(data stored in ACNUC7421 zone)

EMBL: CP000509

ID   CP000509; SV 1; circular; genomic DNA; STD; PRO; 4985871 BP.
XX
AC   CP000509; AAJB01000000-AAJB01000197;
XX
PR   Project:PRJNA12738;
XX
DT   20-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 7)
XX
DE   Nocardioides sp. JS614, complete genome.
XX
KW   .
XX
OS   Nocardioides sp. JS614
OC   Bacteria; Actinobacteria; Propionibacteriales; Nocardioidaceae;
OC   Nocardioides.
XX
RN   [1]
RP   1-4985871
RX   DOI; 10.1128/JB.05109-11.
RX   PUBMED; 21551312.
RA   Coleman N.V., Wilson N.L., Barry K., Brettin T.S., Bruce D.C., Copeland A.,
RA   Dalin E., Detter J.C., Del Rio T.G., Goodwin L.A., Hammon N.M., Han S.,
RA   Hauser L.J., Israni S., Kim E., Kyrpides N., Land M.L., Lapidus A.,
RA   Larimer F.W., Lucas S., Pitluck S., Richardson P., Schmutz J., Tapia R.,
RA   Thompson S., Tice H.N., Spain J.C., Gossett J.G., Mattes T.E.;
RT   "Genome Sequence of the ethene- and vinyl chloride-oxidizing actinomycete
RT   Nocardioides sp. strain JS614";
RL   J. Bacteriol. 193(13):3399-3400(2011).
XX
RN   [2]
RP   1-4985871
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Thompson L.S., Brettin T., Bruce D., Han C., Tapia R., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Mattes T., Gossett J.,
RA   Richardson P.;
RT   "Complete sequence of Chromosome1 of Nocardioides sp. JS614";
RL   Unpublished.
XX
RN   [3]
RP   1-4985871
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Thompson L.S., Brettin T., Bruce D., Han C., Tapia R., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Mattes T., Gossett J.,
RA   Richardson P.;
RT   ;
RL   Submitted (14-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 39d166b1219b8df4fae36ea2cff93ffb.
DR   BioSample; SAMN02598280.
DR   EnsemblGenomes-Gn; EBG00001168503.
DR   EnsemblGenomes-Gn; EBG00001168504.
DR   EnsemblGenomes-Gn; EBG00001168505.
DR   EnsemblGenomes-Gn; EBG00001168506.
DR   EnsemblGenomes-Gn; EBG00001168507.
DR   EnsemblGenomes-Gn; EBG00001168508.
DR   EnsemblGenomes-Gn; EBG00001168509.
DR   EnsemblGenomes-Gn; EBG00001168510.
DR   EnsemblGenomes-Gn; EBG00001168511.
DR   EnsemblGenomes-Gn; EBG00001168512.
DR   EnsemblGenomes-Gn; EBG00001168513.
DR   EnsemblGenomes-Gn; EBG00001168514.
DR   EnsemblGenomes-Gn; EBG00001168515.
DR   EnsemblGenomes-Gn; EBG00001168516.
DR   EnsemblGenomes-Gn; EBG00001168517.
DR   EnsemblGenomes-Gn; EBG00001168518.
DR   EnsemblGenomes-Gn; EBG00001168519.
DR   EnsemblGenomes-Gn; EBG00001168520.
DR   EnsemblGenomes-Gn; EBG00001168521.
DR   EnsemblGenomes-Gn; EBG00001168522.
DR   EnsemblGenomes-Gn; EBG00001168523.
DR   EnsemblGenomes-Gn; EBG00001168524.
DR   EnsemblGenomes-Gn; EBG00001168525.
DR   EnsemblGenomes-Gn; EBG00001168526.
DR   EnsemblGenomes-Gn; EBG00001168527.
DR   EnsemblGenomes-Gn; EBG00001168528.
DR   EnsemblGenomes-Gn; EBG00001168529.
DR   EnsemblGenomes-Gn; EBG00001168530.
DR   EnsemblGenomes-Gn; EBG00001168531.
DR   EnsemblGenomes-Gn; EBG00001168532.
DR   EnsemblGenomes-Gn; EBG00001168533.
DR   EnsemblGenomes-Gn; EBG00001168534.
DR   EnsemblGenomes-Gn; EBG00001168535.
DR   EnsemblGenomes-Gn; EBG00001168536.
DR   EnsemblGenomes-Gn; EBG00001168537.
DR   EnsemblGenomes-Gn; EBG00001168538.
DR   EnsemblGenomes-Gn; EBG00001168539.
DR   EnsemblGenomes-Gn; EBG00001168540.
DR   EnsemblGenomes-Gn; EBG00001168541.
DR   EnsemblGenomes-Gn; EBG00001168542.
DR   EnsemblGenomes-Gn; EBG00001168543.
DR   EnsemblGenomes-Gn; EBG00001168544.
DR   EnsemblGenomes-Gn; EBG00001168545.
DR   EnsemblGenomes-Gn; EBG00001168546.
DR   EnsemblGenomes-Gn; EBG00001168547.
DR   EnsemblGenomes-Gn; EBG00001168548.
DR   EnsemblGenomes-Gn; EBG00001168549.
DR   EnsemblGenomes-Gn; EBG00001168550.
DR   EnsemblGenomes-Gn; EBG00001168551.
DR   EnsemblGenomes-Gn; EBG00001168552.
DR   EnsemblGenomes-Gn; EBG00001168553.
DR   EnsemblGenomes-Gn; EBG00001168554.
DR   EnsemblGenomes-Gn; EBG00001168555.
DR   EnsemblGenomes-Gn; EBG00001168556.
DR   EnsemblGenomes-Gn; EBG00001168557.
DR   EnsemblGenomes-Gn; EBG00001168558.
DR   EnsemblGenomes-Gn; EBG00001168559.
DR   EnsemblGenomes-Gn; EBG00001168560.
DR   EnsemblGenomes-Gn; EBG00001168561.
DR   EnsemblGenomes-Gn; Noca_R0001.
DR   EnsemblGenomes-Gn; Noca_R0002.
DR   EnsemblGenomes-Gn; Noca_R0003.
DR   EnsemblGenomes-Gn; Noca_R0004.
DR   EnsemblGenomes-Gn; Noca_R0005.
DR   EnsemblGenomes-Gn; Noca_R0006.
DR   EnsemblGenomes-Gn; Noca_R0007.
DR   EnsemblGenomes-Gn; Noca_R0008.
DR   EnsemblGenomes-Gn; Noca_R0009.
DR   EnsemblGenomes-Gn; Noca_R0010.
DR   EnsemblGenomes-Gn; Noca_R0011.
DR   EnsemblGenomes-Gn; Noca_R0012.
DR   EnsemblGenomes-Gn; Noca_R0013.
DR   EnsemblGenomes-Gn; Noca_R0014.
DR   EnsemblGenomes-Gn; Noca_R0015.
DR   EnsemblGenomes-Gn; Noca_R0016.
DR   EnsemblGenomes-Gn; Noca_R0017.
DR   EnsemblGenomes-Gn; Noca_R0018.
DR   EnsemblGenomes-Gn; Noca_R0019.
DR   EnsemblGenomes-Gn; Noca_R0021.
DR   EnsemblGenomes-Gn; Noca_R0022.
DR   EnsemblGenomes-Gn; Noca_R0023.
DR   EnsemblGenomes-Gn; Noca_R0024.
DR   EnsemblGenomes-Gn; Noca_R0025.
DR   EnsemblGenomes-Gn; Noca_R0026.
DR   EnsemblGenomes-Gn; Noca_R0027.
DR   EnsemblGenomes-Gn; Noca_R0028.
DR   EnsemblGenomes-Gn; Noca_R0029.
DR   EnsemblGenomes-Gn; Noca_R0030.
DR   EnsemblGenomes-Gn; Noca_R0031.
DR   EnsemblGenomes-Gn; Noca_R0032.
DR   EnsemblGenomes-Gn; Noca_R0033.
DR   EnsemblGenomes-Gn; Noca_R0034.
DR   EnsemblGenomes-Gn; Noca_R0035.
DR   EnsemblGenomes-Gn; Noca_R0036.
DR   EnsemblGenomes-Gn; Noca_R0037.
DR   EnsemblGenomes-Gn; Noca_R0038.
DR   EnsemblGenomes-Gn; Noca_R0039.
DR   EnsemblGenomes-Gn; Noca_R0040.
DR   EnsemblGenomes-Gn; Noca_R0041.
DR   EnsemblGenomes-Gn; Noca_R0042.
DR   EnsemblGenomes-Gn; Noca_R0043.
DR   EnsemblGenomes-Gn; Noca_R0044.
DR   EnsemblGenomes-Gn; Noca_R0045.
DR   EnsemblGenomes-Gn; Noca_R0046.
DR   EnsemblGenomes-Gn; Noca_R0048.
DR   EnsemblGenomes-Gn; Noca_R0049.
DR   EnsemblGenomes-Gn; Noca_R0050.
DR   EnsemblGenomes-Gn; Noca_R0051.
DR   EnsemblGenomes-Gn; Noca_R0053.
DR   EnsemblGenomes-Gn; Noca_R0054.
DR   EnsemblGenomes-Gn; Noca_R0055.
DR   EnsemblGenomes-Gn; Noca_R0056.
DR   EnsemblGenomes-Gn; Noca_R0057.
DR   EnsemblGenomes-Gn; Noca_R0058.
DR   EnsemblGenomes-Tr; EBT00001735793.
DR   EnsemblGenomes-Tr; EBT00001735794.
DR   EnsemblGenomes-Tr; EBT00001735795.
DR   EnsemblGenomes-Tr; EBT00001735796.
DR   EnsemblGenomes-Tr; EBT00001735797.
DR   EnsemblGenomes-Tr; EBT00001735798.
DR   EnsemblGenomes-Tr; EBT00001735799.
DR   EnsemblGenomes-Tr; EBT00001735800.
DR   EnsemblGenomes-Tr; EBT00001735801.
DR   EnsemblGenomes-Tr; EBT00001735802.
DR   EnsemblGenomes-Tr; EBT00001735803.
DR   EnsemblGenomes-Tr; EBT00001735804.
DR   EnsemblGenomes-Tr; EBT00001735805.
DR   EnsemblGenomes-Tr; EBT00001735806.
DR   EnsemblGenomes-Tr; EBT00001735807.
DR   EnsemblGenomes-Tr; EBT00001735808.
DR   EnsemblGenomes-Tr; EBT00001735809.
DR   EnsemblGenomes-Tr; EBT00001735810.
DR   EnsemblGenomes-Tr; EBT00001735811.
DR   EnsemblGenomes-Tr; EBT00001735812.
DR   EnsemblGenomes-Tr; EBT00001735813.
DR   EnsemblGenomes-Tr; EBT00001735814.
DR   EnsemblGenomes-Tr; EBT00001735815.
DR   EnsemblGenomes-Tr; EBT00001735816.
DR   EnsemblGenomes-Tr; EBT00001735817.
DR   EnsemblGenomes-Tr; EBT00001735818.
DR   EnsemblGenomes-Tr; EBT00001735819.
DR   EnsemblGenomes-Tr; EBT00001735820.
DR   EnsemblGenomes-Tr; EBT00001735821.
DR   EnsemblGenomes-Tr; EBT00001735822.
DR   EnsemblGenomes-Tr; EBT00001735823.
DR   EnsemblGenomes-Tr; EBT00001735824.
DR   EnsemblGenomes-Tr; EBT00001735825.
DR   EnsemblGenomes-Tr; EBT00001735826.
DR   EnsemblGenomes-Tr; EBT00001735827.
DR   EnsemblGenomes-Tr; EBT00001735828.
DR   EnsemblGenomes-Tr; EBT00001735829.
DR   EnsemblGenomes-Tr; EBT00001735830.
DR   EnsemblGenomes-Tr; EBT00001735831.
DR   EnsemblGenomes-Tr; EBT00001735832.
DR   EnsemblGenomes-Tr; EBT00001735833.
DR   EnsemblGenomes-Tr; EBT00001735834.
DR   EnsemblGenomes-Tr; EBT00001735835.
DR   EnsemblGenomes-Tr; EBT00001735836.
DR   EnsemblGenomes-Tr; EBT00001735837.
DR   EnsemblGenomes-Tr; EBT00001735838.
DR   EnsemblGenomes-Tr; EBT00001735839.
DR   EnsemblGenomes-Tr; EBT00001735840.
DR   EnsemblGenomes-Tr; EBT00001735841.
DR   EnsemblGenomes-Tr; EBT00001735842.
DR   EnsemblGenomes-Tr; EBT00001735843.
DR   EnsemblGenomes-Tr; EBT00001735844.
DR   EnsemblGenomes-Tr; EBT00001735845.
DR   EnsemblGenomes-Tr; EBT00001735846.
DR   EnsemblGenomes-Tr; EBT00001735847.
DR   EnsemblGenomes-Tr; EBT00001735848.
DR   EnsemblGenomes-Tr; EBT00001735849.
DR   EnsemblGenomes-Tr; EBT00001735850.
DR   EnsemblGenomes-Tr; EBT00001735851.
DR   EnsemblGenomes-Tr; Noca_R0001-1.
DR   EnsemblGenomes-Tr; Noca_R0002-1.
DR   EnsemblGenomes-Tr; Noca_R0003-1.
DR   EnsemblGenomes-Tr; Noca_R0004-1.
DR   EnsemblGenomes-Tr; Noca_R0005-1.
DR   EnsemblGenomes-Tr; Noca_R0006-1.
DR   EnsemblGenomes-Tr; Noca_R0007-1.
DR   EnsemblGenomes-Tr; Noca_R0008-1.
DR   EnsemblGenomes-Tr; Noca_R0009-1.
DR   EnsemblGenomes-Tr; Noca_R0010-1.
DR   EnsemblGenomes-Tr; Noca_R0011-1.
DR   EnsemblGenomes-Tr; Noca_R0012-1.
DR   EnsemblGenomes-Tr; Noca_R0013-1.
DR   EnsemblGenomes-Tr; Noca_R0014-1.
DR   EnsemblGenomes-Tr; Noca_R0015-1.
DR   EnsemblGenomes-Tr; Noca_R0016-1.
DR   EnsemblGenomes-Tr; Noca_R0017-1.
DR   EnsemblGenomes-Tr; Noca_R0018-1.
DR   EnsemblGenomes-Tr; Noca_R0019-1.
DR   EnsemblGenomes-Tr; Noca_R0021-1.
DR   EnsemblGenomes-Tr; Noca_R0022-1.
DR   EnsemblGenomes-Tr; Noca_R0023-1.
DR   EnsemblGenomes-Tr; Noca_R0024-1.
DR   EnsemblGenomes-Tr; Noca_R0025-1.
DR   EnsemblGenomes-Tr; Noca_R0026-1.
DR   EnsemblGenomes-Tr; Noca_R0027-1.
DR   EnsemblGenomes-Tr; Noca_R0028-1.
DR   EnsemblGenomes-Tr; Noca_R0029-1.
DR   EnsemblGenomes-Tr; Noca_R0030-1.
DR   EnsemblGenomes-Tr; Noca_R0031-1.
DR   EnsemblGenomes-Tr; Noca_R0032-1.
DR   EnsemblGenomes-Tr; Noca_R0033-1.
DR   EnsemblGenomes-Tr; Noca_R0034-1.
DR   EnsemblGenomes-Tr; Noca_R0035-1.
DR   EnsemblGenomes-Tr; Noca_R0036-1.
DR   EnsemblGenomes-Tr; Noca_R0037-1.
DR   EnsemblGenomes-Tr; Noca_R0038-1.
DR   EnsemblGenomes-Tr; Noca_R0039-1.
DR   EnsemblGenomes-Tr; Noca_R0040-1.
DR   EnsemblGenomes-Tr; Noca_R0041-1.
DR   EnsemblGenomes-Tr; Noca_R0042-1.
DR   EnsemblGenomes-Tr; Noca_R0043-1.
DR   EnsemblGenomes-Tr; Noca_R0044-1.
DR   EnsemblGenomes-Tr; Noca_R0045-1.
DR   EnsemblGenomes-Tr; Noca_R0046-1.
DR   EnsemblGenomes-Tr; Noca_R0048-1.
DR   EnsemblGenomes-Tr; Noca_R0049-1.
DR   EnsemblGenomes-Tr; Noca_R0050-1.
DR   EnsemblGenomes-Tr; Noca_R0051-1.
DR   EnsemblGenomes-Tr; Noca_R0053-1.
DR   EnsemblGenomes-Tr; Noca_R0054-1.
DR   EnsemblGenomes-Tr; Noca_R0055-1.
DR   EnsemblGenomes-Tr; Noca_R0056-1.
DR   EnsemblGenomes-Tr; Noca_R0057-1.
DR   EnsemblGenomes-Tr; Noca_R0058-1.
DR   EuropePMC; PMC3133255; 21551312.
DR   EuropePMC; PMC3156400.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000509.
DR   SILVA-SSU; CP000509.
DR   StrainInfo; 352430; 0.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 3634503
CC   Source DNA and bacteria available from James Gossett
CC   (jmg18@cornell.edu)
CC   Contacts: James Gossett (jmg18@cornell.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4985871
FT                   /organism="Nocardioides sp. JS614"
FT                   /strain="JS614"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:196162"
FT   gene            72..1658
FT                   /locus_tag="Noca_0001"
FT   CDS_pept        72..1658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79551"
FT                   /db_xref="GOA:A1SCL6"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL6"
FT                   /protein_id="ABL79551.1"
FT                   /translation="MGIPGDGQDDREMTQKAGAVDQSTSDLGVAWRGVVNDLQPNQRAW
FT                   LRASEPVTLHESTAIVAVPNDFTRNQLEGRLRAQLEDALTVRFGREIRIAVTVNPQLED
FT                   APVAPGDRTDSATGRTDSGTDLAGGGHPEAPGQAPITRRTTQSLNRYDDMSTNSAAERS
FT                   AVVPVPPAPEPDLGARPSSLETRLNPKYTFETFVIGSSNRFPHAAAVAVAEAPGKAYNP
FT                   LLVYGDSGLGKTHLLHAIGHYVRSLYTGAKVRYVSSEEFTNEFINAIRDDRQDRFKRRY
FT                   RDVDVLLIDDIQFLEGKTQTQEEFFHTFNTLHNANKQIVLTSDRAPKRLEALEDRLRNR
FT                   FEWGLITDVQPPDLETRIAILRKKAAMDRLTAPPDVLEFIASKIQTNIRELEGALIRVT
FT                   AFANLNRQEVDMTLAEIVLKDLIPEGGEPEITAALIIAQTAAYFGLSIDELTGPSRGRH
FT                   LVMARQIAMYLCRELTDLSLPKIGAQFGNRDHTTVMYADRKINQLLAERRAVFNQVSEL
FT                   TNRVKLQARQS"
FT   gene            2029..3255
FT                   /locus_tag="Noca_0002"
FT   CDS_pept        2029..3255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sma:SAV4317 putative DNA polymerase III beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79552"
FT                   /db_xref="GOA:A1SCL7"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL7"
FT                   /protein_id="ABL79552.1"
FT                   /translation="MQSPERALLPPPFNPRSTLAPPSRPEGTIVKFRVERDVLADAVAW
FT                   AARSLPVRPSVPVLAGLLVEASDDGLVLSTFDYETSARATLTAEVSDEGQALVSGRLLA
FT                   DICRSLPAKPVEMVLDGARVSLTCGSARFSLQTMPVDDYPSLPSMPAATGTVQSEAFAH
FT                   AVAQAVTAAGRDDMLPVLTGVRIEIDGSTISLLATDRFRLSHRELEWSPRTPDESAAAL
FT                   VPARVLGDTAKSLTGGGEVTIALATTGSGEGIIGFEGHGPGGLRRTTTRLLDGEFPKVR
FT                   SLFPNEHQTTALVDKAALVESVKRVALVAERNTAVQLAFSDGVLTLDAGSGDEAQASES
FT                   IEATIDGEDITTGFNPQFLLDGLTAIDQPVVELAFTQASKPVVISGAVDGDDTDSSFRY
FT                   LLMPRRLLS"
FT   gene            3332..4237
FT                   /locus_tag="Noca_0003"
FT   CDS_pept        3332..4237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: sco:SCO3877 putative 6-phosphogluconate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79553"
FT                   /db_xref="GOA:A1SCL8"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCL8"
FT                   /protein_id="ABL79553.1"
FT                   /translation="MHIGLVGLGKMGGNMRTRLRDAGHTVVGFDRNPDLADVDSLEAMV
FT                   EQLPSPKVVWVMVPAGDPTRETIRRLGELLDEGDLVVDGGNSKWTDDQENADLLAQRGV
FT                   GFVDCGVSGGVWGAKFGYALMCGGSDEDVAKVQPAFDALKPDEGGFVHAGKKVGAGHFA
FT                   KMVHNGIEYAMMQSYAEGWELLEKVDLVDNVTEVFDSWRSGTVIRSWLLDLLVTALEED
FT                   GHLDQITGYADDSGEGRWTVQAAIDNAVPMHVIAASLFARFTSRQDDSPAMKAVAAMRN
FT                   QFGGHAVHTEPPVGGDANPG"
FT   gene            4254..5516
FT                   /locus_tag="Noca_0004"
FT   CDS_pept        4254..5516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: sma:SAV4319 putative DNA
FT                   recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79554"
FT                   /db_xref="GOA:A1SCL9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCL9"
FT                   /protein_id="ABL79554.1"
FT                   /translation="MYVAHLSLHDFRSYATAEVELSPGVTAFIGRNGQGKTNLVEAIDY
FT                   LSRLSSHRVASDAPLVRAGADQAVVRAAVVRDGRTAVLEVELNPGRSNRARVNRSPLPR
FT                   ARDLVGLVRTVVFSPEDLTLVKGDPADRRRFLDDLLVLRVPRLAGVRADYDRVLRQRNT
FT                   LLKTARKGGFARKGGFARKGGFAPLGPPEGRPEGPPEGRTGGSATSGPPSRSVALDTLA
FT                   VWDAHLARTGAELLAERLALVEALRPYVGKAYETVARGATRDDAEIDYKPSFDLEGRTG
FT                   RDDLVEALLAEVERRRGDELDRGVSLVGPHRDELLLTLGHGSPDSRLPVKGYASHGESW
FT                   SFALALRLAAYDLLRADGDDPILILDDVFAELDTERRAQLADLVAGAEQVLVTAAVAAD
FT                   VPAGLAGARFAVGNGEVLREQ"
FT   gene            5506..6072
FT                   /locus_tag="Noca_0005"
FT   CDS_pept        5506..6072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   sco:SCO3875 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79555"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM0"
FT                   /protein_id="ABL79555.1"
FT                   /translation="MSSDEPLGSQPADLPAPAGGAEAPEHHDDGLDLAKALTRATARST
FT                   PAARKRLRKKDTPRRGRASGAHPDDRDPQLLDATLSRLVDDHGWELDLRVHGVFGRWAE
FT                   LVGAEVARHTTPESFTDGRLVVRTDSTAWATQLRLLAPTVVRRLNEELGHGTVTVIEVL
FT                   GPHGPTWKKGPRSVRDGRGPRDTYG"
FT   gene            6391..8526
FT                   /locus_tag="Noca_0006"
FT   CDS_pept        6391..8526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pac:PPA0009 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79556"
FT                   /db_xref="GOA:A1SCM1"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM1"
FT                   /protein_id="ABL79556.1"
FT                   /translation="MSDETPIENPAEGGSGTAAAEATDRRPNGVDYDASAIQVLEGLEA
FT                   VRKRPGMYIGSTGERGLHHLIWEIVDNAVDEALAGYCDRIVLTLLADGGIRVEDNGRGI
FT                   PTGTAPGQELPALTLALTVLHAGGKFGGGGYKVSGGLHGVGVSVVNALSTRLVAEVKNR
FT                   GHLWRQSFSAGVPDGELEQVRPVEPDEGTGTTITYWASPDIFETTTHSLETITSRIREY
FT                   AFLNKGLEIVVRDERPAAAEIVDAVEDDTVDPDHRGGIDDAGHDAIKRGEGGALEQIFK
FT                   YDRGLIDYVEHLNRRKTAANPTVIAFEAETPESVENHMSLEVAMQWNTSFSESVHTFAN
FT                   TINTHEGGTHEEGFRAALTSLVNNWGFEWGLMKKPEDRVSGDDIREGLTAIISIKLGEP
FT                   QFEGQTKTKLGNTEAKGFVQRLVNDQLGAWLEQNPAEGRDIVRKAQAAASARIAARKAR
FT                   DLARSRKGLLGGGGLPGKLSDCQSTNPAECEVFIVEGDSAGGSARQGRDPRIQAILPIR
FT                   GKILNVEKARIDKVLSNQEVQSIISALGTGIQDEFDIEKLRYHKVVLMADADVDGHHIN
FT                   TLLLTLLFRFMKPLIEGGYVYMAQPPLYRLRWNKPHEHEFVYSDAERDALLRAGQEAGK
FT                   KLPKENPVQRYKGLGEMNAKELWETTMDPEQRLMLQVTLDDAAHADEIFSILMGEDVEQ
FT                   RRSFIQRNAKDVRFLDI"
FT   gene            8578..11346
FT                   /locus_tag="Noca_0007"
FT   CDS_pept        8578..11346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV, subunit A; DNA gyrase C-terminal
FT                   repeat, beta-propeller; KEGG: pac:PPA0010 DNA gyrase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79557"
FT                   /db_xref="GOA:A1SCM2"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCM2"
FT                   /protein_id="ABL79557.1"
FT                   /translation="MTETPTDGGSTPPSDGGGPGGRIEPVELQTSMQRAYIDYAMAVIV
FT                   GRALPDVRDGLKPVHRRVLYAMYDGGYRPDRGFSKCSRVVGDVMGQYHPHGDTAIYDTL
FT                   VRLAQPWVMRAPLIHGQGNFGSPGNDSAAAMRYTECRMAPLAMEMVRDINEDTVDFQPN
FT                   YDGRSQEPVVLPARFPNLLVNGSAGIAVGMATNIPPHNLREVAEGARWALEHPDATREE
FT                   LQDALIERIKGPDFPNGALIVGRQGIEQAYRTGRGSITQRAVIEVDEDAKGRTNLVITE
FT                   LPYMVNPDNLALKIAELADSGKVQGISDVRDDTSDRTGQRLVVVLKRDAVARVVLNNLL
FT                   KHTELQTNFSANMLALVDGVPRTLAIDQFISNWVTHQIDVIRRRTEYRLAEAEKRAHVL
FT                   RGLVKALDMLDEVIALIRRSPDVAEAREGLIALLDIDEVQATAILDMQLRQLAALQRQK
FT                   IIDDLAEIEARIADLKDILANVARQRQIVADELAEIVERYGDDRRSQIIAADGDLSMED
FT                   LIPDEELVVSITRGGYAKRTRADQYRTQRRGGKGVRGATLRGDDVVEHFIATTNHHWLL
FT                   FFTTAGRVYRTKAYNLPEASRDAKGGHVAGLLSFQPDENIAQVLAIRDYDQAPYLVLAT
FT                   RDGLVKKTRLGDYNSPRQAGVIAINFRSEDDELIGAELVNPEDHILLVSRKGQSVRFQA
FT                   DDSQLRPMGRATGGVTGMKFRDGDSLLSMSVIRAAQVEAEEAAEASGESVEEMAETRGQ
FT                   WFGLHPQYVFTITDGGFAKRTQIPEYRVQSRGGIGIRAMKLANEDRGELVGAFIVEDGD
FT                   EILSITSGGQVVRSPIDENFRPTGRSTMGVKFVTPKKGDSVAVVARSVEANGDDELDEL
FT                   DESALDEGGAEGGEVDESADAGTDATIDGSAASDVARTEGDTEPDPGESDG"
FT   gene            11346..11864
FT                   /locus_tag="Noca_0008"
FT   CDS_pept        11346..11864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79558"
FT                   /db_xref="GOA:A1SCM3"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM3"
FT                   /protein_id="ABL79558.1"
FT                   /translation="MTDRQDTAVRAPLGERISAKLSNAADEHRANAQPESRQAAAKAAA
FT                   GGRPPRRARLRLTRVDPWSVMKTAFLLAVAFAVVAVVAVFIIWSVLAAAGVWDSINDTV
FT                   RDVVGGEDAANWDVEKYVGLSRVMGFTMLVSVVDVVLITAIATLSAFLYNMSAALVGGV
FT                   ELTLAEDDR"
FT   gene            11935..12008
FT                   /locus_tag="Noca_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11935..12008
FT                   /locus_tag="Noca_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12276..12351
FT                   /locus_tag="Noca_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12276..12351
FT                   /locus_tag="Noca_R0002"
FT                   /product="tRNA-Ala"
FT   gene            12546..13964
FT                   /locus_tag="Noca_0009"
FT   CDS_pept        12546..13964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0009"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   cef:CE1215 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79559"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM4"
FT                   /protein_id="ABL79559.1"
FT                   /translation="MADASPAEVRAVLDALGSGRVSSIFEKLERDQAPTLLTAPAQVRG
FT                   FRVRLDLHGAKPPVWRRLELPGDLSLPRVHAAIQAAMGWTNSHLHRFRTGCDRSSASFV
FT                   TQFDVDEGDEGTLEDDVRLDQLLAENGDELWYEYDFGDGWDHVLVVEEVLEEPPSTVRC
FT                   TGGRSACPPEDCGGLGGYQELAAWVRSGYDDGQLPDVFDDAEDARAWLPLDWHPDEFEV
FT                   EDADAAVAAAAAELVAVSGELAGLAAQLDRHGILLLRQVLSRPSSHGPIEVADAEAGRL
FT                   TETYRTFLEVIGDGVALTAAGHLPPAVVEKFAERSGIADWWIRKANREDATPPVANVRA
FT                   AVRLLGLVSVRKGRLAPTAAAIRCHQDPQALLRHIVERLPVGTQEWEREAGWMALAVAG
FT                   SGVPAEDWRAEISELTFALGWRGDPGDDSLPSPRSRTLRVLDDLGGAARHPWGRNEGVD
FT                   AAVAAVARAVTRRA"
FT   gene            complement(13975..14715)
FT                   /locus_tag="Noca_0010"
FT   CDS_pept        complement(13975..14715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0010"
FT                   /product="fatty acid hydroxylase"
FT                   /note="PFAM: fatty acid hydroxylase; KEGG: mmc:Mmcs_2728
FT                   fatty acid hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79560"
FT                   /db_xref="GOA:A1SCM5"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM5"
FT                   /protein_id="ABL79560.1"
FT                   /translation="MTKSQSPIASGEVERLAAQRVAADEQRITGSRRTNVSLGQAWRSF
FT                   WRHPSPWMMASCIVASLLARVLVGGGAWWELLVPVGLVATLPVVEWVVHVGILHWRPRH
FT                   VGPVTLDPLLARKHRAHHADPRAIPLVFIPWQVELWLFPSYVAIAWLAMPTTSSALTLL
FT                   VAVYAIMSGYEWTHYLLHSDYRPRSRWYRSVWRNHRLHHYKSEHYWFTVTTAGTADRLF
FT                   GTYPDPAAVETSPTVRALHSRERL"
FT   gene            complement(14712..15461)
FT                   /locus_tag="Noca_0011"
FT   CDS_pept        complement(14712..15461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0011"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_2727 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79561"
FT                   /db_xref="GOA:A1SCM6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM6"
FT                   /protein_id="ABL79561.1"
FT                   /translation="MPTLPGMPLQPVNRRSVPDEVFDQVLSEVVDGGIGAGEALPSERR
FT                   LAEVLGVSRPAVREALQRMAQTRLLDVRHGGATTVRDFRRYGGLDLLPRLLVRRGELDP
FT                   AVARSILEARLVVGPGVAALAAERGGPALEPVLAETVAALEGTEDGIERQRHALAFWDL
FT                   VVDAADSMVFRLMFNSLRAAYEPALEALAALMAEEVGQVGAYRLLTAAIGAGDPETARA
FT                   AADRVLRPATTSLLTALAALDSDQEDS"
FT   gene            15502..16314
FT                   /locus_tag="Noca_0012"
FT   CDS_pept        15502..16314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79562"
FT                   /db_xref="GOA:A1SCM7"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM7"
FT                   /protein_id="ABL79562.1"
FT                   /translation="MPAGGRVGWPAAYAGVVPRTLAPRFWAAHLLALVLVGVAVGLGFW
FT                   QLGAWQEHRRIEARDLTHAEPLPLAEVIGPDDPFPGDSIGQPVTVSGTWVGAGTVYVSG
FT                   REHEGHEGYWVVTPLAVGSADAPALPVVRGWVADPADAPEAPSGTADLQAWLQPPEGTG
