRKMKLARREKHEVVPPIYTLLDIQRQLRNRGINTFFDVYQTQDAIDDAISRLEITP
FT                   YEDAVEAIKHAKAEGYRIGIISNVLLWRSRATRKLLETLGISQLVDLQLYADDIGYVKP
FT                   AVQIFEAAKTLLLGDVEPDVYLHIGDDFYEDFLGALMAGYGAVLIDRREQHTKRELTEA
FT                   VPCRAYIVRSLKALPLVLHEAESCIKPS"
FT   gene            complement(348510..349274)
FT                   /locus_tag="Pisl_0353"
FT   CDS_pept        complement(348510..349274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87531"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRE9"
FT                   /protein_id="ABL87531.1"
FT                   /translation="MKRLVFSSGTKGGTGKTTLALNTAVLLAYAWRNVSYYPVVFIDLT
FT                   PNIGTAALILIGESLATWGRPSLSDYVIGKLADPIRAFYLRRWNTEKGAFQLVFTFLGR
FT                   DGFLTKRQLEHVLQIVESRLKPGVLIIDMPPSPFGSLAAGLVDYVVPVVTPDISAIETT
FT                   KSYVELLGGRRLRPVLNMYIPEYSISAVHSMPWERVVEKTFGEPPHIVPFDKLLQAARQ
FT                   ALEIEVLKLKPTESPAVKSIIEYVKYLMSNLA"
FT   gene            complement(349271..349501)
FT                   /locus_tag="Pisl_0354"
FT   CDS_pept        complement(349271..349501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87532"
FT                   /db_xref="GOA:A1RRF0"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF0"
FT                   /protein_id="ABL87532.1"
FT                   /translation="MSLVDYVKFAIGIVLNITAFTLAVLCQWPIAAILFYVASLVLIMP
FT                   RREKKKEEKVETKREITPEEIKRRPVSAPEV"
FT   gene            complement(349511..349819)
FT                   /locus_tag="Pisl_0355"
FT   CDS_pept        complement(349511..349819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87533"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF1"
FT                   /protein_id="ABL87533.1"
FT                   /translation="MCEILARFLVELVEGARGNVVSFVVGDVSKWAETKIRPTRSIVFK
FT                   VANMSEALLVAGYLEKIGKKYILRRDTPLWVKAKAGDVEGLCEIIEGVLYNYSKVVK"
FT   gene            349872..351008
FT                   /locus_tag="Pisl_0356"
FT   CDS_pept        349872..351008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87534"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF2"
FT                   /protein_id="ABL87534.1"
FT                   /translation="MRVLIIGTTGLNMKALASSLEKFHREQSRGKLGLYFVEEELKKEV
FT                   DWVIFLDSDDYYWQERVWREAVAKTVARVEEEAPDHAAIFMNLPYFRKSRFFPAVDISV
FT                   LRAFKPDLLMTLIEEAHVIWRRIQIREGREKTGATLRLKDVFAWRTASILIGDTIAKAL
FT                   GVQNVVVAVKHPAKTIYGIAIGAARPRFYLSFPITYTRGDPEARREIDAFRAEMHKRFY
FT                   AFDPLTIDERVLRTAKRQGNIVVIEAEDRWLLPEGVRPAVEDEPELYPMEIPVDQVEEV
FT                   LIDIDNLIRFKDFRFILQSDAVVVYRPFMKKMFHKGVFSEIMYASNTAHKRLFIYLPPD
FT                   DRTTGMDSPFDPGVGTIEERLEKFFEVIERFAARFSAE"
FT   gene            351417..352229
FT                   /locus_tag="Pisl_0357"
FT   CDS_pept        351417..352229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0357"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: pai:PAE2954 bacterial extracellular solute-binding
FT                   proteins, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87535"
FT                   /db_xref="GOA:A1RRF3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF3"
FT                   /protein_id="ABL87535.1"
FT                   /translation="MDYKLAAGVAIGLIIGVIATMLFIPQPQSQQQSAPPCPTSLDLIK
FT                   KRGKLIVGTSADWPPYEYVESGKIVGIDIDIARRIADSLGVQLEIRDMKFSALIEAVRK
FT                   GDVDFVIADMAITPEREKQVLFSIPYQVDSSTVVVKKGTQIRSVEDLRGKTIGVQVGTV
FT                   QEDWAVRTLGNYSKIVRYDRVYPYMVEALRKGDVDAIVVGGVVGDAVVKRFPEFEKAFS
FT                   VGVRYSAVAMPICAYDLKLQVDKVIYDMLQSGEMERLINNWVEKWLYG"
FT   sig_peptide     351417..351506
FT                   /locus_tag="Pisl_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.471 at
FT                   residue 30"
FT   gene            352214..352600
FT                   /locus_tag="Pisl_0358"
FT   CDS_pept        352214..352600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0358"
FT                   /product="protein of unknown function DUF192"
FT                   /note="PFAM: protein of unknown function DUF192; KEGG:
FT                   pai:PAE2955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87536"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF4"
FT                   /protein_id="ABL87536.1"
FT                   /translation="MALWLIIKLSLVLISPFSTTTTFELNNVVYTVYVADNFVKWVIGY
FT                   MNVTSYDPRGVGAVGMLFIFPRNSTYCFWMKNTYIPLRIVWVSGSRITGQALGRPLDKT
FT                   PVCGYGDKVLELKPEITLGEQQQK"
FT   gene            352977..353681
FT                   /locus_tag="Pisl_0359"
FT   CDS_pept        352977..353681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87537"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF5"
FT                   /protein_id="ABL87537.1"
FT                   /translation="MPRYRRYRNAEKSRGMYPRTWVYTGSTSGIKSRVSASAMRLGVVV
FT                   AAAALALALAVYIAAAAGSDSKAQSAQDAAIEGLAIVEPDYYDSFWYMYGRLPRKMNIE
FT                   VDDVVRRILERPVGAPGPARGEFQIDERQWFHSDAAGREVYERCFGGIFVDAARIYIVV
FT                   TDRACGEKIMRAVEDLASQYGAELVFLKGKYTYKQLSQWADALFHKVSKEGLQDRLKQI
FT                   CGKYVVTMLMVD"
FT   sig_peptide     352977..353159
FT                   /locus_tag="Pisl_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.269 at
FT                   residue 61"
FT   gene            353766..354002
FT                   /locus_tag="Pisl_0360"
FT   CDS_pept        353766..354002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87538"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF6"
FT                   /protein_id="ABL87538.1"
FT                   /translation="MGIPKDAVILEKFPGVAPYPLPVGVVESKDCSLVFTGVRGVGNPF
FT                   ALTAGGCVVSYIDVLDHRRCVILPPGVWDMLGS"
FT   gene            354470..355099
FT                   /locus_tag="Pisl_0361"
FT   CDS_pept        354470..355099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87539"
FT                   /db_xref="GOA:A1RRF7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF7"
FT                   /protein_id="ABL87539.1"
FT                   /translation="MTAFKNVLLWVYLALASYVVSIGFGLAGMSAASAAAGAISTVLVG
FT                   ITLTKAYRELLNIRDMYWDKLGGVWLGGEYVVAIWLFVISGVSSQPIALFLVHQFEILA
FT                   DRNVEQIDFTKLMGLGALVLGLLLLVAVWIVAWAYLIEVFTRDIYIVKVATGVGTFRPS
FT                   SATFYIVLSVITIGFLYFYWLYSVWKWISQLKTSTKLPHLSQSRTV"
FT   sig_peptide     354470..354574
FT                   /locus_tag="Pisl_0361"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 35"
FT   gene            355099..355794
FT                   /locus_tag="Pisl_0362"
FT   CDS_pept        355099..355794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0362"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: pai:PAE2959 NAD-dependent deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87540"
FT                   /db_xref="GOA:A1RRF8"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF8"
FT                   /protein_id="ABL87540.1"
FT                   /translation="MALTGAGVSTASGIPDFRGPQGIWKKIDPEKFDIEYFYRNPDEVW
FT                   DLFIEFFLPAFDVKPNPAHYALAELEKIGKLCAVITQNVDMLHQAAGSRNVIELHGALR
FT                   DAVCVKCGARYPLREVLKWRSSGAPRCPKCGGVLKPDVVFFGEPLPQSALREALMLAEM
FT                   SDVFIAAGTSLAVYPANQLPVVAKKRGAKLVVVNADETYYDFFADYVLRGKVEEILPKL
FT                   VEKVKDILF"
FT   gene            complement(355775..356293)
FT                   /locus_tag="Pisl_0363"
FT   CDS_pept        complement(355775..356293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0363"
FT                   /product="protein of unknown function DUF309"
FT                   /note="PFAM: protein of unknown function DUF309; KEGG:
FT                   pai:PAE2960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87541"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRF9"
FT                   /protein_id="ABL87541.1"
FT                   /translation="MRYLIIAENPGYLPSHREFLIKQLRASLPVITIRVASSHVEVDVK
FT                   TDDLETAVVEVERKIGRVLDVIDITFEEVGGDVEKYVELFNKERFWEAHNVLEGVWRKT
FT                   REPTLQGLIMLAASFVKLQEGQLDKFERLIKEAIQLLEKDVGCIKIRKLRKKVEKALVE
FT                   KKPFKIECL"
FT   gene            complement(356290..356709)
FT                   /locus_tag="Pisl_0364"
FT   CDS_pept        complement(356290..356709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0364"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2961 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87542"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG0"
FT                   /protein_id="ABL87542.1"
FT                   /translation="MPLLKRRELPLRVSDVMVRNVITAKKDDKIKDIAIKMYENKVGSV
FT                   VIVDEEGKPVGIITERDLVYVVARSLAPDTPAWMVMTENPIVIREDALITEAMEKMRVQ
FT                   NIRHLPVVDTSGRLVGMLSFRDVVDFVVMLFSLAK"
FT   gene            complement(356737..357066)
FT                   /locus_tag="Pisl_0365"
FT   CDS_pept        complement(356737..357066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2964 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87543"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG1"
FT                   /protein_id="ABL87543.1"
FT                   /translation="MILITLSELETLLTSIREYAEKYRTNRLALEALEERWLKFQELAF
FT                   AFGIDLKPAEGVEFYAGGPLPDNADFIRRLDRLISTVRKMREVYGDVKVIVDLDLSVRK
FT                   MLVKI"
FT   gene            complement(357063..357488)
FT                   /locus_tag="Pisl_0366"
FT   CDS_pept        complement(357063..357488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87544"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG2"
FT                   /protein_id="ABL87544.1"
FT                   /translation="MIVVSSTNIEKLIWHLRSLVPQIESTPILLARRQVGNYTIGLGTL
FT                   GYIYTALSSVLETLVEADKMAEDLKLRDYTVVIGPDESYITPASLPEVIPTLPQPREIP
FT                   PLPREETRLNTFGCHDLTPGMVKFCVDNVEIAYYLSR"
FT   gene            complement(357485..357622)
FT                   /locus_tag="Pisl_0367"
FT   CDS_pept        complement(357485..357622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2966 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87545"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG3"
FT                   /protein_id="ABL87545.1"
FT                   /translation="MRTLQKKKVAELQIDPRIKEVLLKVLGPNEEVYIEIAGGKTRIII
FT                   "
FT   gene            complement(357619..357831)
FT                   /locus_tag="Pisl_0368"
FT   CDS_pept        complement(357619..357831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87546"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG4"
FT                   /protein_id="ABL87546.1"
FT                   /translation="MILHTSQLHIIEDVESILERYKVKPVAIRGSRVNFYWPPQPTGVP
FT                   LNILRYFPPDMYVVFRGRNTLIVVP"
FT   gene            complement(358146..358706)
FT                   /locus_tag="Pisl_0369"
FT   CDS_pept        complement(358146..358706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0369"
FT                   /product="paREP12"
FT                   /note="KEGG: pai:PAE1827 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87547"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG5"
FT                   /protein_id="ABL87547.1"
FT                   /translation="MSASPWRCLGFPVSPTRRQSTLTFLWRGSRGRLHEEISRLEERAA
FT                   RETGPVRRRRLEERTRHLKSKRFRKIGGVVTQIAGEIVKLAMEYKAAVVVDKIEDESYW
FT                   ELREGDGDGEKKHLLDGLGQLRKRLQELAQWYGLPYLELYSTVCLRYGAKLQELKNRKT
FT                   TCPSYSFNDHKDNIPSIWAKRRY"
FT   gene            358856..359539
FT                   /locus_tag="Pisl_0370"
FT   CDS_pept        358856..359539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0370"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: pai:PAE2968
FT                   sugar-phosphate nucleotidyl transferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87548"
FT                   /db_xref="GOA:A1RRG6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG6"
FT                   /protein_id="ABL87548.1"
FT                   /translation="MQAVILAGGFGKRLAPLTNELPKPLLPVGGKPILVRQIEWLRRYG
FT                   IVDIILAVGYLRHKIFEALGDGRKYGVRLFYSVEEEPLGTGGAIKNAAPYLTDDVFIVV
FT                   NGDVLTNLPVDRVVEALENADGAIALVPLRSPYGIVEFDSNGYISRFREKPLLEGFYIN
FT                   AGVYALRKKVLSELPDRGNIEETLFPSLAQQRRLKAIVFRDVFWRSVDSLKDLEEVDKY
FT                   FTNES"
FT   gene            359529..361241
FT                   /locus_tag="Pisl_0371"
FT   CDS_pept        359529..361241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0371"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="KEGG: pai:PAE2969 glutamyl-tRNA synthetase; TIGRFAM:
FT                   glutamyl-tRNA synthetase; PFAM: glutamyl-tRNA synthetase,
FT                   class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87549"
FT                   /db_xref="GOA:A1RRG7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR004526"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRG7"
FT                   /protein_id="ABL87549.1"
FT                   /translation="MNLEELVLKYALANAVKYGGKADVKAVMSKIMAEVPELRPKAREV
FT                   KSMVEAVVARVNSMSLEEQLRLLRERWPETLEERRVEQKRPGIENLAELPNVKGGVVVR
FT                   FAPNPDFVLHLGSARPAILNYAYRLKYGGKFILRFEDTDPRTKKPLVTSEINAYETIRE
FT                   DLKWLGIKWDEEYIQSMRMEIYYEHIKKLLEKGAAYVDLCRPEEWRKLRNAGRACPHRE
FT                   QSPEENLELWDRMLEGRFKEGEAVVRIKTDLSHPDPSVRDWVAFRIIDTSKTPHPLVGD
FT                   KYIVWPTYNFAVSIDDHLMGITHVLRAQEHSVNTIKQSYIFKHFGWEQPVTIHFGRLKI
FT                   EGASLSKSKLKALGVRYDDISLPTLAGLRNRGILPEAIWELILTVGVKPSDSTIALSNL
FT                   FALNRKRIEPIANRYMYVADPIKLVFKSDRELLAKIPLHPSFRERGERIYKFGPGTIEL
FT                   FVPRQDIKPGAVVRLMELANVEIIAVENGVAHGRLHSVGIDEARKVGAPIIQWVYEPIE
FT                   IHVVKPVAVGKKVEEIGLGESALEKVETGAYVQFMRYGFLKKVGPSAFVYVHD"
FT   gene            361234..362235
FT                   /locus_tag="Pisl_0372"
FT   CDS_pept        361234..362235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0372"
FT                   /product="protein of unknown function DUF354"
FT                   /note="PFAM: protein of unknown function DUF354; KEGG:
FT                   pai:PAE2970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87550"
FT                   /db_xref="InterPro:IPR007152"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG8"
FT                   /protein_id="ABL87550.1"
FT                   /translation="MIKLIFDALTPKQARIAAVLYQEGSRRGINVVITCRNYFHLADIL
FT                   RIYGVPYVCIGRYGVTPYEKLVYGLERQRELVEYVKDVDGMLSFPSPDLARVVFGLGKP
FT                   VIVMNDTPHASHVNRLVIPLSEVLIAPAAIPQEIWKSYCPRRVVTFDGVFEYMWISKFA
FT                   PNEEVIKRLGLRRGEYVVFRPEEEHASYYLWNTATIRMRLVEEFRKRGYVIVNVPRYSD
FT                   QIINGVFNLTEAVDHLQLAYFSAGVVTGGATMATEAALLGVPALSYFPGDYYLDRYIRD
FT                   RGAPLFRCRDLESCLVAVEEMLKIGRTSPPKFEDPTPLILETATEVVSLREN"
FT   gene            362265..362648
FT                   /locus_tag="Pisl_0373"
FT   CDS_pept        362265..362648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0373"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2971 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87551"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRG9"
FT                   /protein_id="ABL87551.1"
FT                   /translation="MRAVALLKVGRDYGVTFLDLKIAGLRETDTKLAKYAEELEMIQND
FT                   LIGIMPKLKEMYVLDITLEDTMGRRYIARFYTYGGIVYYAILISPKSTMGTVLKKLTQQ
FT                   GWKLLILIERKAVKKSASETDVR"
FT   gene            complement(362626..363087)
FT                   /locus_tag="Pisl_0374"
FT   CDS_pept        complement(362626..363087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87552"
FT                   /db_xref="GOA:A1RRH0"
FT                   /db_xref="InterPro:IPR020618"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH0"
FT                   /protein_id="ABL87552.1"
FT                   /translation="MGELLINTPYVKYIPELDTYEIVDLEGAKEVVYKATRPGSIIDTH
FT                   VVEVSPDPEIVIVLRKAPDVLFKELLNRGWPLKKVVDNVWAEILDIVYTSASERWHRVF
FT                   QIDVTLRSPEETFEVLKRCITKRCRSDRVDWLEYSEKTGFLEFIERLSR"
FT   gene            complement(363173..364468)
FT                   /locus_tag="Pisl_0375"
FT   CDS_pept        complement(363173..364468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0375"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase, class II (D, K and N); nucleic acid binding,
FT                   OB-fold, tRNA/helicase-type; KEGG: pai:PAE2973
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87553"
FT                   /db_xref="GOA:A1RRH1"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH1"
FT                   /protein_id="ABL87553.1"
FT                   /translation="MEVFKKAIPISEAIKLSTGYVTVRGWVYRKRVLKEKVFVVLRDST
FT                   GIIQLVFPRDRFKIAEELNIESSIVVSGLLVKEPRAPGGVELHVESIDWVYIGEPYPIN
FT                   EDAVTADSEYLLDVRHLWLRSRKMQAVLKIRHTVFEALHHYFRKNGFYEVQAPMFITAA
FT                   VEGGATLFRVDYFGRPVYLTQSSQFYLEALIYSLEKVYTIAPSFRAEPSRTRRHLTEFW
FT                   HAEMEMAWASMEDAARVGEEVISYTVEKVLQERGEELKLLGRKTEALEKAKPPFYRVSY
FT                   DEAIEILRKKGLNINWGDDIGADEERALTLEFDKPIILYGFPEKLKAFYHRNNPQRPEV
FT                   TLSFDVLLPEGYGEVIGGGERIYDAKELIDKIIRFGLNPEDYQWYIDLRRYGSVPHSGF
FT                   GLGVDRLVMWITGADHIRDVVPFPRDIRRTKP"
FT   gene            complement(364468..364722)
FT                   /locus_tag="Pisl_0376"
FT   CDS_pept        complement(364468..364722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87554"
FT                   /db_xref="GOA:A1RRH2"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH2"
FT                   /protein_id="ABL87554.1"
FT                   /translation="MNVWDYLVVLITSLLVLLFFMYMFWRVTATRDRERPAEIFTLVRC
FT                   GDGTEKKRRYQEGDYVGKQTAECEGGVIIGIFKEAPLQT"
FT   gene            complement(364719..365525)
FT                   /locus_tag="Pisl_0377"
FT   CDS_pept        complement(364719..365525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0377"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: pai:PAE2977 3-hydroxyisobutyrate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87555"
FT                   /db_xref="GOA:A1RRH3"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH3"
FT                   /protein_id="ABL87555.1"
FT                   /translation="MDITIIGMGNMGKAFAKRAASLGYNVYWWNRTREKVKDAPGKAIN
FT                   KPEEARGFVAIFVADDTALFNVLPNIGGDYIALCGTYSIGAVKKAVETLGEKRVFAMPV
FT                   VGSPRNVEGGDAIYIVGAPDELYIKLRPTLEKFGTLFYVGDNVKATALKLAFNSLLIST
FT                   VATLGESLSLAVKYGIKPEVFKELLSMTVFKEVAARYIDRMLGSGQPTFTIRNAAKDMR
FT                   YAATAAGEAESGSVAISGVKALYELLTALGYGDEDYVKAGYLAGRK"
FT   gene            365572..366621
FT                   /locus_tag="Pisl_0378"
FT   CDS_pept        365572..366621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0378"
FT                   /product="translation factor SUA5"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC, N-terminal domain;
FT                   KEGG: pai:PAE2978 SUA5 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87556"
FT                   /db_xref="GOA:A1RRH4"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH4"
FT                   /protein_id="ABL87556.1"
FT                   /translation="MLLLRTDPLKPDADVIRFAAEVLKRGGIVAAPTETVYGLFTHAYS
FT                   DGGCAKVFKAKERPPDNPLIVHVDSVEMAAQIAYIPEEIVDVLRRIWPGPITLVMKSRG
FT                   AVSRCVTAGLDTVAVRAPAHPIPLAIIKELEAPIAGPSANKAGRPSPTTAEHVVEDLNG
FT                   EVDVIIDGGPTFFGVESTIIDVTRKPPILLRPGPFTVEELEKYFGPVEIPPVARGLIET
FT                   DVALAPGMKYKHYAPNTPLVIVHFDLSLAVETLRSKGLKVAVLCATGRCTNADVVIKMG
FT                   DDLYEVAKNLYRSLRELDRFSVDIGVVPAVEETGIGLAIMNRLRKASGHREAFNLGQLL
FT                   KYGLAQPVF"
FT   gene            366596..367369
FT                   /locus_tag="Pisl_0379"
FT   CDS_pept        366596..367369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0379"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: pai:PAE2979
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87557"
FT                   /db_xref="GOA:A1RRH5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH5"
FT                   /protein_id="ABL87557.1"
FT                   /translation="MDWLSQFFDDIYLDFIQHYKGEWESKTEALFIQRALRIEPGMRVL
FT                   DVACGHGRHMAYMPKDTVVGVDINLKYLEIAKKHGDVVQADVRSLPFRKGAFHGAYIMH
FT                   STFGMFGVETEVEILTWLSGILKQGGRLLIDVANKEKIEDIYHSLGEVWNFWISAGPYR
FT                   VLSTAYYNPLTSRIREVRHIYKSGQYVGERVLELTLYSLGELRVMFSTVGFSIEDIYGG
FT                   FNGEKYDRHADRLIVIAVKTGGISRALKEAVVWNV"
FT   gene            367398..368255
FT                   /locus_tag="Pisl_0380"
FT   CDS_pept        367398..368255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0380"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: pai:PAE2980 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87558"
FT                   /db_xref="GOA:A1RRH6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH6"
FT                   /protein_id="ABL87558.1"
FT                   /translation="MDILAFQNAVDLVTELEKVGVVKQVEERVFPDGEVLIRLPETGPE
FT                   VALVLRLYPSVNDNIIKLVLALDALSDIGVRKVVLLTPYFPYARQDRRFRTGEPISSKT
FT                   ILKLLANYPVFAIITLDLHKPYIAEYVPRITTRNIYPAVEFAERLKDVDIVLSPDFGSV
FT                   YRAEAIAKILGVSYTYFEKYRDRDTGSITLVPRYDVNLKGKNVAIVDDILSTGGTLVDA
FT                   CKSARALGANKVYAAVTHCQLLRDAREKVRGCVDRLICTDSIPNEFAEVRTGPILRREL
FT                   ERLL"
FT   gene            complement(368250..369260)
FT                   /locus_tag="Pisl_0381"
FT   CDS_pept        complement(368250..369260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0381"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   pai:PAE2981 acetylpolyamine aminohydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87559"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH7"
FT                   /protein_id="ABL87559.1"
FT                   /translation="MLVYYSPIFKKHTPPFRHPEAPDRLDHLLEGAREAGAEIKEPVMR
FT                   EDVWHIIESIHDKSYVELVRRLCREGHAEIDGDTYISSGTCDAAALAVSAIINAVERKE
FT                   TALIAARPPGHHAGVAGRALSAPSQGFCIFNTAAIGALYGEEGVAVLDIDVHHGNGTQE
FT                   ILYDRDLLYISTHQHPLTLYPGTGYPEEVGEGKGEGYNINIPLPPHTGDDVYIKVIDEI
FT                   ITSVLRQYNPRLVIISLGWDAHKEDPLADMKLSLKSYLYVFETVLRLQKPVIFLLEGGY
FT                   NREVIRRGTKALIRLADAGEFAPGESQTSTDVHTLEKFEEIIKEVKSYVGRYWRL"
FT   gene            369320..369505
FT                   /locus_tag="Pisl_0382"
FT   CDS_pept        369320..369505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87560"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH8"
FT                   /protein_id="ABL87560.1"
FT                   /translation="MSILKRKKKEEEEDDLEKILSELKENDEGNDVTTVTIQIAGLKEL
FT                   TKAIQELAEAMKKCNS"
FT   gene            complement(369502..370122)
FT                   /locus_tag="Pisl_0383"
FT   CDS_pept        complement(369502..370122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0383"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: pai:PAE2983 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87561"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRH9"
FT                   /protein_id="ABL87561.1"
FT                   /translation="MVCILPIGSYEQHGPHLPPTVDTEIAQYIALKLAEKITAQVLPPI
FT                   WYTCSDEHRAFPNTISVRCRSLIPYLEDVLRSAVEKCGKVVAVVGHGGVWEAVSLLVQQ
FT                   LNYELGPRVLAIKVWSYIFVRDHAGSDETSIYLAIGGKLTGDLVDICEGDISLFGKMSV
FT                   DKFSKSGIVGCLKSGEVSAERGRRMLEDALGRILKKVEEFLKV"
FT   gene            370211..370876
FT                   /locus_tag="Pisl_0384"
FT   CDS_pept        370211..370876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0384"
FT                   /product="GTP cyclohydrolase IIa"
FT                   /EC_number="3.5.4.29"
FT                   /note="KEGG: pai:PAE2984 GTP cyclohydrolase III"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87562"
FT                   /db_xref="GOA:A1RRI0"
FT                   /db_xref="InterPro:IPR007839"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRI0"
FT                   /protein_id="ABL87562.1"
FT                   /translation="MHGIAVIELKGYREWTESLGPRREHIIQQIQAKLHATLWKSFTTV
FT                   GALPHHFRYDFFIALVNNISSAAVESAVAKIARHSPVPIDFCIGTGDTPYSAYLNCRGK
FT                   EVEATSFSIVAHMDIVNSTKTTKLNGPLDVYSHIVRLIDTLLDVCKEYGCLVFYLGGDN
FT                   TALFLPTPDVINEIVRNIDTRVRVGVGVAKKPYNAFVKATRGLDYLRSTNREGIKIVK"
FT   gene            370873..371526
FT                   /locus_tag="Pisl_0385"
FT   CDS_pept        370873..371526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0385"
FT                   /product="2,
FT                   5-diamino-6-(5-phosphoribosylamino)pyrimidin-4(3H)-one
FT                   reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="KEGG: pai:PAE2985 riboflavin specific deaminase,
FT                   putative; TIGRFAM:
FT                   2,5-diamino-6-hydroxy-4-(5-phosphoribosylamino)pyrimidine
FT                   1-reductase; PFAM: bifunctional deaminase-reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87563"
FT                   /db_xref="GOA:A1RRI1"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR006401"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI1"
FT                   /protein_id="ABL87563.1"
FT                   /translation="MRPYVYLVAATTIDGRIASYTGYSRLSCPYDLKRLHSIRASVDAI
FT                   IVGANTAIVDNPRLTVRYVEGKNPMRVLIDGALRAPLTLRIFDSSAPTVVFTTHKAPQD
FT                   KIHELQKRGVKIYITEGETVDPAYVLDTLYKQGVRKVLLEGGGRTNWEFLSKCLVDEII
FT                   LTVTPYVFGRGVSLVEGAGFATTEDTPFALTLHSIKLCECGQEVVLKYHVSCKH"
FT   gene            371566..372207
FT                   /locus_tag="Pisl_0386"
FT   CDS_pept        371566..372207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0386"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /EC_number="4.1.2.-"
FT                   /note="PFAM: 3,4-dihydroxy-2-butanone 4-phosphate synthase;
FT                   KEGG: pai:PAE2986 GTP cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87564"
FT                   /db_xref="GOA:A1RRI2"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI2"
FT                   /protein_id="ABL87564.1"
FT                   /translation="MPIEEAIKALREGRIVMIYDGDERENEVDFVIRGDAITPSLVRWL
FT                   RKNAGGLLCFVTTEKVGRTLGLEFLSEYYGRRGYVTKAPYGDNPAFMGYVNHIKTKTGV
FT                   RDADKALTIRELARIVELALRDPDAAYEEFRKNFYLPGHVPILGGRVGTRWGHTELALI
FT                   LANAAGIPPALAIIEALGDYQEAMPLEEAKELASILGIPLVTSREIRPLA"
FT   gene            complement(372530..372955)
FT                   /locus_tag="Pisl_0387"
FT   CDS_pept        complement(372530..372955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0387"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   pai:PAE2987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87565"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI3"
FT                   /protein_id="ABL87565.1"
FT                   /translation="MWEDASWFEVKFRCIKCGICCIGTEMELLVEDILRITSKGYKLED
FT                   FAEERDGVYRLKNVNGHCVFYDPDTKMCKIYDIRPIGCRLYPLIFDGEKVDIDRTCPVW
FT                   YTVSKSEVKRLAPYVIEFVKETKLTKIKLRLRRHFKP"
FT   gene            373013..374101
FT                   /locus_tag="Pisl_0388"
FT   CDS_pept        373013..374101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0388"
FT                   /product="geranylgeranyl reductase"
FT                   /note="TIGRFAM: geranylgeranyl reductase; PFAM:
FT                   monooxygenase, FAD-binding; KEGG: pai:PAE2989 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87566"
FT                   /db_xref="GOA:A1RRI4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI4"
FT                   /protein_id="ABL87566.1"
FT                   /translation="MIYDVIIVGAGPAGSTAALMARRLGLKTLVIDRAQPPREKPCGGG
FT                   LTPRTWKLLERLGIEYPVYGSCKSIETRAAGYRHVLKKEPILITRRPDFDYAILKQSGV
FT                   DFIKDHILGVREGGVVGRAGEYQGRVIIGADGSTSVVAKSIGVRNFRGEKSHAIAYVTI
FT                   AKGPTSDICVIDFDAVVNNTGRVGYAWIFPLDQGANIGAGVGWGKWLDLRKLVVEYAEK
FT                   EGYKPGPVLGHPISLGYIAGLGRRNVILAGEAAGFVDATTGEGIYYAIATGALAAVAAY
FT                   TALKIYGNEKWTFDIYSELAKPYVEEVKKTRWLSHMARTLGARRWVVKLLGRRLVELYS
FT                   RVYTGEATYSLTLKPVERRLKL"
FT   gene            complement(374090..375250)
FT                   /locus_tag="Pisl_0389"
FT   CDS_pept        complement(374090..375250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0389"
FT                   /product="Quinolinate phosphoribosyl transferase"
FT                   /note="PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   pai:PAE2990 nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87567"
FT                   /db_xref="GOA:A1RRI5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR035809"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI5"
FT                   /protein_id="ABL87567.1"
FT                   /translation="MFHVASPQDISLGRTADVYFLRTVEVLKNAGLSDVRVRAEFHVAS
FT                   LPRGYKWALFTGLKEVLELLKNRKVTVYALPEGTAFYENEPVMVIEGPYLEFAILETAI
FT                   LGILRHYSSISTKAARIKKLAGDKTCLFFGARALHPAVQPMADRAAYIGGCDGVATVLG
FT                   AEMIGIKPSGTMPHALMIIFRALMGDHTLAWLWFDKTMPQDVPRIILVDTFLDEREEAL
FT                   IAARLLGNRLYGVRLDTPGSRRGNIRRIVEEVRWTLDLHGYKDVKIFVSGGLDESQIAM
FT                   LRDVADGFGVGTSIAFPPSVDLSMDIVEVEVEGRWVPITKRGKLPGFKQIYKCGSRHVV
FT                   VRWDEPPPCGEPLLIKWIEDGKLMRGIPSDIEIREYVLRQLKELEL"
FT   gene            375283..377025
FT                   /locus_tag="Pisl_0390"
FT   CDS_pept        375283..377025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0390"
FT                   /product="DEAD_2 domain protein"
FT                   /note="PFAM: DEAD_2 domain protein; SMART: DEXDc2; helicase
FT                   c2; KEGG: pai:PAE2991 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87568"
FT                   /db_xref="GOA:A1RRI6"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI6"
FT                   /protein_id="ABL87568.1"
FT                   /translation="MELFPYEEFRPYQREIYEKTYTTLLTGGTLLINAPTGLGKTAAVI
FT                   SAAAKYILETGGVVHYTVRTRTELEPPVRELANIMRRGVELDYVVIKSRQDMCCYQQLK
FT                   KLDYLEFLAECNLLKSMDKCVYYPPRDVSIPLKNVSAYIKFLCTAYSCPYEYAKARLNR
FT                   AKLIISTYYYILGREHIDLKDRAVIIDEAHSIFDAVIHLYTVKVSETDVKSAYREAKKY
FT                   GFLEEASKIYALLTFIRKMSGVVDLGDLLGIVEDLDLENAIWEIIKKKTDEKINPYTPL
FT                   ILLRELKNALKSRIKYFSEIRGEDATKVLVLQPLDPTSLVKEKLKEAKSVIYISGTLPI
FT                   SLFSTTLGLIKYSHIDISFSEYIPRQNYLSIVDLGVTTKFTERSEDMYVKIAQRIADII
FT                   NISPGGVLAVFPSYEVLKGVRKYLSISIPHWYEGSQEVDLHNLPDRFFIGAVARGRYAE
FT                   GVEYVRDGKNLLSTVAVVGVPYPEPSPYLEKRVESLRPRLGEKAWNSVYLYYAIIAVRQ
FT                   AIGRLFRGPGDRGVLIFLDRRYAEPDIWSSLSDILSGSLIVNELGEAKENIIHFFTSVL
FT                   KVAK"
FT   gene            complement(376997..377455)
FT                   /locus_tag="Pisl_0391"
FT   CDS_pept        complement(376997..377455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87569"
FT                   /db_xref="GOA:A1RRI7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI7"
FT                   /protein_id="ABL87569.1"
FT                   /translation="MAVDDKEQEKPLRRPPPPRPPPVQPIPPPPPPPPPIQYQQPIPPP
FT                   PPPPGYPMPSATVRTQRTTPPPPPPPLAPQQETQITKRPLKQAEKTQPLPLVGIIIAMV
FT                   AALMGVITAVFSVFNETLGISLLAISIAGTNAAIIIIAVAIWRLLTRR"
FT   gene            377524..379338
FT                   /locus_tag="Pisl_0392"
FT   CDS_pept        377524..379338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0392"
FT                   /product="DNA topoisomerase"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: pai:PAE2993 DNA topoisomerase; PFAM: TOPRIM
FT                   domain protein; DNA topoisomerase, type IA, central domain
FT                   protein; SMART: DNA topoisomerase I, ATP-binding; DNA
FT                   topoisomerase I, DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87570"
FT                   /db_xref="GOA:A1RRI8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI8"
FT                   /protein_id="ABL87570.1"
FT                   /translation="MILIVAEKRSVAQAIARYLGGTYKVEKIYGVSAYRFLYGNREAVA
FT                   LGLSGHIMDYDFTARQNVWSWLPPEELFKTSPILVLREEAIKYVRALRSLARKAEEVYL
FT                   ALDADSEGEAISYEVALVVRLVNKNVKIYRVRFNAVTYKDIKIAFQNPTKLDLKQVEKV
FT                   FSRMQIDLTLGAVFTRFLTLTVRDLLEKGQFLSYGPCQTPVLGIVVTRELQRRNFKPEK
FT                   YYVIKAVVEIRGYKIEMSADVRFKTRKEAEAVATTIKRGVVKAAIYRPHYIQPPEPLET
FT                   VELERRASRWLGINSKKTLDIAEELYRAGYISYPRTETTIYPPTLNLREILQELIRGEH
FT                   SRYVEELLLRGFRPTRGDSDDGAHPPIYPTKGATKSEIYKTFGKIGDNAWAIYDFVVRH
FT                   FLATLSPPAQVEKQKIVVDFGKIQLEVEGQRTIDEGYWRIYPWERQSDRPLPRVYVGDE
FT                   VHAIKVEVVERETEPPPPMSESELLALMKKYGIGTDATMQDHIYTNIKRGYMKLQKGKC
FT                   IPTKLGETLAITLFQYTPELIEPTVRARIERAIQGIVKNGISPNRLIQEIKSEFEKYYN
FT                   DLKKHRDEIRRALETVLNSKARERSGTY"
FT   gene            379325..380236
FT                   /locus_tag="Pisl_0393"
FT   CDS_pept        379325..380236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0393"
FT                   /product="diphthamide biosynthesis protein"
FT                   /note="TIGRFAM: diphthamide biosynthesis protein; KEGG:
FT                   pai:PAE2994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87571"
FT                   /db_xref="GOA:A1RRI9"