FT                   QPDDDPADDVLPQLRIADVIQHVDQDLYGAYGVAQTPGPGLEPASLEQLPQVDALTGLR
FT                   NLLYAIEWWFFGAFALFIWWRWVTEEPDEVAGAGAAGERADEPSGIGP"
FT   gene            16324..16671
FT                   /locus_tag="Noca_0013"
FT   CDS_pept        16324..16671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV2833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79563"
FT                   /db_xref="GOA:A1SCM8"
FT                   /db_xref="InterPro:IPR023845"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM8"
FT                   /protein_id="ABL79563.1"
FT                   /translation="MKNLFNTYRVLATIVGVLLAFASLVAAPLKYLATEDSGLQRFGES
FT                   ASIVWLVHGWVFMIYVVVAFLLARRARWTIGFTVLMLVAGLIPLLIFWVERRVTRKVRV
FT                   ENPELVGSTAG"
FT   sig_peptide     16324..16404
FT                   /locus_tag="Noca_0013"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.669 at
FT                   residue 27"
FT   gene            16701..17573
FT                   /locus_tag="Noca_0014"
FT   CDS_pept        16701..17573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0014"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: fal:FRAAL0742 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79564"
FT                   /db_xref="GOA:A1SCM9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCM9"
FT                   /protein_id="ABL79564.1"
FT                   /translation="MTTAFVLGGGGVLGAVEVGMLRALLERGIVPDLVLGTSVGALNGA
FT                   LVARQPDLGVIDKLTAMWRGAGKRDGEGDGPQPQQVYGDRPLRTVRRAMSTGTHLWSAG
FT                   PLQRALAAEFGDLTFEDLPVRFQVCAASIERAAEHWFDSGPLVGAVVASAAVPGLLPPA
FT                   RVGDEHFLDGGIVNSIPLGRAVQLGADRVFVLQVGRIDRPLTVPRRPWEVARVSFEIAR
FT                   RHRFIREVEELPEDVEAYVLPARGTSARDDSLLGSRDFASVQARIDETYDASVAYLDEQ
FT                   LGPVSASER"
FT   gene            17570..18589
FT                   /locus_tag="Noca_0015"
FT   CDS_pept        17570..18589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0015"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   fal:FRAAL0743 hypothetical protein; putative signal
FT                   peptide; putative acyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79565"
FT                   /db_xref="GOA:A1SCN0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN0"
FT                   /protein_id="ABL79565.1"
FT                   /translation="MIRLLRRLVIAPAVVALTGLLWFTLPLWVIGAAALSPVVPGRLRP
FT                   LRIMWVAIVYLTCEAILLVVLFGLWLASGFGWRLRSPYFEGIHYDLVQGTMWVFFREAR
FT                   RVLRLRIETEGPAPDAHPGRPVLVCCRHAGPGDSFVLIHTLMAWYAREPRVVLKDTLAW
FT                   DPAIDVILNRIPARFITPNPADGDRLEDQIATLATGLDENDAFVIFPEGGNFTPQRRQR
FT                   AIDRLRRLGMERMAARAERMTHVLAPRPGGFLAALDAAPDADVVLVAHTGLDHLLTVGD
FT                   VWRELPMDKRIVMRWWQVPRGEIPADRDERIDWLYGWWERIDVWIQQNRPEDLSPGRR"
FT   sig_peptide     17570..17674
FT                   /locus_tag="Noca_0015"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.619 at
FT                   residue 35"
FT   gene            complement(18611..19255)
FT                   /locus_tag="Noca_0016"
FT   CDS_pept        complement(18611..19255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aor:AO090120000081 predicted protein Pfam:
FT                   IncA TolA PROSITE: ALA_RICH ARG_RICH GLU_RICH GLY_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79566"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN1"
FT                   /protein_id="ABL79566.1"
FT                   /translation="MGLRKKKSLIDQASETVTQYVDQVKPQLESAVATAREKAGPVIAD
FT                   ARTKAAPVLADARAKAAPVIAEARAKAAPAIASGAALAAEKVAAGASLAAERAAEAADA
FT                   AATKVTEVATPRKKKRGKGKKLLLLTGLAALAAFVAKKLRGSDQSANWQSSYTPTPAPA
FT                   PASPAAAPAQPTDDEGGSSPDEAIADQAEAPHPVTTPDDPAEVVEVDENKG"
FT   gene            19412..19924
FT                   /locus_tag="Noca_0017"
FT   CDS_pept        19412..19924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0017"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: pac:PPA0718 probable
FT                   peptidyl-prolyl cis-trans isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79567"
FT                   /db_xref="GOA:A1SCN2"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN2"
FT                   /protein_id="ABL79567.1"
FT                   /translation="MADLQAVLKTNRGDITLNLFPDHAPETVANFTGLAEGTKAYDAGN
FT                   GKTGPFYDGLGFHRVIEGFMIQGGCPLGTGTGGPGYTFKDEPHPELTFDKPYLLAMANA
FT                   GPGTNGSQFFITVGATTWLNFKHTIFGEVADQASRDVVDAIATTATGPGDRPAEPVVIE
FT                   TVEIVRG"
FT   gene            19941..20861
FT                   /locus_tag="Noca_0018"
FT   CDS_pept        19941..20861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0018"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: mmc:Mmcs_5148
FT                   rhomboid-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79568"
FT                   /db_xref="GOA:A1SCN3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN3"
FT                   /protein_id="ABL79568.1"
FT                   /translation="MSEHATPPAGVPTCYRHPGREAHIRCQRCDRPICPDCMRDAAVGF
FT                   QCPECVAEGRKSTRAGRTAFGGLRPGNAGTTSFVLIGINAFVWLMILASGGSSSRVLAW
FT                   LELRPNGLCLNAAGGFDTTRAVCSGRGEWLPGVYDGAYWQLLTSTFTHVQPLHIAFNMF
FT                   ALYVLGPQLELAIGRIRFLALYLLSGLTGSALVYWASPEFQATVGASGAIFGLMGALLV
FT                   VAYKMRANTQQILMWIGINFVFTVVVSNISWQGHLGGFLGGLVIAAILVYAPRGPKRPW
FT                   FQVSGLVLVAALTAVAVVLRTAALG"
FT   gene            21062..22003
FT                   /locus_tag="Noca_0019"
FT   CDS_pept        21062..22003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_0932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79569"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN4"
FT                   /protein_id="ABL79569.1"
FT                   /translation="MARRTPSDDPRLINVRQLARDQGEVVSRKQVYALGLTRWEVRAEV
FT                   RAGRWQLVGDQAVCVHNSVLSDVGEQWAAVFQGGPRAQLDGASALVAAGLERYEVDRVR
FT                   ISVPRGARVRRNRRFDIRQTRRWAAGDLAAGGIPRTRVEVAAVRGPLWARTDKEATYLL
FT                   TLVVQQGMARPEDIGMELLRIRRDRRRLLLHAVLNDLLDGARSLGEIDVGRELRRRGLP
FT                   APDRQVLRRDRAHRYYLDLYWPDFHLVVEVDGIHHSWAENVVGDALRQNALALDGDTVL
FT                   RLPLLGLRLEPDRFFGQIERALRTAGWMPAAA"
FT   gene            complement(22374..22832)
FT                   /locus_tag="Noca_0020"
FT   CDS_pept        complement(22374..22832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79570"
FT                   /db_xref="GOA:A1SCN5"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN5"
FT                   /protein_id="ABL79570.1"
FT                   /translation="MAKAKLDPLAPARGPLLSVRSVIALVLIVLGIAWMAYFYIVVRVD
FT                   PTAFPKPDPGSPAFMDDLGDWNYLIGFGLFLLGLVVAAHPSTPLGRGRGVVVGMLGCFL
FT                   IGLLWISAYYVFSNDLSDIPVFNDLGQKNLFVGIAFMAVGFTFATRWE"
FT   gene            22883..23704
FT                   /locus_tag="Noca_0021"
FT   CDS_pept        22883..23704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0021"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   pac:PPA0183 membrane spanning protein DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79571"
FT                   /db_xref="GOA:A1SCN6"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN6"
FT                   /protein_id="ABL79571.1"
FT                   /translation="MRGRTHARPPEPSGPGALRTRLARRSVDRPRSLWRIGTPVVVLLC
FT                   GALFVVSAANSDGTDLRPGRYTDLASLVQDEADQYAELQQRRTELNNQVAALSAAVSDR
FT                   DVNRYQRRVEELKDPAGLVPRSGPGISVTLSDAPEDVINSTTGDINELLVHQQDIQAVV
FT                   NALWKGGATAVTIAGQRIVSTTGIKCEGNAVQLQGVPYPQPYVIQAVGDQGALLTAIEG
FT                   DGYVSAYREDAADPDISVGWELDLEEQVTAPAYDGLLDLNYAEPLVPISGS"
FT   sig_peptide     22883..23053
FT                   /locus_tag="Noca_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.513 at
FT                   residue 57"
FT   gene            complement(23664..25457)
FT                   /locus_tag="Noca_0022"
FT   CDS_pept        complement(23664..25457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0022"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: tfu:Tfu_3066 tyrosine protein
FT                   kinase:serine/threonine protein kinase:PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79572"
FT                   /db_xref="GOA:A1SCN7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN7"
FT                   /protein_id="ABL79572.1"
FT                   /translation="MSNHQPTVGGRYQLGELLGRGGMAEVRKGTDTRLGRVVAVKRLRT
FT                   DLASDATFQARFRREAQSAASLNHPSIVAVYDTGEEPAADGSGISQPYIVMEFVAGRTL
FT                   RDILREGRKILPERALEITSGVLSALDYSHRAGIIHRDIKPGNVMLTPSGDVKVMDFGI
FT                   ARAISDASSTMTQTAAVVGTAQYLSPEQARGETVDSRSDVYSAGCLLYELLTGRPPFVG
FT                   DSPVAVAYQHVREPAVPPSDHDTELPPEIDAIVMKALAKRVEDRYQSAAAMRSDIERYL
FT                   AGRPVQAPIPAPVPPPPSATDRTAVVGAVPAADDEPPRSRTGLLVLIGALLVALLLAGA
FT                   YFVWPRLFEQAPEQVAVPNVVGKNETQARRLIGEAELAVGTIDRENSDTVKAGNVIRQS
FT                   PEPDRYVDPDTAVDFVISLGVPEVNVPPVVGLDKDAARAQLEAADFVVRTEEKESDEPA
FT                   GEVIETNPPANASVEQGSTVVVFYSDGPEEVPDVRGLMQPQAKNKIRAAGFEPRVIADP
FT                   DSTEPAGTVTDQSPEPGETPSQGSTVTILVSTYEEPTESPTPSESPTDNPTEPPPPVLD
FT                   RSAVSPRSVSSRRWGRAAPRS"
FT   gene            complement(25454..26899)
FT                   /locus_tag="Noca_0023"
FT   CDS_pept        complement(25454..26899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0023"
FT                   /product="protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; protein
FT                   kinase; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: tfu:Tfu_3065 tyrosine protein
FT                   kinase:serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79573"
FT                   /db_xref="GOA:A1SCN8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN8"
FT                   /protein_id="ABL79573.1"
FT                   /translation="MTSTPDQGHGFADAEHRYRLDSRIATGGMGEVWRGTDTTLGRQVA
FT                   VKLLKNEYADNPSFRTRFETEAQHAASLHHPNIAAVYDFGEAPAADGSGVQRPFLVMEL
FT                   VDGQPLSALLRPGAPMDPDAVRELLAQAADGLAAAHAAGIVHRDVKPANLLVTPDRQVK
FT                   ITDFGIARAAEGIGLTGTGEVMGTPQYLSPEQAQGQTATPASDVYSLGVVAFECLAGRR
FT                   PFVADTAVATALAHLREPVPPLPESVPADLAAVVRRALAKLPQDRFADGAALAAALRDP
FT                   ATAVTELGPPVEHDHTRVLPGVAGVLPAEPTPLPGPVAGHVPDPPRVRRRNALWPVLAV
FT                   LALVAVAVIVVLLVAEGIGSDGPTDEPTRSPQQSRSTQPTSEPPSSQPTSPLPSSEPTS
FT                   APPSSEPTSAPPSSEPTSATPTPTPTPTATDSGAPVAPSQSATGAAASEPAAPDSSASR
FT                   PVAGPGGPSTSPSTSSQGEVDRR"
FT   gene            complement(26896..28368)
FT                   /locus_tag="Noca_0024"
FT   CDS_pept        complement(26896..28368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0024"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: fal:FRAAL6753 putative penicillin-binding protein
FT                   PbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79574"
FT                   /db_xref="GOA:A1SCN9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCN9"
FT                   /protein_id="ABL79574.1"
FT                   /translation="MNKPIRTISMFCLLLFLALMLNATYLQYWKAGRLNDDPQNRRVLV
FT                   ESYSRERGAILVGNKPVAESVESDDQYEFQRTYPKPLEYAPLTGWFSYYSATGIEQTRN
FT                   AILSGDDSRLFVTKLVDLLSNDSTKGGNVALTIDSKAQDAAYNGLKALGPNVQGSVVAL
FT                   QPSTGKVLAMVSLPTYDPNKLASHDLGSVQDTFDRLDADPTQPLLNRAIQTRLPPGSTF
FT                   KILTAAAAIDNGLYKADDPVPGGATFQLPQTSGPTGEIDNEGRSCGANNARIPFTQALA
FT                   QSCNTSFAQIAIEVGAEDMAKTAEGFGFNSHYFDDLAPQAESVFPTDASEPEIGQSGIG
FT                   QFEVAATPLQMAMVTAGIANGGTVMRPYLVDEEQSADLDVIQKTEPQKLSQAVSSSTAS
FT                   EVTKLMVATVNEGTASPAAMDGFQVAGKTGTAQSGQPDKPPYAWFVSFAPAENPQVAVA
FT                   VMIQAADIPRGEIAGGTYGGPIAKAVMEAVIK"
FT   sig_peptide     complement(28297..28368)
FT                   /locus_tag="Noca_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.667) with cleavage site probability 0.667 at
FT                   residue 24"
FT   gene            complement(28365..29771)
FT                   /locus_tag="Noca_0025"
FT   CDS_pept        complement(28365..29771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0025"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: fal:FRAAL6752
FT                   putative cell division protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79575"
FT                   /db_xref="GOA:A1SCP0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP0"
FT                   /protein_id="ABL79575.1"
FT                   /translation="MSQTSSSLMGFVHRRRRGAELFLLILALAVGIGAYAAVGLGVDQE
FT                   VPADLIGYGSWLAALVIAAHVVIRFVAPYADPVLLPVVAALNGLGLAVIHRLDLAKAEA
FT                   GNFHGYAQQQLTWMTLGVVLFVITLLALRDHRVLQRFTYTSGLAAIVLLLLPMLPGIGR
FT                   TINGARIWIHLGPFSFQPGEVAKVLLVVTFAGYLVLHRDALALAGRRVLFVDLPRGRDL
FT                   GPILVMWAVSLGILVRQQDLGSSLLFFGLFLVMLYVATERGGWLVVGALMFAGGATAAY
FT                   YLFPHVQVRFDIWLHPFDYYNKNGDQAFQPVEAQFGMGWGGLIGRGFGDGDPNRVPFAE
FT                   SDFIVAAIGEELGLTAVIAVVLLYGLIVERALRTALICRDGFGKLLSTGLGSVFALQVF
FT                   VVVGGVTSLIPLTGLTTPFLSYGGSSLVANWVIVAILLRISDQARRPTPQLSDDTAAIG
FT                   DDATQVVRLS"
FT   sig_peptide     complement(29661..29771)
FT                   /locus_tag="Noca_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.956 at
FT                   residue 37"
FT   gene            complement(29771..31087)
FT                   /locus_tag="Noca_0026"
FT   CDS_pept        complement(29771..31087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0026"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   sco:SCO3845 putative protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79576"
FT                   /db_xref="GOA:A1SCP1"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP1"
FT                   /protein_id="ABL79576.1"
FT                   /translation="MTDTPAAAPSLRLRFAAISDVGRVRKDNQDSGYVGPWLVAVCDGV
FT                   GGAARGDIASSTAIAQLRRLDVSPSGESADDLLTKVAGALHRAHERINELAAEDPALDG
FT                   TSTTATVALFDGARVAMGHVGDSRAYLFRDGEITRLTSDHTFVQTLIDEGRITEAEARV
FT                   HPHRNLILNALGGPGDVEPDLFMIELAPKDRLLLCSDGASGVLDDDRLADILATGSPEF
FT                   ASVELVRASLEAGSSDNVTCLVADAVDAAEPPGPGEAEEPVLVGAAAERRLHRQRGGMG
FT                   SLFRGHRSGDTGELEPVQAEILDLPYAITADPIDPEEARYAPRPPRRFVWLKRLLTLVL
FT                   LVGLAWVGIAAAWSWTQGQYYVGEQDGTVVIFRGVNTELAGLSLSEPYESSDVELDRLG
FT                   EVEADRVREGIAYDNLEDAEQKVRDLAARQSPASESSAG"
FT   gene            complement(31092..31568)
FT                   /locus_tag="Noca_0027"
FT   CDS_pept        complement(31092..31568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0027"
FT                   /product="Forkhead-associated protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   tfu:Tfu_3061 FHA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79577"
FT                   /db_xref="GOA:A1SCP2"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP2"
FT                   /protein_id="ABL79577.1"
FT                   /translation="MSELTLFLIRLAYLAILWIFVLSAISVIRSDMFGARVPEAARGGR
FT                   GAGRAPKPAKPPSKRRGTPTHLAVTEGSNAGERVDLDRAPILIGRGADAAIRLDDDYVS
FT                   TRHARIAASGDQWFVEDLGSTNGTYVGTVRITQPTTITLGTQVRIGKTILELRK"
FT   gene            complement(31571..32287)
FT                   /locus_tag="Noca_0028"
FT   CDS_pept        complement(31571..32287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0028"
FT                   /product="Forkhead-associated protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG: pac:PPA0189
FT                   conserved protein containing FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79578"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP3"
FT                   /protein_id="ABL79578.1"
FT                   /translation="MGGLQKLEHRLEQMISGAFARAFRSAVQPVEIAAALQRECDNNAQ
FT                   ILSRERRLVPNDFHVELSQTDLDRLSPYDSALAEELGTQLRDHAEQQSYVFPGPVTIGF
FT                   EAADDLTTGRFRIRSRAQAKVTSGATHTQVGRARAVLEVNGTRHPLQPPGLVVGRGTDA
FT                   DLRINDPGVSRRHVEFTVTGSGSPGGSGIAIEVHDLGSTNGMLVDGHRITHTGLRDGSQ
FT                   VKIGNTTMTVRVLEEG"
FT   gene            32617..32700
FT                   /locus_tag="Noca_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            32617..32700
FT                   /locus_tag="Noca_R0003"
FT                   /product="tRNA-Leu"
FT   gene            32794..33363
FT                   /locus_tag="Noca_0029"
FT   CDS_pept        32794..33363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0029"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; FR47 domain
FT                   protein; KEGG: sco:SCO4496 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79579"
FT                   /db_xref="GOA:A1SCP4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP4"
FT                   /protein_id="ABL79579.1"
FT                   /translation="MDACDGGPRGGYGPRVTTDLTASWPAQSTDELRAGLQGLLRDVVR
FT                   AGGAVGWLEPPGRADTDSWLDRLTAQQQAGDAGLVVIGDPVAPLAMGTWRRVDRQVHRH
FT                   VAEIAKVMSHPRARGRGLGRRVTTELLAALPAAGIEIVTLATRGNNHAAMALYTSLGFR
FT                   EYGRIPDGIMVGDDRYDDVRFVLSIE"
FT   gene            complement(33397..34605)
FT                   /locus_tag="Noca_0030"
FT   CDS_pept        complement(33397..34605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0030"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rxy:Rxyl_2414 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79580"
FT                   /db_xref="GOA:A1SCP5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP5"
FT                   /protein_id="ABL79580.1"
FT                   /translation="MAEGSRAVLPRPTGGFDRASMSASLAGVALSVLPVYLLGGLTVFI
FT                   ADDLDYGVVGLGAAASAFYAASAVASIPAGRVAHRLGAERSLILGVCVSSAALLAVALV
FT                   VQAWWSLCVALVVGGVATALVQPAASALVARDQPDSRHGLSFGLLQTAVPVATLAAGLA
FT                   VPVIGATWGWRWAYGLLALGAIPIVAFGLRRAPRRLERRANPPSASRPIRGAAIVLLTL
FT                   AGACAAAPANALGAYYVESAVAAGISRSGAGLWLVAGSAVGIGARLLWGWMIDRRGADP
FT                   RLWIAGLMLSGGVGFALLSVTHTAPVLFAATALTFGAGWAWKGLYNLAAIRHDPEQPSA
FT                   AVGIAQFGVYVGSVLGPIAFGVLLAHSSYAVAWAAAGVTCLLTPVLIWVQRRLGRPAAG
FT                   HGI"
FT   gene            34746..35228
FT                   /locus_tag="Noca_0031"
FT   CDS_pept        34746..35228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0031"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   bja:bll6394 putative monoamine oxidase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79581"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP6"
FT                   /protein_id="ABL79581.1"
FT                   /translation="MTPVRYWEDVEIGDSYTTPARTITETDVVMFAGLTGDYMPFHVDE
FT                   VTASRTIYGGRIAHGLLGLAYMQGMKTWVHTGIASMGSLGWTVDFRAPIRSGDTLTATF
FT                   TVASKRETSKPDRGILFVACELRNQDGVLVQEAEHRRMVRRRPADGEPGAPEGGRG"
FT   gene            35225..36823
FT                   /locus_tag="Noca_0032"
FT   CDS_pept        35225..36823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0032"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; KEGG:
FT                   mka:MK0828 succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79582"
FT                   /db_xref="GOA:A1SCP7"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP7"
FT                   /protein_id="ABL79582.1"
FT                   /translation="MSAPGVDRVEVDLVVAGGGVGGAMAAYHAARVGARVLYLGGSGGA
FT                   SARISSFNTALGYDDPDTPDGIVEDMLRAGRHVNHPGVVRALADRVAEETMRLVEMDVP
FT                   FVRDGDRLARRQAAGSTWTRAVFSRGMIGADIVRALTERLVADESVTVVNGGLLVDVET
FT                   ADGAVCGVLAWSPRDERWMQIGTRAVVMATGGAGQLWASTTNPRGSLGTGYAVALEAGA
FT                   ELMDMEFTSFEPFITSAPPEHAGHDLPTTVLREGARLLNARGEAFLPEQSPTKDIICRA
FT                   MVREVLEGRGTASGSVVFDLTEMDPDNAERYVGIVEALRKRGITSREAQLEVMPAQHYV
FT                   MGGIRIDERGRSTLPGMYAVGEAAGGAHGAHRLAAGGGLEVVAGGAVVGEAAGLDALSA
FT                   TGDRRCSLAPNPDLLSVRLAAEAQADLGLIRGAMDSGCGILRTATDLEDTVTAVEEVHQ
FT                   RHRVPGGHPFVRRAAMVALSIARSAAMREESRGDHFRTDHPHSSEEWLANIVVTAPAGE
FT                   MEFTTAPVPTATTVA"
FT   gene            36843..37760
FT                   /locus_tag="Noca_0033"
FT   CDS_pept        36843..37760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0033"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   sco:SCO1889 dihydropicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79583"
FT                   /db_xref="GOA:A1SCP8"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP8"
FT                   /protein_id="ABL79583.1"
FT                   /translation="MKPEELRPHLAGVASVAITPFDEDRRVDERGTRAVVEYLDQGGTD
FT                   TLVVCGGTGEFYALTPAERRQVVEVAAAAVQRAPLVVSVGLDAVGAAEAARHAEDAGAA
FT                   GIMVHQPIHPYTHPDGLRRYYDEICSAVSIGVVAYVRDPRVGADLLGDVLAHDNVVAVK
FT                   YAVNDVRRFANLRRDTPHSGTVEWVCGSAEAWAPFFWVAGATGFTSGLANFAIEEALGM
FT                   RAALVSGDVERIRATWERLAGVEDLRSRGDDANNIAVLKAGTCRLGLTTAVVRPPLRPL
FT                   PEDHDAELGLILEGWKNSPRPGAG"
FT   gene            37757..38983
FT                   /locus_tag="Noca_0034"
FT   CDS_pept        37757..38983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0034"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   fal:FRAAL3119 conserved hypothetical protein; putative
FT                   cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79584"
FT                   /db_xref="GOA:A1SCP9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCP9"
FT                   /protein_id="ABL79584.1"
FT                   /translation="MSGSPRRPRVGVVGGGIVGAAVARELLARYDAEVVLWEKEDGLGR
FT                   HQTGHNSGVVHAGVYYTPGSHKARLCVQGGRLLRAFCEERGLVYEECGKLIVATDEGQR
FT                   SLLHDIERRGRSNGVTGLRWLEGEEIGSVEPHARGVAALHSPRTAIVDYGAVTRALGAE
FT                   VVDRGGLLHVGTAVTGLQTRGREVVVTTSAGSQVVDLVVACAGLHADRVARMAGDDSEP
FT                   MIVPFRGEYHVLRPDRSALVRGMIYPVPDPRYPFLGVHLTRHVDGSVSIGPNAVLALAR
FT                   EGYRWRDVAGRDLWEMARWPGFARLARRHWRTGVRELAGSASKRRFVAAARLYVPELRV
FT                   ADVERRVAGVRAQAVDRDGTLVDDFRIGRAGRVLSVRNAPSPAATSSLAIAAEVVAMLA
FT                   DDLPRRSGG"
FT   gene            39113..39805
FT                   /locus_tag="Noca_0035"
FT   CDS_pept        39113..39805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0035"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: sco:SCO6565 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79585"
FT                   /db_xref="GOA:A1SCQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ0"
FT                   /protein_id="ABL79585.1"
FT                   /translation="MTTPTEVHDDKLFHQPPLRERVRVRLERMIIDGTFEPGAHLVETD
FT                   LAQRLGVSRGPIREALYQLQLQGWVDLRPRQGAFVHQPSVEEVDQFFQVRALLESEISS
FT                   LVAGHVTAADVDALRAMIEVANRHIAEGNVAALVAANAEFHGYIHRLAGNPVLVDLVQM
FT                   LDKRLRWYFSAVTMERAGDAWHEHAALVDALAEGDRARAVALTRSHNERTRSAYLTHRR
FT                   VLQAADED"
FT   gene            complement(39830..41461)
FT                   /locus_tag="Noca_0036"
FT   CDS_pept        complement(39830..41461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0036"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein;
FT                   KEGG: rxy:Rxyl_2477 thiamine pyrophosphate enzyme-like TPP