FT                   /db_xref="InterPro:IPR016435"
FT                   /db_xref="InterPro:IPR022428"
FT                   /db_xref="InterPro:IPR035435"
FT                   /db_xref="InterPro:IPR042263"
FT                   /db_xref="InterPro:IPR042264"
FT                   /db_xref="InterPro:IPR042265"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRI9"
FT                   /protein_id="ABL87571.1"
FT                   /translation="MEHIEVHPFVWKAGPDTLIEAPPGFKWVAMEIARKTGATVSGRPV
FT                   WGACDIRPDPRFRKIFHLGHSVPPNVAYLLQKNLGGEIERVEQDFYRFKTDGTEIYFIP
FT                   VYYKPPPDLPRLEKVGKIYFPLPYRKIAEVIHKETGFPIARDPVTGCWVGEQPGDVAYV
FT                   VSTGLFYPLTLKFFYPDTTVYLVDPFRREVKDIEPEFMRLIKLKARAHISTPKRVAVLL
FT                   TTKPGQRQDDKALELSSRGLVMVLLDEISPEYIDDLQFDLVVNTACPRIGIDDIDRIKT
FT                   PILNYYEYKRGVIDPRLSIKLI"
FT   gene            380301..380603
FT                   /locus_tag="Pisl_0394"
FT   CDS_pept        380301..380603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2996 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87572"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRJ0"
FT                   /protein_id="ABL87572.1"
FT                   /translation="MKFKCPVCGKEVNLEPRLEGEPIGGLYEVIVQHERHFVKVYIDKS
FT                   GFIRRVFPIEHLVIIDPPQYTIYIYEDRAEIIDHTGNIYITDSDYLLSVVKKIIK"
FT   gene            381080..382651
FT                   /locus_tag="Pisl_0395"
FT   CDS_pept        381080..382651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0395"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   pai:PAE2998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87573"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR018538"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRJ1"
FT                   /protein_id="ABL87573.1"
FT                   /translation="MEKIGVVVKSPSIYYYIFRPFRGVEIDVGSFVATEVDGLRVISRI
FT                   TAIRHRNAATDPRLIAQFDDENVIREIKETLGIEDVLYYTEARAVVLGARVGRRILKPQ
FT                   KPVKPLSYVYRIVERELEEFFAPPEDGTYITIGRIRGTNISAKINAEKLVTHHCAILAS
FT                   TGAGKSWLAGVIIERLSLLDIPIIVVDPHGEYSAMSIPLTEEGKAVAEKVRIYVVGKVD
FT                   TRPVDDAFEKRYGTRRVYTRIGINPRSLPLRTLEKLLDILYGLTDAQKRILEEGWQVAT
FT                   NYGERQPLTTVEELIREVLEGGKHAAPPGYAGEMALRGLEGRLRSLFYTSPIFITRYGE
FT                   VYQGEPIKLIDPQSFVTTPALHILDISGLDSVDQQLFLAVFLDQIYRVATQRKNLTTFI
FT                   VIEEAHIFAPSTPNALSKNYVVKIAREGRKFGLGLCLITQRPTKLDQDVVSQAMTQIFK
FT                   RMINPSDLKYVATVAEHLEDPRPLRTLDETEAMITGISVPVPLLIVVGQRWTHHGGITP
FT                   RIKREM"
FT   gene            382868..383260
FT                   /locus_tag="Pisl_0396"
FT   CDS_pept        382868..383260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87574"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRJ2"
FT                   /protein_id="ABL87574.1"
FT                   /translation="MVNNALVLACAVNIPLLPPQALLPLAIPIVALTIDAVRRVEQTRF
FT                   PLLIFKNTRLSGLYLFTFSLQRNYERIQNTKSENPIAVRGTRRPRLCDAQTLSSGKVCQ
FT                   KTVEKVTGRKEPRLTTEEIDRFAHAR"
FT   gene            complement(383289..384623)
FT                   /locus_tag="Pisl_0397"
FT   CDS_pept        complement(383289..384623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0397"
FT                   /product="translation elongation factor 1A (EF-1A/EF-Tu)"
FT                   /note="KEGG: pai:PAE3000 translation elongation factor
FT                   aEF-1 alpha subunit; TIGRFAM: translation elongation factor
FT                   EF-1, subunit alpha; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87575"
FT                   /db_xref="GOA:A1RRJ3"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004539"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRJ3"
FT                   /protein_id="ABL87575.1"
FT                   /translation="MPSIILPPKPTALQKPHLNLAVIGHVDNGKSTLVGRLLYETGYVD
FT                   EKAFKEIEEMAKKMGKEDFAFAWILDRFKEERERGVTIEATHVGFETNKLFITIIDLPG
FT                   HRDFIKNMIVGASQADAALFVISARPGEFETAIGPQGQGREHLFLIRTLGVQQIVVAVN
FT                   KMDIVNYDQKRYEQIKAEVSKLLKLLGYDPSKIHFIPVSAIKGDNVKTKSSNTPWYNGP
FT                   TLLEALDTFQPPPRPVDKPLRMPIQDVFTITGAGTVVVGRVETGVLKVGDRVVIVPPAK
FT                   VGDVRSIETHHMKLEQAQPGDNIGVNVRGISKEDVRRGDVLGKVDNVPTVAEEIVARVV
FT                   ILWHPTAIGPGYAPVMHIHTATVPVQIVELVSKLDPRTGQAVEQKPQFIKQGDVAIVKI
FT                   KPLKPVVAEKFSEFPALGRFALRDMGRTIAAGQIIEVKPAQVQIK"
FT   gene            384703..384957
FT                   /locus_tag="Pisl_0398"
FT   CDS_pept        384703..384957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0398"
FT                   /product="LSU ribosomal protein L34E"
FT                   /note="PFAM: Ribosomal protein L34e; KEGG: pai:PAE3224
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87576"
FT                   /db_xref="GOA:A1RRJ4"
FT                   /db_xref="InterPro:IPR008195"
FT                   /db_xref="InterPro:IPR018065"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRJ4"
FT                   /protein_id="ABL87576.1"
FT                   /translation="MPRPAYRSRSLRRVKVRTPGGRTVVHYEKRAKGVPKCPVTNLPLG
FT                   GMNHKVYRFGISIRAPSRPYGGVFSHKVLARALRLAVRG"
FT   gene            384964..385518
FT                   /locus_tag="Pisl_0399"
FT   CDS_pept        384964..385518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0399"
FT                   /product="cytidylate kinase, putative"
FT                   /EC_number="2.7.4.14"
FT                   /note="TIGRFAM: cytidylate kinase, putative; KEGG:
FT                   pai:PAE3225 cytidylate kinase (cmk)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87577"
FT                   /db_xref="GOA:A1RRJ5"
FT                   /db_xref="InterPro:IPR011892"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRJ5"
FT                   /protein_id="ABL87577.1"
FT                   /translation="MVVIAISGQPGSGKTTVAREVARVLNLPLVSSGSLFRELAAKMGI
FT                   DFIEFHKYAEKNPDIDKVVDSMAIERAKAGNVVLEGHLAAWIVRPYADICIYLKASSEI
FT                   RARRISIRDKKSFEDALREVREREELNRRRYLSLYNIDINDLSVFDLVLDTSYLSINDA
FT                   IRISLDYICTVLGFKYSRKFC"
FT   gene            385571..386620
FT                   /locus_tag="Pisl_0400"
FT   CDS_pept        385571..386620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0400"
FT                   /product="sulfide dehydrogenase (flavoprotein) subunit
FT                   SudA"
FT                   /EC_number="1.8.1.-"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: pai:PAE3227 glutamate synthase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87578"
FT                   /db_xref="GOA:A1RRJ6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRJ6"
FT                   /protein_id="ABL87578.1"
FT                   /translation="MKFLLRCKPNTKKPPTGKRVAIIGAGPAGLGAAGVLLCDGHEVHI
FT                   YDALPEPGGLLIFGIPPFRVPRESVREGVRELIEAGAKFYTSTFVYCGEKPHEHEALLL
FT                   VKEFVNLEDLVKRYDAVIITTGTWKSRSLGVPGENLQGVYKALDYLFRIYANQLGYLPK
FT                   EKVYPTGKKVLVVGGGLTAVDAAIEARLQGAEKVVVAYRRTINEAPAGKKTIETELIAR
FT                   GIEFRELINPVAFLGREKVEKVRFIKMRLGPPDKSGRPRPEPVPGSEFEEEFDTVLIAI
FT                   GEEPTPPGPCLGIEFNPDGTIKVDEKMQTTHRGIFAAGDVVTGPSLIGKALGSGMKAAQ
FT                   FVNEYLSSH"
FT   sig_peptide     385571..385684
FT                   /locus_tag="Pisl_0400"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.890) with cleavage site probability 0.502 at
FT                   residue 38"
FT   gene            complement(386621..387328)
FT                   /locus_tag="Pisl_0401"
FT   CDS_pept        complement(386621..387328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0401"
FT                   /product="rRNA 2'-O-methyltransferase fibrillarin"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: fibrillarin; KEGG: pai:PAE3228
FT                   fibrillarin-like pre-rRNA processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87579"
FT                   /db_xref="GOA:A1RRJ7"
FT                   /db_xref="InterPro:IPR000692"
FT                   /db_xref="InterPro:IPR020813"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRJ7"
FT                   /protein_id="ABL87579.1"
FT                   /translation="MSIEVVDVRKHEHHFGVYVVKFEDGTERLATKNLTPGKRVYGERL
FT                   IKWRDEEYREWNPYRSKLAAAIVNGIKFIPIQEGTHMLYLGAASGTTPSHISDIVGERG
FT                   LIYSVEFSPRVFREFIEKLVDQGRRNVVPILGDARFPYQYAHYVKGVDVVYIDVAQPAQ
FT                   AKILADNADYFLKPGGYVMLVIKAMSIDVTAPATETFKQEINTLKERGFEILETVHLEP
FT                   YDTAHAMVIAKKK"
FT   gene            complement(387381..388643)
FT                   /locus_tag="Pisl_0402"
FT   CDS_pept        complement(387381..388643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0402"
FT                   /product="rRNA biogenesis protein Nop56/Nop58"
FT                   /note="PFAM: Pre-mRNA processing ribonucleoprotein, binding
FT                   region; NOSIC; KEGG: pai:PAE3232 nop family pre-rRNA
FT                   processing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87580"
FT                   /db_xref="InterPro:IPR002687"
FT                   /db_xref="InterPro:IPR012976"
FT                   /db_xref="InterPro:IPR029012"
FT                   /db_xref="InterPro:IPR036070"
FT                   /db_xref="InterPro:IPR042239"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRJ8"
FT                   /protein_id="ABL87580.1"
FT                   /translation="MTKIYIATDVLGFFALDETGNLVDKVFYERKPDLVAERLIELEKS
FT                   NYVPELLTIIERVKTKAQKIVVEDPELARKLVSVIKGVEIVAESPSPVLTTFRQNFSKY
FT                   LQALGLSWEDYRNYLFEISDLVTRRKLRQAVEKRDLFIAQAISTLDDVDKILNLIASRI
FT                   REWYGLHFPELEELVRDNKEYVRIVYYIGHRSGISEESIRKVFPDMPAERVKKIVESAK
FT                   KSIGAEMSEWDLAQLKSYAEAFIKLESYRESLATYIDEAMKEVAPNIRELVGPLLGARL
FT                   IKLAGGLTRMAFLPASTIQVLGAEKALFRALRTGGKPPKHGVIFQYPEIFRSPRWQRGK
FT                   IARALAAKLAIAAKADAFTGNFIAPRLKEELMKRIQEIKTLYAKPPPKTPQQPATKTPP
FT                   PPPPPPSGGGKRPPPPRRGRR"
FT   gene            complement(388665..390488)
FT                   /locus_tag="Pisl_0403"
FT   CDS_pept        complement(388665..390488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0403"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /EC_number="6.3.5.7"
FT                   /note="TIGRFAM: putative aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit; PFAM: GatB/Yqey domain
FT                   protein; GAD domain protein; GatB N-terminal region; GatB,
FT                   central domain protein; KEGG: pai:PAE3222
FT                   glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87581"
FT                   /db_xref="GOA:A1RRJ9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRJ9"
FT                   /protein_id="ABL87581.1"
FT                   /translation="MDYRSLGLKVGLEIHIQLNTKRKLFCHCPPVLRDDEPHFRIERRL
FT                   HLSVSELGAVDPAVLWEVRKRRRYIYEGYRDTTCLVELDEEPPHLPDEEALATAVAVAK
FT                   MFNAKIFDEIHVMRKIVIDGSNVSGFQRTMLIAYGGKKKILGYDIGVETIALEEDAARK
FT                   IAEEGKTVVYRLDRLGIPLIEIATEPMSYPPQQVEEVAWIIGYSVKITGRAKRGLGTVR
FT                   QDVNVSIAGGAKTEIKGVPDLSLIPKVIEYEVQRQLSLLKISEELRRRGVGKLELSTVD
FT                   VTQVFTNTKSKIVKRVLETGGKVVAVKTPGFQKIFGVEVQPGRRFGTELADYVRAWTEL
FT                   GGLLHSDELPGYGITAEEVRDIISKLGVESFILLMGVDDRELEEAATVVVDRLNTALQG
FT                   VPEETRGANPDGTTRFLRPRPGAARMYPETDIPPIRITFEILKKSEEIAKVSLEGKLSE
FT                   LTSLGLSKDLALQLIKSPYLEKFEDYVSKYKVPPQQIATILLNISRALAREGVEITDEK
FT                   IASVLEALEKKIITKEAVEEVLRNMKAGESAEEVAKRLGLVRMSYEEVKKVVGEVVREV
FT                   GKDRALGEVMRRYRGRIDVEDVRRALSELYF"
FT   gene            390521..391228
FT                   /locus_tag="Pisl_0404"
FT   CDS_pept        390521..391228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0404"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   pai:PAE3221 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87582"
FT                   /db_xref="GOA:A1RRK0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRK0"
FT                   /protein_id="ABL87582.1"
FT                   /translation="MGKRRWSQHFLRDTSVAQFITELVPSGLDIIEVGPGRGALTLPLA
FT                   EKSKTIYAIEIDPTLAEFLKRQAPPNVVVIVGDALEIEWPRADFFVSNIPYSITSPLLL
FT                   KLAKYRLPAVVTIQKEVAERLVAAPGTENYGRLTVAIRCHYDVEVLRILPPHVFSPPPK
FT                   VYSAVVRLTPRRPCVEDFENFQRFTARLFSTRRKTLRRLKLGETEKRVYQLTLEEIVEL
FT                   YKKHFDTTETCRS"
FT   gene            391216..392079
FT                   /locus_tag="Pisl_0405"
FT   CDS_pept        391216..392079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0405"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pai:PAE3218 ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87583"
FT                   /db_xref="GOA:A1RRK1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRK1"
FT                   /protein_id="ABL87583.1"
FT                   /translation="MPLLKLVFLGTGGAVPKSDRMLPTIYLEDWLGHRVLLDAGEGAQY
FT                   RLLQIDVSPASLTLVAITHQHEDHTLGLPGLVITNKFLGGKLKVLAPRSMHKILERLGV
FT                   EVSDSYEEGRFKITCVEVCHTVDACGWLFQWDVGYKLDLSKVAGLPKWALTNLIRGEAV
FT                   KVGGRLITPEEVADLTHKRFRRLLYTGDTAPCPQMWKTVGEVDVLIHEATFADDVEPQK
FT                   AHDEGHSTVADAVEAAKTLKADVLILTHISARYPSKERHKALADAVKPPPHIYIPDDFD
FT                   TLLIKL"
FT   gene            complement(392069..392815)
FT                   /locus_tag="Pisl_0406"
FT   CDS_pept        complement(392069..392815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0406"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pai:PAE3217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87584"
FT                   /db_xref="GOA:A1RRK2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK2"
FT                   /protein_id="ABL87584.1"
FT                   /translation="MKAVADYYDTVARLYVDKYLGTWYYRTLYRKLGEVLDVYIKRGMY
FT                   ILDVGAGTGFWSLYMQARGATVIPLDISVESLKVCRCGDRIQGDAAMLPIRARRFDAVT
FT                   ALGSVYNHLHNLESAFASVAHVLKKGGIFITDIDNAVCLDMLYEYLLFQGVGKFKDALL
FT                   RGVVRGVWESVDSELPFNYYSYFYVKSALRKAGLEIIDARPIYLFPPLPSRFLQKRFRL
FT                   KFFEKLDLLKRFAPFATTVIYVAVKV"
FT   gene            complement(392812..394374)
FT                   /locus_tag="Pisl_0407"
FT   CDS_pept        complement(392812..394374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0407"
FT                   /product="ATPase, PilT family"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: pai:PAE3216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87585"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK3"
FT                   /protein_id="ABL87585.1"
FT                   /translation="MLAVDKYIADSSVVLDGSLKEAILGGRLRGTLFLLSEMAEYFSSL
FT                   ARQGDGVGIIGVEELKDLFESVEKLGLSDFVKIEVVSIDRRVDPSELDMYARRFAKENN
FT                   CIYVTSDELSRDAAVVQGIRTIYLGKPRDVLTIEKFFSKDVMSVHLKEGLPPFGKVGKP
FT                   GSWRFVQLSPEPLTRKQLYTIVRELVSEASRLNSKTRIEIRRPHSMIIQHKEHRIVVVF
FT                   PPVSERLEITATKPVVRKSIEDYGLDPRVLERLEKSAEGILIAGAPGAGKTTFAQALAE
FT                   FYLSKGKIVKTLESPRDMTLSPAITQISKNLATSEEVHDILLLSRPDYTIFDEMRDTAD
FT                   FQLYVDLRLAGVGMVGVVHATSPIDAIQRFIRRVELGMIPSIIDTVIFMKDGEVKKIYA
FT                   LSMVVKVPAGMREEDLARPVILVKDFLTDEVEYEIYVFGEETFVVPVKRGGERAPSRKI
FT                   YSMVVSALKRYVPPGEIKLEERDGLIVIKVPEEYLGVVLSRGVAKLEKLRRKLSLDFRI
FT                   EPR"
FT   gene            394413..395417
FT                   /locus_tag="Pisl_0408"
FT   CDS_pept        394413..395417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0408"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: pai:PAE3215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87586"
FT                   /db_xref="GOA:A1RRK4"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK4"
FT                   /protein_id="ABL87586.1"
FT                   /translation="MRYLITTVPGLEDFVIEESAERLSAKTAKAIYMTGRVIVETEAEP
FT                   HALYSLKTAERFGIFLGEGLAETLQEVVNTASTYLPHVLKYLTKNTTVGIRCERVGQHP
FT                   FTSRDVEREVGRWLKERGYVISLVDPDVEINVDVVHNYVTVWITVAKKSLKDRPWRAYE
FT                   HYASLNPIIAHAMARLAKPAPGETICDLTCGGGTIAAEAAEYAPWARYICVDISLKHIK
FT                   GAALNTARYPQVDLLWFDSTKLHRAIRPICDKYIFNPPYGFRIPGKIGKLYHLLGKAMR
FT                   KLTRHCATYVTITPRHKTFTSQVGGEIIMRRVIYQGGLYSSIIVGRICPTSSP"
FT   gene            complement(395918..396787)
FT                   /locus_tag="Pisl_0409"
FT   CDS_pept        complement(395918..396787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0409"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pai:PAE3209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87587"
FT                   /db_xref="GOA:A1RRK5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK5"
FT                   /protein_id="ABL87587.1"
FT                   /translation="MNKKAEGVLEMVVTTAIWGSVSILSIYSGLPSPVFVFFRVFFTAL
FT                   SLLLLLRNVKVQLLRDRFIAASGVFLALNWIFLFYSVAMLPVSIAVMIYYTGPVFSMFV
FT                   MHFVGEKLSRVKLLSAAISFAGLSVIINPFVTMVSEGAGASLGLILAILSGVSYGLLIV
FT                   FNKLSVGKLTNPLELVLCQTLISTAITSPFLLILHFELNAYNIAIVLVSALVNTLLALF
FT                   LWYDSLRKISIHTASILSYLDPVFATLFAYIFLGQVPAKTAMLGGALIIIGGVMAVLEE
FT                   VAKAKKRT"
FT   gene            complement(396784..398334)
FT                   /locus_tag="Pisl_0410"
FT   CDS_pept        complement(396784..398334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0410"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   sto:ST2084 hypothetical transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87588"
FT                   /db_xref="GOA:A1RRK6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK6"
FT                   /protein_id="ABL87588.1"
FT                   /translation="MEYKLGNRLSELRRRKGLSLSRLARLAGVSKSTLWEIENDKISPS
FT                   INTLWAIANALGVPFGELVTYDIVVKDEGVEVRLIERVENKEVYLMKLRSNAIKRSEPH
FT                   RNSPMEVVQVIKGVMIVGSRDKLSLVGEGDFAKFYGGREHLYMAVGDDAEAIVTLIYGS
FT                   KDELPTIEYKNTRKVSIPRYRDLIYDENVENKFLKMLIDAVNNLQTVEGLEESLTADVL
FT                   NAEILTLRGKLTIPKAIKEGVRKFSQNALLRRSSFERNIDPLKYLLYEPLHPGYAEQAV
FT                   YVAYELEKRGIRDVVSLGCGPAYHERMLTEILDLGITCVETSNLFKAISTFPTLNELPE
FT                   KTDAIISFGSSHHIDNFLELTSSRLSRGGVLIVADEFIDDFASERARKLNVVKHHLVYL
FT                   LDIPLETFREELLSAYNAAVEGKLRVALNILSKVYVDISEGTKDENRVDEEKAFLNFYH
FT                   LELTSLLLGVIEERKTSVAKFISEAAERGLRLESHYKIYSTGEGKLGGGTHVLVFRRV"
FT   gene            complement(398757..400109)
FT                   /locus_tag="Pisl_0411"
FT   CDS_pept        complement(398757..400109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_3523 allergen V5/TPX-1 related"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87589"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK7"
FT                   /protein_id="ABL87589.1"
FT                   /translation="MRRLVLILLLALALYLMGGSWLYGYAHLFAARLLDLVKHLKLVPE
FT                   GGLYNSTPGLVTHGLNVTSLVRRWAEDLRRAAAGVSPGACRAEVNYSRYVSFAGSEVPV
FT                   RVELRGVPRGVLRVGGRVYEVAGNATVYLPYLGGAPAVNYTFVLETPCGSYSGVVTARY
FT                   LLPPTPPEETYNGTPSGLRRLALEYLNQIREREGVPPVRWIPLKTPQYRAEYMLKTGIY
FT                   SHYDAEGRHPIYYYTKLDGGKYAAEENGAMARCLLNGKPVRCGNFNMTDFIVGSIRSMV
FT                   YNDSHANWGHRRSLLDPCNNYVSVGIVYNGSEAHMTIYMVSKWVRWIKPPAYNGTYFIA
FT                   EGYVEGAMAPFNYTRWCYPVAVFYDVPTSAYVRRSFYTLGNQTGWFCEGVAVENGGMWY
FT                   FRVEVPFNATKHGLYTFVIVARDTRGITWEPKPGAKATSQYCQLATYTAER"
FT   sig_peptide     complement(400029..400109)
FT                   /locus_tag="Pisl_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.430 at
FT                   residue 27"
FT   gene            complement(400162..400821)
FT                   /locus_tag="Pisl_0412"
FT   CDS_pept        complement(400162..400821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ape:APE2054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87590"
FT                   /db_xref="GOA:A1RRK8"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK8"
FT                   /protein_id="ABL87590.1"
FT                   /translation="MVSSLYNDLALASALGAWVAFVALGLTRWLYKPLSRLGHMRAVYF
FT                   NRKVIHVLAGGVVAVLVPSFSSWVVPAATAFLIAVLLYIPHRTGRLLWWFQDPGNMYEV
FT                   SFAVMWGVVVAASWGLLGDWRLGVVPALFMAVGDSATGVVRNLLFGRRTKHWVGNLAMA
FT                   AVSIPIGWHYLGAAGAVAAVLASFVERFEFPPIDDNVLVPLASFVFLLTWDALSPL"
FT   sig_peptide     complement(400744..400821)
FT                   /locus_tag="Pisl_0412"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.781 at
FT                   residue 26"
FT   gene            complement(400802..401407)
FT                   /locus_tag="Pisl_0413"
FT   CDS_pept        complement(400802..401407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0413"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: pai:PAE3001
FT                   isochorismatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87591"
FT                   /db_xref="GOA:A1RRK9"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRK9"
FT                   /protein_id="ABL87591.1"
FT                   /translation="MLPDYVRVPRVNIVDRVSIPSKRAAVIVVDMQNDFAHPNGRLYAP
FT                   SSREIIPRIVSLLERARRSGVRVIYTKDTHYGDDPVEFPIWGPHVIRGTWGWEIVDELK
FT                   PREGDIVVEKMRYDAFFGTPLDHILRMYGVQHLVVTGTVANICVLHTVASARLRLYDVV
FT                   VPVDAVAALNEFDYAAALRQMDFLYRVTLTKTDGVEFV"
FT   gene            401455..401829
FT                   /locus_tag="Pisl_0414"
FT   CDS_pept        401455..401829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0414"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: putative endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: pai:PAE3003 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87592"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL0"
FT                   /protein_id="ABL87592.1"
FT                   /translation="MKEVIYTENAPKPIGPYSQAIKVGNMLFVSGQIPVDPKTGEVVKG
FT                   GIREQTRQVMENIKAVLEAAGYTLEDVVMAFVFLADLNTFQEYNEVYSQYFKKPPARVT
FT                   VQAARLPKDVLIEVAVIAVR"
FT   gene            401852..402166
FT                   /locus_tag="Pisl_0415"
FT   CDS_pept        401852..402166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87593"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL1"
FT                   /protein_id="ABL87593.1"
FT                   /translation="MKTNRVPTVFIIGGGREAMLCAKKIGAVHIDHYAEVNPEEIDGGI
FT                   QAHVEDPNLAILLLDAAEKIYLYPEFAQLLPSLPRDRVVVVAPEGHPLCAEYRCGDPCS
FT                   "
FT   gene            402145..402762
FT                   /locus_tag="Pisl_0416"
FT   CDS_pept        402145..402762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87594"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL2"
FT                   /protein_id="ABL87594.1"
FT                   /translation="MRRSLFIATTSLTRSGVEACTDFLEATAPRLGEFWLPLPRELCAG
FT                   RPVDLGPLEKYLEPLLALYHEVEADWRCYGSAEDLRRREMATAKLAALVIKARVYGKID
FT                   LREWDAYFSRPPSPPPTPSLVFGAVGGEELVICGAYPPNPIEAAHELWHTLTPQKKTEL
FT                   AMWITKFIAHIVDSINLDEAYHKLIREGWENAYKTILGNSGP"
FT   sig_peptide     402145..402204
FT                   /locus_tag="Pisl_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.923 at
FT                   residue 20"
FT   gene            402980..403231
FT                   /locus_tag="Pisl_0417"
FT   CDS_pept        402980..403231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2541a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87595"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL3"
FT                   /protein_id="ABL87595.1"
FT                   /translation="MTVDVKYAADIESTISKSYILWPGEEIALSLQPKSGKLTLDISVR
FT                   QDVPLIGGLHLSREIDIKPDKRREIEYGVLPGMTPSPP"
FT   gene            403466..403879
FT                   /locus_tag="Pisl_0418"
FT   CDS_pept        403466..403879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0418"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87596"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL4"
FT                   /protein_id="ABL87596.1"
FT                   /translation="MALRVRIRLRAGRREVETSALVNTGFESSAPDVAVPVEVARRLGL
FT                   WPPKSARVVSADTGGGEVEMVYIEAGAEIEVEGRRASVNILVNPYIDEVLISDFLAGEL
FT                   GIVILDAKRGHWRFKDEETLRSSVEPQRWPRRG"
FT   gene            complement(404415..404690)
FT                   /locus_tag="Pisl_0419"
FT   CDS_pept        complement(404415..404690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3014 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87597"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038723"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL5"
FT                   /protein_id="ABL87597.1"
FT                   /translation="MKRRGRFYPDLHVVTKILLLLADGRSRREAALLSGVSYSRFQQYV
FT                   EYLKERGFVTGDEELRLTPKGAEAAARLAQLIKELTGEEPRDVKRK"
FT   gene            complement(404662..405309)
FT                   /locus_tag="Pisl_0420"
FT   CDS_pept        complement(404662..405309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87598"
FT                   /db_xref="GOA:A1RRL6"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL6"
FT                   /protein_id="ABL87598.1"
FT                   /translation="MLLSRAPLRSMSLLFRLCRWAPPLLYLTLVHVWLLPVLFLLYVGG
FT                   AVGGFVFLATAASAVATAVVGLLPGRKGAGGLDLLELFHRRGGVCVAAPVLYVASYAAL
FT                   AFVATTSLYLYTTPLMVVEGAPAFPVGNVTEVVLHVRAVGSVAPGGRFIAVATGDVFWG
FT                   SAGWVLYTALWAASFYSALAVALVLAWRLVMRSAELARRAEVFYEKAREILS"
FT   sig_peptide     complement(405130..405309)
FT                   /locus_tag="Pisl_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.246 at
FT                   residue 60"
FT   gene            complement(405384..406178)
FT                   /locus_tag="Pisl_0421"
FT   CDS_pept        complement(405384..406178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0421"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE3017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87599"
FT                   /db_xref="GOA:A1RRL7"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL7"
FT                   /protein_id="ABL87599.1"
FT                   /translation="MRFGQVGGEERKTAGCETGYTALVVRERRLSEAPANAPGALLWSG
FT                   VFTWALGVELRLQPAPVWNIDWRHVGVSPCSAQAALAPVSAAKAGHVVVTALSCVLRCI
FT                   SAAVVDLEYAKLICPGTMAGMEKKSQTVKLAALAALAAAVMAVALSAGVFKVTYTYENG
FT                   VVKMVDPQGGVHTVALNLKEGVKKVEVRLLPNGSAVLLEGGRPIAVVKIVMRGGEARRV
FT                   EFKLLPNGTLLVIDGGRIWSRGIIEWKGGAEGAGQAGDIRAR"
FT   gene            complement(406228..407781)
FT                   /locus_tag="Pisl_0422"
FT   CDS_pept        complement(406228..407781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE1816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87600"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL8"
FT                   /protein_id="ABL87600.1"
FT                   /translation="MAPKPQIIKLVVLAALAAVAFVMLGFQTPSPGITLRFELYEAGVK
FT                   KSDLFTRPDVVAAVFIRAVTPDGEAVVFSGPTRGSVHISAGALADVARNWTELLKARGH
FT                   DPEDFFTALIVSLAVINKTSGKPLFYTTYFLDYHPAKVVRGDRELIYTLHIAKGRGEWR
FT                   GHVVKVDREEKRGLFTSYSFTPLSMKLPYVEPPKDTWCEVVSPDPPAFICWYRKAWVGV
FT                   ENLTSVLPSTYFTTYNGKLYMKIPVIMAVNNYTYSGSVGVAIGTLPATSQVAVGAALAV
FT                   PGDYGPSISLAGWSWGGRQYFLANGLFLGPTRSGWIWIWGRPVFASYDVYYEGVLGRDY
FT                   IQEENYFYIADIYISGSTIVSGKDFGLPQEVANLFYGGVDKQQLVISNTALSDGALQPG
FT                   EHIQFNEIFPYFDRCEADFEVGIPVGAVVLAVLARVPVPAVLPKDVFPGIDISLSIQGA
FT                   TMYVLGSIKNYGDHPDVPTDYNVPEYIYAAVSKYQYTATDIWGNTCLYQVPSGIYIEAR
FT                   "
FT   sig_peptide     complement(407698..407781)
FT                   /locus_tag="Pisl_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.882) with cleavage site probability 0.509 at
FT                   residue 28"
FT   gene            complement(408124..408600)
FT                   /locus_tag="Pisl_0423"
FT   CDS_pept        complement(408124..408600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0423"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   pai:PAE3010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87601"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRL9"
FT                   /protein_id="ABL87601.1"
FT                   /translation="MRVAAALGAGYRYADGRLGRVDKYDFVSVIRVFDEYVEGPGRLEE
FT                   YSHAFIIWLFHETPGVKLRLRPWGREDFPEVGIFATRFTQRPNPIALSIVKIVEVDPPR
FT                   LRVLGLDAWSGSPVLDIKPYDHLDVVNEFRTPDWFEEFFKETRGGLPRWLGPSR"
FT   gene            complement(408681..408938)
FT                   /locus_tag="Pisl_0424"
FT   CDS_pept        complement(408681..408938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0424"
FT                   /product="carbon nitrogen hydrolase, conjectural"
FT                   /note="KEGG: pai:PAE3023 carbon nitrogen hydrolase,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87602"
FT                   /db_xref="GOA:A1RRM0"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM0"
FT                   /protein_id="ABL87602.1"
FT                   /translation="MSALVVGGLAVRRGGAVVNVCPVVGRGGLLTWGEKVFLSAATGER
FT                   GWVSPGGLALFRAGEFAVCCLVCVDLLSPELARWRRRGRR"
FT   gene            complement(409290..409363)
FT                   /locus_tag="Pisl_R0007"
FT                   /note="tRNA-Thr1"
FT   tRNA            complement(409290..409363)
FT                   /locus_tag="Pisl_R0007"
FT                   /product="tRNA-Thr"
FT   gene            complement(409784..409898)
FT                   /locus_tag="Pisl_R0008"
FT                   /note="tRNA-Pro4"
FT   tRNA            complement(409784..409898)
FT                   /locus_tag="Pisl_R0008"
FT                   /product="tRNA-Pro"
FT   gene            409947..410708
FT                   /locus_tag="Pisl_0425"
FT   CDS_pept        409947..410708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0425"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pai:PAE3023 carbon nitrogen
FT                   hydrolase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87603"
FT                   /db_xref="GOA:A1RRM1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM1"
FT                   /protein_id="ABL87603.1"
FT                   /translation="MRIALVQMPRVGLGEGVRWLLERLPRADVVVLPEYWLGRSVLDEE
FT                   GLRRLVGAFVDVASAVGGVVVAGGVAVAVGSSVRGVCPVVGREGLLTWGEKIFPSAATG
FT                   ERGWLSPGSRLALFAVSGWAVGCLICIDLMYPELVRRLALAGAELVVNPASISADRRGL
FT                   WGAVGLVRAFENSIYVASAVGTGFEYADGRPVAGGSYVASPNGGFRSFGSEAGVYVAEL
FT                   DRGEVLQARARRRYLDDVKAVGGVDLNIYGL"
FT   gene            410714..411202
FT                   /locus_tag="Pisl_0426"
FT   CDS_pept        410714..411202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0426"
FT                   /product="protein of unknown function UPF0066"
FT                   /note="PFAM: protein of unknown function UPF0066; KEGG:
FT                   pai:PAE3010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87604"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM2"
FT                   /protein_id="ABL87604.1"
FT                   /translation="MSCPICVRPIGVVEVGLPRWGSVDRFDFVSVIRVFDEYVDGLVGL
FT                   EEYSHAFILWHFHEAGAPRLRLRPWGREDLPEVGIFATRFPQRPNALALTIVKIVEVDP
FT                   PRVRVLGLDAWSGSPVLDIKPYDHLDVVNEFRTPDWVEEFFRGSADKFPRWLGPARKT"
FT   gene            complement(411216..411327)
FT                   /locus_tag="Pisl_R0009"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(411216..411327)
FT                   /locus_tag="Pisl_R0009"
FT                   /product="tRNA-Pro"
FT   gene            complement(411366..412457)
FT                   /locus_tag="Pisl_0427"
FT   CDS_pept        complement(411366..412457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0427"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase; KEGG: pai:PAE3024
FT                   sugar-phosphate nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87605"
FT                   /db_xref="GOA:A1RRM3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM3"
FT                   /protein_id="ABL87605.1"
FT                   /translation="MKIAPVVLAGGKPGLFEKLTGPLPKTYIEVGGKRLYQYVADPLLA
FT                   IFGRVYIVSPHPERGPYIYVEERGQGIEQAIAAAETHLGAETHILLAYGDVYVDPSAFR
FT                   ALVEGTISTGADGAILIVPKKATKGYGAVETKAGGLLARIGGESQWIFGGVALLPRDII
FT                   KTILQATFYETLNEAAKTKKIATIPWSGVWHDVNYPEDILQLLEYIAPKHTYIASNTKI
FT                   SPTAIIEGPVIVEEGAEIDHYAVVKGPAYIGKKTFVGSHTLIRNYAYIEEDAVVGSAAE
FT                   ISHSLIGRKATIGRASFISYSIVGEEAVLEPNVVTMAVLREGRERLEPVEVRGRTYYKL
FT                   GALIPRGARIPAGTTLKPATGWQ"
FT   gene            complement(412459..414270)
FT                   /locus_tag="Pisl_0428"
FT   CDS_pept        complement(412459..414270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0428"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   pai:PAE3025 glucosamine--fructose-6-phosphate
FT                   aminotransferase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87606"
FT                   /db_xref="GOA:A1RRM4"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM4"
FT                   /protein_id="ABL87606.1"
FT                   /translation="MCGIFGIVFAERPRRNLGEILRRALERLEYRGYDSAGIAVVDRGL
FT                   LIVRKDAGKVAEVAARYNFDSIQGTAGVAHTRWATHGKPDQSNAHPHIDCGGIIAVVHN