FT                   binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79586"
FT                   /db_xref="GOA:A1SCQ1"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ1"
FT                   /protein_id="ABL79586.1"
FT                   /translation="MPHVGDAMIDAIASAGVRRLYTVPGESFLEVLDAADRHPALRQFS
FT                   TRHESGASFMADADAKTSGVPAVAMATRGPGAANLSIGVHTAHQDGTPMLVLIGDVETP
FT                   RIFRGAFQEVDLPAFYRPITKAAMTARRGDRLPEMVTDALRIAVSGRPGPVMISLPADL
FT                   LAEEFTGPAPAPLAPVAPAGCPPETVRRLRSTLERAQRPVVIAGAGVRHATDRLVALCE
FT                   AYGLGVYAAMRRQDVFPNDHPLYLGHLGVSPAPGTVDALREADVVLILGAALDQMTTQQ
FT                   FTLPAASAHRIHVDADPLTLGAGLPVDEAVVAEPRELIEALLAEPPTAPHRAWDAAHRR
FT                   FLESTCAPPRTPARGCDPGAVIEAMKRAWPADTIVTSDAGNFSGFLHQYWRFTTPRSQA
FT                   APINGAMGYAVPGAVGAKAASPDRHVLGVVGDGGFLMTGSEVETAVRYGLPLTIVVLRN
FT                   GLYGTIAMHQAQEMGRLSAVDIGDVDLAAYGRSLGAEGITVEEPGQLDEAMRTAATSDA
FT                   VTVVDVVTDPDLITASGRLSEMFQTS"
FT   gene            complement(41511..43124)
FT                   /locus_tag="Noca_0037"
FT   CDS_pept        complement(41511..43124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0037"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: nfa:nfa35030
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79587"
FT                   /db_xref="GOA:A1SCQ2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ2"
FT                   /protein_id="ABL79587.1"
FT                   /translation="MTTETTETTETVTGDQLVAGAATRGSSGVFHAVDPRTGEELATAF
FT                   AEATVAEVDRAVEAAVDAFASFRDWDDARRADLLDAIAAALVHDGSAILSAVEAETALP
FT                   RARAEGELVRTAEQFRAFARVLRQGWHRDALVDPPDPGAVPVPRPDVRRINVPVGPVAV
FT                   FGASNFPLAFSTPGGDTAAALAAGCPVVVKGHPSHPATSELCGRAIVRALREHDAPAGT
FT                   FSLLQSTRNEVGAALVQHPQVAAVGFTGSEAGGRALFDLASRRPTPIPVYAEMGSLNPV
FT                   LVTVAALEARADAIAQGLSGSFLFCAGQYCTKPGLVLVPEGPAGDRFVGLLATTVREQE
FT                   ALPVLAANIGSAFDTSVGALEAALGDDAVVHGQARRRGLEREAALVVVDAARVREAPDL
FT                   LVEHFGPLSVVVRYASPTDVLDVIAQVPGSLTATVHGEPDDHDLVRQLLPALVEKAGRV
FT                   LWNGYPTGVSVTGAMMHGGPYPSSTFPAHTSVGWTAIRRFLRPVTFQNFPDELLPAPLR
FT                   ADNPLAAPRLVDGALSTGPS"
FT   gene            complement(43121..43837)
FT                   /locus_tag="Noca_0038"
FT   CDS_pept        complement(43121..43837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0038"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   pol:Bpro_2296 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79588"
FT                   /db_xref="GOA:A1SCQ3"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ3"
FT                   /protein_id="ABL79588.1"
FT                   /translation="MTPLDDDVRELLGSASTATITTQLFRRGLRNAFLHGLRPLNPAAA
FT                   RLVAEAVTLRYVPAREDLDTLSAFDDYDHPQRRAIETVGPGQVLVMDCRGRGRAASAGE
FT                   ILATRLQVRGASGLITDGSVRDSHRIAASGLPCFTASVSATTNLALHHAVDINVPIGCA
FT                   DVAVYPGDVMVADEEGVVCIPRHLAEDVAVAAAAQERHEAYILAKVAAGAPLRGTYPPD
FT                   APAKAEYRRWAQEEDA"
FT   gene            43915..45135
FT                   /locus_tag="Noca_0039"
FT   CDS_pept        43915..45135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0039"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mes:Meso_2971 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79589"
FT                   /db_xref="GOA:A1SCQ4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ4"
FT                   /protein_id="ABL79589.1"
FT                   /translation="MDERPGELLPLSGVRVVDLTRALSGPFCTMLLGDQGAEVVKIERP
FT                   VVGDDTRRQSNPMVGTENSAFLAVNRNKRSVAVDLRAEAGVEVVRRLVAVSDVVVENFR
FT                   PGKAEQMGLGYEQLRELNPGLVYCSISGWGSDGPYAARGGYASTAEAAGGLMSVTGERG
FT                   RGPVKVGVSIVDSLTGLYAKDAITAALLARVRTGVGQKVETSLLESTVSILSMSAYAYL
FT                   LGGVVAGRWGSEHQWHVPWKAFPTVDGFLVIATNNQEQWRKICVGIERPDLLEDPRFTT
FT                   MADRAAHREILYALLDEVFATRTTHDWVARLDAVGAAAAPVNTIDQVFADPQVLARDML
FT                   QSVEHPTLGPIAQVGHAQKLHGTPHQITLPPPLLGQHTREVLTDLGGYTPDEIDELISG
FT                   RVIPANC"
FT   gene            45212..46573
FT                   /locus_tag="Noca_0040"
FT   CDS_pept        45212..46573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0040"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG:
FT                   bur:Bcep18194_B1168 MmgE/PrpD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79590"
FT                   /db_xref="GOA:A1SCQ5"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ5"
FT                   /protein_id="ABL79590.1"
FT                   /translation="MRTVLSTYTEQLAEYVTATTYDALPTSTVAAAKRVTLDLIGVVLP
FT                   AINYGPGSVMNQYVRETGGPGQATVVGTDIKTNAANAALANGTMAADMEQDDVHPESNL
FT                   HASSVFVPAMLGVAEELGSSGRDWINALAVAYDVGCRISIAMDNGRQYASGFHPTAVSG
FT                   TFGAAAAVARLLGLDAAGVNSTIGLTGCQAAGMLTWEMETEHYTKSFQSGVPARNAVVA
FT                   AQLAARGYVGASNTLDGKYNVFDAFSNHRNFSRLVENLGDRHEIEYTGYKFYSVCRFIH
FT                   SAIDQLLDLSAEHGFAGADIESLDVWLPHTQVPIVDHNTLITHNLQYSLAVGITDRVVE
FT                   RAQTSNERFADPALQAIAAKVTLRGADDLEALYPAHWPSRVHIRLTDGRTFDSEKHDPR
FT                   GTSFVPVTDADIVAKFEGMASQVLPAERVNQIVKIVDELETLDSIRELTALLVP"
FT   gene            46643..48025
FT                   /locus_tag="Noca_0041"
FT   CDS_pept        46643..48025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0041"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: mes:Meso_4520 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79591"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ6"
FT                   /protein_id="ABL79591.1"
FT                   /translation="MALRKQHTKVSGVTSGAWSSAAASPFSRRGLLKAGGLAAGAVAAA
FT                   PLLSACGRGSGSGSSGSSYNMWVMSDTVPIMKHFVAKYRESEDSKFNANITEIPSGMSL
FT                   RAKIISASAAGQLPELLDVSMNYSSDFATYNLFEPLDSLISSDLASKYSLYDRVWKWAD
FT                   TASIPGYEGDQQVFGIPYGVSVFVPTYRADLFREAGVEFPTTWEELVTVGQALTQAPQR
FT                   YALSVPTSGDLMDEFHPFLMQAGAQYVNDDLTEAFPNREAAYDGFEFYRDLSARYKIAP
FT                   KEAPDRFAGDPVQRLTSGQVAVTTLSVLSVNAMRNEATDLEFGPDKDWYISKFWSGSGG
FT                   PGGYFNANCMHIRKGVKNVDGAIGFMEWMLEPEQQAEMYKSFNRPPMNTTVWDGELGDD
FT                   PEFQIYRESIELSERQGGFRGWKLAEFTIDRGVERVVIDGEDVKSVVDSTATDMIQALQ
FT                   NA"
FT   sig_peptide     46643..46777
FT                   /locus_tag="Noca_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.549 at
FT                   residue 45"
FT   gene            48055..49050
FT                   /locus_tag="Noca_0042"
FT   CDS_pept        48055..49050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0042"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lin:lin0218 similar to
FT                   sugar ABC transporters, permease proteins; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79592"
FT                   /db_xref="GOA:A1SCQ7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ7"
FT                   /protein_id="ABL79592.1"
FT                   /translation="MRARAIPEAEPESVVAAPPADRSSGQLRQRRERRQRRQRPRGDWL
FT                   NLLLFLGVPIVLIVAVEIIPMLGVVWISLTDYNPLEPDSWTEFVGGENYSRMLDDSLFW
FT                   KSLGNTFFFAVLYLPISILGALLAATLLNQNLRGRLVYRGIFFMPVVVSWVVASTMIMW
FT                   FLDPSSGFVSMVSQELGFGRLPQLLQDESTAMPAVAFVAIWKYFGYNTVIYLAGLQSVN
FT                   PALEEAAKVDGASAFGRFWYVTLPALRPVTAVVVMLNMIQAIRIFDPMLIMTNGGPNYA
FT                   TTSTVLYVYRMAWDNLEFGYGSAITGALSLIIFAIAGLQFWFFNRRSVEG"
FT   gene            49062..49934
FT                   /locus_tag="Noca_0043"
FT   CDS_pept        49062..49934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0043"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: tte:TTE1936 sugar
FT                   permeases; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79593"
FT                   /db_xref="GOA:A1SCQ8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ8"
FT                   /protein_id="ABL79593.1"
FT                   /translation="MSTRRPARPVRETPRTWLSKAVTYVLLTLGAVVILGPFLWMVRSV
FT                   ITPNSVLYSRGGGGVIPRHFTLDHITGAFTEGIQPFDVYFVNSLIVTAIAVVSNVFFCG
FT                   LAGFALARFEFVGRRALLIVIVLMLAIPIESRIIPLYILASRSGFSNTYFGIALPLLVT
FT                   SLGIFLMRQYVMTIPREIDEAATVDGCSAWRLYWQIIFPICRPVIAAIAIFTFITAWND
FT                   FLWPLVITQTQDMQTLPVAAANLAVVKDQLRWGTLLAFSLLSVLPVLIFYLFMQRQFMA
FT                   GITGGAVKE"
FT   gene            49963..50724
FT                   /locus_tag="Noca_0044"
FT   CDS_pept        49963..50724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0044"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   ape:APE1484 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA
FT                   hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79594"
FT                   /db_xref="GOA:A1SCQ9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCQ9"
FT                   /protein_id="ABL79594.1"
FT                   /translation="MHVTWTADGHVARVALCRPPVNAFSREMIADLEMVLAEVESSDAR
FT                   AVVVTGGSRFSAGVDVGLLAQAPPEDAIPRNASFQRVFDRIQHHRLPFVAAVNGYALGG
FT                   GCELAMACDIRVAARDAFFALPEIGLGGLPGIGGMARVQRLVGPGKARQLVLTGDRIPA
FT                   EEAYRIGLVEELAEPGCAETVAQEVAERIAARPPLSVQAGKRALDQGADVSLVAAQQID
FT                   LRYCGEIAGTEDRQESLRAFLEKRPPVVVGR"
FT   gene            50721..51641
FT                   /locus_tag="Noca_0045"
FT   CDS_pept        50721..51641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0045"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79595"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR0"
FT                   /protein_id="ABL79595.1"
FT                   /translation="MSAARGVDDWSRTPDRAAQNETFGPRRVVVSDALVRRHAFVHDAA
FT                   VSAVSLPTGEVSPLVVGNDLLRIYEERHQRHADVGGLHLRESLQLLSPVWTGEVLELSG
FT                   RYAGWFPRGDVACLVVDAEAHGEDGRLIARARATESLPAAPDGVPERPPLPSLPRRVSP
FT                   SAGPVGEAAHPWRTPMPGARLPELRRRLEQEHLSVYSGGASFERNLHTDPDKAAERGYA
FT                   RPVAQGMHLCGLVDELCRQHLGVRWWLGGELDVRFVGPVLAGSPLVVGGAVVATDERGG
FT                   SRVEIDVWVTCGEDAVLVGVASAPR"
FT   gene            complement(51689..52852)
FT                   /locus_tag="Noca_0046"
FT   CDS_pept        complement(51689..52852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0046"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   ppu:PP_3725 acyl-CoA dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79596"
FT                   /db_xref="GOA:A1SCR1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR1"
FT                   /protein_id="ABL79596.1"
FT                   /translation="MTLAPDELEEMAATTRRFIRERIHPIEQEVDDTDHIDPQVWQSLV
FT                   DESVELGLYTANVPETLGGPGLTIAEQTRLWEEFGHTSWPFSYLLARPHRVLFACTEEQ
FT                   RSRYLDPVLAGKRAQCFALTEPGAGSDNSAMRTRAEKVEGGYVLNGAKHFISHGNADFA
FT                   IVFAVTGPPLRGRTPQVTAFLVDRGTPGFTVGKAQRMMGWSGMEECELVFENCFVPDDQ
FT                   VLGTPGEALRLGLASVAQRRLQMAAYCVGAMERLLGLSIAYTRDRVVFDEPLFDKQGIR
FT                   WMLAEAAMEPYLAREATYKAARLCDEARAAGRSEIELSRLFAREISIAKLHATRALNRV
FT                   ADVAVQVHGGMGWCREYPVERLYRDARVFRIIEGADEVHKEIIAKAL"
FT   gene            complement(52863..54101)
FT                   /locus_tag="Noca_0047"
FT   CDS_pept        complement(52863..54101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0047"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mes:Meso_2971 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79597"
FT                   /db_xref="GOA:A1SCR2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR2"
FT                   /protein_id="ABL79597.1"
FT                   /translation="MVKAEAAVLPLSGVRVVDLTRALSGPFCTMLLGDQGAEVVKIERP
FT                   VVGDDTRRQSNPMVGTENSAFLAVNRNKRSVAVDLRAEAGVEVVRRLVAVSDVVVENFR
FT                   PGKAEQMGLGYEQLRELNPGLVYCSISGWGSDGPYAARGGYASTAEAAGGLMSVTGERG
FT                   RGPVKVGVSIVDSLTGLYAKDAITAALLARVRTGVGQKVETSLLESTVSILSMSAYAYL
FT                   LGGVVAGRWGSEHQWNVPWKAFETTDGYVVVASSSEEQWRKICVGIERPDLLEDPRFTT
FT                   MADRAAHREILYALLDEVFATHTTHDWVARLDAVGAAAAPVNTIDQVFADPQVLARDML
FT                   QSVEHPTLGPIAQVGHAQKLHGTPHQITLPPPLLGQHTREVLTDLGGYTPDEIDELARD
FT                   GVVGVADHPAATA"
FT   gene            complement(54476..55060)
FT                   /locus_tag="Noca_0048"
FT   CDS_pept        complement(54476..55060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0048"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; KEGG: sco:SCO1410
FT                   GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79598"
FT                   /db_xref="GOA:A1SCR3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR3"
FT                   /protein_id="ABL79598.1"
FT                   /translation="MFGFWRYLSSSAHDVSRNTLREAFRLLVHERLLVHELNRGVFVRE
FT                   ASLDEVADLFRLRRVLECSSVRTPEPPEAAVARLRSAVSEGETAAREGQWQEVGTANMH
FT                   FHLAVGALAGSPRIDELMEQLMAELRLVFHVMAAPQKFHAPYLEDNARICALVQAGRGE
FT                   EAAALLDTYLARAERQLVQAYRLVAHATASA"
FT   gene            complement(55679..56056)
FT                   /pseudo
FT                   /locus_tag="Noca_0049"
FT   gene            56595..58040
FT                   /locus_tag="Noca_0050"
FT   CDS_pept        56595..58040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0050"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; KEGG:
FT                   rpc:RPC_1956 Tat-translocated enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79599"
FT                   /db_xref="GOA:A1SCR4"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR4"
FT                   /protein_id="ABL79599.1"
FT                   /translation="MTEQHHNPTELTASTPGAARHARGVVPFQPDDPVMKSPYAHGAFV
FT                   FATLPAEWDTPAVTTWLTTIDTARQALRAACTPDVVRVATIAVGFGPSFFYRPDATVRF
FT                   AGVTPPAGFAQLPPMPHGAAVPADVCFYIVAIAEAEIAKFVNALAASGVTGLAMEHGYK
FT                   SYPDEEAFGYRDGVRNIPVSSRNDFVFIDADRNAEEPDWTHHGTYMAYMRIAQNLAAFQ
FT                   AIPAAEQDQVIGRDRTGRRLDLPEGTKAKDEPSFATDDPRLDSHVRKVGPRGFEHRDET
FT                   QIFRRGLPFFEVRDGQVVQGLQFASFQASLDQFDAVFNRWMLNPDFPRSGTGVDALVAR
FT                   GLITIEKWGFYFVPPDTDGPIGMGMFAPAKETRKPKTGRVAVRKELVDANGTRVNGDLG
FT                   GFTFQITDLEGNPVGESFTSNSHGHALSGEIPLGDYQLTELPPQPPQPPMPAAGPVSFT
FT                   LRSAQEVVKVRNQLTPAAGPYNG"
FT   gene            58431..59273
FT                   /locus_tag="Noca_0051"
FT   CDS_pept        58431..59273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79600"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR5"
FT                   /protein_id="ABL79600.1"
FT                   /translation="MKAFISSVRRGLGPERDYLAELILACGHTPLRFEDFGAQDLTSRG
FT                   ACLGGVQEADVYLLILGPHYGTEVDDSGLSPTEEEFNVAMERGIPVYVFVKSGIEVDQA
FT                   QREFMDRVGNYKDGRFWAEFADNAQLGVHVARVLREHREPAPPFRQMALTRQVQVPWRT
FT                   GQLSVPQTRDGSPVLEVHVLPIESTALRPVAHLAALAVQLASDARRQGFFGHGDALDIA
FT                   SDTELAWAVRAEDRGRRGGWNEVRLDPSPASTPPGAARSPSFRPCRVTRSAAWSTSRT"
FT   gene            59586..60119
FT                   /locus_tag="Noca_0052"
FT   CDS_pept        59586..60119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79601"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR6"
FT                   /protein_id="ABL79601.1"
FT                   /translation="MATEEEDPRDRVWRLLMEKERYTDCPREVMGALDALGVTNDVEVA
FT                   HAELTYDDTSGATDWTITAATRSTLIRIRASATRADRQVWSVGRHRDSIEYTVAPTVDV
FT                   DVRPLTDIERVELNNVGATDAWQPGAQVVQTWTFHLRGADTVELRVDTGDRFRSEAVGQ
FT                   ICSLFARQVTSRSS"
FT   gene            complement(60327..60929)
FT                   /locus_tag="Noca_0053"
FT   CDS_pept        complement(60327..60929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79602"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR7"
FT                   /protein_id="ABL79602.1"
FT                   /translation="MCGSSNGLPFLRDDVCVSELLTQLWARVRAQLESARSQLTNPDDE
FT                   ALFLYEDLLSHNELGLALDALADVAFEQRAPGEVWQMLGGAIEAMQLEPDDSVHGGAVQ
FT                   KVLEQLAAAHDWRGLQRLLNEWDPIGVRPDLGGPDDEYSCLYVPLVDRLHAEAPVAEIA
FT                   EFLRAEPSDHFGLDPAYSRPEVFAGRLVEWYASGAPA"
FT   gene            complement(61631..62167)
FT                   /locus_tag="Noca_0054"
FT   CDS_pept        complement(61631..62167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79603"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR8"
FT                   /protein_id="ABL79603.1"
FT                   /translation="MRCGMSTAESLAFERKLTWNRRHIRATYEVVMAEGAEHVRSLAGE
FT                   AVDDQFDLPDLCARPQCRKEFRQSVGRGRKRDYCSETCRRLADRDYKRAKATVEHFEKL
FT                   ARRSRHDVLAFGRSADELDEEAVSDETVIAQAVAALGRVDAVLRFVGDADPRLVEELEA
FT                   LRDGVRGVVTRAQAG"
FT   gene            62400..62666
FT                   /locus_tag="Noca_0055"
FT   CDS_pept        62400..62666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0055"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sag:SAG0550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79604"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCR9"
FT                   /protein_id="ABL79604.1"
FT                   /translation="MREQENKMSNDNRRHVVPNPDGGWDVRAPDAQRSSAHTDTQADAI
FT                   SRARDIVGNAGGGEVVIHGRDGRIRDSDTVTPGNDPNPPRDRK"
FT   gene            complement(62748..63995)
FT                   /locus_tag="Noca_0056"
FT   CDS_pept        complement(62748..63995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0056"
FT                   /product="Glycosyl hydrolase family 32, N terminal domain
FT                   protein"
FT                   /note="PFAM: Glycosyl hydrolase family 32, N terminal
FT                   domain protein; SMART: glycoside hydrolase, family 32;
FT                   KEGG: hma:rrnAC1479 sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79605"
FT                   /db_xref="GOA:A1SCS0"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS0"
FT                   /protein_id="ABL79605.1"
FT                   /translation="MRPLVHFTADAGWINDPHGLTFHRGRYHLFHQYVPESMVWAPNCH
FT                   WGHATSSNLLTWTRHRVAIAPGDGDDGIWTGSLALTGQDATILYTSVAQPDLGLGRVRL
FT                   ATPADDSWEIWSKGDIVVTPPDELDLIAFRDPFVVRDAAGWRMFIGAATREGDALALTY
FT                   TSPDLSSWIYEGIALQRSTKEKDPVWMGALWECPQVFEVDDHWVMVSSVWDNDVLHYAG
FT                   YALGDRDSYSAGKLMPTEWGQLSFGDSYYAPSYFLDEDELPCLMFWMRGVSDADDGWAS
FT                   CLSLPYSLTVRDDRLVAEPHAALAEARGDALAAGADARAYDLEWDPTASQAELVLASDL
FT                   GKSATLRATEGRIHLERPGVDAQSMPWPGGPVRVVVDGPVLEVSCAGGLLGGPIAPATR
FT                   WDGPAEACSAWRLAID"
FT   gene            complement(63995..65443)
FT                   /locus_tag="Noca_0057"
FT   CDS_pept        complement(63995..65443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afm:Afu5g00510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79606"
FT                   /db_xref="InterPro:IPR021345"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS1"
FT                   /protein_id="ABL79606.1"
FT                   /translation="MRTASVEFYDGQARKRFDGNRAPWALERTIMSTDFRGGLLGELTL
FT                   ARPGRTARASSFDQTGRNRDNWIVMPGEERTLADLEGPGFITHIWMTQSCRIQPGPSQI
FT                   DPAGVGVPMLEIHNALGVNWEVVDPDYYRKILFKIYWDDQETPSVIAPLGDFFGLMNSL
FT                   SGSYDSLPLSVSAKEPELHTFGGSAAFNSYFRMPFAKRARVVVENQNDIPYLQYFYIDY
FT                   ELSPTALPEDTVYFHAHWRRALPNVGWGPDLQTNSIETTIPNLTGADNYVALETEGRGH
FT                   YVGCTLAVRHFQGSWWGEGDDMIFIDDDTWPPSLHGTGMEDYFGHAWGMQRNAYQFNGT
FT                   IVHEEDVPGFHHSYRFHMVDPIRFEKRIKVTFEHGHGNHLSDDWSSTAYWYQTLPSPVL
FT                   EVPDVDDRLPLRPVNRVIEAPLPELSDEQRTARERADERMRRFVEARDALREERRGEVD
FT                   DWERGNVDQARAIRRSYDAEREGN"
FT   gene            65532..66548
FT                   /locus_tag="Noca_0058"
FT   CDS_pept        65532..66548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0058"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sma:SAV6288
FT                   LacI-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79607"
FT                   /db_xref="GOA:A1SCS2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS2"
FT                   /protein_id="ABL79607.1"
FT                   /translation="MATIVEVARLAGVSTSTVSHVLNGTRNVEPKTRKKVVEAIEKTGY
FT                   RQDAVARAMRRSRTDSIGLVVSDAGEPAFADMVHGVEHAAAARGLTLLLANSAEDPERE
FT                   TRAVRTLLQRRVDGLIVARCPRSSSEVEGQMSHATPPVVLLDRVFDRAPCDQVGADNRE
FT                   SMRRLAEHLLGRGHRRLVVVAGDTRVPTLTERLAGFRDAIAARSDVDAAILEGAEAEPL
FT                   KAGLVESIAAGGRTCVITASSPLAVMALQSLRDLHLAVPEDIAFATFDGFHHSDLFRPS
FT                   ITTVRQPAFDMGVAAVGLLLERLESPDASPRITRLQQRLELRSSSEDYVFAALGAGN"
FT   gene            66676..67995
FT                   /locus_tag="Noca_0059"
FT   CDS_pept        66676..67995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0059"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: oih:OB0774 sugar ABC transporter sugar-binding
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79608"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS3"
FT                   /protein_id="ABL79608.1"
FT                   /translation="MIGRHLVSRRRRRIAAAALAVSSLLALAACSSASDSNNADGKTTI
FT                   TLSMQNPDVKTADPATWAIVEAFEKANPDIKVEVSGQAVAEHLQSLSIAAQSDTLPDVF
FT                   WVYKATAEDMLEAGKLMDLKPTLDELGITENLPESTVANFTAGDQIYGVPYQGLLTGLW
FT                   VNKKILADNGLEMPSTFDDLVNVAQELSSKDVVTISNGANQSSFSVWSFLVWLDRFGFE
FT                   DKISGMLDGSESYDNPDFVRMYKHIAELRDAGAFASNVSTQTYQQAVDQFLQGKAAMLD
FT                   AGVWASSAIQDSPVAADTVFWNGATFDDGVGDQNIVMNVASAPLVVDHKVADDQDKLDA
FT                   VKAFLDFYYGDEAQQLLVDNGQPPVTNYEPQIDATKQSVLKSALDVATDPSLSSPQSQP
FT                   DLLVSTAVASAMYDSIYGVIQNQLSPEEAVALVQKALDAE"
FT   sig_peptide     66676..66777
FT                   /locus_tag="Noca_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.871 at
FT                   residue 34"
FT   gene            68116..68985
FT                   /locus_tag="Noca_0060"
FT   CDS_pept        68116..68985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0060"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB0775 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79609"
FT                   /db_xref="GOA:A1SCS4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS4"
FT                   /protein_id="ABL79609.1"
FT                   /translation="MIWISSRWKIALMLAPALILFTAFFVYPVGYAIAYSFTDSAGFGA
FT                   AKFVGLDNYLALKDDPFFWQSMRNTIAILVVSVALLIPASFGLALLLRRRIRGGGALRA
FT                   LVFGPAIIAPILVGLIWVFILDPKIGLLNRALEPLGVEPIQWIGGNTLTPYAISLVFIW
FT                   SSVGFAMTIFYAGLQLLPGDVMEAAQLDGAGSWQQLRFVTIPMMRETFAIVAILLITNV
FT                   FKIFELVYMLTGGGPVHRSETLVSYMYFVTFTNQRYGSGMAIAVVIFVLGALTSLAYLA
FT                   AARRRSLA"
FT   sig_peptide     68116..68214
FT                   /locus_tag="Noca_0060"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.436 at
FT                   residue 33"
FT   gene            69064..69957
FT                   /locus_tag="Noca_0061"
FT   CDS_pept        69064..69957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0061"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB0776 sugar ABC
FT                   transporter permease; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79610"
FT                   /db_xref="GOA:A1SCS5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS5"
FT                   /protein_id="ABL79610.1"