FT                   GIIENYAELKEELLAKGHVFRSETDTEVIAHLVEEYKRQGVDTFTAFKKAISKIRGAYA
FT                   VALIDAENPKVIYFARNLSPLIIGVGDGFNIIASDIPTVLDYTRRVIAVRDGEYGYITP
FT                   TQVYIEADGVSQDVSSRIEEIPWSAEMATKGGYPHFMLKEIYEQPESLATTVAGLEWPL
FT                   LETAANTLLSARNVYIVGAGSSLHAGLAFLQLLLRIKVTPVPIVASEYATYEQLFDKGD
FT                   VAVAISQSGETIDTIKAVRTMREKGVRVLAVTNVVGSTISRESDAVIYTRAGPEIGVAA
FT                   TKTFTTQVATLSALYVAALKTLGYDTAPMEREIKALPDLVRKTLENTAGAAKDLAKRLK
FT                   NKPSAYYLGRGAALPVAMEGALKLKEVAYIHAEAYPAGESKHGPIALVEEGFPVLFVFS
FT                   DPNTREKTLSNVAEMKARGAYTIGTVPMKSDIAKRLDYAIEVPELGELTAPILHIVPLQ
FT                   LLAYFTAVEKGYDPDKPRNLAKTVTVE"
FT   gene            complement(414412..415362)
FT                   /locus_tag="Pisl_0429"
FT   CDS_pept        complement(414412..415362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0429"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="KEGG: pai:PAE3027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87607"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM5"
FT                   /protein_id="ABL87607.1"
FT                   /translation="MLLTVIIAKLTGRPLALCDVGDVDGIASAALFKRANPRGAVVLAG
FT                   PADVKKWWIRLTRWDFVADLPCPGRVRVRADHHKTNKPCAEVEFYDPEAPASALLAAKA
FT                   LGLENDEAAKQLVDAAIQTDTANITDPRVRLLDLAIRYADRREKLAAVEKLAKAGLVAL
FT                   EEEPLKSLAQRGLERNRQIQEIATKLPAEETLFIYSPIRLGISYRLLTIELEKKGVKFV
FT                   NILVRRGWRVYRLYCGAHRDSPYDCTEVATRMGGGGHKYAAGAHIKAPIYDRHRPLRQL
FT                   IQLLKPSVVYVLGSCNNINVPCRAIEVMSRGSGER"
FT   gene            415421..415939
FT                   /locus_tag="Pisl_0430"
FT   CDS_pept        415421..415939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87608"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM6"
FT                   /protein_id="ABL87608.1"
FT                   /translation="MGRRSLFEVVRRVSFNIALFERGDITIVDAKLREGGDIVLHCDSY
FT                   RCVAQELFTLLPKLLGGGKVGVDLGTSRNGMAYVWRGEPILHAVLDWKTVEEILRNIGP
FT                   LQIYIGSSPYVDVKKAATLVGCREVRLVDELAAGWTRRWLKAKYPELEEDEIDALAFTY
FT                   HDGVAVSLC"
FT   gene            416683..419028
FT                   /locus_tag="Pisl_0431"
FT   CDS_pept        416683..419028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0431"
FT                   /product="Oligosaccharyl transferase, STT3 subunit"
FT                   /note="PFAM: Oligosaccharyl transferase, STT3 subunit;
FT                   KEGG: pai:PAE3030 oligosaccharyl transferase STT3 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87609"
FT                   /db_xref="GOA:A1RRM7"
FT                   /db_xref="InterPro:IPR003674"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM7"
FT                   /protein_id="ABL87609.1"
FT                   /translation="MDRKGKLLLAVPALLAAFAIALYARMYRVFLWGWWLDEFDPYIRY
FT                   YLAKYTLEHGVGWWWGGAQFTQFWHPYGVDWGRVLLPGTSLYGLFVYALLRPFGVDLWH
FT                   AVIAAPAIMNSLAVFSMFYLGYRVGSELGIPNGGVRVGLAAALLTAIAPAFVERGFAAW
FT                   FDDEPISLFLIPLGLALLIDGLRRPWTGALAGAALGYVVWTWGGHFYVWNLVGLYAMVL
FT                   PAYYYLKLALAKPGKKSRPPELPFDARNFFLSYLLFYVVYAAFVAAIPRYGVHTVASAF
FT                   NILPTFGLASAALTWALGLKLGAAKTAELLRRYIWAVAGVVAVGVAVFAAAIAAGLIGG
FT                   KFLATLLPFGRSAIVASVAEHSTTQFIQILSRYGPIIPFIVASLPYLFTPSGLLALSYL
FT                   VTAGYSAATMVRLLVLLAPAALLATAVGMVKLVDNRRFGHIVMAAAVVSTVMLFSAVMP
FT                   TVSQGQGFVQGLARQPTQIATSAVGVVSDDFVDALMWLKTRLPPYEPVASWWDYGYWIS
FT                   VVGNKTSLADNSTINATQIGKIGLAFMAPPQIGAAIFTRQFGTKYVLAIMPYAIYPVTL
FT                   STGQQVPLLVHEYPPGGDFLKSYWMTKIALENVGYAADVLKARGMSPEDYIYTRVMSFP
FT                   GPPPNTAYAYFTIGGSYYPVPLDLNRTLYAMLFSKERFFPIYGNYSQFLPWIFEGVEQP
FT                   GGGFTSFRSLRLVGGNVYLPTDITPQLQSLGAYVIKGWDRGGVDVVVDPLTNTTQRIPL
FT                   VTADPRPLRLVYVSKPYGWVVVYEVEGS"
FT   sig_peptide     416683..416757
FT                   /locus_tag="Pisl_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.597 at
FT                   residue 25"
FT   gene            complement(419025..419249)
FT                   /locus_tag="Pisl_0432"
FT   CDS_pept        complement(419025..419249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0432"
FT                   /product="Nucleolar RNA-binding protein Nop10p"
FT                   /note="PFAM: Nucleolar RNA-binding protein Nop10p; KEGG:
FT                   pai:PAE3031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87610"
FT                   /db_xref="GOA:A1RRM8"
FT                   /db_xref="InterPro:IPR007264"
FT                   /db_xref="InterPro:IPR023532"
FT                   /db_xref="InterPro:IPR036756"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM8"
FT                   /protein_id="ABL87610.1"
FT                   /translation="MRSLLRRCTKCGAYTLSKEKCPRCGGPVKVPHPPKYSPEDKYQRY
FT                   RILQKLSTGALPVREETKERILKDLLGGP"
FT   gene            complement(419246..420040)
FT                   /locus_tag="Pisl_0433"
FT   CDS_pept        complement(419246..420040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0433"
FT                   /product="translation initiation factor 2 subunit alpha
FT                   (aeIF-2a)"
FT                   /note="PFAM: RNA binding S1 domain protein; Eukaryotic
FT                   translation initiation factor 2, alpha subunit; KEGG:
FT                   pai:PAE3032 translation initiation factor aIF-2 alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87611"
FT                   /db_xref="GOA:A1RRM9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR011488"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR024054"
FT                   /db_xref="InterPro:IPR024055"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRM9"
FT                   /protein_id="ABL87611.1"
FT                   /translation="MKLVKKDLPDVGELVIGTVKKIAEHGAYIYLDEYELEAFAPTQEI
FT                   IQSWFHSIRDYVKEGNKTVFKVISVNPRMRVVEVSLKRVRVDEKEKKLLLYRHKVRVLK
FT                   MLEIAMKKLGRPPEEALKALWYLEEQFGDPFKVFEEVVKTGPHVLDDLELDPQLKEQIV
FT                   ELARQQVEIPPTKISGIIKAVSVEGDGAERIKAALAELAKTLHEKYPSVSVKIYVVGPP
FT                   RYRIDLVGQAPKQVEAAFTELANILQTLQKKHKVIATVQRLE"
FT   gene            complement(420076..420279)
FT                   /locus_tag="Pisl_0434"
FT   CDS_pept        complement(420076..420279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0434"
FT                   /product="SSU ribosomal protein S27E"
FT                   /note="PFAM: Ribosomal protein S27E; KEGG: pai:PAE3033
FT                   ribosomal protein S27"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87612"
FT                   /db_xref="GOA:A1RRN0"
FT                   /db_xref="InterPro:IPR000592"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023407"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRN0"
FT                   /protein_id="ABL87612.1"
FT                   /translation="MPVKFSKVLIPQPRSKFIKVRCPDCGNEQVVFSHAAMVVRCLVCG
FT                   RVLAEPTGGKARLAGHVVKILE"
FT   gene            complement(420281..420556)
FT                   /locus_tag="Pisl_0435"
FT   CDS_pept        complement(420281..420556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0435"
FT                   /product="LSU ribosomal protein L44E"
FT                   /note="PFAM: Ribosomal protein L44E; KEGG: pai:PAE3034
FT                   ribosomal protein L44"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87613"
FT                   /db_xref="GOA:A1RRN1"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRN1"
FT                   /protein_id="ABL87613.1"
FT                   /translation="MKFPKSVNKYCPRCNTYTKHTVSHYHAGQRRTLAEGQRRYERKLK
FT                   GYGSTPKPKQKRFAKVNKKVTLVFTCTKCGYKTVRSLGRMKKVELV"
FT   gene            complement(420657..421133)
FT                   /locus_tag="Pisl_0436"
FT   CDS_pept        complement(420657..421133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87614"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRN2"
FT                   /protein_id="ABL87614.1"
FT                   /translation="MIEKLRLWLTAEVNSRLLTEPPYSSYAEVAERFIKELQNSPLPQS
FT                   LQDKVKDHIISTLLAIVDLRIKKILWELSQGRTPSNMTAEEERLIGPLLKIRQASPQRK
FT                   KSQNYVVVQFLVSHPAIVTEEFIQIGPFAKGDLAKLPARDAKDLEERGVAKRFP"
FT   gene            complement(421126..422064)
FT                   /locus_tag="Pisl_0437"
FT   CDS_pept        complement(421126..422064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0437"
FT                   /product="DNA primase small subunit"
FT                   /EC_number="2.7.7.-"
FT                   /note="TIGRFAM: putative DNA primase, small subunit; PFAM:
FT                   DNA primase, small subunit; KEGG: pai:PAE3036 DNA primase
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87615"
FT                   /db_xref="GOA:A1RRN3"
FT                   /db_xref="InterPro:IPR002755"
FT                   /db_xref="InterPro:IPR014052"
FT                   /db_xref="InterPro:IPR023639"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRN3"
FT                   /protein_id="ABL87615.1"
FT                   /translation="MIVEVFFRNFYRNYAKFDIDAVEKREFAFQYFEGGIVRHRAFKTL
FT                   EELKKFVIEKTPRHIYHSSAYYERPGEEDMERKGWLGADLIFDIDGDHLDTEACRESKL
FT                   VSIACLNDAKEEANKLIDVLTGELGLKPRRVVFSGNRGFHIHVSEEEVLTLGAKERREL
FT                   VNYLKAVGFDPSRFVVKKGRKKVVLYEEEVGGNLFRIRQGVEDPRALKIEIDEVVTQDI
FT                   HRLIRVPGSINGKTGLLALPLSQQDLEKDVEQIVERAIVFKKGNLKLRFNKTFEGAVLF
FT                   EKINAREGDVKVLPAYLAIYLELQEIGKIYD"
FT   gene            complement(422061..422810)
FT                   /locus_tag="Pisl_0438"
FT   CDS_pept        complement(422061..422810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0438"
FT                   /product="monomeric archaeal DNA polymerase sliding clamp"
FT                   /note="TIGRFAM: proliferating cell nuclear antigen PcnA;
FT                   PFAM: Proliferating cell nuclear antigen, PCNA; KEGG:
FT                   pai:PAE3038 proliferating-cell nuclear antigen homolog
FT                   (PCNA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87616"
FT                   /db_xref="GOA:A1RRN4"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRN4"
FT                   /protein_id="ABL87616.1"
FT                   /translation="MSKHILTYLDAKEFAYIVDSISVLVEEASFIVRSDGLYLRALDAS
FT                   RTAMVDLSIPKEAFEEFPEVEELRIGLNFKDLKKVLRRIKKGDKISMEIEEGRVRIKLV
FT                   GKSVRSITIPTIEVVSEDLPTPKVVFTAMVKTASDVLASAVKDADAIADEIKFEANEEA
FT                   LLMKASSDKGEVEVKLDKNSELVYEFDVKEPASARYSLEYLVDIVGKTSKISDIVTIEL
FT                   ATAKPLLLTFDIPAGGKISYFLAPRVE"
FT   gene            complement(422853..423185)
FT                   /locus_tag="Pisl_0439"
FT   CDS_pept        complement(422853..423185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0439"
FT                   /product="DNA-directed RNA polymerase, subunit M"
FT                   /EC_number="2.7.7.6"
FT                   /note="TIGRFAM: transcription factor S; PFAM: Transcription
FT                   factor TFIIS; DNA-directed RNA polymerase, M/15 kDa
FT                   subunit; KEGG: pai:PAE3040 DNA-directed RNA polymerase
FT                   subunit M"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87617"
FT                   /db_xref="GOA:A1RRN5"
FT                   /db_xref="InterPro:IPR001222"
FT                   /db_xref="InterPro:IPR001529"
FT                   /db_xref="InterPro:IPR006288"
FT                   /db_xref="InterPro:IPR012164"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRN5"
FT                   /protein_id="ABL87617.1"
FT                   /translation="MRFCPNDKSLLIPVRKGDKTVLRCPKCGYEEEISGDAKNRYQSKS
FT                   IVESKNTIIVVSDNIINLPKVKTRGCPKCGHDEAYVWVQQTRAADEPPTRFYRCTKCGY
FT                   TWREYE"
FT   gene            423259..423735
FT                   /locus_tag="Pisl_0440"
FT   CDS_pept        423259..423735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0440"
FT                   /product="SSU ribosomal protein S19E"
FT                   /note="PFAM: Ribosomal protein S19e; KEGG: pai:PAE3043
FT                   ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87618"
FT                   /db_xref="GOA:A1RRN6"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRN6"
FT                   /protein_id="ABL87618.1"
FT                   /translation="MTSVKEVPADMLIAELAKYIKENIPQVKPPVWAPFVKTGANKERP
FT                   PMNEDWWYIRAASIMRKLYLYGPVGVGSLRTAYGYRAKIGDKTRPERTRKAGGAIIRKI
FT                   LQQLEQAGLVAKTKQGRILTPEGKSLVDRIAAKIGRELTKTRPELLKYIAPPKE"
FT   gene            423735..424067
FT                   /locus_tag="Pisl_0441"
FT   CDS_pept        423735..424067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0441"
FT                   /product="DNA-binding TFAR19-related protein"
FT                   /note="PFAM: DNA-binding TFAR19-related protein; KEGG:
FT                   pai:PAE3044 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87619"
FT                   /db_xref="GOA:A1RRN7"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRN7"
FT                   /protein_id="ABL87619.1"
FT                   /translation="MAEGGFEDRELEEIRRRKLEELQKRAELERQAQIAAAQRRVALKR
FT                   ILTPEALARLDNIRVVRPELAEALEQQLIALASSGRVKVPIDDETLKKILEAIYSQTRR
FT                   EYRFRL"
FT   gene            424099..424254
FT                   /locus_tag="Pisl_0442"
FT   CDS_pept        424099..424254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0442"
FT                   /product="LSU ribosomal protein L39E"
FT                   /note="PFAM: ribosomal protein L39e; KEGG: pab:PAB3384 50S
FT                   ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87620"
FT                   /db_xref="GOA:A1RRN8"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR020083"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRN8"
FT                   /protein_id="ABL87620.1"
FT                   /translation="MARNKPLGKKLRLAAALKSNRNPPVWVVVKTKRRVTRSPTRRHWR
FT                   RTKLKA"
FT   gene            complement(424251..424970)
FT                   /locus_tag="Pisl_0443"
FT   CDS_pept        complement(424251..424970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0443"
FT                   /product="geranylgeranylglyceryl diphosphate synthase"
FT                   /EC_number="2.5.1.41"
FT                   /note="TIGRFAM: geranylgeranylglyceryl phosphate synthase
FT                   family protein; geranylgeranylglyceryl phosphate synthase;
FT                   PFAM: PcrB family protein; KEGG: pai:PAE3045 PcrB homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87621"
FT                   /db_xref="GOA:A1RRN9"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR010946"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRN9"
FT                   /protein_id="ABL87621.1"
FT                   /translation="MKLYEYLVEGTKHFTLIDPDKSVDYLKIAKYALEAGTDGILVGGS
FT                   LGIRESQITQVVKDIKSIAHVPVVIFPGSISQLTDEADGVLFLSVLNSLDPYYIIGAQI
FT                   QGAVLLAKHYPKLEVISTAYIIIGDGGAAGFVSMSKPIPYTRPDIVMAYALAANYIGFK
FT                   AVYLEAGSGAPQPAPPEMVRAARRVFPRILIVGGGIRSGEVAYTIAREKPNVIVTGTLA
FT                   EEKPEKLGEIIRAIKSA"
FT   gene            complement(424957..425241)
FT                   /locus_tag="Pisl_0444"
FT   CDS_pept        complement(424957..425241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87622"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP0"
FT                   /protein_id="ABL87622.1"
FT                   /translation="MGRRRKTRKIIPKLKKTLPKIFTCPHCGAQLVTVKKTENGYLVIC
FT                   GNCGLRYEFEERPGWMAVDYYNAFVDLYLEGKITPLQRKQEGVDGNETI"
FT   gene            425366..426595
FT                   /locus_tag="Pisl_0445"
FT   CDS_pept        425366..426595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0445"
FT                   /product="molybdopterin molybdochelatase"
FT                   /note="PFAM: molybdopterin binding domain; MoeA domain
FT                   protein, domain I and II; KEGG: pai:PAE3048 molybdenum
FT                   cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87623"
FT                   /db_xref="GOA:A1RRP1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP1"
FT                   /protein_id="ABL87623.1"
FT                   /translation="MKPMRYLSGLNPVYKVADILPQVNKIEDVEKIAVWDAAGRVVARD
FT                   VIAPHDYPPYPRAAYDGYAVNSSATPGKFRVVGTILVGQYRRDIVLNSGEAAYVTVGAF
FT                   LPEGADAVVPEEAVKREGEYILVDRKFEKYANVDPPGSYVRKGVVLLKQGTVVTPFDVV
FT                   GLLDVGITTLYAYRRVRVGIVTTGDELIAPPIDPDTASELVLRGKVIESTGSLVAWYIQ
FT                   TFMPYVEVREKIITGDRHEEVRAVVDRFLKLYDAVIITGGAGPSEIDHFYKLGFGGLRG
FT                   FRMKPGRPTSVAVVGGKPVFGLSGYPISALHGVIRIVEPVLRYMANVNKAPGHDWHYAV
FT                   ITQDIQGEMAQIVRVKLEVTESGLHAIPIKARHHSFTEPDACGVALIPPGGVKRGDIVL
FT                   VLTYRDIRRG"
FT   gene            complement(426566..427282)
FT                   /locus_tag="Pisl_0446"
FT   CDS_pept        complement(426566..427282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0446"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: pai:PAE3049
FT                   phosphoribosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87624"
FT                   /db_xref="GOA:A1RRP2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP2"
FT                   /protein_id="ABL87624.1"
FT                   /translation="MYINWVGTYLNVPKIPVKVVTFDEIVEWSRKLAEKIKESNWQPDV
FT                   IVAVARGGYVPARLLCDWLGVSDLLSVQVVHWPSAAQIAEKAYVKYPINVDLSGKRVLV
FT                   VDDIVDTGDSIELAKKSLEECCRPKEVKTAALQVITSVAKFMPDFYAVEVREWIWFAYQ
FT                   WNAVEDATGFIMKIVKETGKTEWCLDELIQAHLEWYGSEYVEKRFGYMLYALDMLVKRG
FT                   YIKLSKCLASPNIAVR"
FT   gene            complement(427292..428305)
FT                   /locus_tag="Pisl_0447"
FT   CDS_pept        complement(427292..428305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87625"
FT                   /db_xref="GOA:A1RRP3"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP3"
FT                   /protein_id="ABL87625.1"
FT                   /translation="MSEDLNADNLADIFIKISPSKTLYINSSKLQFGGSRILGRVEIRE
FT                   DGVYLNEKLVVFRRALRCPVKVGGLYLCSDPPEIPRFFYREVFTEGLNKALRISELYAT
FT                   DRLNSGDCLAEYLYAVIKGSRPLWDIYRRGEPIALRRCRETLGVLIARGLRERKLYTPP
FT                   NLDKISAALLGLLKFRDVLEVIDQSWLGFAIAMRYGIYSALKWRLSLSYESWLLLFGIY
FT                   AALDPVVMPGGVAVDLGLLRALPYIVAKVMGRWLVAFNVAGLYIAAGNINMMVDGGRKR
FT                   AKYASCEGDRCVVGNLLFNQCVDMECGIVRTSDFEFKGLVKCRNFGTTFITVEPCK"
FT   gene            complement(428581..428967)
FT                   /locus_tag="Pisl_0448"
FT   CDS_pept        complement(428581..428967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0448"
FT                   /product="zinc finger, SWIM domain protein"
FT                   /note="PFAM: zinc finger, SWIM domain protein; KEGG:
FT                   pai:PAE3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87626"
FT                   /db_xref="GOA:A1RRP4"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP4"
FT                   /protein_id="ABL87626.1"
FT                   /translation="MQYQIDDQIKNFLLALSRVLDIRIEKVLDLYFYVTPETVRIVEIV
FT                   ERGSKIVGLRLAVRSRKKPDVWYYVAVGEYGAKCTCEGNTVGGKICRHIIIGVITWNVL
FT                   SLIKHGEGIDLSKLTWLYTREKDV"
FT   gene            complement(428951..429703)
FT                   /locus_tag="Pisl_0449"
FT   CDS_pept        complement(428951..429703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0449"
FT                   /product="D-fructose 1,6-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: inositol monophosphatase; KEGG: pai:PAE3055
FT                   putative myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87627"
FT                   /db_xref="GOA:A1RRP5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP5"
FT                   /protein_id="ABL87627.1"
FT                   /translation="MLGILEAVVARASQYLLDSFKKGRGVEIILDKGDDVTREIDLAIE
FT                   ELVYYMLKENFREGGVLYAEERGVYRWGDERYMFVLDPLDGSLNYTVGIPIFAISLAAG
FT                   KYREGTLGDLEYATVSILPMGDIYTASPELGARKNGRPIKRRRKSNIVFVAISNGFPDK
FT                   TCEILRKMGLKGRSLGSSAAELIYTAEGIAKGFVDLRGRLRVLDIAGALTFSKYIPGFK
FT                   YVIYGQQYPDSRISIIAGDEDFVDAVSN"
FT   gene            complement(429910..430266)
FT                   /locus_tag="Pisl_0450"
FT   CDS_pept        complement(429910..430266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0450"
FT                   /product="family 417, putative ATP binding protein"
FT                   /note="KEGG: pai:PAE3057 P.aerophilum family 417, putative
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87628"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP6"
FT                   /protein_id="ABL87628.1"
FT                   /translation="MPEDATLLGVEELYKSQIVGIYGTDKRKLAKKLEELASTRDLFYL
FT                   SLFPQTTLPVELEENRVKVATTFRDIIETIYNIYSGRMKVKVFVVSGIRDIERILGNDV
FT                   VDYINAVASVARFC"
FT   gene            complement(430372..430857)
FT                   /locus_tag="Pisl_0451"
FT   CDS_pept        complement(430372..430857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0451"
FT                   /product="family 417, putative ATP binding protein"
FT                   /note="KEGG: pai:PAE3057 P.aerophilum family 417, putative
FT                   ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP7"
FT                   /protein_id="ABL87629.1"
FT                   /translation="MFVIQEVASRGLTVVYGPPGSGKTSVAAKLADKVTNRILWISTNE
FT                   PPNILKTTFARVGANAEKFYVFDFPRAFRGNIAKFIADHIHEYEALVVDTINGIAPHEE
FT                   KLEELAHGFLYQLSKDMPIIAVVEGVSKQVFYIADNLVKVWSKENALGHTVRYLKSC"
FT   gene            complement(430879..431304)
FT                   /locus_tag="Pisl_0452"
FT   CDS_pept        complement(430879..431304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87630"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP8"
FT                   /protein_id="ABL87630.1"
FT                   /translation="MSMFEIFSTVFLIKGRDFECITSIGDYHVAVTENGAVYAMWCREG
FT                   GVCEDCVEFPIYGDVVVYIPRRFYKCLSCLLGELFNAGLFNISVGKLVVVQRQAFLVPP
FT                   MVKERRNPERLAKRAKGVLENYMLKILASSLSSCCKF"
FT   gene            complement(431349..431440)
FT                   /locus_tag="Pisl_R0010"
FT                   /note="tRNA-Undet11"
FT   tRNA            complement(431349..431440)
FT                   /locus_tag="Pisl_R0010"
FT                   /product="tRNA-OTHER"
FT   gene            complement(431501..431619)
FT                   /locus_tag="Pisl_R0011"
FT                   /note="tRNA-Undet10"
FT   tRNA            complement(431501..431619)
FT                   /locus_tag="Pisl_R0011"
FT                   /product="tRNA-OTHER"
FT   gene            431740..431979
FT                   /locus_tag="Pisl_0453"
FT   CDS_pept        431740..431979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0453"
FT                   /product="deoxyribonuclease/rho motif-related TRAM"
FT                   /note="PFAM: deoxyribonuclease/rho motif-related TRAM;
FT                   KEGG: pai:PAE3058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87631"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRP9"
FT                   /protein_id="ABL87631.1"
FT                   /translation="MERRPKRGPFRGRRSPSGPKPVKEGDVLEVEVIEKSRKGDGVARV
FT                   EGFVIFIPGAEPGQRVKIQIEKVGGTYAIGKVVT"
FT   gene            complement(431972..433111)
FT                   /locus_tag="Pisl_0454"
FT   CDS_pept        complement(431972..433111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0454"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: pai:PAE3091 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87632"
FT                   /db_xref="GOA:A1RRQ0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020653"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ0"
FT                   /protein_id="ABL87632.1"
FT                   /translation="MDVRGNEEEFVVTPWEVRGRVDYDKLLKHFGARRLTPDEVALLEK
FT                   YAGEVHPLIKRGFFYAHRDFDTILKWHGEGKPWALYTGRGPSGPVHIGHMVPWILLKWF
FT                   SDKFNLEVYFQMTDDEKFYDDPEMKLDEATGWAYENALDVIALGFTPDKLHLIVDTKDI
FT                   EPLYPIAVRVAKKLTWNTVKATFGFTDSTNIGLIFYPSLQIAVAFLPTELRGQPTPVLI
FT                   PCAIDQDPYFRLARDIADSLGYPKPATIYSKFIMALTGESKMSASNPDSAIYTTDDEKT
FT                   VKRKIMNAFTGGRPTAEEQRKYGGNPDICPVFHYHMLFDPDDASVEKIRQDCKSGAMLC
FT                   GECKLKLYEKISRFLKDHRERREKARGRVDEYRISAKLR"
FT   gene            complement(433143..433907)
FT                   /locus_tag="Pisl_0455"
FT   CDS_pept        complement(433143..433907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0455"
FT                   /product="HhH-GPD family protein"
FT                   /note="SMART: HhH-GPD family protein; KEGG: pai:PAE3092
FT                   DNA-(apurinic or apyrimidinic site) lyase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87633"
FT                   /db_xref="GOA:A1RRQ1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ1"
FT                   /protein_id="ABL87633.1"
FT                   /translation="MMRHSREDRCLSLTLYPSLTLSLLDENYVKIFGVKKGVKASEDQY
FT                   ISGRWYNPWRYINDVDGDLRNRVHRLVELYGDCIGISISPGDEDLLFVTAFLTQNTNYH
FT                   TNVLRWIRRIFSLSEDLREIVKIASQIGRSYQLQRLPQAIEDYIRLGRPRSRGELLKIA
FT                   GVGPKVADLFLLFTGDVTSAPVDKHFMRTAPKLGLAGETPRANYCRKYTCETCPLSSRC
FT                   LRGLSYRKLGRLAGWVQTVSYLIDKGLVGGLA"
FT   gene            complement(433904..434683)
FT                   /locus_tag="Pisl_0456"
FT   CDS_pept        complement(433904..434683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0456"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE3093
FT                   molybdenum cofactor biosynthesis protein (MoaA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87634"
FT                   /db_xref="GOA:A1RRQ2"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016771"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ2"
FT                   /protein_id="ABL87634.1"
FT                   /translation="MTVFNVIDPEKLLALVEKYAVKTVDGVIYRRYKRFRADRWYGGIA
FT                   TADVVGCNLRCGMCWAWRNTSYVLTAGAWMSPYEVADKLRKIVKEKGFNQVRISGGEPL
FT                   IAPKHLIKVIDELRDYVFIVETNGILIDKAVAKELAARPNAVVRVSIKGAAPWEFEKIT
FT                   WSPGVYFYRQIEAIQLLIESGMTPCQDVYPAAMLGFSTDESIRQLEKTLEEIDKRLSQC
FT                   IDVEYVILYPHVVKLMEMRGLRPTHAVTPSGVPTFMI"
FT   gene            435128..435403
FT                   /locus_tag="Pisl_0457"
FT   CDS_pept        435128..435403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0457"
FT                   /product="LSU ribosomal protein L31E"
FT                   /note="PFAM: Ribosomal protein L31e; KEGG: pai:PAE3095
FT                   ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87635"
FT                   /db_xref="GOA:A1RRQ3"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRQ3"
FT                   /protein_id="ABL87635.1"
FT                   /translation="MSEEKKVVLTREYIINLRRAYVVSRTKRAKYAVGLVRRFIARHLK
FT                   VEPKAVKIGQRLNMAIWSRSIEKPPRKVHVVVEKYSDGVVKVELKE"
FT   gene            435400..436065
FT                   /locus_tag="Pisl_0458"
FT   CDS_pept        435400..436065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0458"
FT                   /product="translation initiation factor 6 (aeIF-6)"
FT                   /note="TIGRFAM: putative translation initiation factor
FT                   eIF-6; PFAM: translation initiation factor IF6; KEGG:
FT                   pai:PAE3097 translation initiation factor aIF-6"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87636"
FT                   /db_xref="GOA:A1RRQ4"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ4"
FT                   /protein_id="ABL87636.1"
FT                   /translation="MTFDIAPVRIFGSPSVGVFIATNNTVTFLPPDAPEKIDDVVRNTL
FT                   RTSIARFTVAKSPLLGIFLVLNDNGVLLSALALEEEVRLFKALGLNVGVVNSKYTAISN
FT                   LILANNKVAVVSPLLEPEVRKIIVDTLGVEVIVDTIAGNPLVGSLAVANSRGVLVAPEA
FT                   TDEDLKKLSEYFKTRVDVGTVNKGRSFIRGGIVVNDNGALVGDETAGPELMRITQVLG"
FT   gene            436373..436609
FT                   /locus_tag="Pisl_0459"
FT   CDS_pept        436373..436609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0459"
FT                   /product="LSU ribosomal protein LX"
FT                   /note="PFAM: Ribosomal LX protein; KEGG: pai:PAE3098
FT                   ribosomal protein LX"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87637"
FT                   /db_xref="GOA:A1RRQ5"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRQ5"
FT                   /protein_id="ABL87637.1"
FT                   /translation="MPKIYRIVGETTTGMKFKIEVTAEKPYDAIEKVYSLIGSRHKLSR
FT                   VQIKIREVTAVQPEEARSDSVKMLMAIDRVIKY"
FT   gene            436611..437009
FT                   /locus_tag="Pisl_0460"
FT   CDS_pept        436611..437009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0460"
FT                   /product="prefoldin, alpha subunit"
FT                   /note="TIGRFAM: prefoldin, alpha subunit; PFAM: Prefoldin
FT                   alpha domain protein domain protein; KEGG: pai:PAE3099
FT                   prefoldin alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87638"
FT                   /db_xref="GOA:A1RRQ6"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRQ6"
FT                   /protein_id="ABL87638.1"
FT                   /translation="MSRQDVQRLLEEYQVINELLATLQAQHTTVSELLEELTTALDGVR
FT                   LLKTEGGERLVHIGAGLFVLGTFNAREVLTPLGAGYHAFLDLENAERILKERIDEYSKV
FT                   KTSLEENIEKLIERAAQIRQVLERLGIK"
FT   gene            437009..437932
FT                   /locus_tag="Pisl_0461"
FT   CDS_pept        437009..437932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0461"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: pai:PAE3100 signal recognition particle
FT                   protein (docking protein), probable; TIGRFAM: signal
FT                   recognition particle-docking protein FtsY; PFAM:
FT                   GTP-binding signal recognition particle SRP54, G- domain;
FT                   GTP-binding signal recognition particle SRP54, helical
FT                   bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87639"
FT                   /db_xref="GOA:A1RRQ7"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ7"
FT                   /protein_id="ABL87639.1"
FT                   /translation="MFEKLKKTFSKFVESVVSVVKEEKLDERDAEKLLSDLYFDLVDSD
FT                   VAVDVADAVVEELKKRLVGIKVPRFGDREAAVKKAVYEALLNVLGDVPDVDFYKEAREM
FT                   LEKTRPFVVMFLGPNGYGKTTTLAKLAFHLQEMGFRVVAAAADTFRAGAREQLEEHGRR
FT                   VGFRVVGGAYGSDPAAVAYDAIQHAKSRGYHFVLIDTAGRMHTDTNLMDELRKIQRVAE
FT                   PHRSIFVFDAQLGNEALEIAKYYSKYVNIDGMIATKVDAYPKGGSILTFIYVLKRPVYF
FT                   LGVGQTYRDLVKFSKAEYISQLLALT"
FT   gene            438423..438722
FT                   /locus_tag="Pisl_0462"
FT   CDS_pept        438423..438722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87640"
FT                   /db_xref="GOA:A1RRQ8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ8"
FT                   /protein_id="ABL87640.1"
FT                   /translation="MSSLQEKIANIWRDIKWVISTATKPDEEEFKLTARFLVLLAFVAG
FT                   AFQLVFHLAGVYINSAVYKQTVPTLGDPIKETVTALVSIGVILVGLIYLMAKLR"
FT   gene            438722..439186
FT                   /locus_tag="Pisl_0463"
FT   CDS_pept        438722..439186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0463"
FT                   /product="LSU ribosomal protein L24A"
FT                   /note="KEGG: pai:PAE3103 transcription antitermination
FT                   protein nusG, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87641"
FT                   /db_xref="GOA:A1RRQ9"
FT                   /db_xref="InterPro:IPR005100"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011590"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRQ9"
FT                   /protein_id="ABL87641.1"
FT                   /translation="MSQERCPVYSVSAVSRQEYNIVIVLKMRIESNKIPIYSIVVPPEP
FT                   FGILFIEGESLPAVSRAIYGVKHIKGIMRGVTNVEEVLRVVRPTKPAVEIDINDEVEII
FT                   ADVLKGSRGRVTFVDREKGIVRVELLDSAFPMPLDLRINEVKLVKKASQG"
FT   gene            439217..439720
FT                   /locus_tag="Pisl_0464"
FT   CDS_pept        439217..439720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0464"
FT                   /product="LSU ribosomal protein L11P"
FT                   /note="PFAM: ribosomal protein L11; KEGG: pai:PAE3104
FT                   ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87642"
FT                   /db_xref="GOA:A1RRR0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR0"
FT                   /protein_id="ABL87642.1"
FT                   /translation="MSKRVITVPLQGGKVAVNPQFQDSLKQIGLDPNAVVQKIQEELKR
FT                   YSKYPIQKVELEVFSPSRYEVKIYLPPIGDLFLKILGKDTGAHDSRNEVIGNLSFDQLV
FT                   EIAIFKKDELKSKSLKSAIKQLLSTCKAMGITVDGKPAGEVIKEVDAGKYDEIINKFEK
FT                   LWSQ"
FT   gene            439717..440385
FT                   /locus_tag="Pisl_0465"
FT   CDS_pept        439717..440385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0465"
FT                   /product="LSU ribosomal protein L1P"