FT                   /translation="MTTLTDTERYRRSPAVPHGGDRPRRTGLAITGVAAYLITFTIVLP
FT                   ILWIALLSFQPSDTILSDPFSLNNLTFENYRNAIANLPLAQMYKNTIIVALASVTLGAV
FT                   VSFMASFALTRMVFRHRRAQDSVRFYLLAGLAVPVYVLLFPIYRLDLALGIFGTYAALI
FT                   LPYIAVSIPFNTLLMTGFLRDFPAELEEAAIMDGAGLLRICWSVVLPTMRPVIATILIF
FT                   NVVYVFNEFPFVSILINDPDLATVSLAVSKFQGQYTVDYGGMMAAATLVLLPQLVIYAF
FT                   FQRHVIAGLTAGAVKG"
FT   gene            70016..70936
FT                   /locus_tag="Noca_0062"
FT   CDS_pept        70016..70936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0062"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rha:RHA1_ro02811
FT                   fructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79611"
FT                   /db_xref="GOA:A1SCS6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS6"
FT                   /protein_id="ABL79611.1"
FT                   /translation="MNSPGVLVIGEALIDIVEAPSGAVAEAPGGSPLNVAVTLGRLGVP
FT                   VTLATALGDDERADRIQAHLADSGVALAAGARTLDRTASARARMQSDGSALYDLDVTWD
FT                   PATPDPGGATAIHAGSIALFQEPGASRVGDVLRRAPAGAMISLDPNIRPSLLPGRRRVV
FT                   AQFEQLAALAHLVKLSDEDAAWLYPDLTWRQVAQHLLRLGPTLVVVTRGGQGSHLAAAG
FT                   ITVDRPAITSVIADTIGAGDSFMGALIRQALALGVIDRLVSRSALGSHDLVTLGDAAGL
FT                   VAAVTVSRVGADPPWDWEIDAALTE"
FT   gene            71344..71673
FT                   /locus_tag="Noca_0063"
FT   CDS_pept        71344..71673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0063"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mbo:Mb2839c probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79612"
FT                   /db_xref="GOA:A1SCS7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS7"
FT                   /protein_id="ABL79612.1"
FT                   /translation="MARPSKYPRELRECAVRAVAESVAQGEYPTEFEAIRTIAAQLGIG
FT                   SSETLRKWVRQAEVDGGTRPGKTTEELAEIRELKKKVAELERANQILKSASAFFAAELD
FT                   RQPRY"
FT   gene            71727..72320
FT                   /pseudo
FT                   /locus_tag="Noca_0064"
FT   gene            72341..73780
FT                   /locus_tag="Noca_0065"
FT   CDS_pept        72341..73780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0065"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_5505 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79613"
FT                   /db_xref="GOA:A1SCS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS8"
FT                   /protein_id="ABL79613.1"
FT                   /translation="MATKDWSKKTSDAPEGLRRQWRADRALRPAMRSPGRPDPSRVVQR
FT                   QFWRQIATGVTTVEASMAVGVSWPVGARWFRHAGGMPPISLAEPTGRHLTFEEREEIAI
FT                   LRAKDKGVREIARAIGRDPGTVSRELRRNAATRGGKQEYRAGVAQWKAQQAAKRPKTAK
FT                   LVTNERLREYVQDRLAGNVRRPDGTIVPGPTPPPWKGLNKPHRRDRRWSTAWSPEQIAQ
FT                   RLKVEFPDDESMRISHEAIYQSLFIEGRGALKRELVTCLRTGRALREPRARSRNKAQGH
FT                   VTADVVLSERPAEADDRAVPGHWEGDLIIGTGRSAIGTLVERSSRSTLLVHLPRLEGWG
FT                   EKPYVKNGPSLGGYGAVAMNTALTASMTKLPEQLRKTLTWDRGKELSGHALFAVATGTK
FT                   VFFADPHSPWQRPSNENTNGLLRQYFPKGTDLSRWSAEDLEAVAYALNNRPRKVLGWKT
FT                   PAEVFEEQLRSLQQPGVASTS"
FT   gene            73818..74448
FT                   /pseudo
FT                   /locus_tag="Noca_0066"
FT   gene            complement(74470..76036)
FT                   /pseudo
FT                   /locus_tag="Noca_0067"
FT   gene            complement(76344..77522)
FT                   /locus_tag="Noca_0068"
FT   CDS_pept        complement(76344..77522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0068"
FT                   /product="Inulin fructotransferase (DFA-I-forming)"
FT                   /EC_number="4.2.2.17"
FT                   /note="KEGG: ret:RHE_PE00355 putative inulin
FT                   fructotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79614"
FT                   /db_xref="GOA:A1SCS9"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR040526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS9"
FT                   /protein_id="ABL79614.1"
FT                   /translation="MATTVYDVTTWTGATVSPYTDIGLVINQIIADIKSQQNSQTTRPG
FT                   AVIYIPPGHYTLQTTANIDIGFLTIKGSGHGFMSEAIRDDVNHSAWVETLPGSSHVQIA
FT                   NNNQVGFLVNRATDPGTNGRLNSIVFQDFCIDGVSSTKPYIPGNGKIGIKSQYDTDSLR
FT                   IEGMGFVYLNTALTIRNADAFNITNNFIAECGSSIQLTDSSIVGKITNNYLISAWAGNS
FT                   IFIENNEDCVISGNSLLWGARIQMKNVHRAVITGNKFVSNFSGMIVHETPCHEQLISGN
FT                   HFRRKYGDGGPARNDDLFGMVHLNGNDNSVTANHFAFEVPAANIVPSGATPTVVLVKGG
FT                   ARNFLATNKLASNVAVRHVLDASSTATKVLWSGTAAQLQDLSGGNMSFVATP"
FT   gene            complement(79306..79551)
FT                   /locus_tag="Noca_0069"
FT   CDS_pept        complement(79306..79551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79615"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT0"
FT                   /protein_id="ABL79615.1"
FT                   /translation="MFDIHCNACGKHQLLSISRIRQLVNHEQGIEVIFECWCGTQGAYW
FT                   TGKNARPGDSRTIDSSGVPSAWPCVRGRNTCRATDR"
FT   gene            complement(79607..80230)
FT                   /locus_tag="Noca_0070"
FT   CDS_pept        complement(79607..80230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0070"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   sco:SCO3362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79616"
FT                   /db_xref="GOA:A1SCT1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT1"
FT                   /protein_id="ABL79616.1"
FT                   /translation="MDTSALVAFTVVAAAMVVLPGPDWALVLAAGSRRSGAVMVPTIFG
FT                   LALGYALLTGVVATGLGPLIAAAPVALVVLTVVGAAYLIYLGVGILCGPATGVPEARAV
FT                   APVSRLGSVLRGVGVSALNPKALLFFLAFLPQFARPAAPWPLAGQLFVLGGVWVVLIVA
FT                   FYTVLGHAARTLSGSPGRARAVTWLAGAVMILVGLGLLVEQLAW"
FT   sig_peptide     complement(80141..80230)
FT                   /locus_tag="Noca_0070"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.496 at
FT                   residue 30"
FT   gene            80377..80844
FT                   /locus_tag="Noca_0071"
FT   CDS_pept        80377..80844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0071"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   rha:RHA1_ro03337 probable leucine-responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79617"
FT                   /db_xref="GOA:A1SCT2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT2"
FT                   /protein_id="ABL79617.1"
FT                   /translation="MDSLDRAIIDHLRRNAHLTNTELAELVGLTPSPCLRRVRRLENEG
FT                   IILGYHAHIAPVALHRGFEVHVDLELADQTKQTIRVFEAALIAYDEVVEARRMFGAPDY
FT                   QALVAVTDLPAYEHFLTEHLTALPGLGRLQSRFPMKTIKTDTPSTPPTTRH"
FT   gene            complement(81382..82302)
FT                   /locus_tag="Noca_0072"
FT   CDS_pept        complement(81382..82302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0072"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: bcz:BCZK0803
FT                   ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79618"
FT                   /db_xref="GOA:A1SCT3"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT3"
FT                   /protein_id="ABL79618.1"
FT                   /translation="MPLTGPRWISSDEVYAKLSFRGGARAISESLRHGLDPSADPARSI
FT                   VDVSWGQLLIMPSEFARYVGVKIASVSPDNPTRGLQRIQGLYLLLDAVTLSPLAQLDGV
FT                   ALTTLRTAAVSAAAAEALAPAHVEHLVVFGSGPQAWGHAVALRAVRPVDRVTIVGRDPH
FT                   RAAALADKLDDGDCTATAGSAAAVAEADLVVCATTARSPVFEQAVRDDALLIAVGSHEP
FT                   DARELPGDVVARAQVVVEDEGTALREAGDVAIPVSERRLDPASLLSLRSVVRGDVAVDR
FT                   SRLRVFKSVGMAWEDLVIASAIYEA"
FT   gene            82532..83164
FT                   /locus_tag="Noca_0073"
FT   CDS_pept        82532..83164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0073"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nfa:nfa13110 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79619"
FT                   /db_xref="GOA:A1SCT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT4"
FT                   /protein_id="ABL79619.1"
FT                   /translation="MNGRTPAQSFVSGPLSRAILRLRTQRGLSLSALADQSGVAKGTLS
FT                   NLERGVGNPTLETIFALSRGLGVPIGELVSSEEEAASTFVGRDDARHIRGVAVELMLYD
FT                   RFASTGSATEIYDFRCLPGDRQVSRGHPGVEHIVVKQGRLLTGPTSSPIEVGPGDYVSF
FT                   PSWGDHAYEALDEVVEGFLVIHYPNPAAPSVAIKVESLDSHADRRKP"
FT   gene            83161..83565
FT                   /locus_tag="Noca_0074"
FT   CDS_pept        83161..83565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79620"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT5"
FT                   /protein_id="ABL79620.1"
FT                   /translation="MSGAVPTDPGTAADRAAIRRLLESHLESWNRGDLDALLDTYLQDE
FT                   SVRYASARTVIHGIERVRERFREAYPDRSRLGELRYEGLEIALAGRADAVVFGRARISR
FT                   EGLEDSVSLFSLHLFKRGGQWWIAADHTSA"
FT   gene            83670..84680
FT                   /locus_tag="Noca_0075"
FT   CDS_pept        83670..84680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0075"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: cgb:cg1413 secreted sugar-binding protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79621"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT6"
FT                   /protein_id="ABL79621.1"
FT                   /translation="MHKIVRAAAVGVALSSALFLSACSDTAETADAGSTSDESLSIGFF
FT                   GFSKTNSFAQAAFAGISEYAEANDATAEFTDPNFDVQVQLQQLKDALTSKRFDVWIVQA
FT                   NDGVAVQQTIQEAVDAGITVVAEFTPIGPDFETLKPQIPGTLSLVDDPKRNGTVLGELS
FT                   IDACADAGADPCEVAYLQGFSAQPIDVVRTDAFLAAVDRPGVEVVANVEGGYAQDTGRA
FT                   AVQDILQANPDVDVIAGASSAALLGAIELPGIDDVRIVGNGSSTQAVTAVQDGDFYAVY
FT                   VFAEKTAGAKAAEMGLAAARGEEVDPAYVGYDELTPFGVLGTKENLDGYTGEYSD"
FT   sig_peptide     83670..83759
FT                   /locus_tag="Noca_0075"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.395 at
FT                   residue 30"
FT   gene            84705..86228
FT                   /locus_tag="Noca_0076"
FT   CDS_pept        84705..86228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0076"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO0811 putative ABC transporter ATP-binding
FT                   protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79622"
FT                   /db_xref="GOA:A1SCT7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT7"
FT                   /protein_id="ABL79622.1"
FT                   /translation="MMTSVAQRNGLSISARGVGKSYGGVSVLRDVDLDVRPGEILGLVG
FT                   ENGAGKSTLLRILAGSIRPDAGEVLLDGEPAGIRTPKDAINRGVSLISQELALVPARTV
FT                   LENVFLGSWDRWSGGRGRARDLQTFQRLQEETGFRLDPDAIVASLPIGRQQQVEILKAL
FT                   ARGAQVLALDEPTAVLAGHEKEGLLDLVRRLAEGGTTVVFVSHFLDEVLSIADRVTVLR
FT                   DGDLVATDDANLHDPGSLVAMMVGREVDVMYPTLAPVPEDAPVALSVECLSRGLVKDVS
FT                   LQVRAGEILGVAGLVGSGRSELLRMIFGADPPAAGRVVVNGVPLKAASPTRAMAAGLAL
FT                   VPESRKEQGLALARSVRDNVAVTTLSKRRVGPFAKRKAEGRAVADVARQVDLRAKGLGV
FT                   PIWTLSGGNQQKALFAKWLLTRPSVLLVDEPTRGVDVVAKQQIHGLIVKLAASGVAVVV
FT                   VSSEVEEVLGLSHRVVVMRHGRAVAEFAQNAAAGDVVAAAFGDETRNHD"
FT   gene            86221..87216
FT                   /locus_tag="Noca_0077"
FT   CDS_pept        86221..87216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0077"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sha:SH0178
FT                   ribose ABC transporter permease; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79623"
FT                   /db_xref="GOA:A1SCT8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT8"
FT                   /protein_id="ABL79623.1"
FT                   /translation="MTETSTPVAAQPSALSRSFNLRDYGVVLGAVALVIYLSLSTTTFL
FT                   TTGNLTNVLDQAVVVGLLACGATMCIISGVFDLTATASLALSAIIGVEVTQAAGVEAGF
FT                   VAAVLAGAGLGALTGFIVNVSTAVNAFIATLATSIVYRGVALVITGGAITYPLTDQLDG
FT                   VQVFTDDVPGLGITVATGTLLVVAVVMGVMLWATNFGRRVYAVGGNAEAARLSGIRVGS
FT                   VHIGVYMASGVCSALAGLVLVARSGGGAQANMALGLELSAIAAAVIGGTSILGGEGAIW
FT                   RGMVGVLLLTLISNGFNLLGWDTTFQQVVQGCLILVAIITDRYIRRVRST"
FT   gene            87213..88028
FT                   /locus_tag="Noca_0078"
FT   CDS_pept        87213..88028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0078"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: bpm:BURPS1710b_3485 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79624"
FT                   /db_xref="GOA:A1SCT9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCT9"
FT                   /protein_id="ABL79624.1"
FT                   /translation="MTPPHEARGGTLEARTAIVTGGSTGIGMATARSLAGRGAHVVIAG
FT                   RDRDRGTRAAANLAAGTPGTVTYVELDVREAESVAGLVATTVETFGSLDILVNNSGVEA
FT                   EEGPDGPSEPDWDRMFATNAKGTWLCCRAALPHLERTHGVIVNNASMAGLIGVAGGAGY
FT                   AASKAAVVSLTKSLALAYAERGVRVNAVCAGPVDTQMTYDEWELVGGPEEGLRRALALS
FT                   PARRITAPEEVAELICFLASDDAASITGAAIPIDGGKTAGLMPTERYRW"
FT   gene            88141..90204
FT                   /locus_tag="Noca_0079"
FT   CDS_pept        88141..90204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0079"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   mta:Moth_1967 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79625"
FT                   /db_xref="GOA:A1SCU0"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU0"
FT                   /protein_id="ABL79625.1"
FT                   /translation="MPGSSSSSVRVAVDVGGTFTDVVTLDSADGALRFDKVPTTPADAS
FT                   QGVINAFVRSGVDMQRAGYFTHGTTLGLNALLTRNGARTAIVTTDGFRDVYLLGRTDRP
FT                   VSYDFRYKKPESLVRRDAIFEVPERMNYQGRVLRPFDDVAARAVAERLKDAGYESVAVC
FT                   FLHAYTNPDHELRMREILADVAPEMDVTLSHELSREYREYERTSTAVFDGYIKPVVRRY
FT                   LGRLKNALAENGFGGHFFMIRSGGGAMTVESAREAPVNLILSGPAGGVIGATSFARTTG
FT                   EGNLITIDMGGTSLDASLIVDGESVLRHEAMFEGLPLAIPSLYIHTIGAGGGSLVWIDE
FT                   GGHLQVGPQSAGSSPGPAAYNWGGTQATFTDAALVVGYLGTETALAGSLELRRDLAEDA
FT                   LVPNAEALGMSVETVARGVLRIATTKIVGAVRSITVDIGYKPNDFALLTYGGGGGLVAV
FT                   DVAHELSIPRVIVPPGPGAFSALGMLMADVQHDYSRTQVAPLDGIDLQHLESTFGEMEG
FT                   EGGAALQDEGFAPEDRRFQRFIDVRYLGQEHAVSVPVERLSADEDIERLRHEFSEIHER
FT                   HYGHAMSDPIEIVTLRSRAVGVVERPRLPEVPEREGDVLTPIASRGVVQPDGSRTPYQV
FT                   YDRSHFRFGDRIEGPAIIVEHTSTTVMHTGDTAEVGRVGEIVITLAEETNRG"
FT   gene            90197..91915
FT                   /locus_tag="Noca_0080"
FT   CDS_pept        90197..91915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0080"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG: gka:GK2893
FT                   N-methylhydantoinase B (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79626"
FT                   /db_xref="GOA:A1SCU1"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU1"
FT                   /protein_id="ABL79626.1"
FT                   /translation="MVDSITVEVIRHSLLASADEMARNLCRTAYNTVVYEIHDYGIGLH
FT                   DAAGDVVADTPGIAMFTGANDVGIRNTIKFLGEDNLHPGDVYFLNYPYWSSAHTLDALV
FT                   LAPIFVGEELVAWSTCRVHLLDLKQKDAGYVLDSTDMSQEGIFFPSVKLYDRGVINDDI
FT                   FNVIRFNSRMPERTIGDIQAQVSACQTGERRVQEIAAKHGVDVLREAMREINDHGERLA
FT                   KAALAKLPKGTWSAYDFVDTDGVVKDEMVRMDVTVTVTDEKMIVDWRETSRPAKGPINL
FT                   PRGLTVATTMMAFKALTTPDTPVNSGNFRPVEVLTTPGSLMHAVEPMPTFTIWPAILAP
FT                   EVINKALAQGMPDLVPACSGGDVCSIMALGVDPETGVSWLEATNDGVGFGAHSGGDGSD
FT                   GIMHLSEPGCRNNPIEILETKAPMIIENYRYRTDSGGPGKYRGGVGVERTYRFLAPSSA
FT                   IVINYKTKTKPWGIGEGRDGLNNTVVLYPGTDRSVEVGQSYTHFATNECMANVTGGGGG
FT                   WGDPFTRDPAAVATDVRLGFVSVERAASDYGVVVDPATYDVDEEATRRLRSVGAS"
FT   gene            91912..92895
FT                   /locus_tag="Noca_0081"
FT   CDS_pept        91912..92895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0081"
FT                   /product="peptidase M19, renal dipeptidase"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   mlo:mlr6286 similar to dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79627"
FT                   /db_xref="GOA:A1SCU2"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU2"
FT                   /protein_id="ABL79627.1"
FT                   /translation="MSEPRPRPAAREPLVLDAAVPLVSHPRHLSALLPALTAGGVGVLL
FT                   PTVASIEDLATVSSTLGAWRAFEDGPPPGARLARSVSDIRAAQAAGDLAVVLHVQGLHA
FT                   VGAELDRLELYAAAGVKVAQLTYNYRNYLADGCLEPADAGLSESGRAVVERLNLLRIVP
FT                   DVSHTGERSSLEIVEISTSPVIASHSNAKALCDHPRNLGDGLARAVAASGGVVGLCAFP
FT                   AFVDDTAPTVRRLAEHAAYFAERIGAEHVGMGLDFSDEDASDYEFYGYDERYYPRPPWT
FT                   WPAGLESHADVPGLRAALEQVGFSEEETAGILGENFLRVFAEVWGA"
FT   gene            92896..94077
FT                   /locus_tag="Noca_0082"
FT   CDS_pept        92896..94077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0082"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   sma:SAV1734 oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79628"
FT                   /db_xref="GOA:A1SCU3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU3"
FT                   /protein_id="ABL79628.1"
FT                   /translation="MDCDVVVIGAGIVGAACARRLARAGLAVTVVDRSAAAGGTTAHGE
FT                   GNLLVSDKRAGAELDIAQYSAELWRQLSVELADELGPEFPPLEFEEKGGLVVATDERGA
FT                   GPLVELAASQCQAGVRAEVLSSSEARRLEPELTPSTVAAVHYPEDAQVQPVVAAEALLA
FT                   SARRAGARILPHTEVTGPVLSEGGRLGGVTTTAGPIRATHVVLAAGPWSAGVASSLGAT
FT                   IPVVPRRGMVLVTTRMRHRIFRKVYDADYVGAVGSNDSDLQTSSVIESTASGTVLIGSS
FT                   RQMIGFDDCLRVPVLEELARKAIDLFPFLRTASVMRVYGGFRPFTPDHLPLIGPDVTVP
FT                   GLWHANGHEGAGIGLAPATGEILGALVAGERPAVDASPYLPDRAALVPARGVR"
FT   gene            94074..94412
FT                   /locus_tag="Noca_0083"
FT   CDS_pept        94074..94412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0083"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79629"
FT                   /db_xref="GOA:A1SCU4"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU4"
FT                   /protein_id="ABL79629.1"
FT                   /translation="MSAFLRRAADDPIRRRDGKAISIRVDGEQLTGVEGQSIAGVLLAS
FT                   GRLDWRVTSIDGRPRGVFCGIGVCFDCLVTVNDEPDVRACLRRAVHGDVVARQHDPLPT
FT                   PVERGSDD"
FT   gene            94405..95871
FT                   /locus_tag="Noca_0084"
FT   CDS_pept        94405..95871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0084"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; BFD
FT                   domain protein [2Fe-2S]-binding domain protein;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sco:SCO6291 secreted oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79630"
FT                   /db_xref="GOA:A1SCU5"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU5"
FT                   /protein_id="ABL79630.1"
FT                   /translation="MTDVLVIGAGPAGLAAAAAAREAGGTVTLLDSSDLLGGQYWRHLP
FT                   SSRPAERERLLHHGWDTFAGLRERLASDPHVRIETSAQVWAVERGTGVPVVVHALVGPP
FT                   DAHGRERVALRPDAVVFATGAHDRTLPFPGWDLPGVFTGGAAQALAKGERIAVGRRVLV
FT                   AGAGPFLLPVAASLTQAGAAVVGVLEANRLSTLAKGWSRRPWHLWSTHAKARELAGYAA
FT                   RHLRHGIPYRTGRAVVAAHGTDRVTSVTTMAVDRAWAPVAGTERVIDVDALCVSHGFTP
FT                   RLELAVAAGCSLSPDRFVTTDRDQQTSVPGLYAAGEITGIGGVDLALAEGRIAGWFAAG
FT                   GRIDDRAIDHDLRQRDVYRAFAARLAQAHGIGSGWTRWLEHDTVVCRCEEVSFGRLCGA
FT                   ADATMTTSLRSLKLSSRAALGICQGRVCGRSVEEILGSRATGAPARDGVVADQRPIAAP
FT                   IRIGDLAARQGSPPPHAPPTSPSQTPNETE"
FT   gene            95879..96811
FT                   /locus_tag="Noca_0085"
FT   CDS_pept        95879..96811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0085"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   sma:SAV1731 putative dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79631"
FT                   /db_xref="GOA:A1SCU6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU6"
FT                   /protein_id="ABL79631.1"
FT                   /translation="MTSNFDLGGVVVATTLAFKEDSSAPGGLAVDYDRFAEHCDWLIRN
FT                   GVRGVGPNGSLGEYSSLTPEERRRVIQVAVEAVAGRGLVIAGAHGVGWHQAQKWAELAQ
FT                   EDGADGVLLLPPIVYRANDEEIVEHFSKVAEVGLPIMAYNNPIDTKVDLVPSLVARLAE
FT                   IPEVVAIKEFSGDVRRVLEIQELCDIDVIAGADDLLFESLVVGAKGWFAGYPNAFPREA
FT                   VELYDLVQEGKIAEARELYQAVVAVFRWDSRTEFVQAIKLSIDVAGESYGGASRPPRGP
FT                   LSPAQESAVRSETERALAAIAARRSASVA"
FT   gene            96812..98341
FT                   /locus_tag="Noca_0086"
FT   CDS_pept        96812..98341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0086"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rha:RHA1_ro02898
FT                   aldehyde dehydrogenase (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79632"
FT                   /db_xref="GOA:A1SCU7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU7"
FT                   /protein_id="ABL79632.1"
FT                   /translation="MDGSETPDDRQPPATVELMARAAADAFPAWSATPPRQRASALSAV
FT                   ADAVATAGPELIATAMSETGLPEARLTGELNRTVVQIRLFADIVVDGAYLDVRIDEADD
FT                   DFVLDSRPDLRRYHVPVGPVLNFAASNFPFAFSVIGGDTVSALAAGCPVVVKAHPGHLE
FT                   LSRQTAAVVRAALTGSGAPDATLQLLVGQEQGVAMLLDPRIRAASFTGSTRAGRMLADL
FT                   ALGRPAPIPFYGELGSVNPAFVTSEAAAQHGAAIAQGFLTSVCGSAGQLCTKPGFLFVP
FT                   RGSGVTADVAQAAGAVVEQRLLNPSITAGYTARRDAILGTPGVRALAVGDVRVDGDGQG
FT                   WATPTLVATDVATLHHHRESLLDEAFGPLSVVVEYDDEAGLPGVADELFEGNLTSTIHA
FT                   GDGEDTPTLRALVDWAARTTGRIVFGGWPTGVSVTHATQHGGPWPATTNDAGTSVGSAA
FT                   IGRFLRAVAYQDTPQALLPAPLRDDNPWGVPQLRSPAGRSRSWGEAFRVDG"
FT   gene            complement(98382..99533)
FT                   /locus_tag="Noca_0087"
FT   CDS_pept        complement(98382..99533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0087"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="KEGG: sma:SAV2725 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79633"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU8"
FT                   /protein_id="ABL79633.1"
FT                   /translation="MDALDDLVNDLAAAMGAPCILEDPGFRLLAFSDHRDVDPVRQRSI
FT                   LERRSTEEVRDWFYAHGIAESDQPLRTPAEPGLGIMSRLCVPVRHLGRLQGFFWLLDPS
FT                   GDIDATRWAETQPFADAAGALLSLAERRQAHRDALYREVVEGGHRASRPAAVELAAAAG
FT                   LRMDQPVRLAVVERPDLATQLPSRPSRSGLLWVREAAGSCAAILRADQARSLPTDLAAV
FT                   LGALGLARRVPELDDRTLVGIGPAVASLDHLAEARSGALVALRVGRHRSDPVTCWDGLG
FT                   PLALLGIARDADLARSLVAPGLRAFLEEGSPTLVETARVHLQEAANVARTASRLGVHRQ
FT                   TVYHRLEQIEGAAGIDLADGDARLRLHLALEIAPFVLPSRPGH"
FT   gene            99617..100543
FT                   /locus_tag="Noca_0088"
FT   CDS_pept        99617..100543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0088"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: tfu:Tfu_0434
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79634"
FT                   /db_xref="GOA:A1SCU9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCU9"
FT                   /protein_id="ABL79634.1"
FT                   /translation="MLSPALLRASRSPRARRLVEGLPATRRVVDRFVAGEENADAVRAT
FT                   LELARANRDVSIDVLGEDVHDEGGARRTRDAYLALVGAMADAGVAPGADLSLKLSALGR
FT                   ALPRDGDAIALANAHRICAAADQRGFTVTLDMEDHTTVDATLAVGAELRSDFELVGNVL
FT                   QSNLRRTAGDIEQLRASPARVRIVKGAYREPASVAFQRKAEVDVAYARDISALFGSACY
FT                   PMVATHDPVMLAHAVFEARRSGRDDDGWETQMLYGIRADLQAEIASSGRRMRVYVPVGT
FT                   DWYGYFMRRLAERPANVAFFLRAVAGR"
FT   gene            100572..102200
FT                   /locus_tag="Noca_0089"
FT   CDS_pept        100572..102200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0089"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: aldehyde dehydrogenase; KEGG:
FT                   tfu:Tfu_0433 delta-1-pyrroline-5-carboxylate dehydrogenase
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79635"
FT                   /db_xref="GOA:A1SCV0"
FT                   /db_xref="InterPro:IPR005931"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV0"
FT                   /protein_id="ABL79635.1"
FT                   /translation="MDAVTTPPAPTNEPNLTYAPGAPERATLVAEIEKLQKTQKTLHAY
FT                   IGGRWRAGGGAEIPVVQPHDHQHVLGTMKNSTQADARAAITAASDAAPQWRDMTFDDRA
FT                   AVLLKAADLLAGPWRQRLNAATMLGQSKTAFQAEIDSACELVDFWRFNVHYAKQILTDQ
FT                   PIANSPGVWNRTDHRPLEGFVYAITPFNFTAIAGNLPTAPVLMGNTVLWKPSSTQQLAA
FT                   SLTMELLEEAGMPPGVINMLPGDGLAVSEVALAHPDLAGIHFTGSTPLFQRLWKTVGEN
FT                   IARYRSYPRLVGETGGKDFIVAHASADPDVLRTAMIRGAFEFQGQKCSAASRAYVARSV
FT                   WNKMKDSFLSEIESLTVGDPTDFSHFMGAVIDDRAFARHRAAIDRAKRSGKLDILAGGT
FT                   LDDTVGWFVRPTAIESGDPTDEIFTTEYFGPILAVHVFDDGDFEKVVHAMESSTPYALT
FT                   GSIIARDRRTIAWAQETLRFAAGNFYVNDKPTGAVVGQQPFGGGRASGTNDKAGSAANL
FT                   LRWTSPRSIKETFDPPTDYRYPHLG"
FT   gene            complement(102208..102804)
FT                   /locus_tag="Noca_0090"
FT   CDS_pept        complement(102208..102804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0090"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   plu:plu2238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79636"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV1"
FT                   /protein_id="ABL79636.1"
FT                   /translation="MEPRHHPAEQLELVGLSPADIRFVVYTHLHHDHAGGGRLFPDAEH
FT                   IAQRTEHRWAHCPDPPAAGGYVATDIAGPRAWRLAEGDWHVFRGFSLIFTPGHTPGHQS
FT                   IMLWDVPDLGNVILAGDAINTHENIDGDLPPGIATDALAASFSMRRLTALADATDAVIV
FT                   AGHDLEQFQAMAKAPERLRRTDRWPGPDRRGVARS"
FT   gene            102948..103561
FT                   /pseudo
FT                   /locus_tag="Noca_0091"
FT   gene            103558..104406
FT                   /locus_tag="Noca_0092"
FT   CDS_pept        103558..104406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0092"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: tfu:Tfu_1968
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79637"
FT                   /db_xref="GOA:A1SCV2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV2"
FT                   /protein_id="ABL79637.1"
FT                   /translation="MSGAGLEVLSAGPLTTVQDLGRPGHAPWGVGRSGAADRRSLRLAN
FT                   RLVGNAVEAAGLEVLLGGLELRPDRDVVIALTGARCAATIGGRAADHNTVLRVPAGSVL
FT                   RLGTASAGLRTYVAVRGGIDVPPVLGSRSYDVLSGLGPPVLAAGTVLAVGAPPARFPCV
FT                   DMAPVPDPPAGPVRLRVMSGPHDDWFTGDALGLLERTAWTVTTASDRIGMRLAGAELAR
FT                   ARSTELPSAGVVRGALQVTPAGQPTLFMSDHPLTGGYPVIAVVVDVDVDRAAQVRPGQD
FT                   L"
FT   gene            104442..105254
FT                   /locus_tag="Noca_0093"
FT   CDS_pept        104442..105254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0093"
FT                   /product="protein of unknown function DUF1445"
FT                   /note="PFAM: protein of unknown function DUF1445; KEGG:
FT                   pst:PSPTO_5379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79638"
FT                   /db_xref="GOA:A1SCV3"
FT                   /db_xref="InterPro:IPR009906"
FT                   /db_xref="InterPro:IPR016938"
FT                   /db_xref="InterPro:IPR038021"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SCV3"
FT                   /protein_id="ABL79638.1"
FT                   /translation="MNSAVPGTTHDDIAALTPARARERFRAGERVATSGWCPGFTQANL
FT                   IAVPQQYAYDVLLFTQRNPKACPVIDVTDAGSVEPGIAPGADLRTDLPGYRVYEEGRLV
FT                   AETGDAREHWREDMVAFLIGCSFTFERALLESGVPVRHLTAGTNVPMYRTNRACRPAGR
FT                   LHGPMVVSMRAVPADQVAAAVQVTSRFPSMHGAPVHVGDPAALGIEDLAWPDYGDAPVL
FT                   ADGDVPVFWACGVTPQAVIAAVGIPYAVSHAPGQMFISDVPEATWALA"
FT   gene            105424..106143
FT                   /locus_tag="Noca_0094"
FT   CDS_pept        105424..106143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0094"
FT                   /product="Asp/Glu racemase"
FT                   /note="PFAM: Asp/Glu racemase; KEGG: chy:CHY_1338 hydantoin
FT                   racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79639"
FT                   /db_xref="GOA:A1SCV4"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV4"
FT                   /protein_id="ABL79639.1"
FT                   /translation="MKLTVVSPLLGEEFADGVRKEVAQWAGPDTVIDVVKVERGVASIE
FT                   SEYDEALAGPGILEQVALAVERGAEGVFVTCFGDPAVHAAREIVDVPVVGGFEPAMLNA
FT                   LSLGESVGVITVLDNVVPMIRGLVRRYGLTDRCRSVRVVDLPVLALDAHEELLERLYTE
FT                   ARSVVDSGEADVIVLGCTGMIGVAAAVQARLEADGVFVPVVDPTGAAILWLESQIRLGV
FT                   RPSRATYMPPPPKDRRM"
FT   gene            106207..107760
FT                   /locus_tag="Noca_0095"
FT   CDS_pept        106207..107760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0095"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: mlo:mll9131
FT                   hydantoinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79640"
FT                   /db_xref="GOA:A1SCV5"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV5"
FT                   /protein_id="ABL79640.1"
FT                   /translation="MRIGIDVGGTNTDAVLMDGHQVMGAVKSATQPDVSSGIKATLESL
FT                   RKQRPFAPEDIRAVMIGTTHFINALVEARHLAPTAVLRLGLPATSSLPPLVDWPERLVE
FT                   AIGGRAYLAHGGHEFDGRHIAELDEDELRRHVQDMVAHGLRSLAISSVFSPINSEFELR
FT                   AAEIVAEEAGPEMAVSMSHEIGRVGLLERENATIINAALRELALGIVDGLAGTLASLGI
FT                   DSPLYLSQNDGTLMDMDFARRYPVATFASGPTNSMRGAAILSGLKDCAVVDVGGTTSDV
FT                   GVLTNGFPREATTEVTVAGVRTNFRMPDVLSIGIGGGSLVRGNEAGVTVGPDSVGYRLT
FT                   QEALVLGGSTLTATDIAVASGRADIGDRSLVAHLDRATIEAALARIGSDVADAVERMRT
FT                   SADALPVVAVGGGSILLPDRLEGCGDVHRPEHFSVANAIGAAIAQVGGMVDRIYSIAPG
FT                   QRDAICDEARQEAKDRAVAAGADPETVSIADFDEVPIPYLPGNATRIRCKAVGDLWMER
FT                   "
FT   gene            107763..108863
FT                   /locus_tag="Noca_0096"
FT   CDS_pept        107763..108863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0096"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mlo:mll9130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79641"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV6"
FT                   /protein_id="ABL79641.1"
FT                   /translation="MRVTPTDLIPMARGAAVLGGGGGGDPHIGRLLAASAMRELGDVEI
FT                   VSPEEVPATACVLPIAMMGAPTVMVEKIPSAGQISLALETLARYLGRTPTHVACMEAGG
FT                   VNSMVPFVAAARLGLPLIDGDAMGRAFPELQMVLPTMSGVSATPMSIVDDKNNKGVFDT
FT                   IDNNWAERLARSATIDMGCAPIVSLYAMSGSEVRDCFVPGTLSLCLSIGSAIESARAVN
FT                   QDPVEALVGALRGKLIHTGKVVDVTRRTVAGFARGEAVVTGLDAAAGSQLVLKFQNEHL
FT                   IAEFDGEVLVTTPDLIVVVDAETGEPITTETLRFGHRVAVVAAPMDERWHTPAGIELVG
FT                   PRYFGYDVDPIRFDGTPSEGALLAHV"
FT   gene            complement(108849..110423)
FT                   /locus_tag="Noca_0097"
FT   CDS_pept        complement(108849..110423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0097"
FT                   /product="Regulator of polyketide synthase expression-like
FT                   protein"
FT                   /note="KEGG: sco:SCO1052 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79642"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV7"
FT                   /protein_id="ABL79642.1"
FT                   /translation="MSAASPVPLVALLAHADWQQVSVLAAPPAPTLTVGGVAMVADIRG
FT                   RAADLEGNLLTVLQPPLRDDWQIDVLIQTAAAGRASALLIGDSSPLSQPSSALAARVGL
FT                   TVLGADDPLAAALTARRLVAEVELHVSDTVLRVTAAAARSGEGVEDVMKAVGSVLHRPL
FT                   ALVAAGGDTLLGSDVVAGEDRETVAGTLTAGAARYRATQRVELSDSALLIAHPVPPTTA
FT                   RDATVWLVTRLPHDLPAESAAASAALSVAAAVIGQRASLRRLAVERDARARASLLGELL
FT                   NAPDDVAPTTRRRALEAGWRLDGWHLGIRIDTGPEVDPVAQRPEVIGALQAEGMDAVVV
FT                   EQGDGWSAWITSEDEPRGADVEARAGQIRSAQRRLAATTPTAVGVGRYHAGPRGVARTL
FT                   GEAGEAARLAAGRVASGRFLHVDRLGLGQTLLAWTRTDTFQPAARSLLAPLEGQPGDLL
FT                   HTLTTYLDEESSVSETAAILGIHRNTVAQRLARIRSLLAVDLADPSERLALHLACRTIW
FT                   IPPSDVG"
FT   gene            complement(110420..111496)
FT                   /locus_tag="Noca_0098"
FT   CDS_pept        complement(110420..111496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0098"
FT                   /product="protein of unknown function DUF917"
FT                   /note="PFAM: protein of unknown function DUF917; KEGG:
FT                   mes:Meso_1849 protein of unknown function DUF917"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79643"
FT                   /db_xref="InterPro:IPR010318"
FT                   /db_xref="InterPro:IPR027479"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV8"
FT                   /protein_id="ABL79643.1"
FT                   /translation="MSPPASRTLRAADLEALAVGLCLLGSGGAGDPQPFASVLRSQLGN
FT                   GELVLHAPGGLGGASVVPVGMVGATSVFTEKLPHGGEFGAAVAATGRWTGAAPDAVMGI
FT                   ETAGLNGVTALVAALRMGLPYVDADLAGRGLPRLDQLTWVTAQLPLTPCALAFPGGHTL
FT                   LVDSASATEVERTIRAALAGTGGWAALALPPSPAALLDETACVGTLGRALELGRAHDSL
FT                   RVLADAAEVAEVLGGEVLGEGRVHDVLRHSAGGGLQPESSVTVLDRNGPVLRIETENEF
FT                   LMVLVDGEPRATVPDLICLLDRRTNRPLAVDALRRGDEVFVVVLPAPAWWLAPGRLDRV
FT                   SPAAFAIDSPPLLLGGRP"
FT   gene            111687..112889
FT                   /locus_tag="Noca_0099"
FT   CDS_pept        111687..112889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0099"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: rha:RHA1_ro02908 possible ABC sugar
FT                   transporter, substrate binding component; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79644"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCV9"
FT                   /protein_id="ABL79644.1"
FT                   /translation="MKKQIRSAPGVRPRRLAVAALLLPLVLAACSKPGDPASGGGESAK
FT                   GEVTQAATDTVEKFKAVPDFVSPGPAVDVASLAGKSVFVIPLLTTNDYNIQINAAMERV
FT                   AKLADVDFEVYTNEGQPNQWVAGMNQAIAKGVDVIILSGGTDPRALEPQIKEARDRGIK
FT                   VVVSMFWDTSAQFTPDCSGLSVDCVDGVDAIVAAPYQTATRLDADWIAVDSEGAAKILV
FT                   VTSNDAGPSPGQEAAFKDEIATACPSCEATFANVPISKWTTSVQSTVQSELVRNPDIDY
FT                   VVPLYDNMASYAVAAITAAGKQGQVKVVTFNGTPAVLKMIQDGDIVTMDVGESLEGAGF
FT                   AAMDNAFRLMAGMEPSQVADIVPVRIFDTTNIDEAGTPPEVNKGYGDDLEAQYLEVWGL
FT                   G"
FT   sig_peptide     111687..111806
FT                   /locus_tag="Noca_0099"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.366 at
FT                   residue 40"
FT   gene            112886..114469
FT                   /locus_tag="Noca_0100"
FT   CDS_pept        112886..114469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0100"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rha:RHA1_ro09082 ABC sugar transporter, ATP-binding
FT                   component; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79645"
FT                   /db_xref="GOA:A1SCW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW0"
FT                   /protein_id="ABL79645.1"
FT                   /translation="MTDPARPVLRMRGVAKTFGLTRVLQDVDLTVRRGEVHGLLGQNGS
FT                   GKSTLIKILAGFHTPDEGSIELDGASVDLPLSAVDRRKHRLRFVHQDLALLPSLTVLEN
FT                   LLADDVATGPGIRPRRRRAELARATAQFDRFGISLRPDTLVRDISRLDRAKLAIARAVS
FT                   HLGDDDGDVAGAGRGLLVLDEPTAFLPHSEVAELIALMRAVAAQGTGVLFVSHDLDEVL
FT                   TVTDRVSVLRDGQLVGSEDTASLARGDLVRLIVGRPVSVLSAGSAPVPASQERPRLQVS
FT                   ALRGGAVQHLDLSVHPGEVVGVTGVIGSGFDEVTQLLFGALRASGGSVAIDDLALEARR
FT                   LSPATAIKAGVAYLPSDRAVQGSAPSLTVGENVALLSLRKGGGPFALTGRRLERHAGKL
FT                   LRDLDVRPPEPTLAYASLSGGNQQKAMMAKWLVTGPKVLLLSEPTQGVDVGAREQIFTL
FT                   IAEAARQGCAVVCSSSDLDQLAQICNRVLLMRRGVISDEVHGEAVTKAGLTEMLFADAV
FT                   VRSRRATSDA"
FT   gene            114503..115531
FT                   /locus_tag="Noca_0101"
FT   CDS_pept        114503..115531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0101"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rha:RHA1_ro11174 ABC sugar transporter, permease component;
FT                   TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79646"
FT                   /db_xref="GOA:A1SCW1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW1"
FT                   /protein_id="ABL79646.1"
FT                   /translation="MSVGTTTGHDTDAVAPAQPGARRWTSRIEAGALPAAWLVVFVVFA
FT                   VLLPDTFLSTASVSNILGSQAVPLVLTLCLVLPLVCGDYDMSVASVATLTAMVIGILNV
FT                   NHGWSIGAAILAGLLAALLAGLVNGAVIVIFGVDSLIVTLGTGTVIQGLVLWISDSTTV
FT                   SGISTSLVDLVIGYKLFSVPAAFYYGLALCVVLWYLLQHTALGMRMLFIGRGRDVARLS
FT                   GIAVPRVRMGALVASAGLAGVAGTLYAGTTGSADPSSGTSFLLPAFAAVFLGATTVIPG
FT                   RFNAWGAFIAVYFLATGITGLQLLGAESFVQQLFYGGALVIAVSLAQLARRREASSAGT
FT                   TS"
FT   gene            115531..116544
FT                   /locus_tag="Noca_0102"
FT   CDS_pept        115531..116544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0102"
FT                   /product="dipeptidase, Metallo peptidase, MEROPS family
FT                   M19"
FT                   /note="PFAM: peptidase M19, renal dipeptidase; KEGG:
FT                   dsy:DSY1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79647"
FT                   /db_xref="GOA:A1SCW2"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW2"
FT                   /protein_id="ABL79647.1"
FT                   /translation="MVVPTLPVADCHNDLLLGVLHQRERGIADPFGDFWLPQLRAGGVA
FT                   LQVLPVFTEEQHVGEGALRRSLQVLEEARRLADVHVADVAICERGDQIRPTIESGRIAL
FT                   VLALEGCEPVGHSLELLDTFHRLGVRIASMTWNRRTMMADGVGEQDAGGRLTTLGLEAV
FT                   AEMERLGMLVDVSHLSETGFWHLASVATRPFVASHSSCRALQPHPRNLTDEQIRAVADS
FT                   GGFVAINGFGPFLSDAPTVDSFLDHVQHAVALVGPERVALGLDFMRDLVDAVDPVLSGA
FT                   LVHPDTPPWVAGLERPADLAALAARLEETLGPRAGRQVAADTVIDTLTRQLAPAPR"
FT   gene            116718..117023
FT                   /locus_tag="Noca_0103"
FT   CDS_pept        116718..117023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79648"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW3"
FT                   /protein_id="ABL79648.1"
FT                   /translation="MATVVPVDEFVTDEWYPGFKPALDHAGWAVEPFRTFDKADEKRFW
FT                   FLDFHWPRGLTPMGLIWNEDGYSWGTQLAAESLPLPPGRGITSGSPGRTPTPSRST"
FT   gene            117020..117724
FT                   /locus_tag="Noca_0104"
FT   CDS_pept        117020..117724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79649"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW4"
FT                   /protein_id="ABL79649.1"
FT                   /translation="MTDEWEIGERARRMMQNLPRFLENFEGIWAERRAEVDSWWTHLQS
FT                   VDLRSLQLPELGGYLRKARQFHKRAFEIHFEVMYPLIANYVGFYGACTEMGIDPGQIAK
FT                   MVVAVHQLPFLPRGAAGLSLADLAGARDAADGGLWITGVPSGSPSGRLVVHGRPGGVAQ
FT                   RLAVAAAARTDRNGERPRSSARRPPPREPRPRLSMRRDPPVGRPSRRKWTSRTCARCYA
FT                   GALSYAPTARGA"
FT   gene            complement(118138..118839)
FT                   /locus_tag="Noca_0105"
FT   CDS_pept        complement(118138..118839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0105"
FT                   /product="putative lipoate-protein ligase A"
FT                   /note="KEGG: rha:RHA1_ro00813 possible lipoate-protein
FT                   ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79650"
FT                   /db_xref="GOA:A1SCW5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW5"
FT                   /protein_id="ABL79650.1"
FT                   /translation="MELALAPAMLRRAADGELPEAIHIYSPTTPAVVFGRRDTRLPGFP
FT                   TAVAAARRMGFDVAVRASGGRAVAYTQNTLVIDHVRHDPASVGRLQERFVTYGQALADA
FT                   FTALGIDARMGEVPGEYCPGAHSVNARGVVKLVGTAQRVVKDAWLFSSVIVVEDRLTLQ
FT                   DVLGTVYAALDLPFDPASVGAVREENPQLTRADVRNAVAEVWGLDAIAPTPVAGETLDL
FT                   AHRLVADHRLA"
FT   gene            119154..119783
FT                   /locus_tag="Noca_0106"
FT   CDS_pept        119154..119783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0106"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: mmc:Mmcs_0342 peptidase M15B and
FT                   M15C, D,D-carboxypeptidase VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79651"
FT                   /db_xref="GOA:A1SCW6"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW6"
FT                   /protein_id="ABL79651.1"
FT                   /translation="MPQGCVLPSVDRVTSARIHHPTSRGAVVALLGALLTLAACGDGTG
FT                   AAPAATQGRPQAHERSAAPESARLDRVGLEPGRLGIGRVDVARLEPDLRAALEEATRAA
FT                   EADGVVIEVTSGWRSWEHQERLLDEAVVKYGSLDEALECVSTPEASAHVTGDAVDIGPA
FT                   EAAGWLSRHGSAYGLCQIFANEDWHFELATTPGGECPPMYADASQR"
FT   sig_peptide     119154..119303
FT                   /locus_tag="Noca_0106"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.441 at
FT                   residue 50"
FT   gene            119846..120730
FT                   /locus_tag="Noca_0107"
FT   CDS_pept        119846..120730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0107"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sma:SAV1050
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79652"
FT                   /db_xref="GOA:A1SCW7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW7"
FT                   /protein_id="ABL79652.1"
FT                   /translation="MRIRSIGNETVGRTEVGAIGLGLMTFDQTGTQPREQLLATVRAAI
FT                   DAGVTLFDTADAYGPGEEKGADAQGENELLIASLLDELGVRDRVLLATKGGHVRTEGGA
FT                   WGTDSTDAHLKQAVDDSLRRLGVDQIALWQHHRPSSKVPYEEVLGTMQEIAASGKVRML
FT                   GISNANPEQIRAAHAALGDTLVSVQNQFSPAFRSSRPEIDVCAELGLAFLPWSPLGGLG
FT                   DAKELAAKHPAFARVAEQRGVSAQQVALAWELAQSPVVIPIPGAKRPQSIQDSAAAAEL
FT                   DLTDEELTALDAD"
FT   gene            complement(120754..121770)
FT                   /locus_tag="Noca_0108"
FT   CDS_pept        complement(120754..121770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0108"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   dge:Dgeo_2864 alcohol dehydrogenase GroES-like"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79653"
FT                   /db_xref="GOA:A1SCW8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW8"
FT                   /protein_id="ABL79653.1"
FT                   /translation="MPVAARLHSVGDLRVEQVAEPPAPTVGWSTVAVTSVGLCGSDLHW
FT                   FTDGGTGEVTLDRPVVPGHELAGRALDGPYAGRRVAIDPAIPCGVCEQCRAGHGNLCPD
FT                   VRFAGHAGLDGGLQERLVWPDHLLFPLPDDLSDDAGALLEPLGVAIHAVGVAHVRPGHD
FT                   VLVVGGGPIGVLTAAVARRTGAAQVVVSEPLAHRRETARRFGADVAVAPEEASSAVDEL
FT                   TGGRGVDVVIEMAGADDAIGTAVACARPGARIALGGIPSVPLSSFPAAPARRKGLTFAM
FT                   VRRMHETYPRAIELATSGIDLDALVSDRFPLADAPLAFTHAVARTGDKTVIAVSGTR"
FT   gene            121874..124267
FT                   /locus_tag="Noca_0109"
FT   CDS_pept        121874..124267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0109"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO1740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79654"
FT                   /db_xref="GOA:A1SCW9"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCW9"
FT                   /protein_id="ABL79654.1"
FT                   /translation="MAPRLVRPDPRAGRSRPRAWSLPRPPARRPRGPADRVARSRDSGE
FT                   PAAATRQTGTVDRPTLRRLFPRRVAIVCAAVLVVQGVGLALLVRDVREPRPHQVPVAVV
FT                   GPAVVAQGLAEQVNALEGRPLDVTASADREAAVDDVRHGLTVGAALIDLTGTQDQVVLD
FT                   GSTDERLARAVVEQARAIERSHGRTLSVRRVSMSDVDDDVVRGLAVGFGAVGFVVALAL
FT                   SLRFGPTARTLRLGTRRVLVVAAISLVSGYAATLLPGVSTLDTGAQLRLAGVLALTAAV
FT                   AGTVTLALEGVAGFGGLGLSAVFYLVVATPQLLGTDPHLLPAPWPVLSQWLPPGASVEA
FT                   LGAIALYGGTGIRLPLLVLAVWLLAAVLALQVSRRERVREQTAPDAGLDEPLLLHPPLT
FT                   PVVRHGRLVRWRWRVGVVVLPAAGAAFVLVSFVPRDAVADVAPVASRASETECVSTGTV
FT                   RSVADLNRMVRTVRGGPEFQGGDVGADTELQDGRRVMVFGDTLRSPSFAGQRFVRNSML
FT                   LIGGECIQAVVPEDHGALIPDRPSAQSAGRVGYWPMSAVTITHPGYDLVVVTAQRVRST
FT                   GIDDAFGFESLGPAVAVFVVPRGETPQLVAVRDVGPDAADVTRPEWGAAAVVEGEWLYL
FT                   YGTANPDQPYVFGFSLRVARVHPDDVLRPAAWEYWSGTDWVADPAQSRELIPAAGGTSQ
FT                   TLSVFRDGGQWHALSKRNEFLGSDVVVWTAPDPWGPFDGGRTVAPLPSDAAQGRLRYLP
FT                   LAHPGLLPEPGTVVVSFSRNRTDVDEVVADPTRYRPGFLRVDLP"
FT   gene            124300..124935
FT                   /locus_tag="Noca_0110"
FT   CDS_pept        124300..124935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79655"
FT                   /db_xref="GOA:A1SCX0"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX0"
FT                   /protein_id="ABL79655.1"
FT                   /translation="MSSGRRRSAFVLLLLAVLVNLPFVHSTWTDAKVERSGADVTATVV
FT                   DHREPDWLSFRFPAEIDPDQRTWSVEVEEPTYDEAVGTGRLEVRVLEDDPSAYRVDGAL
FT                   ESRVPLVATVVADVVLLLLALLMWRFGGRLRSSLRAVALGDVERCPPETLLERLQAEDY
FT                   LVRGEVLEVGPDRVVLDLGNRTIEVLLDGHHNAVGHQQAAQVKARMIG"
FT   sig_peptide     124300..124389
FT                   /locus_tag="Noca_0110"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.474 at
FT                   residue 30"
FT   gene            complement(124963..125349)
FT                   /locus_tag="Noca_0111"
FT   CDS_pept        complement(124963..125349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0111"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79656"
FT                   /db_xref="GOA:A1SCX1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX1"
FT                   /protein_id="ABL79656.1"
FT                   /translation="MGGHYPDPQPRMCSRTPLRRRDVVQATPPPRFRQGRRGKRDPQTA
FT                   PTGGPMTITALLMAGLMAFVLLVPTLMVAILVSGIARRPEPAEAAPVTGQATGPVTGPV
FT                   AVPVAVPVGARATVTRPTVELRAS"
FT   gene            125387..125824
FT                   /locus_tag="Noca_0112"
FT   CDS_pept        125387..125824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0112"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79657"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX2"
FT                   /protein_id="ABL79657.1"
FT                   /translation="MDAPRDRIWSALTDPRLVAELTPFVRAIHEDGAHWRWELTALKVL
FT                   GVGVAPAFTEQMTYDEPERIEFRHDPPAGTTERSSVEGWYDLAEHPAGTRLTTALEITL
FT                   DLPLPRISGPAVRAAMSRVIDQMGDRFAQNLLAHLGARQVA"
FT   gene            126048..127421
FT                   /locus_tag="Noca_0113"
FT   CDS_pept        126048..127421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0113"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: amino acid-binding ACT domain protein; malic