FT                   /note="PFAM: ribosomal protein L1; KEGG: pai:PAE3106
FT                   ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87643"
FT                   /db_xref="GOA:A1RRR1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023669"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRR1"
FT                   /protein_id="ABL87643.1"
FT                   /translation="MSAVINKEVLLSKIKEALRNGKPRRFRQSVELIVVLRDVDLNKPE
FT                   NRINLLVELPHPPKPNKVAAFAHGAFETQAKNAGVDAIITRDQIESLAGNKRAIRKLAK
FT                   QYDFFIAPPDLMPLLGRVIGPIFGPRGKMPEVAPPNVDIKALVERLKRSVRVRLRNEAV
FT                   VKVRVGSETQKPEEILENILVILEELNRRFPLRQHLRGIYIKKTMGPPVVARALEVLVR
FT                   "
FT   gene            440417..441448
FT                   /locus_tag="Pisl_0466"
FT   CDS_pept        440417..441448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0466"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="PFAM: ribosomal protein L10; KEGG: pai:PAE3107
FT                   acidic ribosomal protein P0 (L10E)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87644"
FT                   /db_xref="GOA:A1RRR2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR022909"
FT                   /db_xref="InterPro:IPR040637"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR2"
FT                   /protein_id="ABL87644.1"
FT                   /translation="MLAIGKRRYVRTKPYPRRKVKIVEEAIDLLKRYQYIFLFDLHGLS
FT                   ARILHEYRYRLRPYGQIKIIKPTLFKIAFTKAYGGVPIDIAEKVRGEIGFFFTNANPAE
FT                   VIKIIAENSVRRAAKPGDKAPFDIVVPAGPTNASPGPIISKFGKLKIPTRVQEGKIWIV
FT                   KDTVVAKAGQEITPEIAEVLRVVGIEPIFEQLRLIGVIWKGKRFVEIAELAVDVGKYKE
FT                   LFEAAAVYAKNLALNIVYPTREVLQIVIPAAHMRAVALAARLGVVTRETLPMLLSRAIA
FT                   EANSLAALVASKAPELGLSVSTVPQPTSQQPIQPTETPKESAEEKKEGPSEEEIAGSLA
FT                   SLF"
FT   gene            441449..442393
FT                   /locus_tag="Pisl_0467"
FT   CDS_pept        441449..442393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0467"
FT                   /product="mevalonate kinase"
FT                   /EC_number="2.7.1.36"
FT                   /note="KEGG: pai:PAE3108 mevalonate kinase; TIGRFAM:
FT                   mevalonate kinase; PFAM: GHMP kinase; GHMP kinase, C
FT                   terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87645"
FT                   /db_xref="GOA:A1RRR3"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022937"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR3"
FT                   /protein_id="ABL87645.1"
FT                   /translation="MVKVFAPGVVKLFGEHAVVYGKPAIATTIDRGVFIECEKSDRLII
FT                   ESIGTPSTLVYLPEEGRLEALGAERFFAYVNTALKIARERWGKLKARFSIKSELPPSIG
FT                   AATSAAVSVGILKAYSLCANVEVSKEELAKLGHQVELNVQGIASPMDTTAVAIGGVLKI
FT                   WAHPFRVEKLDVSLPQFYIVVLPRRGTTGEIVADVKALLDRRRSAQSVINAIGEVVEEA
FT                   EGCLRRGDLNCVGELMILNNWLLGALGVVDNRVMTLLDLLKTFVYGGKISGAGRGGVVL
FT                   ILPKDETVVEKILSATGYTYFKVSISKTGVVAI"
FT   gene            442390..442632
FT                   /locus_tag="Pisl_0468"
FT   CDS_pept        442390..442632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87646"
FT                   /db_xref="GOA:A1RRR4"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR4"
FT                   /protein_id="ABL87646.1"
FT                   /translation="MTQIVGLLGLLLIASAWAVNIARKSPPPPLDLTLLYLLGSVVLTV
FT                   YALILGDIIFTVLNAVSSMLSLINLLRALRIKNQG"
FT   sig_peptide     442390..442446
FT                   /locus_tag="Pisl_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.988 at
FT                   residue 19"
FT   gene            442641..443426
FT                   /locus_tag="Pisl_0469"
FT   CDS_pept        442641..443426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0469"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine and
FT                   other phosphorylases, family 1; KEGG: pai:PAE3111 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87647"
FT                   /db_xref="GOA:A1RRR5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR5"
FT                   /protein_id="ABL87647.1"
FT                   /translation="MAQRPKIGAKAYHLLLAPGEVPRYVLLPGDPGRVPLIAKYWDNAR
FT                   EVAKNREFVTWVGTYRGVQIGATSTGIGSGSTAIAIEELLYAGADTFIRVGTTGALRRE
FT                   IKLGDVIIGAAAVRFDGASKWYAPPEYPAVAHWLVVKALIEAAEALKVRYHVGIVASTD
FT                   SFYVGQERPGYGGFMPPWAKGLIETLRALRVLSFEMESATIYTLSSIYGARAGGVYAVI
FT                   ANRETDEFSPEVGVEEAVRVANEAVRILAEYDNKGSSNT"
FT   gene            443398..443634
FT                   /locus_tag="Pisl_0470"
FT   CDS_pept        443398..443634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87648"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR6"
FT                   /protein_id="ABL87648.1"
FT                   /translation="MIIKVVQIRDTAIIELSLPPCADVFTFKISSRELEICGKTYVLSE
FT                   EIGEFKRGLLLLEKTPFFIECDEGNCIAAKAQV"
FT   gene            443659..444087
FT                   /locus_tag="Pisl_0471"
FT   CDS_pept        443659..444087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87649"
FT                   /db_xref="InterPro:IPR018665"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR7"
FT                   /protein_id="ABL87649.1"
FT                   /translation="MEVLVAAYNVSSVPKMLELAKVTYGFGLKRFILIKVFGAAAQQIG
FT                   DLFKLAFKMGGEVLVFNDIADAVDILKPDIIYALGRPDRDTKPIEKVDGKIMLLVHGAD
FT                   LSFSPRELPPGAIMSHAVAKDIGSTGQLAIALYRLLGA"
FT   gene            complement(444084..444431)
FT                   /locus_tag="Pisl_0472"
FT   CDS_pept        complement(444084..444431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0472"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: pai:PAE3117
FT                   small heat shock protein, HSP20 homolog, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87650"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR8"
FT                   /protein_id="ABL87650.1"
FT                   /translation="MEDFKRAIEEVTKSFQKMIEEIKEKRDYHLVEEGDGIRIEIDMPG
FT                   LEASDISLSVTKDGSLIKAEGARGDRKYSKLIRLPVRIDPSTASALYKNGVLIITAKKI
FT                   REEEIKIPVRG"
FT   gene            complement(444458..445357)
FT                   /locus_tag="Pisl_0473"
FT   CDS_pept        complement(444458..445357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0473"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3118
FT                   ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87651"
FT                   /db_xref="GOA:A1RRR9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRR9"
FT                   /protein_id="ABL87651.1"
FT                   /translation="MTELLLLLIIQALLASVPILLASLGEILMERSGVVNIGLEGIMLL
FT                   GAFVAPLAVDYLRYRVGMWLPDLVWPIIAMSAAIAIGASVGLIHGYISTYLAGDQIISG
FT                   VAINLFAAGAVAYGIQAYWGVAGYKQVPDWAKADPMWVTVFTFIVAGIMWYVLFKSRVG
FT                   IIIRACGEDPDSAYNMGIDVYKVRLLSTIIGSALASLAGAYLSTAYLSVVTKEISAGRG
FT                   FIALANVVFSNWNPLLAIVGAFIFGFFDALSYWLQTVGVARYEITRMIPYIATLLIVAG
FT                   VIGRAKPPRAVGKVFRRE"
FT   sig_peptide     complement(445289..445357)
FT                   /locus_tag="Pisl_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.638 at
FT                   residue 23"
FT   gene            complement(445354..446358)
FT                   /locus_tag="Pisl_0474"
FT   CDS_pept        complement(445354..446358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0474"
FT                   /product="nucleoside ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3119
FT                   ribose ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87652"
FT                   /db_xref="GOA:A1RRS0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS0"
FT                   /protein_id="ABL87652.1"
FT                   /translation="MRIPLPLLDVVLTLVTAFAIGAVVMWISGYDPIMSYRSMLFTPLL
FT                   DYTYFFSALAFSAPIVLTGLTFAVGLRAGLFNIGAEGQVYMGALGAVVAAYITKSSLAL
FT                   PLALFIGLTLACVWSLVPALLKIWRGVNEVITTIMMNWIAYWVVIMAVSTVFTNPLQPE
FT                   ESIKTPEPARLTPLVAGTDLTAAVPLSYIIALFVYIFVKYSVWGYRISISGQNPIVAKS
FT                   YGIEPMRSIMLSFLIGALTAGVAGVMQVVAKPPSYSLMRNLANVYGLGFDGITAAMLGR
FT                   GHPIGVAIAALFLGVLQEGARHMQIEAGTPFEFVRIIQGVIILLLAIQMLKKT"
FT   gene            complement(446355..447794)
FT                   /locus_tag="Pisl_0475"
FT   CDS_pept        complement(446355..447794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0475"
FT                   /product="nucleoside ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE3120 ribose ABC transport system ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87653"
FT                   /db_xref="GOA:A1RRS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS1"
FT                   /protein_id="ABL87653.1"
FT                   /translation="MKVFLREIHKIFSDGTYALRGVSLEIFPGEILALLGENGAGKTTL
FT                   MKILAGVYRPTSGEIYVNDKRVRFRSARDALKLGIAMVHQHPSLIPGLTALENLAILEG
FT                   ASLKPISTVLKERAVKISEELGFEIEWDRDVEELPLGVRQRVEIVKALYWGADLLILDE
FT                   PTTVLSPPEVRSLFQVIKKLRSLGKSIVYITHKIPEVLEIADRVVVLRRGVKVAEFLPP
FT                   YDPRGLVESMVGELKIERVERIQKPGENFVLEVEDLWIYEGGRAVVQGVSFKVREREIL
FT                   AVVGVEGNGQEHLVEAIVGLRRWRRGVIKIYGRLAYIPDDRLRKALIPEFTLVENAIIG
FT                   KESEFAKRGIISWTLAKQFATKLIKEFGIVAPGPRAFVRHLSGGNQQKLVVGRELSRGA
FT                   KLIIAHQPTRGLDVATTEYVHQLLMKARNNGAGILLVTSDLDEAYKLADTIAVIYRGKI
FT                   VALGPVEEMRVDLVGKKMAGL"
FT   gene            complement(447795..449009)
FT                   /locus_tag="Pisl_0476"
FT   CDS_pept        complement(447795..449009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0476"
FT                   /product="nucleoside-binding protein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: pai:PAE3121
FT                   sugar binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87654"
FT                   /db_xref="GOA:A1RRS2"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS2"
FT                   /protein_id="ABL87654.1"
FT                   /translation="MASKTLALGAIVAVVIAALAILYITQQPKPAQTTVQTKNVYVVYD
FT                   IGGRGDLSFNDMAYLGASKAAKDFGLGLKEVQSRTQDDYVPNLRAAARSGDAALIVAVG
FT                   FLMTDAVKQVSQEYPNVKFAIVDGYVPDRTNVVSILYRENEGSALVGALAALTAYYFNC
FT                   TKVGIVLGMEIPVLWKFEIGYAYGVRWAERYIKQKFGKDTKFDILYIYTGSFNDPAKGK
FT                   QAAEVMLSQGVCVIYQAAGATGLGVFEAVAEAGRKAGKNMGPPFAIGVDADQDYIKPGF
FT                   ILASMMKRVDVGVYTATKMAVEGTFKGGVLELGLKEGGVSVSTLDDLSQFLEIGIKAGA
FT                   VRQEDAQKIIETVREMRSKIPAWIWDAIGMLRQDIISGKEKVPLPTTQDQVVQLRKELG
FT                   LGRVS"
FT   sig_peptide     complement(448947..449009)
FT                   /locus_tag="Pisl_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.650 at
FT                   residue 21"
FT   gene            449165..449473
FT                   /locus_tag="Pisl_0477"
FT   CDS_pept        449165..449473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87655"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS3"
FT                   /protein_id="ABL87655.1"
FT                   /translation="MNYSVEHAKVKELIEKAQCTGASPLDVVNCIIEQLRSAGYTPTTT
FT                   QLLDANVDPAERLEQARFIRFEARREGDKNLHIFTFALLKPGGVYKPLWLQSAVIEK"
FT   gene            449473..449775
FT                   /locus_tag="Pisl_0478"
FT   CDS_pept        449473..449775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87656"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038767"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS4"
FT                   /protein_id="ABL87656.1"
FT                   /translation="METIRERLIKILLESKEPLTIHQLQSLAQTELKPNELYEELEHVR
FT                   RTLKRMGYRLVIVPATCKKCGYQFTDREKLKKPSRCPRCKSERIEPPRFYVVTSS"
FT   gene            complement(449762..449923)
FT                   /locus_tag="Pisl_0479"
FT   CDS_pept        complement(449762..449923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0479"
FT                   /product="LSU ribosomal protein L40E"
FT                   /note="PFAM: Ribosomal protein L40e; KEGG: pai:PAE3255
FT                   ribosomal protein L40"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87657"
FT                   /db_xref="GOA:A1RRS5"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR023657"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRS5"
FT                   /protein_id="ABL87657.1"
FT                   /translation="MPITLDPEKLAIVMKHKFQYKICRECGARNPPDAEKCRRCRSRNL
FT                   RPKKFKKK"
FT   gene            450059..451978
FT                   /locus_tag="Pisl_0480"
FT   CDS_pept        450059..451978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3254 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87658"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS6"
FT                   /protein_id="ABL87658.1"
FT                   /translation="MSTSLLGIARDGDEYYILNITEGYKSRLVYWFRDLENRISAALKI
FT                   GTSVVLLGPHGSGKSVLARYIAAKFVSEYYAVIDLGVDVVTFDNLLEILPEVPNAMGFY
FT                   DPLGISFYDNPHLPRAELAVPWIRRCQYIIDRAFYLNTRDIPTLLVLPYDLFRYSPCKT
FT                   YIEKNSKIVDIAEYLRNIDVPSILKSVFSTHAAALGCKTSNPDPYIDYVLQKHSDLSGV
FT                   FALATYGGRLYARNRCAPYKPDVLYQDVIKELAKIYYRLYRELFFPTCQIARALAIPLL
FT                   LSLQGQHIPPAIIHPLSNADRISRRLYILSRASATLDSAAREEILEELKELYQPQEEFV
FT                   DIAEWASAPKESVVVESLKLSIREDRCTNIQGSPIHKIRTVYKGLMTLDYRYAIDLAKA
FT                   VASIALGIDICKEDIGKYLCYRGEVPQIIIEALGGDKRITLETHIVSPTPRCLEDGIEL
FT                   LTQLAAVDARRAPLQCLEKFIEVLYSTVQKNPESLVKFYKLYRDYMEIVAERVATPILR
FT                   KFALAHYYGVVPSEATPILKRILEVAQEDYKTVATVLASLATLTSEDVASLLPTCDCPY
FT                   LRAFSAYQIARKLLETDRSQEVLKILDVTITEVKRGDPRHEYTPQFIQEVEELYRQVAL
FT                   ELIV"
FT   gene            complement(451975..452382)
FT                   /locus_tag="Pisl_0481"
FT   CDS_pept        complement(451975..452382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3253 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87659"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS7"
FT                   /protein_id="ABL87659.1"
FT                   /translation="MGLSIRPTVTLRPGVYCLYIANREVNLIDVPGQYVIEVVQNFAKM
FT                   WTFYVDKAVYMYDLLHYDTLKALVEIHSDLLDRGIKPFKRLAVVGNKMDLAREYGFYIE
FT                   ADEIAVAVGAQEIYYISALKGDARDLIKVVL"
FT   gene            452529..453098
FT                   /locus_tag="Pisl_0482"
FT   CDS_pept        452529..453098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87660"
FT                   /db_xref="GOA:A1RRS8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS8"
FT                   /protein_id="ABL87660.1"
FT                   /translation="MNPVGRLALWIMMYIVVMAVVQYAFQFVTSNIYKDAMSYKVYVDI
FT                   LLTLFFGWQIVKAFADIVALPVAKKQGETAGKAVANLIKLLGIGALVASLAGAVSGGAA
FT                   AAALGGFIGLVIGFATQQVLSQAVAGIFLLLARPFKIGDKIVGAGQEGIVEDIGAMYTV
FT                   VKDAEGNKILIPNNKLIGDILKIKKS"
FT   gene            complement(453095..453817)
FT                   /locus_tag="Pisl_0483"
FT   CDS_pept        complement(453095..453817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87661"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRS9"
FT                   /protein_id="ABL87661.1"
FT                   /translation="MLIRVNLLETLGAGIGYFGEYIFAKVLQKVSRGETIAMLVEGLYS
FT                   ADKIAPRGTSMPHEKGRGVYSKHVLSEWPIHKSWFVPVVEDGAPAVILDPPRGLVKYIG
FT                   RDTEGVYALLLSLGLKELKDYVLKGVSPTLLKDFDIFTETDIEIAAVIYERLRGEPDFV
FT                   ASVIETLREVDFLLVENGVVYHVEVKTTMRPTDPKLRKKRTLLQKRQQIMEKLGLRPAL
FT                   AVVIPRENWEVEVWFEKS"
FT   gene            453898..455283
FT                   /locus_tag="Pisl_0484"
FT   CDS_pept        453898..455283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0484"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG: pai:PAE3250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87662"
FT                   /db_xref="GOA:A1RRT0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT0"
FT                   /protein_id="ABL87662.1"
FT                   /translation="MISKLFDPQSVALVGASTKQGSVGYVILENLVTRFKGVVYPVNPK
FT                   YDEVELWGRRIKFYKSILEIDAPIDAVVIATPAPTVPKILEEAGLKGVPVAIVVSSGFA
FT                   EAGNVELENWTKAVAKQYGIRVLGPNCIGVYNAYTNFDTIFLPADRAGRPPPGPLALIS
FT                   QSGAVAAAIMDWAARRKIGLGLMVNYGNKIDITEVELLEAFAADDRIKVITLYIEGFKY
FT                   PGEASRFLESVRKIVPKKPVVVYKAGRGRAAQRAVKSHTAAMAGTYEMYHGLFQQAGVI
FT                   EASSVREMFDMAKALAYQPIPRGKRVLVVTDSGGMGIQAVDALEALGLEVPEVPESIAN
FT                   ELKRELLPFAAVSNPIDVTGSATDEHYKIVLDTLLPTAFFDMALVVTLMQVPGLTKNLA
FT                   EYIINSKKYGKPLVVVNFGGSELVQKFEDILEDNGIPVYPTPERAAKALWALYKYAEVK
FT                   RKI"
FT   gene            455280..455978
FT                   /locus_tag="Pisl_0485"
FT   CDS_pept        455280..455978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0485"
FT                   /product="acetyl-CoA synthetase (ADP-forming) beta subunit"
FT                   /EC_number="6.2.1.13"
FT                   /note="KEGG: pai:PAE3249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87663"
FT                   /db_xref="GOA:A1RRT1"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT1"
FT                   /protein_id="ABL87663.1"
FT                   /translation="MTHTIVAKALAEARNKLREDEALALLKAYGIPTPDFALARDEEEA
FT                   VKLAEQIGYPVAVKIVSPQIVHKTDVGGVILGVSNEREVREACVQIKEIIKKVPYAELE
FT                   GVLIQKMVPKGVELIIGTVYDEIFGHVILFGLGGIYTEVYKDVSMRIVPITEEDAWEMI
FT                   REVKAYRILTGYRGMPPRDVAAVVDILVKFSRLVQENPEIREADLNPVIALEEGKGAYV
FT                   VDARFILKMP"
FT   gene            complement(455979..456055)
FT                   /locus_tag="Pisl_R0012"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(455979..456055)
FT                   /locus_tag="Pisl_R0012"
FT                   /product="tRNA-Trp"
FT   gene            complement(456140..457075)
FT                   /locus_tag="Pisl_0486"
FT   CDS_pept        complement(456140..457075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0486"
FT                   /product="Rad51-like protein"
FT                   /note="PFAM: Rad51-like; SMART: AAA ATPase; KEGG:
FT                   pai:PAE3238 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87664"
FT                   /db_xref="GOA:A1RRT2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT2"
FT                   /protein_id="ABL87664.1"
FT                   /translation="MSRKKADLSSLEGVGPKTFEKLMELGITSLEHLSEFTAEELAEAG
FT                   IEYERAVKLLQQVLQKVGGVKAVTFGEFRQRQVKTFKTGLVEFDEKTPWRGIREGFIYE
FT                   FAGEYGTGKSMFAHQLAVVGLKEGFTARVVYIDTEGTFNPTLVETIARRFGVEIERLDT
FT                   SLVLYQPANVMQLEQIVKYDIPRHIQEGCRLVIIDTITALYRAEFPGREMLAARQQRIH
FT                   YLVDWLRRHARTFGVTSILANQVMDVPEIFAGGVKRPAGGNVLAHTVNARFMMVRPNKA
FT                   KLEGYMWPLDVPGMAPDVRIEYRITEAGLE"
FT   gene            complement(457080..457463)
FT                   /locus_tag="Pisl_0487"
FT   CDS_pept        complement(457080..457463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE3245 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87665"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT3"
FT                   /protein_id="ABL87665.1"
FT                   /translation="MEVVVVFRGQPPDEWKGVPGVRALSMGELGDIERRLVLVVGDREF
FT                   AERLGVGYLTEEETEELLAYIKARLSETSSRVSEGRCAHFSPTVRLITYIPLCRGKKVM
FT                   TSWGAWRCEEAVIPLNKFNIEIN"
FT   gene            complement(457541..458068)
FT                   /locus_tag="Pisl_0488"
FT   CDS_pept        complement(457541..458068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0488"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pai:PAE3246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87666"
FT                   /db_xref="GOA:A1RRT4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT4"
FT                   /protein_id="ABL87666.1"
FT                   /translation="MEFVIDRETALRLVGLYYRGPVKYAKAVLERWPGSNAVTVYIDGE
FT                   PVGAEVFYAVRLAEMTCVHYYIVVAPKHRRRGIATSLVRYVEGLCGASTYLATSAIDNV
FT                   AVARLFEKLGYARHAWRELPPSVREVLLKATCGYDDDVLYIKGGKPEEIAAYTGDVEVL
FT                   WRETCLKPYLGV"
FT   gene            complement(458056..458889)
FT                   /locus_tag="Pisl_0489"
FT   CDS_pept        complement(458056..458889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0489"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: pai:PAE3247
FT                   morphine 6-dehydrogenase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87667"
FT                   /db_xref="GOA:A1RRT5"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT5"
FT                   /protein_id="ABL87667.1"
FT                   /translation="MCQFAPVKRVCFRRVGCVSAVGLGTWGIGGGFWVSDRSRDREWID
FT                   ALRYAIERGITLIDTAEMYGGGHTEELVGLAIKGFPRDELFIVSKVWPSHARFEDVLKS
FT                   AKQSMARLGTYIDLYLLHWPSEIVPICETIRAFETLVDRGLIKFFGVSNFSLRQIKEAE
FT                   SCTKKYELAAVQNRYSLYYKSDDANVIPYVLSNGIMYMAYTPLEKGAIARDRRLMEIGT
FT                   RYRASAVQIALAWYVKRGVVPIPKAERREHIDEIVRSLEIELSEEDFLEITRWSS"
FT   gene            complement(458905..459005)
FT                   /locus_tag="Pisl_R0013"
FT                   /note="tRNA-Undet9"
FT   tRNA            complement(458905..459005)
FT                   /locus_tag="Pisl_R0013"
FT                   /product="tRNA-OTHER"
FT   gene            complement(459041..459120)
FT                   /pseudo
FT                   /locus_tag="Pisl_R0014"
FT                   /note="tRNA-OTHER7"
FT   tRNA            complement(459041..459120)
FT                   /pseudo
FT                   /locus_tag="Pisl_R0014"
FT                   /product="tRNA-OTHER"
FT   gene            459233..459406
FT                   /locus_tag="Pisl_0490"
FT   CDS_pept        459233..459406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0490"
FT                   /product="paREP4"
FT                   /note="KEGG: pai:PAE3289 paREP4"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87668"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT6"
FT                   /protein_id="ABL87668.1"
FT                   /translation="MSKKQKLKFYDIKAKQAFETDQYEVVEKQTARGPMLFAVAKSPYT
FT                   GIKVYRLIGKKK"
FT   gene            complement(459428..460420)
FT                   /locus_tag="Pisl_0491"
FT   CDS_pept        complement(459428..460420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0491"
FT                   /product="cell division protein pelota"
FT                   /note="PFAM: eRF1 domain 1; eRF1 domain 3 protein; KEGG:
FT                   pai:PAE3287 cell division protein pelota (PelA),
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87669"
FT                   /db_xref="GOA:A1RRT7"
FT                   /db_xref="InterPro:IPR004405"
FT                   /db_xref="InterPro:IPR005140"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR023521"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR038069"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRT7"
FT                   /protein_id="ABL87669.1"
FT                   /translation="MRYEVDTKRRIIKLVPEREEDLYFIYLLIDKGDIIRGWTVREYKP
FT                   DGVKEGERIKIYLAIKVESLEYHKFRGSLRIRGTVVEVQDGIEGVKGRRHTFDVTPGRE
FT                   IEIEKAYDYPLDVVIEVLNMAKAVLPRVLLISVDDEETVFAYITALGVEILHTMYNTGR
FT                   KDDSMFEEYFTAIKEVVDELKRRHKPDIVVLAGPSMIIEQASEYIQAIKVPQGSGGLAG
FT                   VYEFIRGGLYEKFKIEMGINVYQRFIHKLSVDRLSVAIGLNEVREATDAGRIETVLVLD
FT                   TLIKERPEDIWPLLAQVYKTRGKIHIVKEDSEVGAGLKAMGGVVALLRW"
FT   gene            460558..460713
FT                   /locus_tag="Pisl_0492"
FT   CDS_pept        460558..460713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3286 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87670"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT8"
FT                   /protein_id="ABL87670.1"
FT                   /translation="MKPNSSLVDELTKLISQFYENGYIEVARLLERARILALMKEREML
FT                   IPPATD"
FT   gene            complement(460703..461320)
FT                   /locus_tag="Pisl_0493"
FT   CDS_pept        complement(460703..461320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87671"
FT                   /db_xref="GOA:A1RRT9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT9"
FT                   /protein_id="ABL87671.1"
FT                   /translation="MRPRTLFITAIVVFLIIAATIIYKNLSTSTSQTAVSSALPIPSWA
FT                   ISFGNPNAPLVLVELFDLHCPYCAIAHEKLDPLYRRLMLEGKLRLIFVDFIVHPDAVVA
FT                   HRYLHCAYKQLGNKTYDLLTQLYTTYLNEGPEKQLELLRQYQCSNAPTQNDFEDVKRAM
FT                   VNFLIQKGLVQIGTPTFIIVRNGSIDIVVGADVNRVSSLLSQ"
FT   sig_peptide     complement(461264..461320)
FT                   /locus_tag="Pisl_0493"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.308 at
FT                   residue 19"
FT   gene            complement(461344..461850)
FT                   /locus_tag="Pisl_0494"
FT   CDS_pept        complement(461344..461850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0494"
FT                   /product="Protein of unknown function DUF359"
FT                   /note="PFAM: Protein of unknown function DUF359; KEGG:
FT                   pai:PAE3284 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87672"
FT                   /db_xref="InterPro:IPR007164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRU0"
FT                   /protein_id="ABL87672.1"
FT                   /translation="MTCFKLCCRRDLFAFPYPVAIWKEPPRSIEVVRDLVESYGIEQIY
FT                   TVGDIVTTNFLKYSLAPTSAAVDGKTRRGLKIDKPTFFRKTIEVYNPPGYITEEAWIAV
FT                   EEAVRDNVMIKVNGEEDMLSLAFIKLAPPHSVVVYGHYMGALIAIPVDWYRDAICKLFE
FT                   YLEKC"
FT   gene            complement(461847..462554)
FT                   /locus_tag="Pisl_0495"
FT   CDS_pept        complement(461847..462554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87673"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU1"
FT                   /protein_id="ABL87673.1"
FT                   /translation="MEIYIVGYGGWISSPYIGYASLYVKTDINILLDVGECTYARVIQC
FT                   NLPWPDLIFISHRHGDHILGLPTFMLMAKRLGKKLKIIANRETLEAAKALAIATGIENT
FT                   LQYVEFLEATREVTMGQTRLRFAKTSHPIDTLAVRIEHEGKCATYSSDTAPADVVVELA
FT                   RGCDILIHEVSGNPGQEDEVHRVGHSTTVDAIEISKRAGVKMLIPFHFYTELPIVPPGI
FT                   TVVLPTPCGRVVI"
FT   gene            462601..463950
FT                   /locus_tag="Pisl_0496"
FT   CDS_pept        462601..463950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0496"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   pai:PAE3281 UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87674"
FT                   /db_xref="GOA:A1RRU2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU2"
FT                   /protein_id="ABL87674.1"
FT                   /translation="MLADLLKRGELTIAIYGLGYVGLALSAAWVLAGARVIGVDVDLSK
FT                   VEKLNGGVVEFPETDVVETLTSAIKSGKFQATTDGIIASIRSNVKIIAVPVYLKKSPIA
FT                   VEVDFSALTSASRAIGAGLKRGDLVIVESSVPPGTTEDVVKPILEGVSGLVAEEDFYLA
FT                   YSPERIMVGHALRDITENYPKIVAGIGPRSTEEAAELYRLISKKGVITLRNVKEAEFEK
FT                   LLEGVYRDVNIALANEMAKLANAMGISFRRAREAANSQPYSHVHKPGTGVGGNCIPVYP
FT                   YFLMWTAAKYGVELRLTYLARQINERQPEEVAFATLRAMLKHGINPATAKITILGLAFR
FT                   GDVDDSRESPTYGVIATLLKLGIKPTQIVVHDPYIRQDRQLSTWGVVLTQDLEVAVKGA
FT                   DIVVVSTDHSMYRIEASKIAKYMKTPVVIDARGVLIPDMEIYAIDSGNWP"
FT   gene            complement(463947..464501)
FT                   /locus_tag="Pisl_0497"
FT   CDS_pept        complement(463947..464501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0497"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: pai:PAE3279 2-ketoacid ferredoxin
FT                   oxidoreductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87675"
FT                   /db_xref="GOA:A1RRU3"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU3"
FT                   /protein_id="ABL87675.1"
FT                   /translation="MYVIRNAMYEVIFLGRGGQGAVTAVQLLAHAAALEGKKAQALPEF
FT                   GAERRGAIVKAYLRIGEVLLHSSIKKADYVIVLDGRIIDQIDVKQYGKEGATYIVNTKN
FT                   PADWYISIDATSIALKHGLVVAGWPVVNLIMAAAFAAVSGAVSLESLLKATAEYVPKRY
FT                   LEANIKAIVETYDIVKKLKIS"
FT   gene            464641..464889
FT                   /locus_tag="Pisl_0498"
FT   CDS_pept        464641..464889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0498"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; KEGG: pai:PAE3276
FT                   2-ketoacid ferredoxin oxidoreductase delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87676"
FT                   /db_xref="GOA:A1RRU4"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU4"
FT                   /protein_id="ABL87676.1"
FT                   /translation="MLPISKPALASAGITGTWRVYRPVIKLEKCIDCGLCWLYCPESVI
FT                   EWERGQKIQIDYTYCKGCGICANVCPVKAIDMVPEVV"
FT   gene            464886..466040
FT                   /locus_tag="Pisl_0499"
FT   CDS_pept        464886..466040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0499"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: pai:PAE3275 2-ketoacid ferredoxin
FT                   oxidoreductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87677"
FT                   /db_xref="GOA:A1RRU5"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU5"
FT                   /protein_id="ABL87677.1"
FT                   /translation="MKTLSVQKTALTGNYAVAYAVKMAKPHVIAAYPITPQTSIVEKLA
FT                   EFVERGELNARFVNVESEFAAMSVVYGAAMVGARAFTATSSHGLLYMYEVTWWTALSRA
FT                   PVVMAVVTRTIGPPWNIHVEHNDILTLRDSGWIIAMAETVQETFDLTIQAFKIAETAIL
FT                   PVAIGVDGFILSHSTEPVEIPQQEIVDYFLPPRKPDIPLLLRPGEPITFGNLPSDNKIH
FT                   ARHKVSTVYEAHEKAKKIINHIDEEYGKITGRRYGGLVEWYRAEDAKHIVVCAGAWCSD
FT                   AKHAVNALRKDGMSIGLMRLRFIRPFPREEVEKLEDYDTVIIYDRDITPLGGILGIEIN
FT                   SLVSRPKTINIIAGIAGVDFDSHRFYETIRNAVEGRYRELEFII"
FT   gene            466037..466942
FT                   /locus_tag="Pisl_0500"
FT   CDS_pept        466037..466942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0500"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: pai:PAE3274 2-ketoacid ferredoxin
FT                   oxidoreductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87678"
FT                   /db_xref="GOA:A1RRU6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU6"
FT                   /protein_id="ABL87678.1"
FT                   /translation="MSFRIDQLPKKKYILPGNAACAGCGMMIGLKVLGMAIGDESVLVI
FT                   PASCASVVQGLAPKTGIAIPILNVPFASSAAVATGVAEAFKTLGIKGHVVVWAGDGGTA
FT                   DIGFATLSGAAERNSNIIYIMYDNEAYMNTGIQRSSSTPRAAWTTTTPAGKRERKKDVA
FT                   LLMAMHGVPYVATASIAYPQDFYRKLKRATEIDGFKFIHLHTPCPPGWRFDPAKTVEVA
FT                   RLAVETGAWILWEYDHGQFRLNPPSTIYADKTKRRPLSEYLKLQGRFAHLTEDDIKALE
FT                   EDLEDKWQTILALSQSFSRR"
FT   gene            466985..468667
FT                   /locus_tag="Pisl_0501"
FT   CDS_pept        466985..468667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0501"
FT                   /product="thermosome subunit"
FT                   /note="TIGRFAM: thermosome; PFAM: chaperonin Cpn60/TCP-1;
FT                   KEGG: pai:PAE3273 thermosome (chaperonin) beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87679"
FT                   /db_xref="GOA:A1RRU7"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU7"
FT                   /protein_id="ABL87679.1"
FT                   /translation="MHNFCQTMSQTQAPRTGVPIMILKEGSQRTTGVDARRSNIQAAKV
FT                   IAEILATSLGPRGMDKMLIDAFGDVTITGDGATILKEMEVQHPAAKLLIEVAKAQDAEV
FT                   GDGTTTVVVLAGKLLELGEELLEEGIHPTIVIDGYKKAADYALKVAEEIAKPVELTKEQ
FT                   LLKVVSNALSSKVVAETRDYLANIVVEAALQAVETRDGKPYLDLDWIKIEKKKGKSIYE
FT                   TQLVRGIVLDKEVVHPGMPKRITNAKIAILDAPLEIEKPEWTTKISVTSPDQIKAFLDQ
FT                   EAEILKSYVDHLASIGANVVITQKGIDEVAQHFLAKKGIMAVRRVKRSDIEKLARATGA
FT                   KIITSIKDARPEDLGTAGLVEERKVGEEKMVFVEDIPNPRAVTILVRGGSDRILDEVER
FT                   SLQDALHVARDLFREPKIVPGGGAFEIEVARRVREFARKLPGKEQLAALKFADALEHIP
FT                   TILALTAGLDPVDAIAELRRRHDNGEITTGIDVYGGKIADMAALNVWDPLLVKKQVIKS
FT                   AVEAAIMILRIDDIIAAGAPKKEEKKGKKEGEEGEEKSETKFD"
FT   gene            468717..469046
FT                   /locus_tag="Pisl_0502"
FT   CDS_pept        468717..469046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0502"
FT                   /product="DNA-directed RNA polymerase, subunit K"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb6; KEGG: pai:PAE3271
FT                   DNA-directed RNA polymerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87680"
FT                   /db_xref="GOA:A1RRU8"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR006111"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR020708"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU8"
FT                   /protein_id="ABL87680.1"
FT                   /translation="METLSTSELLERINKLVELLERALVKRDFYPPRLTKYEIARIIGA
FT                   RALQLAMGAQPKIDIRELGTTDPVLIALEEFRRGLLDFIIVREFPDGKAIKIRLRELLE
FT                   LEKTL"
FT   gene            complement(469236..469964)
FT                   /locus_tag="Pisl_0503"