FT                   enzyme domain protein; malic enzyme, NAD-binding; KEGG:
FT                   tfu:Tfu_2390 malate dehydrogenase (oxaloacetate
FT                   decarboxylating)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79658"
FT                   /db_xref="GOA:A1SCX3"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX3"
FT                   /protein_id="ABL79658.1"
FT                   /translation="MAATASSYSITMRLHTAPDHGVVGAVATAISAAGGIVTAIDVADS
FT                   SHARLVVDVTCSASDAEHAERLHAAAESVEGVAVHRVSDRTFLLHIGGKIEVTSKVPLR
FT                   NRDDLSMAYTPGVGRVSMALAESPGDVPRLTVKGNSVAVVTDGSAVLGLGNIGPGAALP
FT                   VMEGKAALFKRFADIDAWPICLASQDTDEIVRAVEMIAPGFGGINLEDIAAPRCFEIER
FT                   RLRESLDIPVFHDDQHGTAIVVLAALTNALRVVKKDITDVRIVVSGGGAAGTAIVTLLL
FT                   AAGAPDIVVWDREGCLSRDDDTLPPAKRQLAEMTNPRLVRGDLRAGLDGADVFIGVSGP
FT                   GVLDAEWIKDMAPDPVVFALANPDPEVDPAEAEKYAAVVASGRSDYPNQINNVLAFPGV
FT                   FRGLLDARASEITLDMLLRAAEAIALVVKDEELNPAFIIPTVFHPDVQRKVAAAVRGV"
FT   gene            complement(127444..129465)
FT                   /locus_tag="Noca_0114"
FT   CDS_pept        complement(127444..129465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0114"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmc:Mmcs_0519 MmpL"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79659"
FT                   /db_xref="GOA:A1SCX4"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX4"
FT                   /protein_id="ABL79659.1"
FT                   /translation="MPRILTEAHMTSLITGRRSAWVLALVPFFLALVLIGAVGEGDRAS
FT                   RSTDALPAGLDSTEGTALLDRLPEAASSAAIVLFTADRGELSRDQLAALRDAGAGLADG
FT                   GSPLVLAEDGTAALLAVPVPAGSAGEVADRVSALRAAADDAAPDGVQAQVTGPAAVQAD
FT                   LAAVFDGANTRLLLVTALVVAVLLVITYRSPVLWLVPLVVVGVADRLAAVLATQVMARV
FT                   DVAWDESTVGILSVLVFGTGTDYALLLISRYRDELRTEPSRRRAMAHALRRTAEAVLAS
FT                   ATTVVLGLLTLLLSLTPTTRGLGLACAVGVVVAAAFALVVLPAALVLFGRWVFWPRVPH
FT                   VGEAVTVEADTVWHRIGARVARRPALVAGGSLVLLALMATGIGRIHLGLDQAEQFLDEP
FT                   EAISAATRLAESFPAGTADPTQVVTEGSGDAVLRAVRSVDGVTSARVSATGGGVVVVDA
FT                   VLSGRSGENADVVTALREAVAPYDAHVTGAEAKALDEREGSDRDLRLIVPLILVLVLGG
FT                   LVVLLRSVVAPLLLVVTVVATYAAAMGASWWLFTGPLGFGAMDSGVPLFAFLFLVALGV
FT                   DYNIFLVTRAREEAAGHGSRGGMLRALSATGGVITSAGILLAAVFAVLGVLPLVVLAQL
FT                   GTIICLGVLLDTLLVRTLVVPALALVLGDRFWWPRRVA"
FT   sig_peptide     complement(129328..129465)
FT                   /locus_tag="Noca_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.641) with cleavage site probability 0.197 at
FT                   residue 46"
FT   gene            129511..130020
FT                   /locus_tag="Noca_0115"
FT   CDS_pept        129511..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0115"
FT                   /product="regulatory protein, MarR"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: rxy:Rxyl_1740
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79660"
FT                   /db_xref="GOA:A1SCX5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX5"
FT                   /protein_id="ABL79660.1"
FT                   /translation="MAKPERAGPASEFADAWRQTGSLVALREAIEAGARVRHVVARRAG
FT                   LSDSELVALQHLVRTSLGPAELARILDISTAASTGVVDRLAERGHVERHPHAEDRRRTD
FT                   VRVTASGREEVLAHLLPMFTALDAWDRSFTEAERALVERYLRGVRAAFEQVFDPPVIAQ
FT                   PPPSEA"
FT   gene            complement(129996..130754)
FT                   /locus_tag="Noca_0116"
FT   CDS_pept        complement(129996..130754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0116"
FT                   /product="Polyphosphate glucokinase"
FT                   /EC_number="2.7.1.63"
FT                   /note="PFAM: ROK family protein; KEGG: lxx:Lxx09960
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79661"
FT                   /db_xref="GOA:A1SCX6"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX6"
FT                   /protein_id="ABL79661.1"
FT                   /translation="MAQTAPQPFGIDFGGTGIKGAPVDLEAGDFAAERVRIRTPDPSTP
FT                   ERVAAVFVELLRRFPDSTGAVGVTVPGVVRHGVVRSAANIDRAWVGTDADRLFTRATGR
FT                   EVHVVNDADGAGLAEVRYGAAKGRSGLVIVTTLGTGIGSAMVYDGVLVPNSELGHLEVE
FT                   GHDAESRAANSAREREDLSWEQWAKRLTTYYRTLERLFSPELFVVGGGVSKSSAEFLAL
FT                   VDIDTEIIPAALLNKAGVVGAALYASEGGG"
FT   gene            130799..131413
FT                   /locus_tag="Noca_0117"
FT   CDS_pept        130799..131413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0117"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: nfa:nfa31300 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79662"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX7"
FT                   /protein_id="ABL79662.1"
FT                   /translation="MLLLGAVALFEPVNGYQIRRELLSWQVDRWAHTNPGSIYHGLTSL
FT                   TGLGHLVRHDLVDGGREVAVYELTGSGRAELERLMVEALETVNPYERSAFTVAFSMLPL
FT                   LDRDRVLRSLTRRRVDLEQTVAELAAANPGVAPPHATRSMLLWLDLAVAELAWLRETIE
FT                   DIRAGKLPFEMDDDWGWTPPADDPGWQMSTDREKYRALLGR"
FT   gene            complement(131399..132259)
FT                   /locus_tag="Noca_0118"
FT   CDS_pept        complement(131399..132259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0118"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   dvu:DVU0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79663"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX8"
FT                   /protein_id="ABL79663.1"
FT                   /translation="MTEPADVRLAVLIDADNVSASHAADLLAELARYGVPTVKRAYGDW
FT                   TTQQLAGWKSELARHAIQPIQQFANTVGKNSTDSALIIDAMDLLYSGHLDAFAIVSSDS
FT                   DFTRLATRLRESGKTVYGLGRRRTPASLQAACDKFIFLEVLRDGEGGGADQAHQKEAAP
FT                   GSEHEADADAEADSLPDLRTILEAAVRSTAQDDGWSALGSVGSYLGKTHAAFDPRHYGF
FT                   PRLSALAGAQPYLDLDHPDGGQPRVRLRSQRPPRKRAAAKKAGSQNEPAKKTTKKGAAR
FT                   DSATE"
FT   gene            132342..133082
FT                   /locus_tag="Noca_0119"
FT   CDS_pept        132342..133082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0119"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   sco:SCO1068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79664"
FT                   /db_xref="GOA:A1SCX9"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCX9"
FT                   /protein_id="ABL79664.1"
FT                   /translation="MSRHLDAIRSAMVAFVRYAERAGLGAPVPTCPDWTVRDLVAHQGM
FT                   VHRWATALVRGEHDVDPDAFEAAGRAAADPLEWLRDGAVALADELTRAPADLHALVFLH
FT                   DAPAPREFWARRQCHETTVHGVDALAAALGRWPTAEDTWIEPDLAVDGIDELPGGFLTR
FT                   PRSRLRCEEEALLVVAPDDAPDRWLVHLGPGPAVTERRVGPVFADADWQLDGSAVSLYL
FT                   ALWNRTRRPGLDAGWRDRAAVTWG"
FT   gene            133252..134268
FT                   /locus_tag="Noca_0120"
FT   CDS_pept        133252..134268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0120"
FT                   /product="daunorubicin resistance ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: tfu:Tfu_1447 ABC-type multidrug transport
FT                   system ATPase component; TIGRFAM: daunorubicin resistance
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79665"
FT                   /db_xref="GOA:A1SCY0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY0"
FT                   /protein_id="ABL79665.1"
FT                   /translation="MIQARGLVQTFHTGRGKTAKDVRAVDGVDLDVHEGEVVGFLGPNG
FT                   AGKTTTLRMLTTLLKPTAGSATVAGYDVVTESVQVRRSIGYVSQVGSTFSGAFAGDEVV
FT                   DHGMLYGMSRAEAVRRGQELFAQLQLDGLWRRMPKNMSGGQKRRLDVAMGLIHDPGLVF
FT                   LDEPTTGLDPQARANLWEHIRGLRARLGATVFLTTHYLDEADALADRIVIIDQGRIVAS
FT                   DTADNLKAQVAGDLVDLEVADPGQVAVAAARLEALVHGADGVETDHRHVRARVQRAGRA
FT                   VPALLRDLENAGVALDSIEVLRPTLDDVFLSLTGRSLRDADSTDPSDAPTQPEEVLA"
FT   gene            134268..135026
FT                   /locus_tag="Noca_0121"
FT   CDS_pept        134268..135026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0121"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sco:SCO5382
FT                   putative ABC transporter, integral membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79666"
FT                   /db_xref="GOA:A1SCY1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY1"
FT                   /protein_id="ABL79666.1"
FT                   /translation="MFLRESSIVFRRQIRMNLRNPAWVLIGILQPVLYLLLFGPLLKPL
FT                   VGSFDTGTANAYTFLVPGLLVQLGMFGAFFAGFALIGEWREGVIEAERVTPASRSALLV
FT                   GRLMRDVLQLLVQALILVGLGLAMGLRGSAVGIGLGIVITLLIGGACAAASNALALTTK
FT                   SEDVMAPVINIVMMPVLLLSGILLPMTLGPAWLERASDLMPFRYVVDAVRDGFAGDVAS
FT                   SAVLWGLVWSVALAALGGWWGTATFRRENA"
FT   gene            135349..136794
FT                   /locus_tag="Noca_0122"
FT   CDS_pept        135349..136794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0122"
FT                   /product="alkane 1-monooxygenase"
FT                   /EC_number="1.14.15.3"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; fatty acid
FT                   desaturase; KEGG: nfa:nfa46180 putative
FT                   alkane-1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79667"
FT                   /db_xref="GOA:A1SCY2"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR014607"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY2"
FT                   /protein_id="ABL79667.1"
FT                   /translation="MTATPPTAPPQVPNSTVPAGSTATWKDKKRYLWLIGLVVPSLAFI
FT                   GYGLWALTGWGVWFWIGPFVILVVVPAIDLVAGLDRSNPPDDVIEALEQDRYYRWITYL
FT                   FLPIQYAGFVGAMWLIGGGADLGTLDKIGLAVSIGCIGGIGINTAHELGHKREANERWL
FT                   SKIALAQSFYGHFYIEHNRGHHVRVATPEDPASSRVGENFYQFWPRTVRGSLKSAWRLE
FT                   QRRYARKQQHPFRIGNDVLNAWLMSAVLWGALVAWLGAGVLPYLVIQAVVGFSLLEVVN
FT                   YMEHYGMLRQKVGVGERQRYERVDPTHSWNSNNIATNVLLYHLQRHSDHHANPTRRYQS
FT                   LRDFEESPVLPTGYAGMIVLAIVPAIWRRVMDPRVLAHFDGDLSRANLSPRKRDRILAK
FT                   YPPPASTVVEEVALQPSRNPVADEVLAARCPGCGYTYRVEEGNELEGLAAGTAWADVPD
FT                   DWCCPDCGVREKVDFVPLTEAAA"
FT   gene            136857..137420
FT                   /locus_tag="Noca_0123"
FT   CDS_pept        136857..137420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0123"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_3220
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79668"
FT                   /db_xref="GOA:A1SCY3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY3"
FT                   /protein_id="ABL79668.1"
FT                   /translation="MPGTTRSRIVDAAVAMTVESGWARVTMGALAERVGVSRQTVYNEV
FT                   GTKPGLAEAMIHQELDRFLGVVSEAFDRHPDDLVDAIRAASSGVLELAQDNRLLHAVVS
FT                   ATHGADTELLPLLTTHAESLLAAAKLVVADRLAPYSLGIEGRRLAAAIDVVVRVVLSHV
FT                   MQPSGSPADTADDIAWIAARVLRG"
FT   gene            137752..139167
FT                   /locus_tag="Noca_0124"
FT   CDS_pept        137752..139167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0124"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV4524 transmembrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79669"
FT                   /db_xref="GOA:A1SCY4"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY4"
FT                   /protein_id="ABL79669.1"
FT                   /translation="MAGPDGVRLGTATGRAVVLAAVLGSGMTMLDGTVVNVALRTIGAD
FT                   LDASLPELQWITNGYLLSMASLILLGGSLGDRFGRRRVFVVGTVWFAVASLACGSAPTP
FT                   EVLIVARILQGVGAALLTPGSLAMIQGAFVRDDRAQAIGSWSGLTSIAAAVGPLVGGAL
FT                   VQYASWRWIFLVNLPIATLTVVVARRAVPETRDPNAPRRFDALGAVLAALALGGLTYAL
FT                   IEWGGALAPWAVVVTVLAAAAYLVDERRSDHPMLPLGIFADRTFTAANAMTMVVYAALG
FT                   AVLFFLVLQLQTVSGYGALGAGLATLPITFCMLLLASQGGRLGARIGPRVPMSLGPLVM
FT                   AAGTLLLLRVGAGTTYWTDVLPGLVVFGLGLALLVAPLTATVLAAVADEHAGIASGVNN
FT                   AVARAGSLLAVAALPAAVGLRGEEYADPVAFDAAYGSAILACAALLALGGVVSWLSIRD
FT                   PGIGRTAAPPIGR"
FT   gene            139333..139515
FT                   /locus_tag="Noca_0125"
FT   CDS_pept        139333..139515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79670"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY5"
FT                   /protein_id="ABL79670.1"
FT                   /translation="MTTTLAVPERHARPTTVPSARKRRVAVRPAELVDLMARRPDLVGV
FT                   YTPADVAVEAIRWSA"
FT   gene            139639..139860
FT                   /locus_tag="Noca_0126"
FT   CDS_pept        139639..139860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79671"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY6"
FT                   /protein_id="ABL79671.1"
FT                   /translation="MTATIAATTTARSAALTRPHHGHRRGELPDAVAKEIRAAARVRDL
FT                   VELMARRPDLAGVYGAADLAAEAVRWTA"
FT   gene            complement(139877..140725)
FT                   /locus_tag="Noca_0127"
FT   CDS_pept        complement(139877..140725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0127"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: bte:BTH_I0496 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79672"
FT                   /db_xref="GOA:A1SCY7"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY7"
FT                   /protein_id="ABL79672.1"
FT                   /translation="MSELVLILSCPDRPGIVHAVTGFLVERGANITESQQFGDPLSGRF
FT                   FMRIAVDVPGAVDAAALRAEFAPVAEEFEMRFDVHDAAAPYRTLILVSKDLHCLNDLLF
FT                   RTSTGSLGIEVPAIVSNHPDAAAMAASYGVPFHHVPVTPDTKAQAEERLLELVRELDID
FT                   LVVLARYMQILSDGLCRELSGKAINIHHSFLPSFKGARPYHQAFDRGVKLVGATAHYVT
FT                   SDLDEGPIIEQDVMRVDHTHHQEQLVSAGRDVEAQVLSRAVRWHAQSRVLLNGHRTVVF
FT                   R"
FT   gene            140747..142054
FT                   /locus_tag="Noca_0128"
FT   CDS_pept        140747..142054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_2367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79673"
FT                   /db_xref="GOA:A1SCY8"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY8"
FT                   /protein_id="ABL79673.1"
FT                   /translation="MGRPGRTALRADRRRRLTTYPGPGRDVMRVRRARSTAVLGLAALL
FT                   GALTTACTGPSEAGDPTPDSSSTATASAGSPTASPALDPAHAVDPPGRRTGLISPPDIV
FT                   ASGSKTIAPGRVRAIERLAGVVDVEQVSLVQVVVENRALSVAAVDPTTYRNFVVNADSA
FT                   KADDVWDRVAGGELALRPALQKRAPIDENGFLKLGSAEDAPQVHVGAYAQQSWLVDAVV
FT                   NETWIPTLGMTEGNALLIRTGGTSPETLRAPIQRILRGTGAAPQMTDVVAREGLDPGAV
FT                   QTVVVVGSIADAIGTFRYSVLAGGRIAPDPAWVASHIATRTVPILGTVTCNRLMFPQLE
FT                   AALRDVVAQGLTDKIHPGEYAGCYYPRFIAGSTTLSNHAFGLALDLNVPGNQRGTVGQI
FT                   DRGVVAIFKHWGFTWGGDWRYTDPMHFEMNRLVEPR"
FT   sig_peptide     140747..140923
FT                   /locus_tag="Noca_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.820 at
FT                   residue 59"
FT   gene            142051..142431
FT                   /locus_tag="Noca_0129"
FT   CDS_pept        142051..142431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79674"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCY9"
FT                   /protein_id="ABL79674.1"
FT                   /translation="MSGAPAAPRTAEELFRADPAGLAAYRIVHEALVGWGGCEERVGRS
FT                   QLGFRRARGFAWLWNPRQYLRHATADVVLTFALDHEVASPRIKQAVRTSPLHVVHHVEL
FT                   ADPAVDLDPELLGWLHEAYDRA"
FT   gene            142477..143439
FT                   /locus_tag="Noca_0130"
FT   CDS_pept        142477..143439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0130"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_1554 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79675"
FT                   /db_xref="GOA:A1SCZ0"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ0"
FT                   /protein_id="ABL79675.1"
FT                   /translation="MRAAQVIDTTGPADVVVRDVPEPTPGPDDVLVEVHRVGISFPDLL
FT                   LSKGEYQLKPEVPFTLGVDFAGTVVSGGPFEPGQRVAGVNGYGGAAELVVNPAQFTFAL
FT                   PDHVTFDEGAALPMNYLTAQFALAERGGLRAGETVLVHGAAGGVGTASIQVAKGYGART
FT                   IAVVSTEEKAEVARAAGADAAVLLEGFKDAVLQLTDGRGVDVVVDVVGGSAFTDSLRCL
FT                   APQGRLLVVGFAAGQGIPEVRVNRLLLNNVDVRGVGWGAYAMTRPGYLQDQWAALLPML
FT                   ESGVVKPPIGATYDLDEVTRALVDMDERRTLGKSVLRVR"
FT   gene            143575..145524
FT                   /locus_tag="Noca_0131"
FT   CDS_pept        143575..145524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0131"
FT                   /product="endothelin-converting enzyme, Metallo peptidase,
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: fal:FRAAL4107 zinc metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79676"
FT                   /db_xref="GOA:A1SCZ1"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ1"
FT                   /protein_id="ABL79676.1"
FT                   /translation="MSILDEARAGMSPEIRPQDDLFGHVNGRWLDETEIPADRSSWGPF
FT                   IQLADTAETQVHEIIEDLARRVAAGEPVDEDAHKIGDLFASFMDTETIARNGLRPVRPL
FT                   IEAVAGLRDVRDLAAFLGEFERIGGHGLFGSYVDTDSKNSDRYLFNLVQGGLGLPDESY
FT                   YRDEKFAEIREKYVAYLTTLFGLGEHPDPAAAAATVLAIDTRMAAGHWERAETRDVQKT
FT                   YNLMTRAELIELSPGFDWDAYVTNLGGNEETLAEVCVRQPSYFTHLSVLLDEISLEDWR
FT                   EWLLAHVLRSAAAYLTDDFVETNFDFYGRTLSGTPELRARWKRGVALVEGAIGEAVGKE
FT                   YVARHFPPRSKAMMDELVANLLAAYRQSISRLDWMTEETKQRAYDKLDRFRPKIGYPEK
FT                   FRDYSALRVTRDDLLGNVAAASAFETDRQLAKIGSPVDRDEWFMLPQTVNAYYNPGTNE
FT                   ICFPAGILQKPFFSPDAEEAENYGGIGAVIGHEIGHGFDDQGAQYDGSGNLHDWWTPDD
FT                   KAAFEVKSKALIEQYDGFEPRTLPGERVNGALTVGENIGDLGGLTIGHTAYLIARGGSA
FT                   SVEDRQKVFLNWAYCWRTKRRKEQEQQYLTIDPHSPAEFRANIVRNLDEFHEVFGTVEG
FT                   DGLWLDPDQRVRIW"
FT   gene            complement(145778..146350)
FT                   /locus_tag="Noca_0132"
FT   CDS_pept        complement(145778..146350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79677"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ2"
FT                   /protein_id="ABL79677.1"
FT                   /translation="MSNHRTLAFAAVASLATLGLVGGATTTSSADADGFAPHVGQRVAA
FT                   KATAPVKCGGGALKKMTSRLSAEPFSFAGTAGADVAVTGAQVALTGPPKGTDTVLVTFT
FT                   AESYYTGSGWMSLELHKDGVPAAPYADNGSPFAFTSEASYHGDSAQFCTKIGTGTHVLA
FT                   IQASTTGNSSTDSGWIDDWTMSVPRFE"
FT   sig_peptide     complement(146258..146350)
FT                   /locus_tag="Noca_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 31"
FT   gene            146475..148619
FT                   /locus_tag="Noca_0133"
FT   CDS_pept        146475..148619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0133"
FT                   /product="ATP-dependent DNA helicase, RecQ-like protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sma:SAV2450 putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79678"
FT                   /db_xref="GOA:A1SCZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ3"
FT                   /protein_id="ABL79678.1"
FT                   /translation="MSAPAETDVRRSAEAHLRALVGPRPGEPEPVLREDQWAAIEALAV
FT                   HRRRALVVQRTGWGKSAVYFVATLLLREQGAGPTVIVSPLLALMRNQIAAAERAGIRAV
FT                   TINSTNIEDWEPIHEAIAAGEVDVLLVSPERLNNPGFRDEVLPRLAATCGLLVVDEAHC
FT                   ISDWGHDFRPDYRRIRTLLGELPDGIPVLATTATANARVTDDVAEQLGVSTGSATDGFG
FT                   EVLVLRGSLDRESLRLGVVRLRTAEQRLAWLADHLAEQPGSGIVYCLTVAATQEIADYL
FT                   RSRGHEVAAYSGQTDPTERHALEQDLVNGRVKALVATSALGMGFDATLGFVVNMGAPPS
FT                   PVAYYQQVGRAGRGTTLPPEGATVVLLPAIEDRDIWAYFASLAFPREEQVRRTLEVLGA
FT                   EGRPLSTATLETYVDLNRTRLETMLKVLDVDGAVRRVRGGWEATGREWSYDEERYRRVT
FT                   EARQREQQAMLDYIATDACRMRFLRDQLDDPEAEDCGRCDNCGGLTLSADVSAAALEDA
FT                   GARLARPGVAVEPRKMWPSALANLGIELKGKIAEGAQEGRAVARLTDLGHGQALRELFA
FT                   PATPDGPVPVPLVRAVLEVLGDWRPPVDAIVVVESQTRPTLTADLAAGLSRHLGVPVVG
FT                   RWAIVNPDIVPGQGAANSAQRVAAVGRRFALQVDQPLDGLRVLLVDDRTDTGWTLTLAA
FT                   RAVRRAGAAEVRPLVLATTT"
FT   gene            148881..149261
FT                   /locus_tag="Noca_0134"
FT   CDS_pept        148881..149261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79679"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ4"
FT                   /protein_id="ABL79679.1"
FT                   /translation="MAEGATNRVAADKEYLDEYGFRGRLQQRVDGLTYAVAGLLTAAPE
FT                   PQELLESVRAAADRGTRFLLVAAGDVETEGLAAQRLLTAAPDLVEVWTVPGAGHVQGLR
FT                   TDPEGWSQRVVGFLDAALVGPR"
FT   gene            149285..149956
FT                   /locus_tag="Noca_0135"
FT   CDS_pept        149285..149956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79680"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ5"
FT                   /protein_id="ABL79680.1"
FT                   /translation="MTSQDDSPDDGRRAAELGERLAAWLEELGLGAHLAAAGLPTCERD
FT                   EHGRAAWTDPNTGLPMTGEQLEDLERLLRSEGADPQHAVPVQLVQIARRARVRQELLDS
FT                   AWYDYESLAELRGTSVDATRFAVHKAEGEHRLLVVAADARTLVPAFQLTPEGNLRPELG
FT                   PVLTSLLAARMDPWQAWAWLTQPAGLLGGEVPERAAADPETADVVQRAAARLAERAGAR
FT                   P"
FT   gene            complement(150060..151574)
FT                   /locus_tag="Noca_0136"
FT   CDS_pept        complement(150060..151574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0136"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro01949 multidrug resistance transporter, MFS
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79681"
FT                   /db_xref="GOA:A1SCZ6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ6"
FT                   /protein_id="ABL79681.1"
FT                   /translation="MTETQDERTAPAPGRPVDAPDAPPEGLDRRVLMVAGVVVLGAIMS
FT                   ILDITVVSVALQTFQQEFDATSAEVAWTMTGYTLALASVIPLTGWAADRFGTKRLYLLA
FT                   VLLFTAGSVLCAAATSLEMLVSFRVLQGVGGGMLMPLGMTILTRAAGPERVGRVMAVLG
FT                   IPMLLGPIFGPILGGALIDSASWHWIFLINLPIGIAALAYAAVVLPRDHVEPSETFDWL
FT                   GMVLLSPGLAAFLYGVSSIPAAREEHGTLWTTEVVAPALAGLLLIAAFVPWALNRRNLH
FT                   PLVDLRLFGNGTMTAAVLSMSLFAIAFFGASLLFPLYFQWVRGEDALGAGLLLAPQGVG
FT                   AMITMPIAGVLADRIGPGKIVLTGIAVITVGMGMFTQLDQDTSYAYLLTALFVMGLGMG
FT                   ATMMPIMSAALATLREHTIARGSTLMNIVQQVAASIGTAVFAMLLTNGTIDLDPSDPAG
FT                   FVTGLADAFAHVFVVATVMVALVLVPAFFLPRRKVAPADPTLVVGH"
FT   gene            complement(151665..152153)
FT                   /locus_tag="Noca_0137"
FT   CDS_pept        complement(151665..152153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0137"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: nfa:nfa46650
FT                   putative glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79682"
FT                   /db_xref="GOA:A1SCZ7"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ7"
FT                   /protein_id="ABL79682.1"
FT                   /translation="MSILDAKIARLDGTPSTLGEITGGRPALLVNVASKCGLTPQYAGL
FT                   EELHERLADRGFTVVGLPCNQFRGQEPGTADEIAEFCSATYGVTFPMTEKIDVNGPDRH
FT                   EIYRTLVDTPNESGESGDITWNFEKFLVDASGAVLARFSPGVEPGDPRLVAAVESQVG"
FT   gene            152214..154925
FT                   /locus_tag="Noca_0138"
FT   CDS_pept        152214..154925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0138"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: sco:SCO1167
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79683"
FT                   /db_xref="GOA:A1SCZ8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022138"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ8"
FT                   /protein_id="ABL79683.1"
FT                   /translation="MSFVPVTGPATFRAADPPREGVVEFTDDRRTVSLPIRAALPVLTK
FT                   ARSRDDLHPSVGVLSGAALLALRLVAAGKFAPAGSSPPAWRVAGLDADDEQRIVLLARN
FT                   GPDDEQLVRDLLDAVADAMPRTQPRTQPRSRPSAEPSGTTVSRERRPTFEERLQARLAR
FT                   HQRVDARALPQLVTISLRVEADEEELVAGAVRLVAQAHDEQNPLHLCDLALLWTGTPQE
FT                   HGFGERARTHATIALRAAADAWPVLDRLLELRVPDQLTLDSDELVSLLDEGVGALRAAG
FT                   VDVLWPKALGRDLTATTVLDRAAPMTREEPLNEPVLGAEALFAFNWQIALHGDPLTAEE
FT                   MDRLATSASPLLRLRGSWTVVDPSIARKAKKRLVRTVKPAEAVAAALTGTAQIAAPGGE
FT                   QSEQDVVVGASLLKVRDRLLGAATREPVEPPAALRATLRDYQRHGLTWLAEMTSLGLGA
FT                   CLADDMGLGKTVTLIALHLHRAERGHRGPTLVVCPASLLGNWEAEVRRFAPGVPVVRFH
FT                   GTSRDVEAAGDGFVLTTYGTMRRDAEALGSVRWDLVVADEAQHVKNPRTATARALRSIT
FT                   SAARVALTGTPVENDLTELWAILDWTTPGLLGSRNAFRKAWAAPIESGREPAKARQFAD
FT                   LIGPFLLRRRKSDPGIAPELPAKTETDHPLRLTREQVVLYESFVRDTMARIERADPSDP
FT                   VARRGLVLTLLTGLKQICNHPDHFLKRSGARLSGRSEKVDLLDELVGTVLAEDGAVLVF
FT                   TQYVAMARLLEGHLARAGVPHQLLHGGTPVREREAMVARFQAGETPVFLLSLKAGGTGL
FT                   NLTRADHVVHVDRWWNPAVEEQATDRAYRIGQTKPVQVHRMITRGTVEEKVAELLTRKR
FT                   ALADAVLSRGEAALTELSDDELRDFVALRRDP"
FT   gene            154925..155605
FT                   /locus_tag="Noca_0139"
FT   CDS_pept        154925..155605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0139"
FT                   /product="zinc finger, SWIM domain protein"
FT                   /note="PFAM: zinc finger, SWIM domain protein; KEGG:
FT                   sma:SAV368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79684"
FT                   /db_xref="GOA:A1SCZ9"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCZ9"
FT                   /protein_id="ABL79684.1"
FT                   /translation="MTGTVLHPRVAPRRATARATTWWGKAWVRAVDEAAYAEADLVASR
FT                   ALARAGRVGQIATEPGRFVAAVEDRRGLWTVEGTVPVLGAADVAALVETVAAESGRIAA
FT                   LLAGELPHRLVEHAEEAGVELLPYGGELGASCTCEHWVDPCVHALAVLHQLAWLVDADP
FT                   FVLLQLRGLARDELLGRLHERSAAPLVEPRDSADGTVDEDEPDLQAALEAALYAARLLV
FT                   DPLS"
FT   gene            complement(155620..156168)
FT                   /locus_tag="Noca_0140"
FT   CDS_pept        complement(155620..156168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0140"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   fra:Francci3_2248 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79685"
FT                   /db_xref="GOA:A1SD00"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD00"
FT                   /protein_id="ABL79685.1"
FT                   /translation="MSRRDQILATAAELFAAHGYHGVSVADLGAACGISGPALYKHFAS
FT                   KQAVLAEMLVAISEELLRVGTERVAAATGPRTAIAALVDWHVDFALRHRALIVVQDRDW
FT                   EALPEEARERVRTLQREYVDLWAAQLRLADPRLDLATARAMAHAAFGLINSTPHSGLLP
FT                   DTDMRGLLSRMALGALGAG"
FT   gene            complement(156321..156584)
FT                   /locus_tag="Noca_0141"
FT   CDS_pept        complement(156321..156584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0141"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   cef:CE0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79686"
FT                   /db_xref="GOA:A1SD01"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD01"
FT                   /protein_id="ABL79686.1"
FT                   /translation="MELDPQEMTPVINRIKRAQGQLAGVLRMLEEGRECEDVVTQLAAV
FT                   SRALDRAGFAIVATGLQQCLTTGDGLDSLDAKKMEKLFLSLA"
FT   gene            complement(156586..156990)
FT                   /locus_tag="Noca_0142"
FT   CDS_pept        complement(156586..156990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0142"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   nfa:nfa41010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79687"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD02"
FT                   /protein_id="ABL79687.1"
FT                   /translation="MSFTLSATVERPYDETVAEVREALAGQGFGVLTEIDIRATLAAKL
FT                   GVDVPPQVILGACRPQLAHRALEIDPTIAAVLPCNVVVRSLGEHTTVVEAFDPDAMMGL
FT                   AGDGLTEVAGEARQRLSAALAALTPPAEES"
FT   gene            complement(156987..157367)
FT                   /locus_tag="Noca_0143"
FT   CDS_pept        complement(156987..157367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0143"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: nfa:nfa18780 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79688"
FT                   /db_xref="GOA:A1SD03"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD03"
FT                   /protein_id="ABL79688.1"
FT                   /translation="MTTTTLTAAQFEETVTGNDIVLVDFWASWCGPCRQFAPVFEAASE
FT                   KHPDVVFGKVDTEAERELAAAAQITSIPTLMAFREGVLVFAQPGALPATSLEQVIGAVR
FT                   ELDMDDVRAQLAAQSQDQEENQ"
FT   gene            157493..159649
FT                   /locus_tag="Noca_0144"
FT   CDS_pept        157493..159649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0144"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: nfa:pnf2660
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79689"
FT                   /db_xref="GOA:A1SD04"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD04"
FT                   /protein_id="ABL79689.1"
FT                   /translation="MSTITTPPDVDPEIGYRPGPLGRLGVWVTHHTRATAVVWLLVIVG
FT                   LGAFAPKVEAELSGAGWQADGSESVAARELAQEHFGGNASSAIQVVVHSSKIPLDSSSG
FT                   QRILDRATALLEEDPRIAEVVQPQPGATLSEDGRTAVLLAGAAADPNEMVRAADDLKGP
FT                   LQDLSTAGIQVNPTGASLLWSDFNEANLDAMLKSEMFSWPVTLAILVLAFGALVAAGLP
FT                   LILTLAGLVASAGSLVLINQVVPVSIWAMNFAMMFALALGIDYALFLVVRFRAARMGHH
FT                   ESPRQAIAETMDTAGKAVLLSGATVLISLSAVMLVPSPSFRSMAGGIMLSVVFVLAATL
FT                   TLLPLVLHLLDQRINKLALPWVHTGEHRSPKFAAWGERLWKRPIVFGLAALFILLALAA
FT                   PILGLKTAMPSIKVLPEDASARVGYDLVQESFGEGAPGTLQVVTTGADAEATYDALGAD
FT                   PGIAAAMPPMPAPDGTDHVLIQAVPTVDPSDPGLGATVDRLRADLPESAIVGGAAVENL
FT                   DLKSQLDDSTPLVIGVILALGFLLLLVALQAPLIALLGTLASLLSTAAAFGVARLIFQE
FT                   GWGSGLLGFESQGFLDAWAPVFFFAMIFAIAMDYTVFLLASAKEHFEHTGDPKDAMVGS
FT                   LAHSGRVIFAAGAVMVAVFFTFALSGPLPPKEMGVVLGVAVLLDAFLVRLVLLPVLLRL
FT                   TGRAAWYVPRWLDRVLPDVRFSHS"
FT   gene            159674..159841
FT                   /locus_tag="Noca_0145"
FT   CDS_pept        159674..159841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cgb:cg1481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79690"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD05"
FT                   /protein_id="ABL79690.1"
FT                   /translation="MCHRTTCRRCGKASWAGCGAHVSQVMAGVPKADRCPGHEGEPPLP
FT                   GFLSRLLGRA"
FT   gene            160034..161599
FT                   /locus_tag="Noca_0146"
FT   CDS_pept        160034..161599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0146"
FT                   /product="Hyalin"
FT                   /note="PFAM: Hyalin; KEGG: hch:HCH_03306 protein of unknown
FT                   function (DUF1555)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79691"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR003410"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD06"
FT                   /protein_id="ABL79691.1"
FT                   /translation="MQFTTSRAIVRRLVPAAAGAAVLATVASSAALAAPGVTPAHYTDA
FT                   LDPGSTVTITKTVETPPIPPRPDIVFLADTTGSMGGSIANVRSNANAILAQIQAAQPTA
FT                   RFAVAEYKDESDGPAAVFHVDQQLTDSTADVVAGINAWSASGGGDAPEAWIGALGRIPS
FT                   SIDFRPDGTRVLVMFGDAPSHDPSLGFTLGSATSGLQASGVRVIAIDVPGTAGGLDALG
FT                   QATHVTSQTGGSLAAADPDQVASTILSELQNLPAVVTHDTTCDPGASLSFDQASRTVTS
FT                   GDSTTFDETITVAGDAVQGSVLTCTTRFLVNGELPGPEFVQTVEIAVNDVTPPVVTVES
FT                   KTVEATGPDGATVGYTSSATDNVDGPLTPTCTPASGSLFGLGATTVTCAATDAAGNTGT
FT                   GTGTITVVDTTPPSVGCPEAENPGGQVPGAHNEDGFFRLEASDIVDGDVDVYLRDTGSG
FT                   TVFGPYASGQRVKYTENGAKPSVKTMPSGILHITGTGDAEVYAVDFSGNTSAPAACLVP
FT                   QPPK"
FT   sig_peptide     160034..160135
FT                   /locus_tag="Noca_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 34"
FT   gene            161748..163259
FT                   /locus_tag="Noca_0147"
FT   CDS_pept        161748..163259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0147"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: sco:SCO2776
FT                   acetyl/propionyl CoA carboxylase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79692"
FT                   /db_xref="GOA:A1SD07"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD07"
FT                   /protein_id="ABL79692.1"
FT                   /translation="MKELVDELRERLATARQGGSEKARRKHTDRGKLLVRDRVDRLLDP
FT                   GSPFLELSPLAADGMYGGAVPSAGVVTGIGRVSGREVVVVANDATVKGGTYYPMTVKKH
FT                   LRAQTVAADNRLPCVYLVDSGGAFLPMQDEVFPDREHFGRIFFNQANLSARGIPQIASV
FT                   MGSCTAGGAYVPAMSDETVIVRNQGTIFLGGPPLVKAATGEVVTAEELGGGDVHARTSG
FT                   VADHLAEDDAHALAIVRSIVETVGPRAAAPWEVHPVEEPHEDPTSLYDVIPADTRTPYD
FT                   VREVIRRVVDGSRFHEFKKLYGETLVTGFARVWGHPVGIVANNGILFSESSLKGAHFIE
FT                   LCNQRGIPLVFLQNITGFMVGKEYENGGIAKDGAKLVTAVACSVVPKFTVVIGGSFGAG
FT                   NYGMCGRAYDPRFLWMWPNARISVMGGEQAASVLATVAGRPDDEEFKAPIREQYETQGS
FT                   PYYSTARLWDDGIIDPADTRRVLGMGLAAAANAPVPAPTYGIFRM"
FT   gene            163348..165252
FT                   /locus_tag="Noca_0148"
FT   CDS_pept        163348..165252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0148"
FT                   /product="Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: rso:RSc0265
FT                   probable acyl-CoA carboxylase alpha chain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79693"
FT                   /db_xref="GOA:A1SD08"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD08"
FT                   /protein_id="ABL79693.1"
FT                   /translation="MTNSLAAVLESVLVANRGEIALRVMRACRKYGVRTIAIYTDLDVD
FT                   APHVRAADDAVHVSSYLDIDAVVAAAVASGATAVHPGYGFLSERSAFVRAVEAAGVVFV
FT                   GPPADVMDKMGRKDAAREIAVAAGVPVVPRGEDAGFPVLVKAAAGGGGKGMRVVREEAD
FT                   LEEAKAAAAREALAAFGDDTLLIEKYVERGRHIEVQIMADAHGHVVHLDERDCSTQRRH
FT                   QKVLEEAPAPTISPEVRELVTSSAVALAKQVGYVNAGTVEFLVDDDTGEAYFLEMNTRL
FT                   QVEHPVTELIHHDLDLVLHQLLVALGHPLEIEQDNVRPSGHAIEARVYAEDSFGGFLPQ
FT                   AGRTSIVRWPAGVRVDHALEPDQVVSTSYDPMLGKVIVHGPDRESARRALVDALDRTAI
FT                   LGLTTNVGFLRALVASEEFRDAAIDTAWLDRNSVPAPDDDLPRVFVAWVSAMLAAGHDS
FT                   GQPFRADGWRSGADPAPTIVELDRPVVVDRFAGLVDGRAVRQVAAADHVLTLEVDGRVH
FT                   SAVVNVQPHVAEVVHHGQRFVFERPDVFGDHAVDVGDGAIAAPMPGTVLDVRVEPGATV
FT                   VAGDVLGVLEAMKMELTLKAPFDGTVSQVGATIGAQVALGARLFVVEPHAEAEEEEAG"
FT   gene            165252..166199
FT                   /locus_tag="Noca_0149"
FT   CDS_pept        165252..166199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0149"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   sma:SAV5276 putative hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79694"
FT                   /db_xref="GOA:A1SD09"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD09"
FT                   /protein_id="ABL79694.1"
FT                   /translation="MRTPAVVPALPVSAAPMPDRVTIYEVGPRDGLQNEKSLVPTDVKA
FT                   EFVRRLLAAGLPIVEATSFVHPKWVPQLADAAELMALLGPAGRDCPVLVPNERGLDRAL
FT                   ELGVRHVAIFGSATETFAQKNLNRSLDEQFAMFEPTVRRARDAGLDVRAYVSMCFGDPW
FT                   EGAVPIEQVVGVGKRLFDLGASQLSIGDTIGVGTAGHVTALVRAFDEVGLGTDRLALHF
FT                   HDTFGQALANTYAALQAGITTFDASAGGLGGCPYAKSATGNLATEDLVWMLRGLGIETG
FT                   VDLEEVAATSVWMAAHLGRPSPSAVVRALAPSAS"
FT   gene            166369..167466
FT                   /locus_tag="Noca_0150"
FT   CDS_pept        166369..167466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: syd:Syncc9605_2166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD10"
FT                   /protein_id="ABL79695.1"
FT                   /translation="MSRKVYLHIGAPKTGTTYLQDRLTVNAKTLAAQGVHFPTGSPLVS
FT                   PGLYQFRAALDLLGQDWGGPPGHADGSWEGLVRRARRRSGTVVISHEILAPAAPGQVAR
FT                   AMRDLAGSEIHVVYTARDLARQLPAAWQESIKQGRRWSYRRFLDRFEKGRSWFYRAFDV
FT                   PRVLGTWGAGLPPERVHVVTVPHARVQTQHGDQLWLRMCEVLGIDPVWAPLDSDRSNRS
FT                   LGIAETQVIRQLNRRMDRAARRESTYDALIRDMLAQGELVKRESAAVRLPPERFAWVEE
FT                   RAERWIEWIEGSGVHVVGDVAELRPVRPAEDERWRDPDRVRAKRQLATALDALAAMTRE
FT                   AARRPDPERQLTTRVLAQAQRLRDR"
FT   gene            167474..168574
FT                   /locus_tag="Noca_0151"
FT   CDS_pept        167474..168574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79696"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD11"
FT                   /protein_id="ABL79696.1"
FT                   /translation="MSLGVDTDTPGVRRAWGWAAHLQEGGTTPWRDWTGEGRPGGRILP
FT                   GAQQLELLRRLNQAGRPSADLATRVLEASAPGRGRPDLELEGAVDPLAFGPPPVDPASL
FT                   PDDELLRVLASLLADDLVAAGLPEPRRPRPPRFWRTRYRLVGDPLLADPARAELMARGR
FT                   PPGGRRSVVLVLGADLGTMLVHAWTARSFAEGGPAWRDWLEPLTRRRALPPRADLAGTA
FT                   RTWASRVGPERVRIVLDPAELPGLVGVRRPLPGPPALSADGVDLARRVGQVLGLLAVPP
FT                   RRHALLRDTLRPRLLAVPGPPLTVPAEHLDWVHARAVKVRAAVLRAGYAVHGDPDSLLS
FT                   VDRSGVPEPSDAGVLALGMRLLLENT"
FT   gene            168571..169785
FT                   /locus_tag="Noca_0152"
FT   CDS_pept        168571..169785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79697"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD12"
FT                   /protein_id="ABL79697.1"
FT                   /translation="MSTRVLLHVGTPKTGTSYLQDVLYRNRRTLAAADILYPADRFDAH
FT                   FLAALDLMRLPWGGLEAEAVGAWDRLAARVRGHHGTAIISHEILATASRSQAGRALESL
FT                   GHRAGTEVHLVLSVRDLVRQIPAEWQENVKHRQALTYGAFLDQVQDPQRESRIATWFWG
FT                   VQEIPDILNRWGHDLPPERVHVVTVPPAGGPHQLLWKRFSLVLGLDGLDLDLEAERANP
FT                   SLGAPETALLRRVNRAANRELNPGDYRPLVRELLAHQTLSKRTRSPRLALPPDVHPWTQ
FT                   EVTRSWIAEIEERGYDVVGDLHDLVGAPPVTQYADPDHPAEKQVAAAAVDAIKALLLEG
FT                   ARLRQSEERLRQELRDTQVALERSYLRPTYRWREKVVRRLQGGAVGRQLLAGYRRVRGR
FT                   SSRSA"
FT   gene            complement(169746..170450)
FT                   /locus_tag="Noca_0153"
FT   CDS_pept        complement(169746..170450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79698"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD13"
FT                   /protein_id="ABL79698.1"
FT                   /translation="MSAKGIGGGIGGRIVEKHLVPRVPQLAPDLTASFVREALDRAIHG
FT                   AGPLPAAAAAADKQLREQHGDVKRAVREVIENHVRYAGAQGLLTGVGGVVTAAFAIPAN
FT                   ITGLALIQARMVAGIAHLRGYDLEDARVRNAVLACMLGGDAVDRLVKERKLPAPPMAIA
FT                   TAPVHDPQLDRVLSAEVTSDLITRVAGKRLAITVARRTPVVGGAFGMGADGFATWRIGR
FT                   YADRELRPRTRR"
FT   gene            170563..171246
FT                   /locus_tag="Noca_0154"
FT   CDS_pept        170563..171246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0154"
FT                   /product="Leucyltransferase"
FT                   /EC_number="2.3.2.6"
FT                   /note="PFAM: leucyl/phenylalanyl-tRNA--protein transferase;
FT                   KEGG: pac:PPA2221 leucyl/phenylalanyl-tRNA-protein
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79699"
FT                   /db_xref="GOA:A1SD14"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD14"
FT                   /protein_id="ABL79699.1"
FT                   /translation="MGADLEPGTLLAAYRRGLFPMPSGRPGDPMAWFCPVRRGVVPLDG
FT                   LRVSRSLRRATRDFEIRIDTAFDQVVAGCADPRRSGGWIDEEVGAAYAALHQLGWAHSV
FT                   EAWRHGRLAGGLYGVAIGGLFAGESMFHRQRDASKVALVALVEALNDEWTADRLLDVQW
FT                   LTPHLASLGAVEVPRPTYLRRLARALPLPLPEPFSSVAPTPGGWSMGAPAGPEPDGPPR
FT                   RETDR"
FT   gene            171243..171833
FT                   /locus_tag="Noca_0155"
FT   CDS_pept        171243..171833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79700"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD15"
FT                   /protein_id="ABL79700.1"
FT                   /translation="MTRALILRRGAVAVGLALMASLSACGGDDGGGSGAKAPDDASTDD
FT                   FCATFNSLFEKVLSQATSGDSAAVISALKDWAADIEDVGTPSAMPDDARHGFELFVDQA
FT                   KKLDENASLEDLQNLGDDLSADDQADGEAFTTWTEENCPLDIPGLDGSDLPSIDPSDLP
FT                   SIDPSDLASMDPEELESMMSELASNMSELTESP"
FT   sig_peptide     171243..171356
FT                   /locus_tag="Noca_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.408 at
FT                   residue 38"
FT   gene            complement(171864..172199)
FT                   /locus_tag="Noca_0156"
FT   CDS_pept        complement(171864..172199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0156"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: sco:SCO3839
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79701"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD16"
FT                   /protein_id="ABL79701.1"
FT                   /translation="MTQVPTVPIEGVPHPLPDGLVVLDVREPAEWEHGHIEGAVHIPLA
FT                   LLPLRHTELPEAQTLVVCRVGARSAQAVAWLQQQGHDAVNLAGGLLDWEAAGRPMVSDT
FT                   GRPPQVV"
FT   gene            complement(172231..173097)
FT                   /locus_tag="Noca_0157"
FT   CDS_pept        complement(172231..173097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0157"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase /
FT                   Formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /note="PFAM: Formamidopyrimidine-DNA glycolase; KEGG:
FT                   lxx:Lxx00140 formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79702"
FT                   /db_xref="GOA:A1SD17"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD17"
FT                   /protein_id="ABL79702.1"
FT                   /translation="MPELPEVEALALDLRGRLDGHAIAKIHVAAFSALKTFDPPLSALE
FT                   GTLVDDVTRHGKFLDIEASGLHLVLHLARAGWVRWRDEVPTIPPKPSTKSTLAVRIVLD
FT                   DQSGLDVTEAGTRKSLAMYVVRDPHDVPGIASLGPDPLTDEFTIDRLREILEREGRKQL
FT                   KGVLRHQGTIAGIGNAYSDEILHAARMSPFKAAGTLTDDELQVLYDALRGTLGDAVGRS
FT                   RGLAASELKGEKKSHLAVHGRAGQACPVCGDTVREVSFADSSLQYCPTCQTGGKPLADR
FT                   RLSKLLK"
FT   gene            173255..173677
FT                   /locus_tag="Noca_0158"
FT   CDS_pept        173255..173677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79703"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD18"
FT                   /protein_id="ABL79703.1"
FT                   /translation="MRRIPAGNAPRVTIRAIPHAISKLLMVFRCPEHRPPERRRPPRPV
FT                   TARRLRAHHGQVPAVRPLPETGSIFLDARGGDRALRVSWHQDAGLVVLSLWRDNVCAGS
FT                   FRLAIDEVPELIEMLRAGLVRSYEQARDRLGTVESA"
FT   gene            173827..175029
FT                   /locus_tag="Noca_0159"
FT   CDS_pept        173827..175029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro02400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79704"
FT                   /db_xref="GOA:A1SD19"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD19"
FT                   /protein_id="ABL79704.1"
FT                   /translation="MDPIRNPYAPGAGQRPPELAGRDRELEQFEVTLERVAANRPERSM
FT                   VLSGLRGVGKTVLLNALRGQAVRRAWGTGKIEARPDQSVRLPVAQAVHAAVREVAHRHR
FT                   DPDRVDAVAGVLKSFALRTGVDERRAAARAGARWTPPVDVPATRGRADSGDLELDLVEL
FT                   FTDVATLAGDLGVGVALFVDEMQDVAPPELAAVCGACHEISQQGAPLIVVGAGLPHLPV
FT                   ALAASKSYAERLFRYVSVDRLPRPMADRAWRVPAGSEGVTFEEAALDELYRLTDGYPYF
FT                   VQAYGKVTWDAAVGSPIRVADVQAAAPEAEAELAVGFFGARYDRATPAERDYMTAMADL
FT                   GAEHGDAAVATADIARHLARKPQSLSPARDGLIKKGLVYSAERGSVAFTVPHFGKFLRS
FT                   R"
FT   gene            175148..175516
FT                   /locus_tag="Noca_0160"
FT   CDS_pept        175148..175516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0160"
FT                   /product="methylmalonyl-CoA epimerase"
FT                   /EC_number="5.1.99.1"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mlo:mlr1095 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79705"
FT                   /db_xref="GOA:A1SD20"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD20"
FT                   /protein_id="ABL79705.1"
FT                   /translation="MDLVQIAQRADDLERATAFYTLLLGSPPVATYEPPGLVFFDLGGV
FT                   RLLIEHGAPSATVYLRVEDIDAAVAQAREAGTEVASEPHVIFAHADDTLGPRGTDEWQA
FT                   FIRDSEGNLVGLVEHRPR"
FT   gene            175513..176310
FT                   /locus_tag="Noca_0161"
FT   CDS_pept        175513..176310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0161"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: sma:SAV4224 putative phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79706"
FT                   /db_xref="GOA:A1SD21"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD21"
FT                   /protein_id="ABL79706.1"
FT                   /translation="MRPQVVAHRGASYENAEHTLGAYIAALDAGADAVECDVRLTADGH
FT                   LVCVHDRDLRRTARTRGLVSTMELAELDQLDFASWKNPWADLDDEAPLRDERLDRVLTL
FT                   RTLLETIADYDRPVEVAIETKHPTRYGGLVERRLIEQLRRFGWDRPGAPVRVMSFSWTA
FT                   LQRVERLAPGVRLVMLLEHARNWPALRRLVGPDWLVGPGIDELMDHRRLGPRITRSGHD
FT                   LHVWTVNTPVELDLCLELGVKAVITDRPAYVRDLLDQREADPG"
FT   gene            176321..177259
FT                   /locus_tag="Noca_0162"
FT   CDS_pept        176321..177259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0162"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG: sma:SAV4226
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79707"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD22"
FT                   /protein_id="ABL79707.1"
FT                   /translation="MAKKSRTKARDHQPASGEVGPRQPCPCGSGKRYKACHGAAGGAPA
FT                   PFVNRPFEGLPSECDIVAMRELVPAATAPLTLVDHADRTVQLCTLLPMAAPAMVRDSGE
FT                   IWLGLQVQHNFGDPARDLGAVLAKALTADAGIVGLTDPPGEGPRLQDLVTGDRLAVTVH
FT                   EGFEFWIGDVEESERAGMAAALEQANTAAMPTARLTTVEAAYWTDVGTKEHLRWVLPEP
FT                   EDRLLDALARLHAAGNDGLVAGSRFVGMFRAHGLLAPVWDLPLGTGPEPLEEPAERFAA
FT                   DLAQALADTSDLTADERAARSGLANRQVTIR"
FT   gene            complement(177386..178240)
FT                   /locus_tag="Noca_0163"
FT   CDS_pept        complement(177386..178240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV5728 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79708"
FT                   /db_xref="GOA:A1SD23"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD23"
FT                   /protein_id="ABL79708.1"
FT                   /translation="MENVLLATFELLPQGEDGGDLLPRELARLGIEARWAVWTDPEVDW
FT                   SRADAVVVRSTWDYHRRLPEFLAWADRVAATTRLVNAPDVLRWNADKRYLLDLADAVPV
FT                   VPTRDVPPDGLVAGLADGLAEHGTVVVKPRVGASGVGVVVAERSDDLRLAGLTAGPWLV
FT                   QPLVTSVRTEGEASVFVFAGRAVSQLRKVATSGDVRVHEEYGGTTTPVPLDAEAAALAE