FT   CDS_pept        complement(469236..469964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0503"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE3269 branched-chain amino acid ABC
FT                   transporter, ATP-binding protein, putative; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87681"
FT                   /db_xref="GOA:A1RRU9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRU9"
FT                   /protein_id="ABL87681.1"
FT                   /translation="MAEVLRVEKLEAGYGKFHVLFGVDIVVNSGEIVVLLGPNGAGKST
FT                   LLNSIVGMADVYSGRITLLGHDVTGKPPHEVMKLGVAYVMQSPNNFGTPNIFGELTVFE
FT                   NLIAASAGLSKKDVLKRVEEIYEIFPRLRELRDRKAKFLSGGERQMLAISLGLMKNPKL
FT                   LMLDEPTAGLAPKLVSEFFSVIKDIRDKFGISILLVEQNAKKALEIGDRAYVLVTGRIR
FT                   YSGDTKSIDEDRLAKLFLGQ"
FT   gene            470104..471354
FT                   /locus_tag="Pisl_0504"
FT   CDS_pept        470104..471354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0504"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pai:PAE3268 branched-chain amino acid binding protein,
FT                   putative; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87682"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV0"
FT                   /protein_id="ABL87682.1"
FT                   /translation="MSTGGQAPSATTTPTPTQTLTTSPPTAQKVFKLGALLPLTGGFSS
FT                   YAKLAQCAAQLAIDDLNSEYANKGYKFELYVEDTQLDPNVALQKLQTLYAKGVRAVHAG
FT                   LTSREASGEKPFADQNKIILFSAWSTSSLLAIPNDWLYRIVGTDAKQIRAIGAILKELG
FT                   VKNVALIYRKDPYGEGLYIELQKEATRRGFKLVSVAAYDPDPKAFPQAAPEAVRKISAE
FT                   VKDLVGPDFALVIVSFEDDGAVVLKAIGQDPILSKARLIGTEGMAFSPILLQEGGAVMA
FT                   KGKIVGTANWALPTTPEYKEFYRKFKAKCGAEPITPAPQSYDVIKMLGEIMASIGTDDP
FT                   DKVRTTLEQWGREGRYKGATGVVILDENGDRANPNFLLWGVTIKNGTSTYIEVGYYDYD
FT                   KDSIEFTPEGKQYFYGK"
FT   gene            471486..471566
FT                   /pseudo
FT                   /locus_tag="Pisl_R0015"
FT                   /note="tRNA-OTHER1"
FT   tRNA            471486..471566
FT                   /pseudo
FT                   /locus_tag="Pisl_R0015"
FT                   /product="tRNA-OTHER"
FT   gene            471637..471724
FT                   /locus_tag="Pisl_R0016"
FT                   /note="tRNA-Leu2"
FT   tRNA            471637..471724
FT                   /locus_tag="Pisl_R0016"
FT                   /product="tRNA-Leu"
FT   gene            471697..472212
FT                   /locus_tag="Pisl_0505"
FT   CDS_pept        471697..472212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0505"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: pai:PAE3265 aspartate carbamoyltransferase,
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87683"
FT                   /db_xref="GOA:A1RRV1"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRV1"
FT                   /protein_id="ABL87683.1"
FT                   /translation="MGSNPTPRTKSLLTGPVMLLMSRELIVSKIRSGTVIDHIPAGRAL
FT                   AVLRILGITGKEGVRIALVMNVESKKLGKKDIIKIEDRELTPEEVNIISAVAPTATINI
FT                   IEDFRVVRKFKVTPPEVIRGKFKCRNPTCITNAPREPVEPTFYLVRREPPLFICAYCGR
FT                   YHELSDLI"
FT   gene            472209..472790
FT                   /locus_tag="Pisl_0506"
FT   CDS_pept        472209..472790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0506"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: pai:PAE3264 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87684"
FT                   /db_xref="GOA:A1RRV2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRV2"
FT                   /protein_id="ABL87684.1"
FT                   /translation="MIEKFLELGVVKFGIFRLSSGLESPFYIDLRNVLGEPELLRWVIE
FT                   QYREILLRLKFDIIVGVATGGIPYASILGYTLGKPISYVRPEAKEHGTGRLIEGAEVSG
FT                   REVVVIDDVLTTGKSIIGAINAIRSAGGIVAGAVVFLDREQCGSRNIKTATGVEVYSVY
FT                   KMRGLLDRLKDYIDEEQYRSVINYLAQWRC"
FT   gene            472778..473668
FT                   /locus_tag="Pisl_0507"
FT   CDS_pept        472778..473668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0507"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /note="PFAM: dihydroorotate dehydrogenase; KEGG:
FT                   pai:PAE3263 dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87685"
FT                   /db_xref="GOA:A1RRV3"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV3"
FT                   /protein_id="ABL87685.1"
FT                   /translation="MALLIIIGRLLHYVHPEISHRLGSLLFSLPLPTCRCVQQWEIGDV
FT                   KVCGPVGVAAGLDKTGRYSRFLSFFCPGFIVVGSTLPYKRRGNKPPRVARIWPYSLVNA
FT                   MGLNSPGIAAVLHKLTNLNYPIFISIAGFTKEDFLTQLIYLRRYKPTAVEVNISSPTYK
FT                   GLWRDLPELIDIDMPMFIKVGPSVDVASVIRDVRRLGWGLVVTNTFPIEDNRISVGRGG
FT                   LSGLLLYKYGFKLLVKVREAAGPDIPIIYSGGLFSCSQLREVLKYANAAEILTSILYFT
FT                   PYILKILNRCLYSRE"
FT   gene            complement(473640..474050)
FT                   /locus_tag="Pisl_0508"
FT   CDS_pept        complement(473640..474050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87686"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV4"
FT                   /protein_id="ABL87686.1"
FT                   /translation="MLRILFGLKVIYSSDLGDTELLNTECLVVTRDEELYKTRRGPTIL
FT                   IKTDDHIKWISIFLRLGLKPLEKSRCPLCGGDVVEVSCREAEKAVGHRIFSEKCWRCTS
FT                   CGRYYWVGAHWRRLKKLVEEAYETTLDCINIG"
FT   gene            complement(474122..475963)
FT                   /locus_tag="Pisl_0509"
FT   CDS_pept        complement(474122..475963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0509"
FT                   /product="protein of unknown function DUF814"
FT                   /note="PFAM: protein of unknown function DUF814; KEGG:
FT                   pai:PAE3259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87687"
FT                   /db_xref="InterPro:IPR008532"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV5"
FT                   /protein_id="ABL87687.1"
FT                   /translation="MKKVVTALDLLASAVEMSNLINNRVENIYKTGAGFLFKFTSGFMT
FT                   ITKFRASLTGVIPEKSHEGAETLRGLFRGEKLVKVYMPRFDRILELEFVSGKIIIELIE
FT                   PFNIVSVRDGKIVWLLHSYRGRDRELKPGLSYVYPPAAFIDIFTADVNAIEKAIDPGDV
FT                   KKSLVRRLGTGPELAEELIARAGSSPRALAETLKIIVDQIRIGKIEPTVCIKENIPVTV
FT                   LPIRLTAIQCDELKQFTHFWEALDYYFSPMELGSTLIQETQELIQRRKKLETTIAELEK
FT                   KIPEYKKEASLLKTTAHKLLMYKSEIEDALRGYETSIRVVYVNKRVKIELPDGTVVELE
FT                   KDIPVGRQISRMFEHAKELEEKANKAAQVVEKLRRDLAKLEEEIHRAEEKVKSSVKIVV
FT                   KRAWFEKFRWSITTGKRPIIGGRDASQNETIVRKYLREHYLFFHADIPGASVVVMPPSE
FT                   DPLELLQTAQFAAAYSKAWKIGIHSIDVYYVRGEQVSKHAPAGQYLARGSFMIYGKREY
FT                   IRHVRLELAVGCRKDGDIYRVVAAPPKSAQLLADRYVIISPGGVEKSKLGRELAKKWGG
FT                   CSLEEIVAAIPGPSQIAEEGRGSPLSWEEVERVFATW"
FT   gene            complement(475994..476845)
FT                   /locus_tag="Pisl_0510"
FT   CDS_pept        complement(475994..476845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0510"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   SMART: AP endonuclease, family 2; KEGG: pai:PAE3257
FT                   DNA-(apurinic or apyrimidinic site) lyase (endonuclease
FT                   IV)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87688"
FT                   /db_xref="GOA:A1RRV6"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV6"
FT                   /protein_id="ABL87688.1"
FT                   /translation="MDSVFELMARVYLGPAGIPQYVAKARSTLDAVRVVRELGLNAMEV
FT                   EFVQGVRMSRELAKQVGKAAQEYNIKLSVHAPYFINLCSEETDKVEKSRQRLVDSLDRA
FT                   YYMGAWVVVVHAAYYGKLGPQKCYEKVKEELEKAYKESGVGSGVYVGVEITARTNQFGS
FT                   IEETFKLAKELPFVTPVVDWGHLYARNNGVLNYGEVLDLWTKEFGDRHMHTHFTSIRYR
FT                   NGKYVDEHEPIERNMPPFEPLAKELSARDITITLICESPLLEKDALLMKEILEKHGVRL
FT                   AT"
FT   gene            476873..478111
FT                   /locus_tag="Pisl_0511"
FT   CDS_pept        476873..478111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0511"
FT                   /product="Pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="PFAM: tRNA pseudouridine synthase D, TruD; KEGG:
FT                   pai:PAE3134 putative tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87689"
FT                   /db_xref="GOA:A1RRV7"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRV7"
FT                   /protein_id="ABL87689.1"
FT                   /translation="MIEAPPFDKSLGMLYYVTDTCPAGGVIKARPEDFIVEEVLKDGTV
FT                   VALTGISLKPRVGSWTWIHVVKKNTDTLKLLLYLAKTLGLKARDISIGGIKDTRAVTSQ
FT                   IISIRGDVTNLPKIRNVEFLSFWPMDKPITPSLIYGNRFTITLRNVEKVDCAEATLKTL
FT                   QYIALPNYYGYQRFGTIRPVSHLLGKALVKKDAEEFFDIMFCKIFAYESDVAKKAREAA
FT                   CKGDYRRALEIFPKRFIEERAVLRGLLRGLDLWNAIMSIPIQILRIYVEALQSYLFNLF
FT                   LSKRMELGPLNRPIEGDLVEINGQVVHYAEGLGGEVVLPTVGVGVKMPRGKVGEAVLQL
FT                   LKREGVEPSMFLKMPRGLRVYGGYRKVVLTLRDFRYAVDKEVTVSFTLPRGSYATVILR
FT                   EVVKPEEPYRHGF"
FT   gene            478150..478947
FT                   /locus_tag="Pisl_0512"
FT   CDS_pept        478150..478947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87690"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRV8"
FT                   /protein_id="ABL87690.1"
FT                   /translation="MVDAYPADAEIPIPKRDALIILAVHSYIPSQANPRPELIETLLQT
FT                   LQGRDVSITFSMPKSYFEKAVKIMGLEKLAAKYGARIIQPQQHVDYKIELETSRGTKIT
FT                   VRALRAAFEESLTKIVVAIPVSHPQTILYLTMPTAALQVLEPKDAQNLYEGFRALYKYI
FT                   ANIYKLEKNTFCLTDGKFVIEGDGPIKGFQRYWGVIVTGENCGEVDYITAQALGVNPED
FT                   LGYLYFYFGGSWPKIKPPRLLEENKIQIKLTSNIGILLSWKRG"
FT   gene            479079..479513
FT                   /locus_tag="Pisl_0513"
FT   CDS_pept        479079..479513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0513"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="PFAM: ribosomal protein L14b/L23e; KEGG: pai:PAE3136
FT                   ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87691"
FT                   /db_xref="GOA:A1RRV9"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR019971"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRV9"
FT                   /protein_id="ABL87691.1"
FT                   /translation="MAKRGGKRTVGVSYRFHVTPGIFLNSLVPVADNSGARLVRVIGVV
FT                   GHYSKTVHRRIPGAGVGDMVVVVVREGKPELRKQIFRAIVVRQRRPYRRPDGTWVAFED
FT                   NAVVIVTPEGDPKGSEIHGPVAMEATLRWPTIANLASIIV"
FT   gene            479583..479909
FT                   /locus_tag="Pisl_0514"
FT   CDS_pept        479583..479909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87692"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW0"
FT                   /protein_id="ABL87692.1"
FT                   /translation="MALSELETLLPRLTKLSPAKKILALYKLRSLVSEEDFRHLATLLS
FT                   IDLSKSESPKRWVSVNTVDEKIEDEGDIVEDLIEVDVEILEILEDDEYVGKKIVERIWK
FT                   SNTL"
FT   gene            479888..480238
FT                   /locus_tag="Pisl_0515"
FT   CDS_pept        479888..480238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87693"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW1"
FT                   /protein_id="ABL87693.1"
FT                   /translation="MEVEYLIEKLGQYLGGIDIEKVRHSLRSKPVGAERILGIKIEESE
FT                   TTEAECLRIKGLIDLYKKEEMRLIALLRELKTMGIAPSDMEILKKKIRLVRKRIRIYRD
FT                   IMKKCQASLPEV"
FT   gene            complement(480686..482014)
FT                   /locus_tag="Pisl_0516"
FT   CDS_pept        complement(480686..482014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0516"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: pai:PAE3140 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87694"
FT                   /db_xref="GOA:A1RRW2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW2"
FT                   /protein_id="ABL87694.1"
FT                   /translation="MFYMPMTESKVKDLSLAERGREQLYWAERNMPVLLEIRKRFEKEK
FT                   PLAGQTIAACLHVTKETGVLVRTLIAGGARVVVIPSNPLSTQDDVAAALAQEGAYVYAW
FT                   RGMSERDYYNAIGFALSFYPTITLDDGADLTVTIHKLKHEARDKTIEYVLETAGSIDPD
FT                   KLVAGLRGGTEETTTGVLRLRALKRAGKLLYPIIAVNESYTKYLFDNRYGTGQSTWDGV
FT                   LRATNLLIAGKNVVIAGYGWVGRGIAMRARGLGARRVIVVEVDPVRALEAVFDGFEVMP
FT                   MDKAAEIGDIFITATGNIRAINLGHIFKMKDGAVLANAGHFNVEIDVAGLERVAISKKL
FT                   IRQYLEEYTLPNGKRVYLIGEGRLVNLVAAEGHPSEVMDLSFANQALAAEHIVKNKLAI
FT                   DVYKLPDELDREVARLKLKTMGIEIEELTEEQKQYLTSWELGT"
FT   gene            482050..482895
FT                   /locus_tag="Pisl_0517"
FT   CDS_pept        482050..482895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0517"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: KaiC domain protein; KEGG: pai:PAE3143
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87695"
FT                   /db_xref="GOA:A1RRW3"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR022475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW3"
FT                   /protein_id="ABL87695.1"
FT                   /translation="MVPRVRSYIPGLDEILYGGIPERSVVLLSGGPGTGKSILGKQFLY
FT                   NGLKRGEPGVFVALEEHPVAVRRSFRHFGWDISQYEREGKFAIIDAFTGGVGTAAQREK
FT                   YIVKQVDDVYELSDVLRQAIKDIGARRVVIDSVSTLYLTKPAVARATIMTLKRVIAGLG
FT                   CTAFFVSQVSVGERGFGGPGVEHAVDGIIRLDLDEIDGKLHRSIIVWKMRDTKHSMLRH
FT                   PMEIKDGGIEVMWDRYLKIVGNTVKIEPISKEEVEAMRKAVEEAEKQPAQRKVEIEVED
FT                   "
FT   gene            482900..483325
FT                   /locus_tag="Pisl_0518"
FT   CDS_pept        482900..483325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0518"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87696"
FT                   /db_xref="InterPro:IPR022285"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW4"
FT                   /protein_id="ABL87696.1"
FT                   /translation="MAEIPLKPTGREEIRKLESALLVMSLFDKETLEAIKDPATRVTWV
FT                   DSLYTAAAALARERAGIPTSKIAEELGVTEATVRRHLKGETRAGQLVKKVYDRLSKEGF
FT                   KVELPTELAEECTKQITELKDKIEKVKKALAEIQSWL"
FT   gene            483331..483996
FT                   /locus_tag="Pisl_0519"
FT   CDS_pept        483331..483996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0519"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="PFAM: B3/4 domain protein; KEGG: pai:PAE3145
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87697"
FT                   /db_xref="GOA:A1RRW5"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW5"
FT                   /protein_id="ABL87697.1"
FT                   /translation="MITILNEVKSLGVFVAYDVVYGVDNTRYTSQLEEEINRIVEEIRG
FT                   ALSLETLKDHHIIRAYRDFYWKTLKIDPTKQRPAQEALLRRVLRGESLPRINPVVDAGN
FT                   AISIKYIVPIGLYDISKIHGKTLRIRLSRKGEVFHPIGGQPHELDDQIVLASNDQILHV
FT                   YPYRDSVETKIDVSTKDVLIVVAGVPGVEEERLINATLHLRRLLSLLGGVADGDVRLA"
FT   gene            complement(483988..485289)
FT                   /locus_tag="Pisl_0520"
FT   CDS_pept        complement(483988..485289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87698"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW6"
FT                   /protein_id="ABL87698.1"
FT                   /translation="MRRVAIIGAAGRDFHVYHMVYRGSKDYKVVAFLMTQIPLPNRRYP
FT                   PSLSGIPEGIPIYTWRSYEELTRLLKELRVDEAVLAYSDLLYDEVGHIISAVLASGATF
FT                   KIHGPNDTYLNSIKPVIAVTATRTGAGKSTVSKEVVRELSAKGYRVAVVRHPMPYRDLE
FT                   ESIVEVFKRPEDLDKLTFEEREEFEQYVEIGVPVLAGVDYSAVLREAERLGDIILWDGG
FT                   NNDFPFFRPNYMIVVTDARRAGHEVNSFPGEVNLRLADAVIITKVSDASRENVEKVVSN
FT                   VRRVNPRASITKADLEVYVDKDITGKRVLIIEDAPTVTHGGLPYGAGYIAAVKYGAEVV
FT                   DPRPYAVGTIKKIYEEYNIGPVLPSLGYTLEQRRDLEAVIKHIDVDIVLVATPAKIERV
FT                   ISINKPIARVSWRLKIVEGPTVKDLVNAFLERLS"
FT   gene            485366..485965
FT                   /locus_tag="Pisl_0521"
FT   CDS_pept        485366..485965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87699"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW7"
FT                   /protein_id="ABL87699.1"
FT                   /translation="MIFFGDVHIGSRYSKIQELVKCLRATYVEEVVITGDLFENQYRRV
FT                   SYDEAIKLIRRAMGILQIQPRRLYISFSKSSHDPQLPGPLITKIGDTEVFAYNGEVFIE
FT                   GPQKIVVTHGDRAIRSGVLAYFIDLVRRGQLGRWLRRELALSDEVWLVYGHSHVPYVNE
FT                   QEKILNPGSWKIYGVRRIRGNIYQLPYPKPLCQPDL"
FT   gene            complement(485927..486409)
FT                   /locus_tag="Pisl_0522"
FT   CDS_pept        complement(485927..486409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87700"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW8"
FT                   /protein_id="ABL87700.1"
FT                   /translation="MILGEVPERYILHDFYTYLLFDVTNALGDVTVIPPPPGSSYQFAV
FT                   VGALIAKMGYRVRVLNMSTCRRRTISRILSHAVGELIYVGYAHKLAYAGPGAVINQEEA
FT                   TFENVRRIARGNVRFHVMWEKCLGGDLRQREVVDLGRLPEAITRLEIWLAERLGIR"
FT   gene            complement(486406..486954)
FT                   /locus_tag="Pisl_0523"
FT   CDS_pept        complement(486406..486954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0523"
FT                   /product="thiol:disulfide interchange protein, putative"
FT                   /note="KEGG: pai:PAE3152 thiol:disulphide interchange
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87701"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRW9"
FT                   /protein_id="ABL87701.1"
FT                   /translation="MSSPLKCFKQLFVFIAVFFRKSKLRLTPLTKTEVVKRLLDLAVVK
FT                   VGNSERVVLVFFDLKCPFCAKLFKETEELLVDMANRGLITYAMCDYVVHRDAEPLHRML
FT                   RCISEKERLKFVRDAFEGKRVEIGNCPEGNLRICEKMAEELGVIGTPTLLFYHLAKGKG
FT                   YIHFGYISPTEILEAISSL"
FT   gene            487027..487764
FT                   /locus_tag="Pisl_0524"
FT   CDS_pept        487027..487764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87702"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX0"
FT                   /protein_id="ABL87702.1"
FT                   /translation="MIKIVIHHTCKSSYVLYKALRGVPGITFEMVGTLYFPYLKRYVLS
FT                   VPAVFANGKLVLVDPVEPGDVIALKDGRTKKELDIEEAIENFVRGIMASQAILTAVMLY
FT                   KSLKPVLDPELVAVLSRARYHEQEDKIGQIVHKLQERGEELLQEHWESFIKLLTFGLVR
FT                   ELYWLGIDINELEISHIKMWLLAKATLGRLGLPYPKPSVPDDVATAVYATLKESGQRYM
FT                   DKIAEEQNIIATDREFLALIQEY"
FT   gene            487836..490370
FT                   /locus_tag="Pisl_0525"
FT   CDS_pept        487836..490370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0525"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="TIGRFAM: ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent; PFAM: ribonucleotide reductase
FT                   large subunit; Ribonucleotide reductase large subunit, N
FT                   terminal domain protein; KEGG: pai:PAE3155 ribonucleotide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87703"
FT                   /db_xref="GOA:A1RRX1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX1"
FT                   /protein_id="ABL87703.1"
FT                   /translation="MYTVVKLSGLLEPFSLEKLRLSIRQAASEVGVEVDGEVEININRD
FT                   VNSWELADLVQLELLKRAIDRPELAEVAKSHLLGRIYKEVFGKDFLKHKSGYLERALAR
FT                   YRQLAEAGLLKEESLRLLEAFEPRPDFDRSLSYNALRLFTNGNYALRGGDFRLAETPSM
FT                   AAWRVATAVARDVETARRYYDAITSLRIVPASPFWFNAWTKKEMFASCFTLEVEDCLSS
FT                   LSHPGRFCIYDALAYSGIIQQLGGGVGYDFSLLRPEGDVVRGSVGVASGPVSFMKLFDT
FT                   NVEVIKQGGKRRGAQMGTLHVWHPDVRKFIKAKTGELKDAHLQNFNISVFVDDAFMEKA
FT                   LGLDKDPKYPLVNPRIYLERTGRKPVEETRVSPPQEAVAGWVDARELFREIAEGAWDSG
FT                   DPGVIYKDNLNASNPLLGEEIEVAGHRFRYIWRAVNPCSETHQNPFEVCNLTHINLVKF
FT                   ARECAGKTFEEKLACIDWEGLAEAARLGTRFLDDAIDRSYTGIEVIDEMNRATRKNGLG
FT                   IMGFAELLIKLGIPYASWEAVELINRIMAWIYVNALDESAELARERGPFKFFEKSAYAR
FT                   GEIPVLKFQDYVWGRWERVKGAFPPELREAGDRLREITMRTREWLRPRLEALREKVKGG
FT                   VRNSVVLSIAPTGRTSILAGTTSGVEPVFALAFIRNVTVGTLIEYYWPAVEWLRARGLW
FT                   TPQVRKTVEETGMLKDAPLPEEVKHLFATAMEIGWLWHVLMQASAQQWVDQGISKTINM
FT                   PANAPKEDVYWAFALAWALGVKGITVYRDKSKSVQVIYTGLKQEIKKKLADTKIIVKPI
FT                   ALDSAIEEVAEKAKLKALEEGKDPYCKTGECG"
FT   gene            490417..490890
FT                   /locus_tag="Pisl_0526"
FT   CDS_pept        490417..490890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87704"
FT                   /db_xref="GOA:A1RRX2"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX2"
FT                   /protein_id="ABL87704.1"
FT                   /translation="MLDIISRSVRIGLVFVIFSVFYTLFNVWWAGVLDVFPLLVGVYLM
FT                   TLISVVPYIVINVVIALRNRGDGRWVITVGLSLTLLASLIAAIVKLSHLREVVVPFSIS
FT                   QLRFDSVLALSLVLLGLSALIYLNGIVPESKKLARILYFNLVEDNKEDDVETI"
FT   gene            490950..491216
FT                   /locus_tag="Pisl_0527"
FT   CDS_pept        490950..491216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87705"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX3"
FT                   /protein_id="ABL87705.1"
FT                   /translation="MESVLLIREFEKGPYELVEILRFEKGRRYIYRLLANDREYFVHIV
FT                   VLGNVMYIELWHPGYAIPLLIFRISRVEELTRVFTLLKSLTGG"
FT   gene            491248..492594
FT                   /locus_tag="Pisl_0528"
FT   CDS_pept        491248..492594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0528"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: pai:PAE3158 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase, class II (G,
FT                   H, P and S); seryl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87706"
FT                   /db_xref="GOA:A1RRX4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRX4"
FT                   /protein_id="ABL87706.1"
FT                   /translation="MSYSVLEALRNNPDYVKKVLTARRLDTSLVDKFLELDKKWRQLKK
FT                   EVDELRHVYNQLSKEGAKAPPERRREIVEKARELAAKLENLEKEVEKIEREREDLLWSF
FT                   PNLIHDSVPICPEGVDSIPVRYGGVVKVAKDAVGTLKDVEYVIVDKLPIGHADMAEVVL
FT                   GMVDTLKAGEVAGSRFYYLLDDLVWLDFALAMYAMDRLAQKGFRPIIPPYMLKFDVIKR
FT                   VLDFDTFRDAIYKIEGEDLYLIATAEHGIAAYLYKRELVEDELPLLFVGWSPCFRKEAG
FT                   AGSRDLKGIFRVHIFHKVEQFVFSLPEDSWRWHEEITKNTEELIKDLGLPYRVVNICAH
FT                   DLGAPAAKKYDIEVWYPAQSMYRELASCSNVTDWQSYRLGIRVTRKGMRREFVHTLNCT
FT                   GLATTRTITAILENFQREDGVVEIPKVLRPYLEPIKAAPKDYIYPKKRS"
FT   gene            492694..493200
FT                   /locus_tag="Pisl_0529"
FT   CDS_pept        492694..493200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0529"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87707"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX5"
FT                   /protein_id="ABL87707.1"
FT                   /translation="MSAHNVVVGIISEALVDLLKRMCECEKLKELHVKDFELAKVADEV
FT                   TKAISEGREGDFGPVVVRLQKKFLGRREIKVWLFGREIDVDSLLSEISKAKSRVSWLLN
FT                   DCSDQALIETLYKYEDRYLIEVVQRNFNEIRKVCSREVPKLVFGDVPTYVIEGVTRGIE
FT                   TYLSK"
FT   gene            493197..493850
FT                   /locus_tag="Pisl_0530"
FT   CDS_pept        493197..493850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0530"
FT                   /product="uridylate kinase, putative"
FT                   /note="TIGRFAM: uridylate kinase, putative; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: pai:PAE3159
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87708"
FT                   /db_xref="GOA:A1RRX6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRX6"
FT                   /protein_id="ABL87708.1"
FT                   /translation="MTLVIKLSGRVFEDEELIFKYARVIKAYSGKVGVVTGGGEIARRY
FT                   ISIAKRGGASYTFQDLLGIYASRLNALLFISLLEDACPIVPTNIEEFLDAWRRCRITVT
FT                   GGFQPGQSTATVAALVAEAVKAPVLLNAANIDAVYSEDPKINPNAKRLPVLTYDEFERI
FT                   LKSSVLPGGYELMDTWSISILKRNCITTYIFDGRKPEHIEAVMRGENPGSKITC"
FT   gene            493970..494383
FT                   /locus_tag="Pisl_0531"
FT   CDS_pept        493970..494383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0531"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   pai:PAE3162 HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87709"
FT                   /db_xref="GOA:A1RRX7"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX7"
FT                   /protein_id="ABL87709.1"
FT                   /translation="MDCIFCKIVRGEAPAWKVYEDGEFIVILDKYPASYGHLLVVSKEH
FT                   YTNVIDAPVEKVVKGFEIATKLAKAWAKLGAPGVNIVTNAGRDAGQMVYHLHIHVIPRW
FT                   GGKLTWHGREEIREEEAREVVEKLQRVLPEYFK"
FT   gene            494415..494876
FT                   /locus_tag="Pisl_0532"
FT   CDS_pept        494415..494876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0532"
FT                   /product="Bacterio-opsin activator, HTH domain protein"
FT                   /note="PFAM: Bacterio-opsin activator, HTH domain protein;
FT                   KEGG: pai:PAE3163 regulatory protein, LuxR family,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87710"
FT                   /db_xref="GOA:A1RRX8"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX8"
FT                   /protein_id="ABL87710.1"
FT                   /translation="MKLTATEKKVAELYSRGLRPREIAETLGISINTVYKALSKARKTL
FT                   EVVEPPANHYIFSFPIYTYSINISATPVSISSSGAFLVQNLHDMILKKLDEILALLSSE
FT                   RREPRTAQNNTTSNQTYVRLEGEGRNGNGHMPELLKKNIWISLLRNKAV"
FT   gene            complement(494877..496082)
FT                   /locus_tag="Pisl_0533"
FT   CDS_pept        complement(494877..496082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0533"
FT                   /product="GTP-binding conserved hypothetical protein
FT                   TIGR00650"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; TGS domain
FT                   protein; GTPase of unknown function-like; KEGG: pai:PAE3165
FT                   GTP binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87711"
FT                   /db_xref="GOA:A1RRX9"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRX9"
FT                   /protein_id="ABL87711.1"
FT                   /translation="MVTQARVQIGIVGKPNAGKSTFFAAATLKDVKISPIPFTTIDPNI
FT                   GIGYVRIETCPCTNIRCNPRSYIVLDGVCFAPVELIDVAGLVPGAWQGRGLGNQFLDHL
FT                   RRAPVLIHVVDASGSTDEEGRLVKPGSHDPVSDVYFLEREIDMWIASILRRDWDRVVRY
FT                   VEFSKRDITEVLLEKLAGLGMGRAHVEAALQDADLAKKSPSKWSDEDLVKFSHLVREYS
FT                   KPIVIAANKIDLPEGEEGYKKLRETLPNRIIVPTSAEAELALRRAAAKGLIKYKPGDQS
FT                   FEVVGQLTPQQKSALDKIAELLKKWGSTGVTKAINAAVFDAIKYVAIYPVEDERRLSDK
FT                   NGNVLPDLLLVPHTYTARDVAYAIHTELGERFIAAIDVKSGRKLAADETVFQGLIIKIL
FT                   AR"
FT   gene            496100..497323
FT                   /locus_tag="Pisl_0534"
FT   CDS_pept        496100..497323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87712"
FT                   /db_xref="GOA:A1RRY0"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY0"
FT                   /protein_id="ABL87712.1"
FT                   /translation="MFIKMRRAIVILITIALLLVNPVLGITTAFFYITRRYIITYAVLW
FT                   RRLLKCEIFTPLITSASLIASLLSPHAGIAKAIVISLGGIALYLAPTMPRLSRAISLFT
FT                   LGLSIETPFKLFTVLLFISIAFLVYKATSCGYICQKVATAPEGDLGYIPQLGLVCVFEK
FT                   DGNDMHTLLFRYNNWHVKCTYAICRAVDKESFYSEVGTLDRYLPEPVAEDFKGLIHIVA
FT                   PSQTALRIVGKYFKTAVVIGNIEASQRRLVSISKLKPDVVATVFRTVMGLSVEQSVLVR
FT                   ELLSRGSREELLTWSLRHPWLRPLYDLWDGGEEPIGIVKSIFPDQIGTFESLLYAYTKR
FT                   IPVLTDRADIANIAAELGILTFFITDSPRDNFIILGPVVVKRADRELKIEGGRYIVHLN
FT                   GALYADEL"
FT   sig_peptide     496100..496177
FT                   /locus_tag="Pisl_0534"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.798 at
FT                   residue 26"
FT   gene            497353..499329
FT                   /locus_tag="Pisl_0535"
FT   CDS_pept        497353..499329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0535"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE3169 conserved protein with 7 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87713"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY1"
FT                   /protein_id="ABL87713.1"
FT                   /translation="MLKKEEVKKVVRPEAPQYVKDVVEHPPFRVTTNTTLETLASYLRK
FT                   FPIDVVPVFKSIFSEDVAGVVYPHTSLLIKSKKLDAKIGDFLNPPIVVKESWKIENVAE
FT                   ILIAESKWGAVVVDEEGKYVGIVTLRGLLSALALKEPKAKSVAAIYTPLGEKKSRAGFV
FT                   KAIERVSKIFKKLVGGEVDGYVVLSRENGAVGILTIWDFVKSRRWYRGAGEPRPLFGTR
FT                   VTRGESKHTGVVRVWRIMFRGVAVATPETPVEEVAKYMATTGLYVVPVVDKDQRVIGAV
FT                   TVWDILHAYLYGPKEGREDIEVRKAIEIVVEKPTLETAIGIRPSKHVTGLRARDVMLTD
FT                   IPSVNIRDTLSRIRKVFLRSRSSIVAVLDDGGKIVGFITRRDFLTYIAEKSLGYWKRQK
FT                   GKMLILKEQVAPGETVRILVEEGTAGDIMKTNYPVVAPNTTVEEIAYKMLAAGTDYVVI
FT                   VGEDNTPIGVVTKDELIKAFKERGRKAKVGELMTPAEIATVNFFASLHSVIKKINAYEL
FT                   DGVVVTEGNDIKGVVSVDDLALRPIEETLRGEKIIFFTKSGVLRKVSTGLRRLRYSKVG
FT                   TLMAFDVMRPVSLNISINNDVGEIIDKLLENGVLPVFDEQGRLVGVLNKMDIVKDLARV
FT                   YITYAMPEKVAEVKEMEREIKQS"
FT   gene            499363..501579
FT                   /locus_tag="Pisl_0536"
FT   CDS_pept        499363..501579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0536"
FT                   /product="AAA family ATPase, CDC48 subfamily"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: pai:PAE3171 AAA family ATPase, possible cell
FT                   division control protein cdc48; TIGRFAM: AAA family ATPase,
FT                   CDC48 subfamily; PFAM: AAA ATPase VAT domain protein domain
FT                   protein; AAA ATPase, central domain protein; cell division
FT                   protein 48, CDC48, domain 2; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87714"
FT                   /db_xref="GOA:A1RRY2"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY2"
FT                   /protein_id="ABL87714.1"
FT                   /translation="MSSEITLKVAEARSRDVGRSIVRIPVRIMRKLGIEPGDYVEIVGR
FT                   KSAYAQVWPAYPEDEDKDVIRMDGIIRQNAGVGIGDTVKVRKAVLKSAQRVVLAPTEPV
FT                   RVDPEYLKKQILLGKPVARGQAIDVPFYGGAIRFVVVQVQPGPAAYVSIDTEVTVREEP
FT                   VKETELSIPRVTWEDIGDLEDAKQKIRELVELPLRHPELFKHLGIEPPKGILLIGPPGT
FT                   GKTLLAKAVANEANAYFVAINGPEIMSKYYGESEARLREIFEEAKKNAPAIIFIDEIDA
FT                   IAPKREEVTGEVEKRVVAQLLTLMDGLQERGQVIVIGATNRPDAIDPALRRPGRFDREI
FT                   HIPMPDKRARREILAVHTRNMPLCTKADVESGICAPGDEVDLDKIAEMTHGYTGADLAA
FT                   LAKEAAMAALRKAMNKGIINIEQDVIPQEVLNKLKVGMSDFLEAMKYVHPTVLREVIIE
FT                   VPEVHWDDIGGYDTIKQELREIVEWPMKYKHYFDELGVEPPKGILLFGPPGVGKTLFAK
FT                   AVATESGANFIAVRGPELLSKWVGESEKAIREIFKKARMAAPCVIFFDEIDSIAPARGS
FT                   RLGDSGVTDRMVNQLLAEMDGIGTLKNVVVMAATNRPDILDPALLRPGRFDRIIYVPPP
FT                   DLKARIEILKVHTRKIKLGDDVNLEELAKKTEGYTGADLAALVREAAMLALRETIKEKT
FT                   PKAKPVSWKHFEEALKRIPPSLTPEDIRRYEEMAKRIKRAVVGL"
FT   gene            501612..502133
FT                   /locus_tag="Pisl_0537"
FT   CDS_pept        501612..502133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0537"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; CS; KEGG:
FT                   pai:PAE3172 small heat shock protein, HSP20 homolog,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87715"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="InterPro:IPR040612"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY3"
FT                   /protein_id="ABL87715.1"
FT                   /translation="MSIFDEFEKFMRRWQKFFEEIERQIEEDFRRFSSQVGGGRPRYYY
FT                   YGFEITVGPDGRPVVREFGNVRRRPDVERIEVVDEIDPLTDIVEEDDKIKVVVDMPGVE
FT                   KEDIKLYISEDGKTLTIDARGKERKYHKEIRLPAAVDPNKAKATYKNGVLSVELEKVEK
FT                   KKRGFEIKID"
FT   gene            complement(502130..502579)
FT                   /locus_tag="Pisl_0538"
FT   CDS_pept        complement(502130..502579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3173 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87716"
FT                   /db_xref="InterPro:IPR017140"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY4"
FT                   /protein_id="ABL87716.1"
FT                   /translation="MAAWKLEENIQRDLEKAQENVELYGGHVVKAPNRYEIRTGVVVAA
FT                   RFADKLRRTAFAVFGGVLPREEIVRATSELNKKIYEKLISMGVGKLDIVRITVEAIIEG
FT                   GKLTFGEPKIEWFIPHSEVEKRVVECERRINEIKQKIETLLRELP"
FT   gene            502645..503733
FT                   /locus_tag="Pisl_0539"
FT   CDS_pept        502645..503733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0539"
FT                   /product="THUMP domain protein"
FT                   /note="PFAM: THUMP domain protein; KEGG: pai:PAE3175
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87717"
FT                   /db_xref="GOA:A1RRY5"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR025849"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY5"
FT                   /protein_id="ABL87717.1"
FT                   /translation="MDLIIKVRRGFEKVVASIIKELLGSAVEVTPAPQGYLGIVFVNGV
FT                   GAGKWEIAKMLVEKVPEADKVLVVEGVTKAELPEIERVAVEVAKRYIKSGDTFAIRTTR
FT                   RGVHSFTSIDVNVRVGAAVKEATDAEVDLEEPSKPLYIEIFQDIAAICIPATREYRKLR
FT                   RDKPLPLETFRKVAIGQFIYEGDEEAVRKMGERIGRAAQTFEVGELTILLYKQTSGKTL
FT                   RLFLEAVEEGIESRYQIQVKSYGRAVWKVPIYVYELYQYVRDRVGEPLVVTDPKGDYIT
FT                   HVKDKLAELFKAERVNFLIGSREGVPPGVFRFASLVVDLVPEVTIATDFVIPSLAVAIA
FT                   SALEEANALPKYVGKKRPRSSE"
FT   gene            503768..504187
FT                   /locus_tag="Pisl_0540"
FT   CDS_pept        503768..504187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0540"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pai:PAE3179
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87718"
FT                   /db_xref="GOA:A1RRY6"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019961"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRY6"
FT                   /protein_id="ABL87718.1"
FT                   /translation="MSATEQPQQQQQKLRWGIAWIYSSSNNTIITITDLTGAETVARVS
FT                   GGMVVRADKDKPSPWAAMQAAYKAAQLALARGINAVHIKVRGPGGYGMKVPGPGASAAI
FT                   RALARSGLIIGRIEDVTPIPHDTIRPPSGRKGRRV"
FT   gene            504187..504459
FT                   /locus_tag="Pisl_0541"
FT   CDS_pept        504187..504459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87719"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY7"
FT                   /protein_id="ABL87719.1"
FT                   /translation="MEKKDCLFTILDFCSNRNSRGVPNDLLKQARIKARKLIIVSKCGD
FT                   VREIFSAIRIIAGENMDFPMRHYHEVEIQEIAKLERCSTFEVLNL"
FT   gene            504558..505712
FT                   /locus_tag="Pisl_0542"
FT   CDS_pept        504558..505712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0542"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: pai:PAE3184
FT                   pyruvate formate-lyase activating enzyme homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87720"
FT                   /db_xref="GOA:A1RRY8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY8"
FT                   /protein_id="ABL87720.1"
FT                   /translation="MNALSYADQTFFIIKSGFAVEAVLSKKLSDGRIECLACARRCKLR
FT                   EGQTGFCGVRTVRDGVLRLDVYGLISAIAVDPIEKKPLTHFYPGALVLSFSTFGCNWAC
FT                   QYCQNYELSQRRRAEGFEVTPELLVKIAESYGAHGITYTYNEPSIFIEFAHDVGILARS
FT                   KGLFNTFVTNGYMTPEAVKYASEFLDAATVDFKGNADEKFLRRYVYITDAEPIFETLAE
FT                   MKKYGIWVEITDLVVPEVGDDLEKARKLVRRIIDILGPEVPIHFLRFHPDYNMRHLFPT
FT                   PIETLEKHVEVAKEEGAKYAYVGNVPGHRYEHTYCPECGRVVIKRRGFDILEINLIEKG
FT                   GEYRCKFCGAKINIKGRIMPTWREEFRFVYVPIHAFAKWVKRES"
FT   gene            505732..506391
FT                   /locus_tag="Pisl_0543"
FT   CDS_pept        505732..506391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0543"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   pai:PAE3187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87721"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRY9"
FT                   /protein_id="ABL87721.1"
FT                   /translation="MVQRLKKIFSSGLEDIRTKLKVHIGLSFESLRILQELISAKSIDK
FT                   SFVDEALRKVTALEREGDEIVRDLVDRVAQGAVVPTITNVVLILLDNVDNILDLIYFAI
FT                   KEIRRGYHLWSSDQIYTIIITEVKEMLDLIKTMLEYFQNMLNAKGDEDIRRYARLISSL
FT                   EEEIDEIKENILDKAYGLQLNAVEFNHLISLVYTADKIADNIQDAAYHLATISTSI"
FT   gene            506392..507168
FT                   /locus_tag="Pisl_0544"
FT   CDS_pept        506392..507168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87722"
FT                   /db_xref="GOA:A1RRZ0"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ0"
FT                   /protein_id="ABL87722.1"
FT                   /translation="MEDLEDIYTFLLALILIYNNSLVLLGPTAWGTGVGPRRSFIIAVA
FT                   GQLLGISTSHMSHIHVGTSEFLYIAALYTALSIAKISIPISIVGYAIYSLRPDAVILWL
FT                   TSPTVSLIVFPLCKLLKRSDIMILPSLFLLMYVFGYNNVALFSRNIPLATLAVVVGTYL
FT                   GLGFSRWVADLAALRPRTVVAINLATIIGAFIGISFNIPVSFTLVAYSAMLVASLSSSI
FT                   RLIKIEKFVRAYVGIIIALIAAAIFPALKSLLLSLV"
FT   gene            complement(507125..507796)
FT                   /locus_tag="Pisl_0545"
FT   CDS_pept        complement(507125..507796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87723"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ1"
FT                   /protein_id="ABL87723.1"
FT                   /translation="MPYRFKNLTIYWLGHDAFRIVGEGAVLYIDPYQIQLGEPKADIVL
FT                   ITHEHFDHCDPPSIQRLKKPSTIVVAPKIARQCVGKVVTDIVEVTPGETKSIENIQVTT
FT                   YPAYNINKYRDIARGVVFHPKQDGRVAYLIKWGDVSIFHAGDSDFIPEFRDIKTDVALV
FT                   PVSGVYVMTPSEAAEFVNTIEPKVAIPMHYGAIVGSRREAEEFKRLVKPGIEVVILERE
FT                   I"
FT   gene            complement(507835..508008)
FT                   /locus_tag="Pisl_0546"
FT   CDS_pept        complement(507835..508008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0546"
FT                   /product="paREP4"
FT                   /note="KEGG: pai:PAE3289 paREP4"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87724"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRT6"
FT                   /protein_id="ABL87724.1"
FT                   /translation="MSKKQKLKFYDIKAKQAFETDQYEVVEKQTARGPMLFAVAKSPYT
FT                   GIKVYRLIGKKK"
FT   gene            508260..508589
FT                   /locus_tag="Pisl_0547"
FT   CDS_pept        508260..508589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3290 conserved within P.aerophilum"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87725"
FT                   /db_xref="GOA:A1RRZ3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ3"
FT                   /protein_id="ABL87725.1"
FT                   /translation="MVYRKVVAILGVGGVGKTIFAYRILKISDTPVLTLRPSYYRIYLG
FT                   DLEVDLVDVPGQRVFDVAMKFASFKIPVIDRLIYMYDVTNYESLFAISELHTLFIERGS
FT                   QVAKG"
FT   gene            complement(508830..509354)
FT                   /locus_tag="Pisl_0548"
FT   CDS_pept        complement(508830..509354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0548"
FT                   /product="protein of unknown function DUF265"
FT                   /note="PFAM: protein of unknown function DUF265; KEGG:
FT                   pai:PAE3292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87726"
FT                   /db_xref="GOA:A1RRZ4"
FT                   /db_xref="InterPro:IPR004948"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRZ4"
FT                   /protein_id="ABL87726.1"
FT                   /translation="MTLRERAELKLGISGMPGVGKTTLVTKVLEVAKSKFAICGFITVE
FT                   VRDGGKRIGFDIIDVNSGERKPFAREGIGMPSVGKYVINLGTCTLISKALRHKPCNLAI
FT                   VDEIGAMEFKCPNFTTDLEEVVSNTPRILATIHRNYIGIAKRLGFEVIWLTRENWEMTY
FT                   KQVLKRLGLSI"
FT   gene            complement(509398..510186)
FT                   /locus_tag="Pisl_0549"
FT   CDS_pept        complement(509398..510186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0549"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: pai:PAE3294
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87727"
FT                   /db_xref="GOA:A1RRZ5"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ5"
FT                   /protein_id="ABL87727.1"
FT                   /translation="MSLPREILTALEQVRELLQNVGKSVEPRSLRDVIRYYIETPGKLL
FT                   RPILLLTFSYSLDRKSIFETKIIQAAAIVELLHIVSLLQDDVMDKHDERRGVKTPRALY
FT                   GDGRSIVASDWIIAESIKRALQLGPEVVEYLADVAQRLSIGQALDLDGEYKKAAEFKTA
FT                   PLIEATLVLPIILLGRRELFDTATKLGRLLGILYQYSDDYSDEKREKDDMVNIAIEIKK
FT                   MLMKLKSTLGETFTPFERLIKGIIEKALEGTLTPSRSFIS"
FT   gene            complement(510233..510421)
FT                   /locus_tag="Pisl_0550"
FT   CDS_pept        complement(510233..510421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87728"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ6"
FT                   /protein_id="ABL87728.1"
FT                   /translation="MPSGVKAKIYEYLSQNKGKEFTAEEIAKVLGVEKVAIVRAQLTRL
FT                   VREGKVEKTAEGRYRAK"
FT   gene            510483..510956
FT                   /locus_tag="Pisl_0551"
FT   CDS_pept        510483..510956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0551"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.78"
FT                   /note="PFAM: 6,7-dimethyl-8-ribityllumazine synthase; KEGG:
FT                   pai:PAE3296 riboflavin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87729"
FT                   /db_xref="GOA:A1RRZ7"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ7"
FT                   /protein_id="ABL87729.1"
FT                   /translation="MVLYRSYMVKLALVVAEFNYDITQLMLQKALEHAKFLGAEVTYVV
FT                   KVPGVFDIPMVLKELASKNDVDAIATLGAVIQGATKHDEIVATQAARKILDIAVEVDKP
FT                   ITLGIIGHGANRIQALERVEEYARRAVEAAVKLARRKRALKEAKYTGSTVYID"
FT   gene            complement(510966..511961)
FT                   /locus_tag="Pisl_0552"
FT   CDS_pept        complement(510966..511961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0552"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: pai:PAE3298 acetohydroxy acid
FT                   isomeroreductase; TIGRFAM: ketol-acid reductoisomerase;
FT                   PFAM: acetohydroxy acid isomeroreductase; Acetohydroxy acid
FT                   isomeroreductase, catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87730"
FT                   /db_xref="GOA:A1RRZ8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RRZ8"
FT                   /protein_id="ABL87730.1"
FT                   /translation="MAKIYTDKDASLEPLKGKTIAVIGYGIQGRAQALNLRDSGLKVII
FT                   GLRKGGNSWNLAVSEGFEVYEVSDAVAQADVIMVLIPDMEQPKVWQNQIAPFLKEGAVV
FT                   DFAHGFNIHYGLIKPPKNVDVIMVAPKAPGKAVREEFLAGRGVPALVAVHQDYSGAALK
FT                   YALAIAKGIGATRAGVIETTFAEETETDLIGEQIVLVGGLMELIKKGFEVLVEMGYQPE
FT                   VAYFEVLNEAKLIMDLIWQRGIYGMLNGVSDTAKYGGLTVGPKIIDEEVKKKMRIFALR
FT                   VKSGEFAKEWVEEYARGGLTLKKLMESARTHPIEIVGAEMRKLLFGRQQE"
FT   gene            complement(511974..512204)
FT                   /locus_tag="Pisl_0553"
FT   CDS_pept        complement(511974..512204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0553"
FT                   /product="acetolactate synthase small subunit"
FT                   /note="KEGG: pai:PAE3299 acetolactate synthase small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87731"
FT                   /db_xref="UniProtKB/TrEMBL:A1RRZ9"
FT                   /protein_id="ABL87731.1"
FT                   /translation="MSNINIIVPKSLDALGRVIAITRRAKVQLINMSVTLEDSMYKIYM
FT                   RVEGPPDEVRWLVAKLDKLPEVLKIEEYINS"
FT   gene            complement(512197..513840)
FT                   /locus_tag="Pisl_0554"
FT   CDS_pept        complement(512197..513840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0554"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein; KEGG: pai:PAE3300 acetolactate synthase
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87732"
FT                   /db_xref="GOA:A1RS00"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS00"
FT                   /protein_id="ABL87732.1"
FT                   /translation="MTLYDALYDQEIEPILFRHEQGAMHAAEGYARVSGKPAVVAVTSG
FT                   PGATNVVTGLTNAYMDSTPLVVITGQVATNIFGRDGFQETDILGVVTPITKFVYQVRKP
FT                   SEASSAFKTAYEISILGRPGPTLIDLPRDIQIAPAPDYEDKIVVNREKFIPPPPDVDKT
FT                   RLAAKYLSEAERPVILVGGGVLWSGATPEVLELAKTLYAPIVSTLPGKAAIPHDFPLYM
FT                   GPAGMHGRAEADAALANADVILAVGTRFSDRTWGRFKELIEYVKSGRIKLIHIDIDKSE
FT                   IGKNVKPTIGIVGDAKETLRLLLDYIHVSSFRNQKFIDWLLEIRKKYEETMAKISASTP
FT                   AFHPWKALKILRAAAPRDTITVTGVGSHQMWAEIVWDVYEPGTFITSAGLGTMGFCVPA
FT                   ALGAKLAARERPVLCIDGDGSFQMTMNNLALVRDYNLPIVVVIFDNRALQLVKQWQIYL
FT                   YQRRIIATEFSKRPDFLKIAEAYDIDAIRPESYEQLEKAVAKALRNNEPLIVDLTIDSE
FT                   YDIVLPWVKPGDWLTSAILPPGMDVKLTYE"
FT   gene            complement(513984..514433)
FT                   /locus_tag="Pisl_0555"
FT   CDS_pept        complement(513984..514433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0555"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: pai:PAE3301 MutT/NUDIX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87733"
FT                   /db_xref="GOA:A1RS01"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS01"
FT                   /protein_id="ABL87733.1"
FT                   /translation="MVKKCVVASGVLIRDDRVLMVKHRRLGVYLYPGGHVEEGETPIET
FT                   LVREFEEETGLVVEPIGYVHGIKDDNVVERPLPFVILEEVVQYPEEVHIHFDLIYLVRE
FT                   VGGVLRSGMWIDISDIDSIETYPNVRNVIKLATRAINTLYRGKNV"
FT   gene            514478..514978
FT                   /locus_tag="Pisl_0556"
FT   CDS_pept        514478..514978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87734"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS02"
FT                   /protein_id="ABL87734.1"
FT                   /translation="MFSKIKLGIEEWRRLETDLMRISSGEPLEIIINLTLVATEEGEEY
FT                   EEDEEEYHHHTFEENEFTKEVAKLMDHIAQTYGVHIHPHLHSNHGSVMFAVKGAPKDLI
FT                   KTLRDTVEYIKLNCEKCILHTLDGEFHIGEDLAAIYFGDAYKVTFILPAEDGRRLKIHE
FT                   IHL"
FT   gene            complement(514952..515224)
FT                   /locus_tag="Pisl_0557"
FT   CDS_pept        complement(514952..515224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87735"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS03"
FT                   /protein_id="ABL87735.1"
FT                   /translation="MPVVRGPSLLAKILGCPTQCDCDVVIHVNDLDKIKERKCVWSVED
FT                   SSFIHRHIWIGGYPHISLEDMEKIKEREVLDVINCIKLKMNFVDF"
FT   gene            complement(515429..516721)
FT                   /locus_tag="Pisl_0558"
FT   CDS_pept        complement(515429..516721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0558"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: pai:PAE3309
FT                   putative mRNA 3-end processing factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87736"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS04"
FT                   /protein_id="ABL87736.1"
FT                   /translation="MKIRFLGGAGEVGRLAVFLKTASNGILLDYGVSFDAQGRPVFPLH
FT                   IRPRDLTAVFLSHAHLDHSGGLPLLYISSRTPIYSTSLTMELSDLMYTDAIKLSGYYLP
FT                   YTQEEVRETMASAIPLIYGEPVEIGRDAVLTIYNAGHIPGSAIGVVEVEGWVVVFTGDF
FT                   NTVDTNLLRGADVYNLPKNPDVIIMEATYASTDHPPREKLERDFIQAVRETLEGGGSVL
FT                   IPSFALGRAQEILLTLVKHGVDKYPIYIDGLARQINQIIARYPHLLRDPGLYKKALEVA
FT                   IEVPSAYVRKGALEEHSVIIAPAGMLKGGAALYYFKKMAQNKKNGIFLPSFQAPNTPGF
FT                   EILSKGYAVVDGTIIKVDARLEWFDFSAHAGRRELEHFIKRFSRDTKIILVHTDPLSAS
FT                   VLIRRLINEGYDNIYLPTAPGEEVRISSLKE"
FT   gene            516932..517303
FT                   /locus_tag="Pisl_0559"
FT   CDS_pept        516932..517303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0559"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="KEGG: pai:PAE3312 ribosomal protein L24; TIGRFAM:
FT                   ribosomal protein L24; PFAM: KOW domain protein; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87737"
FT                   /db_xref="GOA:A1RS05"
FT                   /db_xref="InterPro:IPR005756"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS05"
FT                   /protein_id="ABL87737.1"
FT                   /translation="MPFTTSIQPRRQRLSLYTAPLHLRHKLFNAKLSPDLQKKLGVKRL
FT                   PVRRGDTVMIMRGDFKGVTGKVVKVDLKKVRIYVEGATRTNSKGQTVYYPIHPSKVMII
FT                   DIDTSDKIRQKIIQRRKKE"
FT   gene            517306..518022
FT                   /locus_tag="Pisl_0560"
FT   CDS_pept        517306..518022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0560"
FT                   /product="SSU ribosomal protein S4E"
FT                   /note="PFAM: RNA-binding S4 domain protein; Ribosomal
FT                   protein S4E-like; Ribosomal protein S4E, central; KEGG:
FT                   pai:PAE3313 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87738"
FT                   /db_xref="GOA:A1RS06"
FT                   /db_xref="InterPro:IPR000876"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR013843"
FT                   /db_xref="InterPro:IPR013845"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR038237"
FT                   /db_xref="InterPro:IPR041982"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS06"
FT                   /protein_id="ABL87738.1"
FT                   /translation="MVHLRRTTAPYWWPIPRKIGGVWVVRSSPGPHSLAYSLPLAIIIR
FT                   DVLKYAKTMREARYIISRGYVKIDGVIRKDYKFPVGLMDVVEIVPTGEIYRVVPDEKKY
FT                   YALIPISSEEATLKLLRVEGKTAVKGGKLQLHFHDGRNLIVSQDVGRHIKTFDTVLYDL
FT                   QNKNIKMHIPFKLGAYAVVTRGGNVGFSGKLYEIVWTLKRRQSVVALKRNEEVRRTILD
FT                   YIMITGSEAPVIKISP"
FT   gene            complement(518019..518447)
FT                   /locus_tag="Pisl_0561"
FT   CDS_pept        complement(518019..518447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87739"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS07"
FT                   /protein_id="ABL87739.1"
FT                   /translation="MRIERTGQPVSKLLQLLEEDLKREDIIYLERVPSPKANERYRDVV
FT                   SRFFTEFGIATVYIKVRGSTFERRYVINAKYDWAVGGVVEGWVVEGDVVRVYEPIAISL
FT                   SDIGKALDYYGDAYWKAEERILSKKMAEVYTEEKPPAD"
FT   gene            complement(518471..519442)
FT                   /locus_tag="Pisl_0562"
FT   CDS_pept        complement(518471..519442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0562"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: pai:PAE3316 oligopeptide transport ATP-binding
FT                   protein, putative; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87740"
FT                   /db_xref="GOA:A1RS08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS08"
FT                   /protein_id="ABL87740.1"
FT                   /translation="MSLLEVKELKTWFPVKRGLFSPVRYVKAVDGVSFSMEKGEVLAVI
FT                   GESGSGKTTLGRTILRLIKPTSGRIVFEGKDVTYLPESELRWYRFSTAMVFQDPFSSLN
FT                   PYHTVQYILEEPLILRGVDPKERYEFVIKALEEVKLVPPEDFLRKYPHMLSGGQRQRVG
FT                   IARALITRPKFIVADEPVSMLDVSIRAEILSLMRSLQTKYGITMMYITHDIATAKYLSD
FT                   KILVMYAGKVVEYGRFRDVIKEPLHPYTQALIEALPDPDPSNRFKVRKVPPGEPPSLLN
FT                   PPSGCRFHPRCPYAIKGKCDKEEPKLIEVKSGHYVACWLYNK"
FT   gene            complement(519444..520412)
FT                   /locus_tag="Pisl_0563"
FT   CDS_pept        complement(519444..520412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0563"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: pai:PAE3317 oligopeptide transport ATP-binding
FT                   protein, putative; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87741"
FT                   /db_xref="GOA:A1RS09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS09"
FT                   /protein_id="ABL87741.1"
FT                   /translation="MPPLLELRNVKMYYSTSRGVVRAVDGISFRLNKGEAMALVGESGS
FT                   GKSSLAFTIIRLLPRNVAEIGGEIFFYDDELGTIDLMKMSEEEIRRKIRWKKISMVFQA
FT                   SMNALNPVLRVRDQMIEPLVLHLGLSEDEALKISEEALRSVGLTKDVLMRYPFELSGGM
FT                   KQRVVIAMAIMMKPKLIILDEPTSALDVITQANIMNLLKELKTKYNLSYILITHDIALA
FT                   SEIADKIGVMYAGKLVELAPADVFFYKPKHPYSQKLLAAVPTLREEKTIEYIPGDVPSL
FT                   ITPPSGCRFHPRCPYAIKGKCDKEEPVMKHIEESEVACWLY"
FT   gene            520461..521231
FT                   /locus_tag="Pisl_0564"
FT   CDS_pept        520461..521231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0564"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: pai:PAE3318 kinase,
FT                   conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87742"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS10"
FT                   /protein_id="ABL87742.1"
FT                   /translation="MEVTIVGNPTIDIIYTNKGIFKRYGGPTYYASLALAALYNNVRVL
FT                   GVVSSEVAMELRKIFQEMGVKADLIEADVTTTFELDYRTKPRNVRLVKKPSRGIERVEG
FT                   DIVILSPVYDELRDAEIRARIVVADLQGYLRAKIPLPDANLVHFSYDDIQMSMKELLNF
FT                   AKRWLYVVYTLGEEGSYVVMGSKLYYINSARLNVEDVTGSGDVFLAVLTLYHYIRGMDL
FT                   LASVCEASKYTAGFLITRRVQRYEYDCTIQVVQE"
FT   gene            complement(521209..522069)
FT                   /locus_tag="Pisl_0565"
FT   CDS_pept        complement(521209..522069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0565"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function UPF0074; Protein of unknown function
FT                   DUF293; Helix-turn-helix, type 11 domain protein; KEGG:
FT                   pai:PAE3319 conserved protein with 2 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87743"
FT                   /db_xref="GOA:A1RS11"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005104"
FT                   /db_xref="InterPro:IPR016436"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS11"
FT                   /protein_id="ABL87743.1"
FT                   /translation="MVNFSDSVYSVLKVLVELYNKGNTPVKSKDIASALGIHEGYVRNM
FT                   LSILKSMGLVISKAGPHGGYIPTSKATDMLSRQTFSVPIVSLSNVIGYALDVTLIGLLS
FT                   DKPLASMRVIGDLTEYIEREVRIGPLPNGLVLIGKIIKADIEALVEITSIVSIPRTSVK
FT                   NIMTPNPVVAKPDDTIAPYVKLFIEKRYRGIPVVDENGKPIGLLMASKLMETLSLCKLD
FT                   AKVKDVMVKDPPTIYEDEDIHEAIRLMVAGGIGRLLVVDSEDRLVGIITRTDILRRIAT
FT                   LEQLV"
FT   gene            522229..523152
FT                   /locus_tag="Pisl_0566"
FT   CDS_pept        522229..523152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0566"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: pai:PAE3320
FT                   D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87744"
FT                   /db_xref="GOA:A1RS12"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS12"
FT                   /protein_id="ABL87744.1"
FT                   /translation="MLALIVDNVDLLIKERLEKIGIKVDIKPGISREQLLNIIGDYDIL
FT                   IFRGRLRIDREIIDAGTNLKILARYGVGLDNVDVEYAVKRGIAVVSAPRAPTQSVAELT
FT                   IGLMLAVARRIPLLNAKVKEGEWPKGKYIGIELSGKTLGVLGFGRIGRAVAQIAKGLGM
FT                   KILASDIVDVSSDVEKLGGRQVSLQELLKESDVLSIHVPLTPDTYRLINADRLALVKDN
FT                   AILINTSRGEVVDHEALLQHIDRLWGVGLDVLPEEPPKSPYLRKLITHEKVVITPHVGS
FT                   ETYEAMRRLAEELVLNIEEVVSRIRL"
FT   gene            523149..524159
FT                   /locus_tag="Pisl_0567"
FT   CDS_pept        523149..524159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0567"
FT                   /product="phosphoserine aminotransferase apoenzyme /
FT                   L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class V; aminotransferase,
FT                   class I and II; KEGG: pai:PAE3321 aminotransferase (class
FT                   5)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87745"
FT                   /db_xref="GOA:A1RS13"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS13"
FT                   /protein_id="ABL87745.1"
FT                   /translation="MKYLTPGPVQLPKFVIDAMAKQPPFHRDSEFKKLFKSVLDKLHSL
FT                   YPTRAVVMPGTGTLAVDTMIYNYVNPGDKILALVYGEFGKRAVETAKIRGANVVEIEQD
FT                   KPPAPDEVEDILRRDREIRALLLIHNETSTGIAYKQLKKLIDITKSYNVLLLVDSVSGF
FT                   PAEPLPQDIDVVATASHKALLAPPGASILYLSTEPKAETGVPPSMNLRKFIKMLDNLET
FT                   PYTPPISILFALDVSLSYILELGPKYVDIHRERVEYLYSALKLRPIPPAGLRSFTVTAF
FT                   YCEKPKEIIAKLKEAGYVISGGMYKYREKSIRIGVMGDITMEDLRRVVDIINRVD"
FT   gene            524149..524943
FT                   /locus_tag="Pisl_0568"
FT   CDS_pept        524149..524943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0568"
FT                   /product="protein of unknown function DUF89"
FT                   /note="PFAM: protein of unknown function DUF89; KEGG:
FT                   pai:PAE3323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87746"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR014444"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS14"
FT                   /protein_id="ABL87746.1"
FT                   /translation="MWIDEVNCKLCIISSRTSDLVRLNRPEKLPEILSELSRLLQKSSR
FT                   SEAFSESFRSVAKLVGVEDPYREYKERLATIGKKVAEIVRHKLQQTSWDLKTALRIAAA
FT                   ANIVDTSVLGYRPKKLEEAIWDLPAIEEYVELPSELYYVLDNAGEAQIDFVVAEALERN
FT                   GIKPIFVVRSEPYEIDMTESDLAGYRVIATPGNISPIRWIRDRFIIAKGIANFEAYIEW
FT                   GEVPALLLFRAKCDVLSRVFSVPRNSPIIISGEKAKAISLAQ"
FT   gene            complement(524927..525367)
FT                   /locus_tag="Pisl_0569"
FT   CDS_pept        complement(524927..525367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0569"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87747"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS15"
FT                   /protein_id="ABL87747.1"
FT                   /translation="MAIGIWYMDVYTVKTYSDANQFLSELDQKVRELEELVKALSTELE
FT                   NLKPSLERYKRLQELLRKFSTGSSEKSPPLEITGLQLYIDPNPMTRYEILEESYRHMVD
FT                   LLSVLKKVREVAQSIIREGGLESLKITIQYKNGVPVKLIVLG"
FT   gene            complement(525383..526639)
FT                   /locus_tag="Pisl_0570"
FT   CDS_pept        complement(525383..526639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0570"
FT                   /product="tRNA adenylyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: pai:PAE3325 tRNA nucleotidyltransferase (CCA-adding
FT                   enzyme)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87748"
FT                   /db_xref="GOA:A1RS16"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS16"
FT                   /protein_id="ABL87748.1"
FT                   /translation="MSTLEEVLREAYKLVTPSEEEERELKKVTEKVKALIADAINKYGI
FT                   EAEIGVYGSSARSTWLPGQRDIDIFIVLTNRNINIKDVITLLSRYFSERGVTWSMRYAQ
FT                   HPYLSLLVDGYEVDVVPCYKISFGERPITAADRTPLHHKFLVEKLSEEQRRDVRLLKLF
FT                   MKTIGVYGAEIKVEGFSGYLTELLVAYYGSFIDVLKAASRWRPYRTYITFSESRAKFKA
FT                   PLVVVDPVDPERNVAAAVSLTSMSTFILASRRFLKNPSITYFQQRQGAVIKTNVVEVVF
FT                   PYPNEPPDIVWGRYKRIGRSVFNWLKQCGFRVYRWGVESDEKSYVSLIYVVEQIELPPY
FT                   MLHRGPPVYDGAVDAFVEKYLDKDIIGPFVQGSRVYVIKRRRYTNISDCLKTYLGKGDY
FT                   TIRINLYEGALVRKNAWIT"
FT   gene            complement(526636..527199)
FT                   /locus_tag="Pisl_0571"
FT   CDS_pept        complement(526636..527199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0571"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase;
FT                   KEGG: pai:PAE3326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87749"
FT                   /db_xref="GOA:A1RS17"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS17"
FT                   /protein_id="ABL87749.1"
FT                   /translation="MTLVRAFVAIDVENPEIVKKVEEIQREVLRLGLDIKLVEKENLHL
FT                   TLRFLGEIPQSRVNDIVKSLTTIRFSKFKIALSGLGVFPDLAKPRVLWIGVSKGLENLV
FT                   NLANIVRNLVDKYAEHREDREFSPHLTIGRIKSGRNIDKLREVIERYREAEFGVIEVDK
FT                   VKLKKSVLTPRGPIYSDLFVQYLT"
FT   gene            complement(527196..527636)
FT                   /locus_tag="Pisl_0572"
FT   CDS_pept        complement(527196..527636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0572"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pai:PAE3327
FT                   DNA binding transcriptional repressor, conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87750"
FT                   /db_xref="GOA:A1RS18"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS18"
FT                   /protein_id="ABL87750.1"
FT                   /translation="MATQEFAEESDVLTEVEIQILQGLERLGGSYQQRNLWKYIGIDSK
FT                   TGLPILARLEKRGLIARERVGGNKRGVYIVRLTEKAYRLLSKIHEETVEAFIVDFDALP
FT                   NELRTLLSIPCVYCPYSDRCGVSFITPLTCNLLTKWLHNLRS"
FT   gene            complement(527673..528569)
FT                   /locus_tag="Pisl_0573"
FT   CDS_pept        complement(527673..528569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0573"
FT                   /product="Transcription initiation factor IIB (TFIIB)"
FT                   /note="PFAM: Zinc finger, TFIIB-type domain protein;
FT                   Transcription factor TFIIB, cyclin-related; SMART: Cyclin;
FT                   KEGG: pai:PAE3329 transcription initiation factor IIB
FT                   (TFIIB)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87751"
FT                   /db_xref="GOA:A1RS19"
FT                   /db_xref="InterPro:IPR000812"
FT                   /db_xref="InterPro:IPR013137"
FT                   /db_xref="InterPro:IPR013150"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS19"
FT                   /protein_id="ABL87751.1"
FT                   /translation="MTRKLIFEVEEHRCPVCGAVNDVVVDYERGQVICKNCGTVLREGV
FT                   ADLGPEWRKPESSRAYSGPIGSSMGDIEFGNVKIADKLKALSLKKFARPISTPLERIEV
FT                   DIREFLEAAKQKLNIPKAVIEDTVMLYKKLYDAGYRAPRLEGYAAALYFTLKKHGVAAI
FT                   TLRSLAENLGINRSSFISAYMELMRVANKLGIKPPRIDPKIYIPRIVSALGIGDEKSAE
FT                   VQRIAVDILRYILSSPRIRNGRKPQVLAASAVYYACYIAGVEVTQKELAKATDTTEGPI
FT                   RDLLKELSEILYIEVTV"
FT   gene            complement(528566..528811)
FT                   /locus_tag="Pisl_0574"
FT   CDS_pept        complement(528566..528811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0574"
FT                   /product="snoRNP protein GAR1"
FT                   /note="KEGG: pai:PAE3330 hypothetical protein; involved in
FT                   rRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87752"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR038664"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS20"
FT                   /protein_id="ABL87752.1"
FT                   /translation="MKRIGTALHYSRLGNLVVKLNEVPPIYINIYTYTMKKVGILYDVI
FT                   GNIKNPYGLVKPYVRDESLIGQPLYVKLQDLEKRRK"
FT   gene            529357..529752
FT                   /locus_tag="Pisl_0575"
FT   CDS_pept        529357..529752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0575"
FT                   /product="SSU ribosomal protein S8E"
FT                   /note="TIGRFAM: ribosomal protein S8e; PFAM: ribosomal
FT                   protein S8E; KEGG: pai:PAE3331 ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87753"
FT                   /db_xref="GOA:A1RS21"
FT                   /db_xref="InterPro:IPR001047"
FT                   /db_xref="InterPro:IPR020919"
FT                   /db_xref="InterPro:IPR022309"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS21"
FT                   /protein_id="ABL87753.1"
FT                   /translation="MKLAAFYKGRDLKKPSGGKKGRVRKTKKKALCGGPPQIPKLGERD
FT                   LRLVERVTGGNLKVRVREVRYANVYIPKERRHVKAKILSILSTPANPDFARRNLIVKGA
FT                   VIQTEVGRAVVTSRPGQDGVINAVLIE"
FT   gene            529749..530036
FT                   /locus_tag="Pisl_0576"
FT   CDS_pept        529749..530036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0576"
FT                   /product="signal recognition particle, subunit SRP19
FT                   (srp19)"
FT                   /note="PFAM: Ribonucleoprotein complex SRP, Srp19
FT                   component; KEGG: pai:PAE3332 signal recognition particle,
FT                   subunit SRP19"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87754"
FT                   /db_xref="GOA:A1RS22"
FT                   /db_xref="InterPro:IPR002778"
FT                   /db_xref="InterPro:IPR022938"
FT                   /db_xref="InterPro:IPR036521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS22"
FT                   /protein_id="ABL87754.1"
FT                   /translation="MKKRGGRILWLVYLDSSVPRSRGRILPRSKAVSKPTLQEVIQALE
FT                   RLGYRYQVYQDKKYPALWFEERQGYIVVETSEKLRILALKVAEEVRKLRR"
FT   gene            530036..530785
FT                   /locus_tag="Pisl_0577"
FT   CDS_pept        530036..530785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0577"
FT                   /product="protein of unknown function, ATP binding protein"
FT                   /note="PFAM: protein of unknown function, ATP binding;
FT                   KEGG: pai:PAE3333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87755"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS23"
FT                   /protein_id="ABL87755.1"
FT                   /translation="MYTVFFVGTAGSGKSTLVSTLSTWMEDQGFDVGIVNLDPAVEYLP
FT                   YVPDIDIRDRISARKIMKQFKLGPNASIIAAVDMIVTEAERIKEEMEIIGAPIYLIDTP
FT                   GQMELFAFRQSGAYLVQKLSDVHTLVVYVADAVYAQSVDGFAVTMLLALSTRIRFKKPQ
FT                   ILVINKSDLLSEDVRINILNWVEDPTTLLESIDLPPYEKEILRSVANMGGFIEPLFVSA
FT                   KTSEGIDKLYYQLQLHYTGGEDVQLPP"
FT   gene            complement(530770..531072)
FT                   /locus_tag="Pisl_0578"
FT   CDS_pept        complement(530770..531072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0578"
FT                   /product="LSU ribosomal protein L21E"
FT                   /note="PFAM: ribosomal protein L21e; KEGG: pai:PAE3334
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87756"
FT                   /db_xref="GOA:A1RS24"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS24"
FT                   /protein_id="ABL87756.1"
FT                   /translation="MVKRTHGYRYKSRKLLRKKPRERGLSGLSRLLYEYKPGDRVVIDI
FT                   DPTFVENAPHRRYQGKVGVVIGTRGRAYVIETYLGDKKKILVVTPEHLKPHQGGS"
FT   gene            531151..531486
FT                   /locus_tag="Pisl_0579"
FT   CDS_pept        531151..531486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0579"
FT                   /product="DNA-directed RNA polymerase, subunit F"
FT                   /EC_number="2.7.7.6"
FT                   /note="PFAM: RNA polymerase Rpb4; KEGG: pai:PAE3335
FT                   DNA-directed RNA polymerase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87757"
FT                   /db_xref="GOA:A1RS25"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR038324"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS25"
FT                   /protein_id="ABL87757.1"
FT                   /translation="MSIKKIRKSEEITNAKALEILRTLSTTTQLSEDQRKTLDYLEKVT
FT                   KRKPDEAESIVKKLIEKFGFTRITAVQLTNLSIESLDELKLILSYLEKREYSDSELKEI
FT                   YKILTGQ"
FT   gene            531483..532070
FT                   /locus_tag="Pisl_0580"
FT   CDS_pept        531483..532070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0580"
FT                   /product="putative nucleotide binding protein"
FT                   /note="KEGG: pai:PAE3336 putative nucleotide binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87758"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS26"
FT                   /protein_id="ABL87758.1"
FT                   /translation="MKGRKEEYAYVIDILPPEVAVYKLPPKMRREFPHDATYAHLVGEN
FT                   HFTLLEVTLKKGVTVDIGERLYVGLGTRDKVDKIVRRIRYDDLQPQGKENLRVIIRKIV
FT                   EQQEERFIKWLNEAGPITLKLHSLELLKGVGKKKVQEIIEERRKKPFVSYEDVKQRVGI
FT                   DLVELITDRILREIAGEDPYYVFASPPPATSQ"
FT   gene            complement(532599..532997)
FT                   /locus_tag="Pisl_0581"
FT   CDS_pept        complement(532599..532997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0581"
FT                   /product="translation initiation factor 5A precursor
FT                   (eIF-5A)"
FT                   /note="TIGRFAM: translation initiation factor eIF-5A; PFAM:
FT                   initiation factor 5A hypusine (eIF-5A); KOW domain protein;
FT                   KEGG: pai:PAE3337 translation initiation factor aIF-5A"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87759"
FT                   /db_xref="GOA:A1RS27"
FT                   /db_xref="InterPro:IPR001884"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR019769"
FT                   /db_xref="InterPro:IPR020189"
FT                   /db_xref="InterPro:IPR022847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS27"
FT                   /protein_id="ABL87759.1"
FT                   /translation="MSTKYVEVGELKEGSYVVIDGEPCRVVEIEKSKTGKHGSAKARIV
FT                   AIGVFDGGKRTLSLPVDAQIEVPIIEKFTAQVLSISGNVIQLMDMRDYKTIEVPIDYVE
FT                   EEAKGRLAPGVEVEVWQILNRYKITRVK"
FT   gene            complement(533028..533870)
FT                   /locus_tag="Pisl_0582"
FT   CDS_pept        complement(533028..533870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0582"
FT                   /product="methylthioadenosine phosphorylase"
FT                   /EC_number="2.4.2.28"
FT                   /note="TIGRFAM: methylthioadenosine phosphorylase; PFAM:
FT                   purine phosphorylase, family 2; KEGG: pai:PAE3338
FT                   hypothetical 5'-methylthioadenosine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87760"
FT                   /db_xref="GOA:A1RS28"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010044"
FT                   /db_xref="InterPro:IPR018099"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS28"
FT                   /protein_id="ABL87760.1"
FT                   /translation="MVIKLTQPPKEPKELGVEEFPRLGIIGGSGLYDPGIFENAVEVQI
FT                   HTPYGLPSDNVIIGRVSGRVVAFLPRHGRGHKYPPHKIPYRANIYALYTLGVRSIIAVS
FT                   AVGSLRPDYAPGDFVVPDQFVDMTKSREYTFYDGPRTCHISIGLEPFTQEIRKVLVEVA
FT                   SRYNRTHDGGCYICIEGPRFSTKAESRIWREVFGCDIIGMTLVPEINLARELGMCYGLI
FT                   ALVTDYDVLVPHQPVTAEAVEKMMTEKIDIIKRVIAEAVPRIPAEIPKCGDVLKYACV"
FT   gene            533902..534390
FT                   /locus_tag="Pisl_0583"
FT   CDS_pept        533902..534390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0583"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87761"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS29"
FT                   /protein_id="ABL87761.1"
FT                   /translation="MEVFAPLPTELVKRFGARKIDDKYEISAINLPWVIKQEINFIFTP
FT                   GEKYVVDGVEIDGLVPPWEAYVSFVDPSGEFGIGYIATGRRRMFECVHKVYTTPLYLQL
FT                   APYIVVKPVELLLSDKPNVIDCVERVFHARYIAVFINAPINIVQKIKTTLSPNIKRNI"
FT   gene            534417..534779
FT                   /locus_tag="Pisl_0584"
FT   CDS_pept        534417..534779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0584"
FT                   /product="translation initiation factor 1 (eIF-1/SUI1)"
FT                   /note="PFAM: translation initiation factor SUI1; KEGG:
FT                   pai:PAE3340 translation initiation factor SUI1 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87762"
FT                   /db_xref="GOA:A1RS30"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS30"
FT                   /protein_id="ABL87762.1"
FT                   /translation="MEIKLPNQDAEDIIDQLLGGSEEETLMQTLTKEKALVRIRLENRR
FT                   GHYVTIVDFGNSEDAKQLGIKDMARELKKRLAAGGTIRDSWIEIQGDHRQKIKKILIEM
FT                   GFREENILIDEGITET"
FT   gene            complement(535037..535555)
FT                   /locus_tag="Pisl_0585"
FT   CDS_pept        complement(535037..535555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0585"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3342 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87763"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS31"
FT                   /protein_id="ABL87763.1"
FT                   /translation="MAEIFLRQNGYITWRPVKFIRFLELAVAYEGIRGESCEKEPPEPL
FT                   TLTVPTDVGYISLTYWRGRCLSIDGRRITQLEYSIYAPCVKKCIKKAMGPLLEVFRPIA
FT                   RELLSYRRVLKTFDLFAFKNGVIYAVEVKTNGGKISDIQREKVVVLKNIRHLLIHVYLQ
FT                   SPVVKLERL"
FT   gene            complement(535588..537486)
FT                   /locus_tag="Pisl_0586"
FT   CDS_pept        complement(535588..537486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0586"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: pai:PAE3343 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87764"
FT                   /db_xref="GOA:A1RS32"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS32"
FT                   /protein_id="ABL87764.1"
FT                   /translation="MDPLKPPREEFEKFVAEVAYAIGIGEVPEIERSKRFGYFSAKFHK
FT                   YRVDAGKLKETVDSLKSRQFKYLTSISVDGLYLNVDLAVEKVAELTFRAVAEMGDKYGF
FT                   TDECKIGSFLVEHTSANPIHPLHIGHGRNAILGDSLVRLLRFCGNVVQSHFYVDDCGVQ
FT                   VMYAAIGYNVVKKYVDEVLKRTKPDVVIGAIYSAVNAIAEINRLKKELEKEKDDEKRRE
FT                   IINEIDSWVSVLKRLIDTEGEVINKLVEVLGQRNIVEEAAELNKRYETGDPEVKKIVRE
FT                   VVELVLKGQRETLARLGIELDSWDYESDIAVWSGEATRVVSELRRRWPQYIDDRGGAVV
FT                   FRADKFVEDFKLWDVLDLPKFIPPVTLTRSDGTTLYVTRDVAYALWQARRGFDKVIRVI
FT                   STEQTHEQAHVRIILYALGYEDVAKKLIHYAYEMVNLPGMKMSARRGQYISLDEILDEA
FT                   VERSADLVKEKNPEIAGIIAERVGVGSVRYAFLSTSPRKPIEFKWETVLNMRQNSGPFL
FT                   QYTYVRAYSILEKAQEIDLKKVAIPKEILPEERELILKVAEWPSVVREATRALRPDYVA
FT                   EFLDGLALIFNSYYEKAPVLKTEEPVRSFRLALVNSVKTVLAAGFYILGIPTLTKM"
FT   gene            537687..537920
FT                   /locus_tag="Pisl_0587"
FT   CDS_pept        537687..537920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0587"
FT                   /product="SSU ribosomal protein S28E"
FT                   /note="PFAM: Ribosomal protein S28e; KEGG: pai:PAE3344
FT                   ribosomal protein S28"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87765"
FT                   /db_xref="GOA:A1RS33"
FT                   /db_xref="InterPro:IPR000289"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR028626"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS33"
FT                   /protein_id="ABL87765.1"
FT                   /translation="MSSEVKFSPYEDAVAALVIQILGRTGVAGEVTQVKVKILEGRDKG
FT                   RILTRNIKGPVRLGDIVMLRETEREARRITAR"
FT   gene            537917..538093
FT                   /locus_tag="Pisl_0588"
FT   CDS_pept        537917..538093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0588"
FT                   /product="LSU ribosomal protein L24E"
FT                   /note="PFAM: Ribosomal protein L24E; SMART: TRASH domain
FT                   protein; KEGG: pai:PAE3345 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87766"
FT                   /db_xref="GOA:A1RS34"
FT                   /db_xref="InterPro:IPR000988"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR023438"
FT                   /db_xref="InterPro:IPR023442"
FT                   /db_xref="InterPro:IPR038630"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS34"
FT                   /protein_id="ABL87766.1"
FT                   /translation="MKIYKCAFCGADILPGYGIMYVKTDGTTLRFCSRKCFVSAVKFKR
FT                   DPRRLAWVRKRQK"
FT   gene            complement(538094..538603)
FT                   /locus_tag="Pisl_0589"
FT   CDS_pept        complement(538094..538603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0589"
FT                   /product="LSU ribosomal protein L7AE"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   pai:PAE3347 ribosomal protein L7"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87767"
FT                   /db_xref="GOA:A1RS35"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004037"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR018492"
FT                   /db_xref="InterPro:IPR022481"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS35"
FT                   /protein_id="ABL87767.1"
FT                   /translation="MGVNTYIAFAFSKAMSVTIDPRTFYANPPPGKPFYVRFEVPAEVA
FT                   EKALEILSIARQTGKIKKGTNETTKAVERGLAKLVLIAEDVDPPEVVAHLPLLCEEKKV
FT                   PYVYVPSKEKLGKAAGINVSAASAVVIDPGQAAGDLEALVAKINEIRAKHGLNAIPLPS
FT                   SGAAKK"
FT   gene            complement(539040..540131)
FT                   /locus_tag="Pisl_0590"
FT   CDS_pept        complement(539040..540131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0590"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3348
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87768"
FT                   /db_xref="GOA:A1RS36"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS36"
FT                   /protein_id="ABL87768.1"
FT                   /translation="MILQIDPGALIILFRETAVLFAIYGIYVLSLNLEVGYLGLPQFGK
FT                   VMFLALGGLTVGGITTKIALEIYKATIASQLGIDPLADIDRYCSAYQYQTVTIINNIFS
FT                   MSPLYGTLFFLLSITLAALLAGVFGVLMAGPALRLREDYLGILLLVSAETIRVITTYTP
FT                   PIACGVFGAVVPDPFAWMGSYRPWGYLAITALFLLLTLVILERLGNSPFGRALRAIRDA
FT                   EVAARVFGKDIVKFRVRVLATASALSGVAGALLVFYNNFVNMGQFVPLYTFIAWAMLII
FT                   GGTGNNIGALIGVAVYYALERIISIYKESIRSIVNVDPIFFQYIIFGIAIILVLMFRPQ
FT                   GIFGEKPSKTLSRNILEKLRKEV"
FT   gene            complement(540128..541084)
FT                   /locus_tag="Pisl_0591"
FT   CDS_pept        complement(540128..541084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0591"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: pai:PAE3350
FT                   branched-chain amino acid transport permease protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87769"
FT                   /db_xref="GOA:A1RS37"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS37"
FT                   /protein_id="ABL87769.1"
FT                   /translation="MEFLGIDYPTLARAIIFSNIYVLLGLGLNLTYITTKIPSFAHGDL
FT                   ATVGAYVSYFTIVFLLQPFGLPANIYLTFPLVALVTGLVAVLSYIAVFKPMIRRGAGIT
FT                   PLMIASFGLHYVIFASIAIVADYVQNTFGYLTRNILLTRWEYIWPGTDFLTSALINTTI
FT                   MVAIITTLLYFLLYKTRYGIVMRASIDNLYLARAVGINVEKVFTAAWLLIGAVTGIAGV
FT                   YMAMFFPMTEELGWLRLAVVFIVSVVGGLSNIYGAVLGGYVVGLSLVLGATYILTPLNI
FT                   PTEFQLVIPFAFVIVILLFAPQGLVEIISSLVQRIRK"
FT   gene            541191..542534
FT                   /locus_tag="Pisl_0592"
FT   CDS_pept        541191..542534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0592"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pai:PAE3353 branched-chain amino acid binding protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87770"
FT                   /db_xref="GOA:A1RS38"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS38"
FT                   /protein_id="ABL87770.1"
FT                   /translation="MASKILYIGIAVVVVILVAIVAILATGGKQTAPTTPTPLTPSPTQ
FT                   TPKPTPTPTPSPSPTPVRKVVYIGAALPLTGGLQSYGIGVKNAVELAVEDANRMCPSYR
FT                   FELLVEDTGTNPQQALQKVQVLYAKGVRFVVGPMASGEVKAVKPFADQNKIIIFSPSST
FT                   SPALAIPNDWVYRIVPTDFAQAAAIADLLKQLGVKKAVILYRNDEWGVGLKDAITKEAE
FT                   KLGIQIASAQGYDPDPKAFPTAIPEVVRKLSAALGQPSGDSAVIFVTFEDDGVVAMQSA
FT                   AQDPVLGKVRWIGTDGIAYSDALIKQVGKEMAARKLLGTITAPDPNDPKYQEFKKEYRA
FT                   KYGREPVAYDPYGYDAAMMLMQIICKTGTDDPEKVRATLEQWGKEGTYQGATGKVYLDQ
FT                   AGDRAYPNYVIWGVAIVNGTAKYVDAAYYYGAERRITIFDQGKSLFQS"
FT   sig_peptide     541191..541268
FT                   /locus_tag="Pisl_0592"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.252 at
FT                   residue 26"
FT   gene            542563..543330
FT                   /locus_tag="Pisl_0593"
FT   CDS_pept        542563..543330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0593"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pai:PAE3354 branched-chain amino acid transport
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87771"
FT                   /db_xref="GOA:A1RS39"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS39"
FT                   /protein_id="ABL87771.1"
FT                   /translation="MVLLVTKGIVKQFGAFRALDGVDVEIEKGRVTLIIGPNGSGKTTL
FT                   VNVITGVYKPEAGRVFYTKPDGKMIDITGWPPHKIFEIGIVRTFQIPQIFQKLTVLENL
FT                   LAVARGQRGESVISALLKNWVKEEEELARRAFGILKAVRLIDKWDVPAYLLSAGEMKLL
FT                   ELARALMAGANLIILDEPIAGVPVDQAHEVFKIVRDINKQQNVTFLVIEHRIDIAFKYV
FT                   DYVYAMASGKVIAKGLPEEVANDPKVKEVYIGG"
FT   gene            543361..543448
FT                   /locus_tag="Pisl_R0017"
FT                   /note="tRNA-Ser1"
FT   tRNA            543361..543448
FT                   /locus_tag="Pisl_R0017"
FT                   /product="tRNA-Ser"
FT   gene            543576..543663
FT                   /locus_tag="Pisl_R0018"
FT                   /note="tRNA-Ser2"
FT   tRNA            543576..543663
FT                   /locus_tag="Pisl_R0018"
FT                   /product="tRNA-Ser"
FT   gene            543742..544836
FT                   /locus_tag="Pisl_0594"
FT   CDS_pept        543742..544836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0594"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pai:PAE3359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87772"
FT                   /db_xref="GOA:A1RS40"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS40"
FT                   /protein_id="ABL87772.1"
FT                   /translation="MNLRLILILGLVSLLADWLYESVRAVVPQYLYYLGASAVFVGFVF
FT                   GLGDALGYAARFITGPLADKRGGYWLETFLGYALQVAAVAGLVFARDMWQVAGLIFLER
FT                   FSKALRTPARDAIISAAGGAEARGRAFGIHASLDQIGAIIGVAMATAMLYYKFTPRDVF
FT                   LISLAPGVAALFTLYVAYRVGKLKPEKRKSTILMDLTVFKFGVTQFLLGLSLIHISLFM
FT                   YKLAEVAWMASLLYLVAMVSEVPVSLLLGHFYDKNAKALLVAPLFSILLAAIFVAGNIP
FT                   ALFLGAVLYSVVTSYADVVAKAHAARLGGATSLGVINAMWGFGLLVGGILYGYFFDIGA
FT                   SIPIFILATASAFISLVLLWRENT"
FT   sig_peptide     543742..543792
FT                   /locus_tag="Pisl_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.557 at
FT                   residue 17"
FT   gene            544818..545237
FT                   /locus_tag="Pisl_0595"
FT   CDS_pept        544818..545237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0595"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87773"
FT                   /db_xref="GOA:A1RS41"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS41"
FT                   /protein_id="ABL87773.1"
FT                   /translation="MAREYLIELYRRLAPIYEEVYGVEQRLKYWLILSQVGEKVVDAGC
FT                   GVGLAFEVLKSYVVCLDISLDMLERARAKSGEWGDLILADYWLPPFRENAFISALFISS
FT                   VEPELFEKLHAVWRQIAYKFFYEFRGKWRIFEQRN"
FT   gene            545312..546157
FT                   /locus_tag="Pisl_0596"
FT   CDS_pept        545312..546157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0596"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: KaiC domain protein; KEGG: pai:PAE3364
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87774"
FT                   /db_xref="GOA:A1RS42"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS42"
FT                   /protein_id="ABL87774.1"
FT                   /translation="MSFQEQYYEYQDYYPVYDNRAPTGIWYIDQLLQGGFRKGEIYLVA
FT                   GEAGQGKTIFSLQFLKTGAEIYDEPGLYITIDEPSEDVKRGVKDSLGWDLDILENQNKL
FT                   IFVDLRTHFRTYAKEEKVTADPRDIAKIILEYVKKFGIKRLVIDPIAPLIITSHTDILW
FT                   VREYMRELVFQLRKIKDITTLLTSEIPTGENKISRFGVEEYLASGVIKLELMEYRGFVF
FT                   RVMFIRKMRWTAVRPQKLVFEIYPHYGIYILDRLENFMKQIDIWYATLSQQAQAPPVTQ
FT                   "
FT   gene            546184..547485
FT                   /locus_tag="Pisl_0597"
FT   CDS_pept        546184..547485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0597"
FT                   /product="signal recognition particle subunit FFH/SRP54
FT                   (srp54)"
FT                   /note="PFAM: GTP-binding signal recognition particle SRP54,
FT                   G- domain; Signal peptide binding (SRP54) M- domain
FT                   protein; GTP-binding signal recognition particle SRP54,
FT                   helical bundle; SMART: AAA ATPase; KEGG: pai:PAE3365 signal
FT                   recognition particle (srp54 family), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87775"
FT                   /db_xref="GOA:A1RS43"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS43"
FT                   /protein_id="ABL87775.1"
FT                   /translation="MKALGEVFSKLVEKIRGVSYIDEATLQELSREIQRALLKADVPLD
FT                   MVKTFTENAVKRMREEKPPAGIPPREYVLYILYDELVKLLGGEQPAEFKPVKKPYLVLL
FT                   LGVEGSGKTTTAAKLARYLVKRGYRVGLVETDTIRPAAFDQLKQLAEKIGVPFYGERDS
FT                   KDAVEIARRGVQNFKNMDVVIIDTAGRHKNEEALLQEVKMIYEAVNPDEVILVIDATVG
FT                   KLAAAQAEAFMKYLPIHSVIITKMDSTARGGGALAAVIKTGARVKFIGVGEDVDEFDLF
FT                   NPRKFVARVLGMGDLDALVEKIKAVFEEEKVLQEIESGRLDLLTFKKQIEGLLKLGPLS
FT                   KVLQLLPGGFAAKISEEQVELSQKNLKKWYAILSSMTIEELKNPDILNASRIRRIALGA
FT                   GVTPKDVKEMLTVYENLKKMSKTLKRQLRMRIPK"
FT   gene            547500..547952
FT                   /locus_tag="Pisl_0598"
FT   CDS_pept        547500..547952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0598"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE3367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87776"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS44"
FT                   /protein_id="ABL87776.1"
FT                   /translation="MTSLRRFTAEPHIHAKLLVAALLISNGIRKDAEAVFYLVDLQKTV
FT                   KILGSRVKRLFPDEDSSVGFLKKAFAGEKLTGVIVKRGASDLTIGTTVGPGGRRRCMPN
FT                   PPFTYVVVFEPFDIDLECDAGLGKLPPHHQVVIINIETDRLLYHRR"
FT   gene            547973..549214
FT                   /locus_tag="Pisl_0599"
FT   CDS_pept        547973..549214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0599"
FT                   /product="THUMP domain protein"
FT                   /note="PFAM: THUMP domain protein; KEGG: pai:PAE3368
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87777"
FT                   /db_xref="GOA:A1RS45"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS45"
FT                   /protein_id="ABL87777.1"
FT                   /translation="MDVVDILEKSLEILKAYPLCDSCLGRLFAQMGYALENWERGFSIK
FT                   TMLHMKLVTLFRQGVDVTTDLKSLARIHKPTRRFLSTIGITVEEAQCYICGGLLSNVER
FT                   FAKEAVSKVDGIEFETFAVGTTIPREILERESEVVKKFLVSTGESIKHEINRRIGKELL
FT                   RLLGRRVDKQRPNILIKIDLINGKIDIVKNPLLIEGVYLKLSRRISQAKKFGNVKSSLL
FT                   EKLQYIRDMYGGVEHIIHVSGREDSDARMLGPGRPLVVEIKQPTKYKGLPHLYSDGDVI
FT                   FIPLGFTTRDEVRKLKEKAKTDIKLYRALVYSDRPLSEEELRKLAELSGKTVVQYTPRR
FT                   IKRLNPRKKRTRMVYEIVWRFISSHVFELYVRCQGGLYVKEFIHGDGGRTTPSVAEILN
FT                   TYLEVLELDVLSIE"
FT   gene            549242..550759
FT                   /locus_tag="Pisl_0600"
FT   CDS_pept        549242..550759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0600"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /note="TIGRFAM: GMP synthase, large subunit; GMP synthase,
FT                   small subunit; PFAM: glutamine amidotransferase class-I;
FT                   GMP synthase domain protein; PP-loop domain protein; KEGG:
FT                   pai:PAE3369 GMP synthetase (glutamine-hydrolysing)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87778"
FT                   /db_xref="GOA:A1RS46"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS46"
FT                   /protein_id="ABL87778.1"
FT                   /translation="MERIVVVNFGGQYAHLIARRLRERGVYTEIVTPEDAVEIAKAPDV
FT                   KAIILSGGPSSVYQEGAPDVPDELFAIGKPILGICYGHQLIAKKLGGLVRRGKGEYGKT
FT                   LVRVLVNDHIFDTWESEEIVWMSHSDYVAQPPEGFTILAVSENGYVAAMKKDYIYGVQF
FT                   HPEVVHTPKGGVLLENFARKIAGVKHVWKPEDQIGKLIEEIRKEVKDGDIIIGVSGGVD
FT                   STVVAVLVHMAVGERAKAVFIDHGLFREGEPEQVVKLLNSLGIKVYYVDARERFLKRLE
FT                   GVSDCEEKRRIIGETFAEVFTETLSKFPEVKYLAQGTLYPDVIESGAVKGADKIKSHHN
FT                   VGGLPRWFNLKLIEPLREFYKDEVRKLARALGLPDEVVYRHPFPGPGLAVRIIGPFTRE
FT                   KLEIVRKATKIIEEELEKGGILRKVWQAFAVVGDDKWVGVKGDRRTVGYIVTIRVVESE
FT                   DAMTADWSRLPYEVIERISTRITSEIPQVTMVTYAVTTKPPSTIEPC"
FT   gene            550889..552277
FT                   /locus_tag="Pisl_0601"
FT   CDS_pept        550889..552277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0601"
FT                   /product="gamma-glutamyltransferase 2, Threonine peptidase,
FT                   MEROPS family T03"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   pai:PAE3371 gamma-glutamyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87779"
FT                   /db_xref="GOA:A1RS47"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS47"
FT                   /protein_id="ABL87779.1"
FT                   /translation="MYIGTDFVIVSESYLATRAGYETYKAGGNAIDAITCASIVLTYTL
FT                   PHLGGVGGDFLALVHSGSNVEAILGLGWAPRRIPEKPPRRGLRSATVPGYVAGLYEFHR
FT                   RHGVLEWREVVDIALNAMEKATLHPSLAYAIERHKDVLVADPGGRIYLSLPRLSGAPYR
FT                   IDPLIKLWNKLRENPLSFYDEIANDILYDYFELEDFSRFKAEVKKPVYIELGDWIIYEA
FT                   PPPSLGFAVLLAVKLTKRAEGAFSYSRIQNTVAALRKAHWARDRYLHDGYIPLDDLLSG
FT                   KIELGEAEVPEPTPGTTYLAAADRDFVVSAIQSLYYPFGAGFTDAKWGITFNNRASDFT
FT                   HGLNSASPHKRPAHTLSAVVMERGGEIYALGASAGHYRPAIYTQLIHNIVWYGMDPRQA
FT                   IWAPRFIWLRGAEVQAEEGWEGGPGVHIVKYPSRMGVAALAARKNGTLVAVSDIRGDGL
FT                   ALGI"
FT   gene            552531..552618
FT                   /locus_tag="Pisl_R0019"
FT                   /note="tRNA-Leu3"
FT   tRNA            552531..552618
FT                   /locus_tag="Pisl_R0019"
FT                   /product="tRNA-Leu"
FT   gene            552674..554311
FT                   /locus_tag="Pisl_0602"
FT   CDS_pept        552674..554311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0602"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pai:PAE2391 dipeptide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87780"
FT                   /db_xref="GOA:A1RS48"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS48"
FT                   /protein_id="ABL87780.1"
FT                   /translation="MNKSLAVGIVVLVVVLAVIAIFLSQQQAPAPRPLPQSSSPTTTQT
FT                   PIPTTPKSSPTSTTPQPTSLTIGVTDKVTDLDPANAYDFFTWEIFYNTMAGLVRYKPGT
FT                   TELEPDLAENWTVLEGGKVWVFKLRPNLKFCDGTPLTASDVKRSIERVMKINGDPAWLV
FT                   TDFVEKVETPNATTVIFYLKTPVSYFLALVATPPYFPVHPKYVPDRIDSDQTAGGAGPY
FT                   CIKSFVRDQQIVLEANPYYYGPKPQISKVVIKFYKDATTLRLALERGEVDIAWRTLNPP
FT                   DIEALKASGKFKIVEVPGSFIRYIVLNLNMPELKDVRVRQALAAAVCRKDIVQTVFRGA
FT                   VTPLYTLIPEGMWGSYPVFKERYGDCNISLARSLLQQAGYSQSKKLSIELWYTPTHYGD
FT                   TEKDLAAVLKEQWEATGLVSVTVKSAEWATYVQQLRSGAMMVSLLGWYPDYLDPDDYTT
FT                   PFLKSGSNKWLGNGYSNPKMDEILTKASVEESRLVREQLYRQAQQLLAEDVPIIPLVQG
FT                   KLFIATKPNIQVVVDPTMILRYWAIKIA"
FT   sig_peptide     552674..552754
FT                   /locus_tag="Pisl_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.377 at
FT                   residue 27"
FT   gene            complement(554308..555096)
FT                   /locus_tag="Pisl_0603"
FT   CDS_pept        complement(554308..555096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0603"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2392 dipeptide
FT                   transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87781"
FT                   /db_xref="GOA:A1RS49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS49"
FT                   /protein_id="ABL87781.1"
FT                   /translation="MMLKTGAFLVAFVIIFSALAPVVAPYDPTKKVAEPLSPPSIKHPF
FT                   GTDNLGRDVLSRVLYGGQVIIGVSLLATLFSASIGFTLGMFSGYIGGKTDRVLNMVMDS
FT                   MYAFPSLILAIAIASVLGPSPLNAALAIGVVYIPTYFRMARNETLVVKSSLFIEAAVSL
FT                   GMPRHRIIFRHVLPNLVPSLVVVATINIADAALTESALAFFGYTVTPPTPDWGLDLSSA
FT                   KSYIINGYWWLLIPGIFIVLTALGFSLLGEGLGERLGKKD"
FT   sig_peptide     complement(555025..555096)
FT                   /locus_tag="Pisl_0603"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.922 at
FT                   residue 24"
FT   gene            complement(555093..556106)
FT                   /locus_tag="Pisl_0604"
FT   CDS_pept        complement(555093..556106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0604"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pai:PAE2393 dipeptide
FT                   transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87782"
FT                   /db_xref="GOA:A1RS50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS50"
FT                   /protein_id="ABL87782.1"
FT                   /translation="MSSLLRYIAFRTLLAVPTLLILLTVVFFILRVIPGNPIIAMVGMK
FT                   APPEYVEQLIREAGLDKPIYIQYFDYLSQIFTGNLGRSLIFGKREVVNEIIDRLPATVE
FT                   LAISAFFVSIVLGHLFGFLAVKYGGKFDTATRVYAMVAYVLFIPFIGLALQLIFSVWLN
FT                   LFPVAGRITPGLEPPKITGLYLLDSLLARRLDSFFDAVWHLALPSFTLGLVLSGVFVRL
FT                   IRNNMKKTLGEDFIFAYRAMGFREWSVLWKAYRVAIVPTVTMMGLQLALLLQGAVLTET
FT                   TFSWPGLGTLLLERIQYLDYTTVQGTVVVFVFIVVFMNILVDIINALLDPRVRKGL"
FT   gene            556155..556276
FT                   /pseudo
FT                   /locus_tag="Pisl_R0020"
FT                   /note="tRNA-OTHER2"
FT   tRNA            556155..556276
FT                   /pseudo
FT                   /locus_tag="Pisl_R0020"
FT                   /product="tRNA-OTHER"
FT   gene            556494..556856
FT                   /locus_tag="Pisl_0605"
FT   CDS_pept        556494..556856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87783"
FT                   /db_xref="GOA:A1RS51"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS51"
FT                   /protein_id="ABL87783.1"
FT                   /translation="MYSIAIVMPTLSATASQGVSAKYWFVSTALKVKCVALLPFFPGGG
FT                   CDMRMLAAFLAAVAGVTAVVWYTAFALTHSKTVLRALAVVLSTSAISAVVLDILTWILP
FT                   KAVQAAAALRDAETWE"
FT   sig_peptide     556494..556559
FT                   /locus_tag="Pisl_0605"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.476 at
FT                   residue 22"
FT   gene            556904..557584
FT                   /locus_tag="Pisl_0606"
FT   CDS_pept        556904..557584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0606"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE2522 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87784"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS52"
FT                   /protein_id="ABL87784.1"
FT                   /translation="MSQTYRAPKVKIPWHLVEERPDVLDTVTRMYLAVEEYVKRLLKEL
FT                   TGQEEPRLTAEELDRLLTLDRRELAHGIIEETFHKYGLKKYLAEWAKFLWRDVVFHRAV
FT                   PLYAQLRVKDERDVGKAVKLKKGNIAWIRKRLEEGAKSKLAFLGVEVKRSKKESTYGKL
FT                   YIALVFAREATPVELKAIVTVDINRLDYGIIVGLLVEGKLRQTLRLPDASVTRESGETS
FT                   RGDK"
FT   gene            557586..557978
FT                   /locus_tag="Pisl_0607"
FT   CDS_pept        557586..557978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0607"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pai:PAE1827 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87785"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS53"
FT                   /protein_id="ABL87785.1"
FT                   /translation="MEERAARETGPVRRRRLEERTRHLKSRRFRKIGGVVTQIAREIIE
FT                   LARANDAAIVVDKIENESYRELKESNWSGGKKYFLDGLGQLKRRLMELALWYGLPYLEV
FT                   IQHSLPEMRRQNGRREKLHHASPRLH"
FT   gene            558305..558895
FT                   /locus_tag="Pisl_0608"
FT   CDS_pept        558305..558895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0608"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: pai:PAE2377
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87786"
FT                   /db_xref="GOA:A1RS54"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR019907"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS54"
FT                   /protein_id="ABL87786.1"
FT                   /translation="MHVVYSVEEVEIPQNVKVSVEKIGPFDYVVKVKGPLGEITKEFRN
FT                   TPVVMNLRDGKVVLEVFNARKKEYAILGAYKGILRNMFLGVTKGWRYKLKVIYTHFPML
FT                   VKVQGNQLIIENFLGRKSKIVLTIPSGVKVEVKGKEDIIVEGVDKDLVSQFAATIQSAV
FT                   ELRGDERPSPHGREGGLGIVDGIYVVGYEHIKS"
FT   gene            complement(559110..559979)
FT                   /locus_tag="Pisl_0609"
FT   CDS_pept        complement(559110..559979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0609"
FT                   /product="4-hydroxybenzoate polyprenyltransferase,
FT                   putative"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyltransferase,
FT                   putative; PFAM: UbiA prenyltransferase; KEGG: pai:PAE2375
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87787"
FT                   /db_xref="GOA:A1RS55"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS55"
FT                   /protein_id="ABL87787.1"
FT                   /translation="MLFDPEVVGTTTIRILRFIRVEHTIFTLPMAYAAALLTGGVIDFW
FT                   KAVFIGLAVFGLRTAGMAWNNIADYPIDKLNPRTQRRMLVSGKISFREAYGVFLFGVAI
FT                   FILSAMALGKWPLTLSLPYLAVVMTYPYAKRVHCIPHLHLGLVYALVPLGAAIATYPDD
FT                   IQIALAKTPWILVVASALWVAGFDVMYSKGDYEFDKRQRLGSIPACFGLKAADIVTALL
FT                   MSASATLYIVNYISYGLNIWGLVLTSIGAFLEIYSAVLGIRGDVARGFNLNLAVGIFIP
FT                   FGIFVGYY"
FT   gene            560042..560464
FT                   /locus_tag="Pisl_0610"
FT   CDS_pept        560042..560464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0610"
FT                   /product="Thioredoxin domain protein"
FT                   /note="PFAM: Thioredoxin domain; KEGG: ape:APE2496
FT                   thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87788"
FT                   /db_xref="GOA:A1RS56"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS56"
FT                   /protein_id="ABL87788.1"
FT                   /translation="MDEIDRLLWKKAVEITSRKTQKCCLVSYTPGHVLSDVSQFKNAVM
FT                   GCRVTFVMFFGKTCPYCQMFDPIFRYIGEKYREYANFVKADIEEFYNIAIRLGIMATPT
FT                   TVAFLNGQPIEVAPGFMTAPQFKTFVETVLSHAGCK"
FT   gene            560491..561837
FT                   /locus_tag="Pisl_0611"
FT   CDS_pept        560491..561837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0611"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; HI0933 family protein;
FT                   FAD dependent oxidoreductase; KEGG: pai:PAE2371 NADH
FT                   oxidase (nox)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87789"
FT                   /db_xref="GOA:A1RS57"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS57"
FT                   /protein_id="ABL87789.1"
FT                   /translation="MVRVVIVGGGAAGASAAARARRLDPNAEIILIERGSMITHAPCGM
FT                   PYAIGGVVKSHEDLMTYKPEEFEKERNIRVLIRSTVTEIDVDKRVVVVERGNNTEKISW
FT                   DKLVIATGAKPLIPKIPGVELRGILTMRHPDEVPELKAQLETANTVAIVGGGYIGVEMA
FT                   EILLELGKKVVLFEMFNQVLPTALDPDMAAIVADEMKNRGVELHLGEKVVEFSGAGHVS
FT                   KVITEKGEYKVDKVILAVGVRPDVDLAVKAGAKLGETGAVYVNEYMETTVPDIYAAGDV
FT                   AEKTHRVTGRRVWIPLAPTANKEGQVAGGNSVKGRVLKFPGVVGTAVTKFYSLYIARTG
FT                   LSEREARELGYKVQSTLIKARTKAHYMPGGEPVSIKLVAEESTGSILGAQIVGKSQIVA
FT                   SYADIIALAVQSRYTIEDLFFSDLGYMPDVAPVWHPLIVAARVLSRGKL"
FT   sig_peptide     560491..560553
FT                   /locus_tag="Pisl_0611"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.700 at
FT                   residue 21"
FT   gene            561907..562836
FT                   /locus_tag="Pisl_0612"
FT   CDS_pept        561907..562836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0612"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   pai:PAE2370 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87790"
FT                   /db_xref="GOA:A1RS58"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS58"
FT                   /protein_id="ABL87790.1"
FT                   /translation="MITIIGSGRVGTAAAVIMGLLKIDTKILLIDIIKGLPQGEALDMN
FT                   HMSSILGLDVEYFGSNEYKDMEGSDLVIVTAGLPRKPGMTREQLLEANAKIVSEIGKEI
FT                   KRYAPNSVVILTTNPLDAMTYVMWKSTGFPRERVIGFSGVLDAGRLAYYAAKKLGVSPA
FT                   SILPIVLGQHGESMFPVPSKSFIHGVPLSRLLTEEQLKEVVEETVKAGARITELRGFSS
FT                   NWGPGAGLALMAEAVKRDTKRSLIASVVLQGEYDVRDVPVEVPVILGRSGVLKVLEIEL
FT                   SAEERQKFMQSVEAIRKLIASIPSNYLQ"
FT   gene            562867..563238
FT                   /locus_tag="Pisl_0613"
FT   CDS_pept        562867..563238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0613"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87791"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS59"
FT                   /protein_id="ABL87791.1"
FT                   /translation="MAQALLEITSSKGKLIVMEDVELGHVFAVIPYEKRANPTLIRELR
FT                   EQTLDPWRYVNGVGFVLDLTAWKQQSSIDIDYVKNKIEKYREILDTVFQFLETASAKEP
FT                   KKKTTKKKKSKKKSKKKKS"
FT   gene            563288..564022
FT                   /locus_tag="Pisl_0614"
FT   CDS_pept        563288..564022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0614"
FT                   /product="Glutaredoxin-like domain protein"
FT                   /note="TIGRFAM: Glutaredoxin-like domain protein; PFAM:
FT                   Thioredoxin domain; KEGG: pai:PAE2366 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87792"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS60"
FT                   /protein_id="ABL87792.1"
FT                   /translation="MATPIGGPEEEVPHIEVDEETREIIREMLSQMENPVEINFFTSQN
FT                   CAGRETNWCIPTEEFLDLLIQLAPQEKLRLNKYLYEKDAESFKKFGVEPQRVPVVYFGN
FT                   GFIRYLGAPLGEEVRAFIETVIRLSTGKTGLRQKTRAELSTLAQSASKRVYILTVVTPS
FT                   CPYCPYAVLLANMFAYESKGKVVSVVVEAHENPDIADMYGVTGVPAVILQAEDVSVGDV
FT                   EFVGVPPEHELLARVKNHMGLS"
FT   gene            564022..564579
FT                   /locus_tag="Pisl_0615"
FT   CDS_pept        564022..564579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0615"
FT                   /product="dITPase"
FT                   /EC_number="3.6.1.-"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   pai:PAE2365 nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87793"
FT                   /db_xref="GOA:A1RS61"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS61"
FT                   /protein_id="ABL87793.1"
FT                   /translation="MKIRVVTGNPHKLLEISKILAPFGISVERLDVKKIEIQDDDVINI
FT                   AKNAAEILCPIYGDFIVVEDTGLYIGALGGFPGPYAEYVYRTIGLKGLLKLMEGIVDRR
FT                   AVFKCAAAICVEGTVHIFIGETQGYITREPRGNRGFGYDPVFVPEGETLTYAEMDEETK
FT                   NKVSHRAKAFTALGNWLISKFK"
FT   gene            564605..565447
FT                   /locus_tag="Pisl_0616"
FT   CDS_pept        564605..565447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0616"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   pai:PAE2364 conserved protein with 4 CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87794"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS62"
FT                   /protein_id="ABL87794.1"
FT                   /translation="MFRRPVIEFATRNVVTASEKDKVLNAMKTMVNLDIRRLPIVRGDK
FT                   LIGIITMLDILDAIYSWISDKNTEGSLYSDIYMKSVIEIGTRSVISARPETPLGEVIAL
FT                   FLRHNFGSMPIVDETGRLVGIFTEWDVLKVASQLDFPHRVRDVMTRIVYVLTPYSTVMD
FT                   VLEGITIYKFRRYPIVDETGKVIAMLHAKDVLRYFASDEVIEKIKQGAVEDIVSNYAIN
FT                   IAKSPIFVAKPNDPVIDVVKRMLEYDVGGVPVVNEEGTAVIGMVTEKTLMLLFEGSAE"
FT   gene            complement(565415..565960)
FT                   /locus_tag="Pisl_0617"
FT   CDS_pept        complement(565415..565960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87795"
FT                   /db_xref="GOA:A1RS63"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS63"
FT                   /protein_id="ABL87795.1"
FT                   /translation="MMYKLALLFIMILVFTVWGGVLLVKGPSGNYTAAVINGTLVVDGQ
FT                   SIPLPQKVSWYFNGSYTVYGIYYGNPQCLLSLWPDRPEFYITCTVGTDIAIVVLKDPKA
FT                   KIICRDKNNILTPTTATQHLEMYRTRSLYVECKSNFSATVSTPSLLIAVMAGATAASMS
FT                   LFVALSVLLLRRALKEEH"
FT   sig_peptide     complement(565901..565960)
FT                   /locus_tag="Pisl_0617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.954 at
FT                   residue 20"
FT   gene            566002..568785
FT                   /locus_tag="Pisl_0618"
FT   CDS_pept        566002..568785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0618"
FT                   /product="ATP dependent helicase, Lhr family"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   DEAD/H associated domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: pai:PAE2362 ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87796"
FT                   /db_xref="GOA:A1RS64"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS64"
FT                   /protein_id="ABL87796.1"
FT                   /translation="MVFCLLHPLIKEALKERGISEPTEPQKLAIPEILAGNNVLIIAPT
FT                   GSGKTEAAILPILSRMLESNIERPGIYVLYITPLRALNRDLLDRIKWWGERVGFKVDVR
FT                   HGDTDKADRQKQSKSPPHILITTPEMLQAIMTGRRLLEYLKELRWVVVDEVHELAEDKR
FT                   GVQLSLALERLRYHIGRDFQIVGLSATVGSPVEVAKFLVGGSRPFKVVLVNFARQMKLD
FT                   VVRPKPTEEDYRLAEASGLFPDVIARLRFIRKLVEENRSTLVFVNTRSMAELLGFRLSY
FT                   LFGDLPIAVHHSSLSKMVRVSVEERLKKGELKAVVATSSLELGIDIGHIDLVIQYISPH
FT                   QVTRLLQRVGRSGHRLSAMPRGVIIGEDINDIMEAVVIVKRARNGLIEPTQIPDKPYDV
FT                   LVNQIVAFLILKPRWRLEELYEVIKRAYPYKDLSIEELRRVVRFMQDLYPRLAVYFEDS
FT                   DVVARPRSRGFYRYFYETLSMIPDERQYAVINEKTGELVGTLDESFVAEYGTVGVKFIF
FT                   RGRPWLITKVEDRVIKVIEAPDPTGAIPSWIGEEIPVPFEVAQEVGVLRVKASRGDYKS
FT                   IAEEYGVNEEVAKFIVEEISKHKGPIPDDKTIVIEQFKDNIVIIHAAFGTRVNRTLGKL
FT                   LGELLIKTLERPIGVYQDPYGIIIQSSEPLAAELVREHLKKLASLNAQEIAELLRSALV
FT                   KSGSFKRRILHVAKRMGAIDKEADVYSVSMSKLVEAFSGTVVFDEALRETFERDLDLEH
FT                   TAEVLQRIKTGEISIVHSVEPTYLGEVLYEKLSHRLEIIPPERLKKLVLDSTKARLLNY
FT                   TMLAVCLDCGWHGLIRVGEVTNLICPKCGGANVGVVRVVRSDNLEREIRRNVEEVRRTA
FT                   EVIKRYGWVALYALASRLPVETVEKILADINGVDINRLTEILQEAEKEYLKQRLLE"
FT   gene            complement(568762..569766)
FT                   /locus_tag="Pisl_0619"
FT   CDS_pept        complement(568762..569766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0619"
FT                   /product="sugar phospate transferase"
FT                   /note="KEGG: pai:PAE2361 sugar phospate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87797"
FT                   /db_xref="GOA:A1RS65"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS65"
FT                   /protein_id="ABL87797.1"
FT                   /translation="MELAVVGRIDPPLLTPAPYLIVGGFRIVELAALAFCDMGRVVIYV
FT                   EDTVDLPHILEGCRFEIRKGIPLDVPKIHVGCIPHLLKSRNLACGESRLDFRGELLTAE
FT                   PFTSIADLLENNIEVMKLAIGRLKELGIEIMKGDVGGVVRGDIYLRGKLYEYTYVEGPA
FT                   VIGPSSAVLPFTYVRPGTTLYYDVKIRDEAKNAILDSYTRKQHSGYLGDTYIAAFVNLG
FT                   AGTTVSNLKNTLGPIRPSYTSKTYKKLGPVFGEFVKTAIGTLVYGGKYIGPISHIYGIV
FT                   DRDVPSLTIYKHGEFLPMDREKAKEYIRRNLAQFNRDDLYPFYTARLLEKSLL"
FT   gene            569807..570529
FT                   /locus_tag="Pisl_0620"
FT   CDS_pept        569807..570529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87798"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS66"
FT                   /protein_id="ABL87798.1"
FT                   /translation="MIEKIVKRIIGVEDAPAWLVREVFKKVEDGLDIDSAVNYLAPKLT
FT                   EIYKSNIAKYRPGRASIRKASAFLVAEFIERLGYSVEFINLFGASFPAAVRGERLYTPL
FT                   ALILDEKRKSLYLAAKARRLMQSVIQLTMTRNVDGVLVEVVRIEKPPYYYLYTSANVAR
FT                   LIEESRPIVATVNKKLGKLYYYWRHFRERGYLVLVDKEVGGVVVDLLAVGLGRYAVVSR
FT                   KSKKIGRLRKVLDSIYLV"
FT   gene            complement(570517..570801)
FT                   /locus_tag="Pisl_0621"
FT   CDS_pept        complement(570517..570801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0621"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87799"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS67"
FT                   /protein_id="ABL87799.1"
FT                   /translation="MPICTRWERLVTWAEKDGNNYKALEFKEKLVECIIYTATEKVKRK
FT                   KLAEAEELIKYGREVAKKFGIEELNFHLSLLEKEINKIRERRKAQTQTK"
FT   gene            complement(570839..571348)
FT                   /locus_tag="Pisl_0622"
FT   CDS_pept        complement(570839..571348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0622"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: pai:PAE2357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87800"
FT                   /db_xref="GOA:A1RS68"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS68"
FT                   /protein_id="ABL87800.1"
FT                   /translation="MSIPIREFDLTYNDLFRAPDKEGAVVSVRVHRKVKRVLEELAKRE
FT                   GLDGVSELVRYLIAGYLMGKYNIEKPREKVIVEPIVLTINVQKNSSKTIDDVELDIAAE
FT                   KIVAIIRDVEDYLRKVKAGIVPRNPEVAMRLHEKLANALKTAKKLGMEEEYMKLIKLKA
FT                   QLSAIE"
FT   gene            571487..572551
FT                   /locus_tag="Pisl_0623"
FT   CDS_pept        571487..572551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0623"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   pai:PAE2355 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87801"
FT                   /db_xref="GOA:A1RS69"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS69"
FT                   /protein_id="ABL87801.1"
FT                   /translation="MVESILFAPFIVLALAGLMREYLFWRNETASHRQSCRKISVIIPM
FT                   RGVYSWTEDNLRAITSQKTDVEIEYIFVVDSPEDPAYVLAQKFGRVIISQGEGKSAALA
FT                   TGLKVAKGDCIVFADDDIKPRENWLESLTAPLSLYTAVTTYRWYVGQGLCHKVKLAISN
FT                   MGFPAMMDKRSRFVWGGSTAFKREFAERVKLAERLPKYISDDYAVYSAIKEVGGTIWFA
FT                   KSAIAPTPDPQCKIQEAFHWGVRQILMVKWHARLGWYIGLMIYTLGFFISVVLPIVGVL
FT                   IRNYWLLPGLALHPINLAKDFIRARGVKKYTAIQVSVVDIVATWAIGNFIIPTALWVSV
FT                   FTKCINWRGRKICR"
FT   gene            572542..572772
FT                   /locus_tag="Pisl_0624"
FT   CDS_pept        572542..572772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87802"
FT                   /db_xref="GOA:A1RS70"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS70"
FT                   /protein_id="ABL87802.1"
FT                   /translation="MPVIDYSILWAIFKTFFNLVVSVLAMLGLGEWGGRVMAVLLFATL
FT                   FFLAGAFKKTRRIIGPLLALAIMIVALLGYI"
FT   gene            572797..574569
FT                   /locus_tag="Pisl_0625"
FT   CDS_pept        572797..574569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0625"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; ABC transporter related; Possible metal-binding
FT                   region in RNase L inhibitor, RLI; SMART: AAA ATPase; KEGG:
FT                   pai:PAE2352 RNase L inhibitor homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87803"
FT                   /db_xref="GOA:A1RS71"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS71"
FT                   /protein_id="ABL87803.1"
FT                   /translation="MARIAVVDRDACQPRKCGQECVKYCPVNKSGKVVYIDEQLKKAVI
FT                   SEALCIGCGICVHKCPFQAITIVNLPDELEKDCVHRYGPSGFKLYRLPILRRDKIIGVL
FT                   GRNALGKTTMAKILAGEFVPNLCNTRDKVTPEDVIRYFKGTELQTYFSELYSKRLRSVH
FT                   KIQYIELIPVYLKGSVEEIVKKAGINEQLLKRFGLDKLLDRKIENLSGGELQKLAIAAA
FT                   LSKDADVYIFDEPATHLDIVERIKVADAIREYTANKYVLVIEHDLTVLDFLADNIVIVY
FT                   GKPGAYGIVSYPAGAREAINEYLAGYISSENMRIRDRPIKFETRPPERKASKASRLVEW
FT                   TDIFIDLGSFQLEILASFISKGEIVGIIGPNGIGKTTFLKALVGEIKPAKGQISSIPRI
FT                   SYKPQYIRDIAVRNQDVTVGLWLAKEVGDYSNNPIWPDLNSGFNLVPLLERKMGELSGG
FT                   ELQRVVVAASLLKKADLYVLDEPMAYLDVEQRITVARTIRRIIEESEAAMLVVEHDIAM
FT                   LDYMSNAIMPFVGEPGRRGFSPGPTDMRTGMNMFLKWADASFRRDIKSGRPRLNKPGSA
FT                   LDREQKERGELYYI"
FT   gene            574572..575039
FT                   /locus_tag="Pisl_0626"
FT   CDS_pept        574572..575039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0626"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87804"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS72"
FT                   /protein_id="ABL87804.1"
FT                   /translation="MGYIYGILPPMPPLRPFEGITPVKPHITLVKLKRPVKTELRYRQF
FT                   VVRLGPVVLLPSVTKPRYIALKVEPYGELAALRTLLLASLGEAVEERYTEFKPHLSVYA
FT                   IRLKHPTNEDLAPAIEETSKYVGTAFEVKAIHLIDTTGGVYLSLYTLPLYA"
FT   gene            575032..575487
FT                   /locus_tag="Pisl_0627"
FT   CDS_pept        575032..575487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0627"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87805"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS73"
FT                   /protein_id="ABL87805.1"
FT                   /translation="MRKEIEAYLGGLAVGGCVVESPKPYILQWLKSLGMYKDRLVLPKR
FT                   FCKYTPSTLLEHVYFLKGAFETYGEFFAGDPHMGDVIAIYKVRSRKLIRSLRLLGIHPL
FT                   ETTDEKGERNFIVIYRSKDIKRFIKFVKPVIEDVAIARLLGLCTQSL"
FT   gene            575469..576095
FT                   /locus_tag="Pisl_0628"
FT   CDS_pept        575469..576095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0628"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   pai:PAE2348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87806"
FT                   /db_xref="GOA:A1RS74"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS74"
FT                   /protein_id="ABL87806.1"
FT                   /translation="MYAELIVEILNYVGIVAFAVSGALKAGEKDMDLLGFIVLGFSTAL
FT                   AGGIIRDVLLGRVPPANLMYIPYPATAIIASLVTFVLYPQVRRYRDVVLYPDALGLGAF
FT                   AAIGADITATYCSTNRIESCWLLVITLSSITAAGGGVVRDILAGEVPVVLRREVYASAA
FT                   AIGGVLYLALYPLGREIAMLTTIIAVTAIRVVTLLKGWELPRVRL"
FT   gene            complement(576060..576722)
FT                   /locus_tag="Pisl_0629"
FT   CDS_pept        complement(576060..576722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0629"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87807"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS75"
FT                   /protein_id="ABL87807.1"
FT                   /translation="MDVIGWIDHFDYYGPLVDTRMLEEPKYLVSAIIVSQSEEGFEHAI
FT                   RGWSRFGTYEIVETTYVYITQVKRGVIDRKELLQKLLFLLPRFKYFDILALQRVLKLGL
FT                   GITTCDLGLVVLSYISVRGGRPPQRPLGTLFEIRGDELMIYIARNNKGKMVYDGETMCI
FT                   IPMSAEEPRHPLYEAYLKGFRIYTEGMPTERDLCVVHKKLKLRCKILQPNAGEFPTF"
FT   gene            576779..577141
FT                   /locus_tag="Pisl_0630"
FT   CDS_pept        576779..577141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0630"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87808"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS76"
FT                   /protein_id="ABL87808.1"
FT                   /translation="MAPRFFIYPGYKSIEDEPKIRQMIYRGLKEIETEIRKRMLNSDNV
FT                   EELGRALKAINMIAVRVKSIEGKIESKKEIEQIDAIIFDKMNAMLSALANKDYVSLLAI
FT                   ASELEKLVARRSSLFS"
FT   gene            577141..577773
FT                   /locus_tag="Pisl_0631"
FT   CDS_pept        577141..577773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0631"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87809"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS77"
FT                   /protein_id="ABL87809.1"
FT                   /translation="MVCLAPFTPDEFITWYRHLGRLRLFWAKPVVELFPLYRLTEGCVT
FT                   KARWFSDKPRLEEAYIIVLRHAKKIDFLSTLRGIKILITPNEISKELYQLKGGLYIYST
FT                   SRPCATGVYLEKPPEGHREPDPDHIVLSSGSDLRYLLYLNRWNFNIDYLWLQSLESLDD
FT                   AIESAICEARRHGGRFVTVATSEGHLDTIEFNLYKPDHSYHIYKLAF"
FT   gene            577828..578130
FT                   /locus_tag="Pisl_0632"
FT   CDS_pept        577828..578130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0632"
FT                   /product="family 562 protein"
FT                   /note="KEGG: pai:PAE2341 P.aerophilum family 562 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87810"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS78"
FT                   /protein_id="ABL87810.1"
FT                   /translation="MYSLAHIVKCPICGIEFKPVIESVKDGETEVVCPNGHVFTIFVNN
FT                   SESVLDCEIRDWERFGLLPQATQQAVLEAIQSGRVPSDLQTLMRRLKETGIVVCT"
FT   gene            578127..579080
FT                   /locus_tag="Pisl_0633"
FT   CDS_pept        578127..579080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0633"
FT                   /product="family 577 protein"
FT                   /note="KEGG: pai:PAE2340 P.aerophilum family 577 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87811"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS79"
FT                   /protein_id="ABL87811.1"
FT                   /translation="MKIVEEINVFRYYKPFIEAAGGIGQVKKALAWSEWYAVKWWDEVF
FT                   NELGLQSIRESVFARALFISLRIRGYIREDGHIRRRPEKPEYPTNSYAIEFVELHESFD
FT                   RIGAVNVASNKADENTIAILYSTMLSQGWYKILRHTFLKLVEIEKFQTIFEPIIKEGQV
FT                   ALAVMEFHKPKMYIGFDYRRDNVELATAVLKAKPGECKDICIFNAPTSCDAVKLAKKYI
FT                   SGVDAVLMLHTLYWLLDPVKELTCIRSIIGQGGKLLIGQQVVESTPGLVALVTAMGAKH
FT                   VFSWKGVEHILKAAGYGLSRRYLRYMPYYIAIWEPK"
FT   gene            complement(579073..579756)
FT                   /locus_tag="Pisl_0634"
FT   CDS_pept        complement(579073..579756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0634"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: pai:PAE2338
FT                   ubiquinone/menaquinone biosynthesis methyltransferase
FT                   (ubiE), conjectural"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87812"
FT                   /db_xref="GOA:A1RS80"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS80"
FT                   /protein_id="ABL87812.1"
FT                   /translation="MDFGYRWRALMEAYKKIWKAYERANFIATLGNVDRWREEAVSLFY
FT                   AVDGRSPVKVLDAGAGPGNMARHLRGVRYVVALDATPEMLYVNTTADEKVVGVFEYMPF
FT                   RDKGFDLLLAGYSLHASIDIERAIAEFNRVSLYQCVVSIGNPNNKFVRKLLSIYTKFIL
FT                   PKLVCLITPKEVCKEYKKIHLIISSIPPNAKIREIVGRYSKFMLFKERGFGSVYIYFAS
FT                   SSNFT"
FT   gene            complement(579760..580086)
FT                   /locus_tag="Pisl_0635"
FT   CDS_pept        complement(579760..580086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0635"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE2337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87813"
FT                   /db_xref="GOA:A1RS81"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS81"
FT                   /protein_id="ABL87813.1"
FT                   /translation="MSGRAAISVFILDITAVLLLLFGLLVSISGLCLAKPEVVKKATLG
FT                   LIDSYTVCAKLHLGWVSLATIIIAVVHSTAGLDVWLLKSGRDYWWLWALGGGVSIWFIY
FT                   IYTA"
FT   sig_peptide     complement(579982..580086)
FT                   /locus_tag="Pisl_0635"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            580212..580925
FT                   /locus_tag="Pisl_0636"
FT   CDS_pept        580212..580925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0636"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: pai:PAE2336 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87814"
FT                   /db_xref="GOA:A1RS82"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS82"
FT                   /protein_id="ABL87814.1"
FT                   /translation="MKKATVKGAREILLPYPRLHGTVSVEEALANRRSIREFRDEPIEL
FT                   EELSQLLWAAYGISETRYGLRTAPSAGAQYPLEVYAVVGERGVKADYGYLEAGIYYYDV
FT                   YRHCLLLKKRGDYREALYRAALEQPWVLTAPVSIIFTAVYSRTVRVYGERGRVRYVPMD
FT                   LGHAGQNVYLQATALGLGTVTVGAFHDEEVREILELSPEETPLYIMPVGKPLTPYRLTE
FT                   EELIQFYQNNRKSSY"
FT   gene            complement(580922..582118)
FT                   /locus_tag="Pisl_0637"
FT   CDS_pept        complement(580922..582118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0637"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   pai:PAE2335 possible succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87815"
FT                   /db_xref="GOA:A1RS83"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS83"
FT                   /protein_id="ABL87815.1"
FT                   /translation="MEEKAVSLLRRLISIPTVNPPGEKYAEFVDFAERYFKSLGLDTEV
FT                   LEVPKSEVAKVCPECVDYPRLILIARMGEPRIHFNGHYDVVPPGPLESWKVTKPFEPLY
FT                   KDGRLYGRGAVDMKGGLTSIMLAVEKAVTAGVKNFEVSFVPDEEIGGETGAGYLARSGK
FT                   IKAPWVIIAEGSGEDNIWIGHRGLVWFMVEVYGRQAHGSTPWLGLNAFEGAAYIAYRLQ
FT                   EYIKAISTRVSKYEYEDPRGASPTITIGGEVRGSVKTNVVPGYFAFSVDRRVIPEEDIE
FT                   EVKREFIAFVEKIAKEIPHRVEVKVTNISEPALVEPNHPLVETLASAVEEVVGKKPKRT
FT                   VCIGGLDARFFIKAGIPTVTYGPGPVNLAHAPDEYVEVKQVINVAETYFRVIKKLAVR"
FT   gene            582204..583850
FT                   /locus_tag="Pisl_0638"
FT   CDS_pept        582204..583850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0638"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pai:PAE2333 medium-chain acyl-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87816"
FT                   /db_xref="GOA:A1RS84"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS84"
FT                   /protein_id="ABL87816.1"
FT                   /translation="MEKYQLTLNNVWKYIKEVFSEVEVAYLPPHGNNIRSTYGREYERS
FT                   MRLADGLRQMGVGPGDRVATLDWNTIWHFDLYWAVPGMGAVLHPLNVRLAPEDLVYIIN
FT                   HARDKVLIYHRDFAPLVEKLKPHLKSVQLYIQISDGAGPVAKDPEIEDIIKQGQPKPFP
FT                   DLNEDTVATIGYTSGTTGRPKGAYFTHRALVLHTLTSAVAFAGFRGFARPECAEEPCTF
FT                   LQLVPMFHVHGWGTPWTFALLGWRQIYPGRFDPNHTVRLIAEEKVKTMAGVPTVLYMLL
FT                   TAPDLPKYVAKIREIKPIFVVGGAALPKELAKKAAEVGFIPRVGYGMTETAPILTLGFF
FT                   RPTEKMPQDLDEYYSLLTATGLPIPLVDLAVVDENLNPVPKDGKTMGEIVVRSPWVTPE
FT                   YLGDSEKTKEAWRGGWFHTGDVAVWMPDGRVRIVDRAKDVIKSGGEWISSLQLEDLIAT
FT                   HPAVAQAAVIGVPHEKWGERPVAVVVPKPGAMVTEQEIIKHLEKFVESGKIPKWWLPDK
FT                   VIFVQQLPLTGTGKIDKKVLKEQYKDILRQS"
FT   gene            583891..584859
FT                   /locus_tag="Pisl_0639"
FT   CDS_pept        583891..584859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0639"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   pai:PAE2332 alcohol dehydrogenase (Zinc)"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87817"
FT                   /db_xref="GOA:A1RS85"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS85"
FT                   /protein_id="ABL87817.1"
FT                   /translation="MRAIQLVKFGEPREALKYVELQDPTPGPGEAVVKIEAAGVCGRDL
FT                   VVRKGAFPHVKPPVIPGHEGVGRVIDVGAGVEKDLVGMRVFLSAIYDGTCDYCRRGLEN
FT                   LCRNAELLGESRNGTYAEYVVIPARFVHPFHGVDPKVAVVATCPLATAVYALRQVDVEG
FT                   KRVLIVGAGGTGVYIAQLARVRGAEVYVSTRSVEKAKVLKELGVKIAEDRDKDFDIVID
FT                   TVGSPTLEKSFKLAKRAGTIVVIGNVTGERASISPALIILRQLKVLGSMAFRPWDIYEA
FT                   LDLLKRGLIKPLYTEYRLENAPKAHEDMERGAVVGRAVLIP"
FT   gene            584869..585627
FT                   /locus_tag="Pisl_0640"
FT   CDS_pept        584869..585627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0640"
FT                   /product="Protein of unknown function DUF516"
FT                   /note="PFAM: Protein of unknown function DUF516; KEGG:
FT                   pai:PAE2331 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87818"
FT                   /db_xref="GOA:A1RS86"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1RS86"
FT                   /protein_id="ABL87818.1"
FT                   /translation="MYVIVASLNDPVSRIFLDVIAPTPLVKTEGNIEIRKFVDFPVVVY
FT                   RGEPTDFSREDILASFGKYAIFISRHEMANPRPLFTVHTPGSWPDVSISNPPLTSSIFR
FT                   TLCKLAYEPYTCAFEATHHTPNTSYISATFVEVGSTENEWKDRKAVETLAQAVEEVLNS
FT                   QIKPNTPAMAIGDLHYVTVTDPVLKGELDLGHVIPKYVDISLQVVQNAYLKHTTPIERA
FT                   ILFKKNVKNPARSEIIEFLKSRGVEIITKG"
FT   gene            complement(585731..586000)
FT                   /locus_tag="Pisl_0641"
FT   CDS_pept        complement(585731..586000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0641"
FT                   /product="paREP12"
FT                   /note="KEGG: pai:PAE1827 paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87819"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS87"
FT                   /protein_id="ABL87819.1"
FT                   /translation="MLNNGVVINATREIIKLAREHQAAIVVDTMEDDTYRELKERSGNG
FT                   VRKHFLDGLGQLRRRLQALARWYRLPYLEERLYSMVCPRCGTKL"
FT   gene            complement(586446..586796)
FT                   /locus_tag="Pisl_0642"
FT   CDS_pept        complement(586446..586796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0642"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hsa:84630 tau tubulin kinase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87820"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS88"
FT                   /protein_id="ABL87820.1"
FT                   /translation="MSKPSLFSRPPDVHMSQTQLPIEKKLIENAICELGGKLVNVETCD
FT                   GNVVYIETTEDSGCFALIPDPFAPQHPIPVSCEEYCKKEEDEEEEELWEEFEEEWEQED
FT                   EWEEEWEEEEEW"
FT   gene            complement(587166..587513)
FT                   /locus_tag="Pisl_0643"
FT   CDS_pept        complement(587166..587513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87821"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS89"
FT                   /protein_id="ABL87821.1"
FT                   /translation="MTQIMEREKFWDFVRENGLVLLKPLRLLQVGALDVAYNYSPVAAV
FT                   LLRPVRQANFNVARCVYDYDPDADSYSNIFCGERKLLCVGQDRDVCIDPAYFSVAYRAV
FT                   KAGGFYLVTPL"
FT   gene            587666..588928
FT                   /locus_tag="Pisl_0644"
FT   CDS_pept        587666..588928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0644"
FT                   /product="transposase, IS605 OrfB"
FT                   /note="PFAM: transposase, IS605 OrfB; KEGG: pai:PAE2522
FT                   paREP12"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87822"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS90"
FT                   /protein_id="ABL87822.1"
FT                   /translation="MSQVYRTLKIRIPWRLVEERPDVLDLAVRMHLAVEEYAKKLLKEL
FT                   TGQEELRLTAEELDRLLTPDRRELAVKIIDEVFPKYGLKRYFIDQAKFFWRDTAFWRAI
FT                   PLNAQLRVENERDTSKAVFVDLESGVVRVRKLGIPPFAVKLKKGNVAWIRERLEEGARL
FT                   KLAFLGVERRRGKEPTYGKLYVALVFAREATPVEPRALVVVDVNRLDHGVVVGLLVDGK
FT                   IVKRKRLPDERAVKKLWKLHRKIGRLDARAARETDLTRRSFLESRARYLKSKRYRKIRA
FT                   IVEQIASEIVKLAREHQAAIVVDTMDYETYIARKQSGESGDKKHLYDGLGQLRRRLKDL
FT                   AQWYGLPYLEERLYSTVCPRCGAKMKREKKRIMCCPSCGFSDTRDNIPLLWAKRRYWEI
FT                   LQKIKQPVFSSVPAPLTLLTS"
FT   gene            complement(589869..590906)
FT                   /locus_tag="Pisl_0645"
FT   CDS_pept        complement(589869..590906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0645"
FT                   /product="electron transfer flavoprotein, alpha subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   electron transfer flavoprotein, alpha subunit; KEGG:
FT                   pai:PAE0721 electron transfer flavoprotein alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87823"
FT                   /db_xref="GOA:A1RS91"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS91"
FT                   /protein_id="ABL87823.1"
FT                   /translation="MPCSLWPPIKKEEYKGVWVYLEREGDRLKDVGLELLGKARDLAQK
FT                   LGGAEVGGVIVAGTEEMAREAIYHGADKVVIIDNPELKIYTPKEYAEAIATVVQKYKPE
FT                   IFLIGATKRGRELAAYIANTLTTGITADCTALEIDPKTRDLMQIRPTFGGTQLATIKTP
FT                   QRRPQMASVRPGVFPKPPRDTNRTGEIIIEKVEVTRKTRLISVEKRLEKDVADLPPVES
FT                   ADVVVAGGRGLGSADGFKLLIELAKLLGGTVGASLMAVRAGWAPHTRQIGQTGKTIRPR
FT                   LYIAVGISGAIQHLMGILEAKTIVAINPDPHAPIMENADYAVVGDYKQIIPLLIEEIKR
FT                   LKNQQ"
FT   gene            complement(590909..591703)
FT                   /locus_tag="Pisl_0646"
FT   CDS_pept        complement(590909..591703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0646"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="PFAM: electron transfer flavoprotein beta-subunit;
FT                   KEGG: pai:PAE0722 electron transfer flavoprotein beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87824"
FT                   /db_xref="GOA:A1RS92"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS92"
FT                   /protein_id="ABL87824.1"
FT                   /translation="MKIVVLTKAAVPLSSAIKIDPKTGTLVREGVPLTVNVWDRDAVEF
FT                   ALKLRDRYGGEVIALSMAPPSGIPALESLIGMGVDRAILASDRVFAGADTWATAYVLAK
FT                   TIEKYIPDYDLVVAGEETIDSTTAHIGAQTASWLGVPYVYYVYDAEVKGRTLIVRRFLE
FT                   DEGVDEVYEVEMPAVISILKGSQVPREIKLSRKLNARERIQIVSNKELNLEQDCVGLRG
FT                   SPTMVAGMAPATYPPRKKVVIQGEPREVVKKIIEILKQEGVL"
FT   gene            complement(591708..591998)
FT                   /locus_tag="Pisl_0647"
FT   CDS_pept        complement(591708..591998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0647"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: pai:PAE0723 ferredoxin like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87825"
FT                   /db_xref="GOA:A1RS93"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS93"
FT                   /protein_id="ABL87825.1"
FT                   /translation="MSLKYFTIEERLNANAWDVDIHRPHIKIKDLEQCRKCEKKPCTYM
FT                   CPAKCYVQQGDYVVLSTEACVECGTCRVVCPYNNIEWNYPRSGMGIWYRFT"
FT   gene            complement(591995..593269)
FT                   /locus_tag="Pisl_0648"
FT   CDS_pept        complement(591995..593269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0648"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding; HI0933 family
FT                   protein; FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   pai:PAE0725 electron transfer flavoprotein-quinone
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87826"
FT                   /db_xref="GOA:A1RS94"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS94"
FT                   /protein_id="ABL87826.1"
FT                   /translation="MKFDVAIVGAGPAGLAAAYKLASAGFKVVVLERGREPGAKELYGG
FT                   RIYAYWLDKYLPEFRKDAPVDRWVRKERVTFLTDDKALTLEFSIVEKEKTSFIVPLVSF
FT                   VSWMAKLAQNAGAKIVTEITVDRLVKDDKGRFIGVQSGSDTLHADYVIDAEGVNRLLLE
FT                   RAGIVRKLEPEVVAVGVKEVLKFENKKTLEERLGLGEDEGLAWAIAGYPTEYLPGGGFI
FT                   YTYKDSLALGVVVYLRNWSKLKTPVYDLAERLRLHPYIAPLVKGATLQEYGGHMTPVAG
FT                   INMPPPRLYYDGLLIVGDAAGFLLHTGVLIRGVDFAIASGVLAAEAIREARSPSAEDLS
FT                   IYEKKLRNSFILPQLEKYRKADRLLSDETLFRDLTLLSTETAHKYFNVDENHRTLFEAL
FT                   RDASKKTKVNLVKLMINMLRMAKSL"
FT   gene            593374..594063
FT                   /locus_tag="Pisl_0649"
FT   CDS_pept        593374..594063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0649"
FT                   /product="molybdopterin synthase subunit MoaD /
FT                   molybdopterin synthase subunit MoaE"
FT                   /note="TIGRFAM: MoaD family protein; PFAM: molybdopterin
FT                   biosynthesis MoaE; thiamineS protein; KEGG: pai:PAE0727
FT                   molybdenum cofactor biosynthesis protein D/E"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87827"
FT                   /db_xref="GOA:A1RS95"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010038"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS95"
FT                   /protein_id="ABL87827.1"
FT                   /translation="MRIVIKYFSVLRDITGKIREELDLKNGTSMSQLIEWFFKTYPKAE
FT                   VFREELLILVNGRTVDNNYILKDGDEVAFMPPVSGGGKIIQGSLDLNREVADIIGKTAL
FT                   QGGGGVVIFVGYVKGKVNGAWVNTLEYEAYEPYASFKIDEIEKWAREQEGVLDVRIYHV
FT                   VGSLKPGDTTIYVFVSAINRDIAFKVAREALERVKHEVPIFKLERRDDGEFWVLGDGKR
FT                   VPRSPQS"
FT   gene            complement(594044..594427)
FT                   /locus_tag="Pisl_0650"
FT   CDS_pept        complement(594044..594427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0650"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pai:PAE0728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87828"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS96"
FT                   /protein_id="ABL87828.1"
FT                   /translation="MVNVLEEKVRSLNKLRVYMLIESTSSDIGREIGNFFSEALIRPVE
FT                   VRAGGIHIALSFLWSLLSRVARQLEEVGEQVIDIEFDHGKTTVVTKSGYAINIVIKVKQ
FT                   NQYVSEIEGFVDVEESPFKIEDF"
FT   gene            594547..595323
FT                   /locus_tag="Pisl_0651"
FT   CDS_pept        594547..595323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pisl_0651"
FT                   /product="putative circadian clock protein, KaiC"
FT                   /note="PFAM: KaiC domain protein; KEGG: pai:PAE0729
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pisl_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABL87829"
FT                   /db_xref="GOA:A1RS97"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1RS97"
FT                   /protein_id="ABL87829.