FT                   RAVAVAGEHCGPAPAYGRVDLLHHHGRLVVSEVELIEPGLYLDLLPGNAEALAAALAAV
FT                   LVT"
FT   gene            complement(178261..179376)
FT                   /locus_tag="Noca_0164"
FT   CDS_pept        complement(178261..179376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0164"
FT                   /product="adenylyl cyclase class-3/4/guanylyl cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rha:RHA1_ro05084 probable adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79709"
FT                   /db_xref="GOA:A1SD24"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032026"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD24"
FT                   /protein_id="ABL79709.1"
FT                   /translation="MEELLLGALPHLTRGEVAERAGLPIEVAEQLWRLLGFARTAPDDL
FT                   AFTEADVEALRLTRELIELGILGPDSQAALVRTWGRSYARLAEWQTSLLADIAVADADP
FT                   GRRLTELAESVLPRVEALQSYVWRRHLASATGRALAAESAAAPVSPLAVCFVDIVGYTS
FT                   RSKALDQAELVGWLEQFEDAATGVVVDHGGRIIKTIGDEVLFVADRAADAAEAALRLTA
FT                   RGSDEADPFPAVRAGIAYGDVVSRLGDVFGPTVNVAARLTSLARPGTVLVDDGCYAALT
FT                   GRADDSDQASDQASDQGSDDSGDEGSAGADPVDETGTERDDAGDGTGSDSGDEAGAGAP
FT                   YTFRRMRRASVKGYSRLQPWVLRRLPLPTRE"
FT   gene            complement(179430..179804)
FT                   /locus_tag="Noca_0165"
FT   CDS_pept        complement(179430..179804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0165"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mmc:Mmcs_2490
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79710"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD25"
FT                   /protein_id="ABL79710.1"
FT                   /translation="MAESFYDAFAPEEIARIAAAGTRVHVPEGWSPIWEKTPADKAYII
FT                   LDGTVSVRHRGEEIAQLGAGEIVGEAAIVNHSLRTASIVALTPLELIHFTDEAVRRLCA
FT                   EMPAFKTALEAVAVERFGRN"
FT   gene            complement(179899..181122)
FT                   /locus_tag="Noca_0166"
FT   CDS_pept        complement(179899..181122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0166"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="PFAM: amidinotransferase; KEGG: rha:RHA1_ro05654
FT                   arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79711"
FT                   /db_xref="GOA:A1SD26"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD26"
FT                   /protein_id="ABL79711.1"
FT                   /translation="MASPHGADSEVGTLQTVMLHRPGNELKRLTPRNNDRLLFDGIPWV
FT                   SRAQEEHDAFAEALRARDVEVLYLTDLLTETFASDTAREHAITTALAGLHLGDTMRGYL
FT                   TGFLHDAAPAELTGYLTAGIRNDEVRGGRGLVTSLLARDDFLIDPLPNLLFTRDSSVWV
FT                   RDRVAVTSLAMPARARETQLTELIYTEHPRFQGTRKIHGWHHEHVEGGDVLLLAPGVIA
FT                   VGVGERTTPAGAERFARQVFHADLAHTVLAVPIAQERATMHLDTVCTMVDVDKIVMYPN
FT                   IADSLQAYAVTLAERADDDHDLVLAVAGPEPFLVAAAKAMGIDTLHQIDTGLDPVTAER
FT                   EQWDDGNNTLALAPRVAVAYERNDETNDRLEEAGIEVVRIAGSELGSGRGGPRCMSCPI
FT                   AREPLPAG"
FT   gene            complement(181155..181745)
FT                   /locus_tag="Noca_0167"
FT   CDS_pept        complement(181155..181745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0167"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   fal:FRAAL0931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79712"
FT                   /db_xref="GOA:A1SD27"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD27"
FT                   /protein_id="ABL79712.1"
FT                   /translation="MDPVVIGLTFLAIFVVELPDKTFLATLVLATRYRPILVWLGVGLA
FT                   FAVQTTVAVLLGHAVSFLPDDAVRAGAALMFLAGAVILVREGRGHQQAAAEDTPAPTRD
FT                   RHGLQAVVASFLVLFAAEWGDLSQLLTISLVAKYEQPFSVYAGALGALLVVSGLAVLAG
FT                   RQLQRFISLHVLHYVGAAVCLTLATFTAYDLLA"
FT   gene            complement(181745..182926)
FT                   /locus_tag="Noca_0168"
FT   CDS_pept        complement(181745..182926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0168"
FT                   /product="protein of unknown function DUF111"
FT                   /note="PFAM: protein of unknown function DUF111; KEGG:
FT                   cef:CE2361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79713"
FT                   /db_xref="GOA:A1SD28"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SD28"
FT                   /protein_id="ABL79713.1"
FT                   /translation="MTTAWVDASAGASGDMLLGALVGAGVPVAVLQAAVDAVAPEPVTL
FT                   RVEHVRRGGLAATRCHVEVTDTARHRTWRDVRTLLAAADLADDVRGLALRVFERLATAE
FT                   ATVHGTSPDDVHFHEVGALDAIADVTGVVAGFVHLGATAVTVSPVAVGSGSVSTAHGLL
FT                   PVPPPAVAELLRGVPSYAGAATMETCTPTGAALLTTLATAYGPQPAMSVDTIGVGAGGR
FT                   DPEGHPNVLRLFVGVPADAGGGPLLLECNVDDLDPRVWPAVIAALLEAGASDAWLTPIL
FT                   MKKGRPAHTLSALVDAGRAAGVRAAIFRQTSTIGLREQPLTKHALEREIVAVDVDGQRI
FT                   AVKLARHDGAVVNAQPEYDDVARAAADLDRPVADVLAEAVARGRAFLTPGDKI"
FT   gene            complement(182923..183609)
FT                   /locus_tag="Noca_0169"
FT   CDS_pept        complement(182923..183609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0169"
FT                   /product="circadian phase modifier CpmA"
FT                   /note="KEGG: syc:syc0382_d circadian phase modifier CpmA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79714"
FT                   /db_xref="GOA:A1SD29"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD29"
FT                   /protein_id="ABL79714.1"
FT                   /translation="MDQPVEPRTTDLGFARVDVDRAHRTGDPEVVYGSGKTPDQVVAIL
FT                   RALHDKHPERAVLATRVAADALDVVARALPGATVDRVARAVTVGPMPETRGTVAVVSAG
FT                   TSDAPVAAEAALTVRVHGSAVDQISDVGVAGLHRLLGVRERLDAADCLVVVAGMEGALP
FT                   SVVGGLTGVPLVAVPTSVGYGASLGGVAALLAMLNSCAPGIAVVNIDNGYGAGVHAARV
FT                   ARRSAR"
FT   gene            complement(183811..184674)
FT                   /locus_tag="Noca_0170"
FT   CDS_pept        complement(183811..184674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0170"
FT                   /product="prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; KEGG: rpa:RPA3695
FT                   chorismate mutase/prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79715"
FT                   /db_xref="GOA:A1SD30"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD30"
FT                   /protein_id="ABL79715.1"
FT                   /translation="MTRRIAYQGEPGSNSHQVCKQHYPDWEAVPCASFEDVFAAVEGGP
FT                   GVAPAADLAMIPIDNSIAGRVADIHHFLPGSRLHIIAEHFLRIRFHLLGVPGSSLDTIT
FT                   TVHSHVHALGQCRKVIREHGLKPVIAGDTAGAAREVAELGDPTLAAISPPLAAEIYGLD
FT                   VLEEDVEDEEHNTTRFVVLSPDLVQAPSGNGPVVTSFIFNVRNLPAALYKALGGFATNG
FT                   VNMTKLESYMVGGEFAATQFLAEVDGHPDDIGVKRALEELAFFTTDIKVLGVYPADPFR
FT                   AEVSSP"
FT   gene            184780..185208
FT                   /locus_tag="Noca_0171"
FT   CDS_pept        184780..185208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sth:STH3328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79716"
FT                   /db_xref="GOA:A1SD31"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD31"
FT                   /protein_id="ABL79716.1"
FT                   /translation="MARHSLGAVEILAVLVAILALLVAVVVGLVTLRRTAPGRGDGADA
FT                   LPEDVHGLRQEVAALRAEAAAALRHLAVVRYDAFGDMGGHLSWSLALLDDGGDGVVLTS
FT                   IHGRSDARTYAKGIRGWRCDQQLSPEELEAVANARPRG"
FT   sig_peptide     184780..184917
FT                   /locus_tag="Noca_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.250 at
FT                   residue 46"
FT   gene            185229..185696
FT                   /locus_tag="Noca_0172"
FT   CDS_pept        185229..185696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0172"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: rha:RHA1_ro02638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79717"
FT                   /db_xref="GOA:A1SD32"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD32"
FT                   /protein_id="ABL79717.1"
FT                   /translation="MNPLRWLALRLGAQPWLPRFARVIVTLDLTTQRLSRGRVDLLTFA
FT                   GLPELLLQVPGRRTGVLRSTPLLCVPHGDGWLVAGSNWGAPTPPAWVANVLGADEPLVT
FT                   FRGHTVAADALLLTGPDRDEAWAVMTGTWPNYAKYAERTGRELPVILLTPR"
FT   gene            complement(185796..187316)
FT                   /locus_tag="Noca_0173"
FT   CDS_pept        complement(185796..187316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0173"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG: lxx:Lxx21980
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79718"
FT                   /db_xref="GOA:A1SD33"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD33"
FT                   /protein_id="ABL79718.1"
FT                   /translation="MFVLVTIAVQTGWGPVTSIDNRGQGAETWAVDERWLRLPLRWIEV
FT                   GFGAIGTWVIVGVLAVLLFVRQHRRAAVYAVGVVAVTKIATTILKAVFGRHRPDWQNPE
FT                   HLLDSNAYPSGHSSTIVALVGVAAVLVMMLVRRRSARHTAYALLAVLAVVVGLDRVLLG
FT                   RHFPSDVVGGALLGAIVVLLGIVVQNPLPRSHAASVEPLPEVFGSEHRLTVILNPVKVE
FT                   DVGQFEALVTAMAAEAGWSAPTWHYTTVEDPGTGMAEAAAVAGTDLVLVCGGDGTVREV
FT                   CAELAGTGIPVGIIPAGTGNLLARNLDIPLYLRAAIDVALTGQDRAIDLVEVSGDGFED
FT                   THFMVMAGMGFDAAIMEGVNEDIKKRVGWLAYVLSALKSLMFPAVRVEVSVDGGEFTRH
FT                   RARTIVVGNVGFLQAGMPLLPDAAIDDGVLDVVMLHPRRFLSWIPLAYRVLARRPRTDE
FT                   LVNRMTGHTVVVRASTDTPRQLDGDSIGPGRELRMTCVHGRLLVRVPR"
FT   gene            187506..188780
FT                   /locus_tag="Noca_0174"
FT   CDS_pept        187506..188780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0174"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: sco:SCO3961 seryl-tRNA synthase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase, class II (G,
FT                   H, P and S); seryl-tRNA synthetase, class IIa"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79719"
FT                   /db_xref="GOA:A1SD34"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SD34"
FT                   /protein_id="ABL79719.1"
FT                   /translation="MIDPRVLRDEPDRVRAAQVKRGLSDEVVDHALSADGERRRAIAAF
FT                   EAKRAEQKQLGKLIPQAQGEEKQALLAQTKTLAAEVKQAEAAQAVAEEAWQAALMSIPN
FT                   LAADEAPAGGEDDYVVLEEIGTPRDFAADGFEPRDHIELGRMLGAIDLDRGAKVSGSRF
FT                   YFLTGAGAELELALVNLAMQQARESGFTPVIAPSMVKPRAMDGTGFLGQAADDVYRIEG
FT                   QDMYLVGTSEVPMAAYHSDEILDGGALPLRYAAFSPCFRKEAGSHGKDTKGIIRVHWFD
FT                   KVEMFVYTTTEESYAEHQRLLAWEKEFLEKLELAYRVIDVAAGDLGLSAQRKFDCEAWI
FT                   PTQGRYRELTSTSNCTEFQTRRLDTRGRFGSEIRPISTLNGTLCAITRTIVAVLETHQQ
FT                   ADGSVRVPKALQPWLGREVLEPVTT"
FT   gene            188777..189625
FT                   /locus_tag="Noca_0175"
FT   CDS_pept        188777..189625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0175"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   sucrose-6F-phosphate phosphohydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase, type 3; KEGG:
FT                   pac:PPA2205 hydrolase (HAD superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79720"
FT                   /db_xref="GOA:A1SD35"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD35"
FT                   /protein_id="ABL79720.1"
FT                   /translation="MSGPVSGWRPRLVALDIDGTILKWVEGSGTTREEISPTVKESVHR
FT                   VLAAGAHVVLASGRSPHGMTNVADLLELHGPGRDRLWIVASNGAVVFRYPPLDVVHEET
FT                   FDARPAVEAILDRHPTALVAVEERGVGYRVNSHFPDGELSGDMIVTEIDELLAVEVSRV
FT                   IIRDPESTADEFVALAEELGLQGTNYVVGWTAWLDLAPVGVSKASGLEYVAKQLGISSD
FT                   DTLALGDGRNDVEMFEWAHRGVAMGQAIEEVLAKADAVTGSVYEDGVATELDRWFGDGR
FT                   A"
FT   gene            189625..190122
FT                   /locus_tag="Noca_0176"
FT   CDS_pept        189625..190122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0176"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO4311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79721"
FT                   /db_xref="GOA:A1SD36"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD36"
FT                   /protein_id="ABL79721.1"
FT                   /translation="MLPDGPPEVVTSERLRLPLWTPQDAADIRAGRHREGWHRDYPRPD
FT                   DRDAATIYRSGDPWAPRHVVRGVTALGSIGFFGPPQAAADGVPEVEVGYGLVAEARGWG
FT                   FATEALRALLAETDRAGVRVRASVDPANTASVRVLAKCGFTELRGSNEDGELVMARPLP
FT                   AS"
FT   gene            190119..190913
FT                   /locus_tag="Noca_0177"
FT   CDS_pept        190119..190913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0177"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   Haloacid dehalogenase domain protein hydrolase, type 3;
FT                   KEGG: sco:SCO3950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79722"
FT                   /db_xref="GOA:A1SD37"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD37"
FT                   /protein_id="ABL79722.1"
FT                   /translation="MTRPRLVATDLDGTLVRSDGTVSPYTREVLTAVEAAGAIVVFVTG
FT                   RPLRWAEEVFDHVGEHGLAVVANGALVWDVGRHDVHLLRPIDPALGLEASELLRAALPG
FT                   TTFAVETVDGIGLEPEFLERHPLPEDARRGPLTELFDRPAVKLLARHEELGPQEFWDLA
FT                   EEALGGRLVITWSSASALLEISAPGVTKASTLALLCADLGVEAEEVIAFGDMPNDLPML
FT                   AWAGSSYAMADAHPTVTAAADHVAPGHDEDGVARVLAGVFDL"
FT   gene            190923..191534
FT                   /locus_tag="Noca_0178"
FT   CDS_pept        190923..191534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79723"
FT                   /db_xref="GOA:A1SD38"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD38"
FT                   /protein_id="ABL79723.1"
FT                   /translation="MDAVPVPVPGSVTRLPRLLLAALLLAGGGVVATGAMAAPALACPA
FT                   SRTGLDQLTMQADDVFTGAVEDRARQGRTIVYTVTVDRVYKGDLDGTEATVTTPARARA
FT                   CGLPDLRTGTDYVFFTQGADLETTSTAGTAPAAATLLRRVERLLGEGHPATPPTPPEAT
FT                   FTLVGEQPTSFERVAAPGAALVIAGLLGLLLVAGLSRRRA"
FT   sig_peptide     190923..191051
FT                   /locus_tag="Noca_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.506 at
FT                   residue 43"
FT   gene            complement(191631..192209)
FT                   /locus_tag="Noca_0179"
FT   CDS_pept        complement(191631..192209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0071 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79724"
FT                   /db_xref="GOA:A1SD39"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD39"
FT                   /protein_id="ABL79724.1"
FT                   /translation="MNEQPGQDEQEQQVVIIGPDGHPMGSVPASALEPGESGDEDDERA
FT                   ITDLVEQPAKVMRIGSMIRQLLEEVKAAPLDEASRNRLKEIHQASIKELEAGLAPELVE
FT                   ELDRLTLPFTEDTVPSDGELRIAQAQLVGWLEGLFHGIQTAIYAQQMAARAQFEQIRKA
FT                   LPQAMNPGAGQPRPDGEAPRPGDSGGMYL"
FT   gene            complement(192241..193218)
FT                   /locus_tag="Noca_0180"
FT   CDS_pept        complement(192241..193218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0180"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   sma:SAV4368 quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79725"
FT                   /db_xref="GOA:A1SD40"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD40"
FT                   /protein_id="ABL79725.1"
FT                   /translation="MRAVIATGAGGPDVLSVAELPDPEPGPGEVLLAVAAAGLNRADLL
FT                   QRQGFYPPPPGASDVIGMECSGTVAALGEGVEGWAVGDPACALLAGGGYAELVAVPSGQ
FT                   LMPVPDGVDLVTAAALPEVACTVWSNVFMLGGLKPGEAFLVHGGAGGIGTFAIQLAHQL
FT                   GAQVLTTAGTAEKRAACAALGADVTIDYRDQDFVEVARAATEGRGVDLVLDNMGAKYLD
FT                   RNLDALATEGRLVIIGMQGGTRAELDINKLLRKRGAIIATTLRARPTEEKSAICASVVE
FT                   HVWPLVAEGLVRPVVHGTMPLAEAGAAHALMESGEHSGKILLTV"
FT   gene            complement(193256..193606)
FT                   /locus_tag="Noca_0181"
FT   CDS_pept        complement(193256..193606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0181"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3828 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD41"
FT                   /protein_id="ABL79726.1"
FT                   /translation="MNLHDWIDELSDVLDVDTELDEALVLDLARAAAHNVARPAAPITT
FT                   FLLGFAAGSQDADPDAVEALAAKAQALADGWDRPANAPDPDDINDPVPDDSVVDHTGDV
FT                   FEDENAGADEEE"
FT   gene            complement(193659..194276)
FT                   /locus_tag="Noca_0182"
FT   CDS_pept        complement(193659..194276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0182"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /note="KEGG: sma:SAV4365 molybdopterin-guanine dinucleotide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79727"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD42"
FT                   /protein_id="ABL79727.1"
FT                   /translation="MDLPPGTTGFCAVVLAGGRAARLDGADKASVEYLGRTLLEHAIEA
FT                   LLDASEVVVVGDPVPTTRPVTFTRESPRYGGPVAGLLTGRDALVRTPRTLGVLAVDMPR
FT                   VTSWTFRRLHEAAIGHDGAFLTDQDGHRQPAGVLDPAGLDRVRPDHEGQHGMALRRLLG
FT                   ELDLVDVPPEGDEGRDVDTWTDLRDLGRDPDRDPGRDLGGDL"
FT   gene            194312..195097
FT                   /locus_tag="Noca_0183"
FT   CDS_pept        194312..195097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0183"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: nfa:nfa46820 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79728"
FT                   /db_xref="GOA:A1SD43"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD43"
FT                   /protein_id="ABL79728.1"
FT                   /translation="MPPVTPAPRLRITLVQHASGLEPEANRRLLGELTPAGSDLVVFPE
FT                   AFARDFGDAGSDVSAYAESLDGPFATEVARVAADRGTTVVAGLFEAGEDPTRPFNTLVL
FT                   RGAAEASYRKVHLYDSFGYRESDRLTAGPTGPAVVVEVGGFRVGLMTCYDLRFPELART
FT                   LVDAGAQLLVVPSAWVAGPRKVDHWRTLVRARAIENTVFVAAVGQPGPRYTGHSMVVDP
FT                   LGDVLVEAGDEAAVVTATVDLEALAAARRTNPSLANRRL"
FT   gene            195109..196179
FT                   /locus_tag="Noca_0184"
FT   CDS_pept        195109..196179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79729"
FT                   /db_xref="GOA:A1SD44"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD44"
FT                   /protein_id="ABL79729.1"
FT                   /translation="MSRSTPRRRAERPPSRRARAAAALRTRAERVASSWVPVVLWVLVV
FT                   LAGLGALVSCLAEVGPGWLCGYGSVAVVTAYSWALAARTGGRPVVVGLLALVLGVVVVV
FT                   SDDDSLRTGAAVLTCAVSSVLAVMATVPAVRFVHVVREVVLAVLVAAIGALATVGFEPV
FT                   VTVERFEYAALALSFFGALVLVYRLGAGLHGLGRRGVVTVLMGSLLLAVTLAYAELLRR
FT                   YGTPGLVDSLLDVVDWSREHLGAFPRPLEVLLGVPALAWGTHMRARRRQGWWVCAFGVA
FT                   ATLPVAVALVNPRITLLESGLSAAYGVVVGLLIGFVVIRLDLAITGPRGGRGRRGRRAE
FT                   EASALRPEPSRTRALL"
FT   gene            196213..196446
FT                   /locus_tag="Noca_0185"
FT   CDS_pept        196213..196446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0185"
FT                   /product="biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; KEGG: fra:Francci3_3765 biotin/lipoyl attachment"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79730"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD45"
FT                   /protein_id="ABL79730.1"
FT                   /translation="MAREQVTEVVAEMVANVLSVAVAPGDPVEAGDTVVLLESMKMEIP
FT                   VLLEASGTVRAVKVAPGDVVQEGDVLVEIVRS"
FT   gene            complement(196527..196614)
FT                   /locus_tag="Noca_R0004"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(196527..196614)
FT                   /locus_tag="Noca_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(196675..197058)
FT                   /locus_tag="Noca_0186"
FT   CDS_pept        complement(196675..197058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79731"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD46"
FT                   /protein_id="ABL79731.1"
FT                   /translation="MTITTTGMSVALQGLRQALYSLSEPGVSLGSWRWSVRQQMAGVRD
FT                   ALLAEAEYADEGWLAARTGSVLRERTALLGRLSALGTPVLESDDVDAVCTELDRLLVDL
FT                   GRHAQRLHDLAYDEVELELGGSE"
FT   gene            197169..197642
FT                   /locus_tag="Noca_0187"
FT   CDS_pept        197169..197642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79732"
FT                   /db_xref="GOA:A1SD47"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD47"
FT                   /protein_id="ABL79732.1"
FT                   /translation="MVDGSAAPQVSDYRLAPAFAARFVGALLVALAVVLVVVTVLVAVL
FT                   RLPGVILLVVAVVGAAATLAAAVLISQRVAVVQLGPEGYRVRLVRGAGVTAAGWREVEE
FT                   AVTASPGGVPVVELRLSGGRTTTIPVHALAADREEFVRDLQRHLQDGQGLRPL"
FT   gene            197696..197788
FT                   /locus_tag="Noca_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            197696..197788
FT                   /locus_tag="Noca_R0005"
FT                   /product="tRNA-Ser"
FT   gene            197905..198672
FT                   /locus_tag="Noca_0188"
FT   CDS_pept        197905..198672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0188"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; Helix-turn-helix,
FT                   type 11 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sma:SAV86 erythropoiesis-stimulating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79733"
FT                   /db_xref="GOA:A1SD48"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD48"
FT                   /protein_id="ABL79733.1"
FT                   /translation="MVEKVGVGLGPRNRIPEMRRQEALDAAAILQMRRSELAARLARGE
FT                   DCQARVVARTLAGINEWMREDCLGWRDLLSVRPSGTLPQLRVSVPHNRSLVATGLQMVS
FT                   LLDHDGCVPAARIFLANEEPGYYRFGVGPVQMKIVDRRYVLLQGPFVDDESTLMAVTAP
FT                   DCLAAAWQYWHASMASSFPAEEEAAGGLAALTPRQRQVVVLLADDTRDAAIAETLDVSV
FT                   RTVRSDIAELMERLGVRSRFAAGVRVKELLREQ"
FT   gene            complement(199226..200248)
FT                   /locus_tag="Noca_0189"
FT   CDS_pept        complement(199226..200248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0189"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="KEGG: sco:SCO2686 LuxR-family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79734"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD49"
FT                   /protein_id="ABL79734.1"
FT                   /translation="METYGPEERALFEGAGTALYEELVTAGGLPAEDSRLTPGGQLYPA
FT                   LELLRTLGLTRLSSDSARWEAQDPGVVQSRVVSPLGQEGARLLKESSSWASAFGTLTQA
FT                   WRKAPGSVATGPFTYLPADEIDPFLAALVAECEEEMLTAQPQAIHSTKVLPHVVLRDTA
FT                   LLERGARIRTLYQHSARRNTITRQYVAQVTERGSEVRTLDEFFNRMIVVDRRVAVIPSN
FT                   ETHRVALAVREPSVVAYLVDIFERSWERGRPFTSREASVMRDIASEQRSMTLRMLIEGH
FT                   SDPVSAKRLGVSPRTYAGYISDLKEEFEAETRFQLGYKIGRLGITGRDDEDDEEEVPEA
FT                   "
FT   gene            complement(200387..202231)
FT                   /locus_tag="Noca_0190"
FT   CDS_pept        complement(200387..202231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0190"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   rha:RHA1_ro05180 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79735"
FT                   /db_xref="GOA:A1SD50"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD50"
FT                   /protein_id="ABL79735.1"
FT                   /translation="MTADTQAPISTPTSDLSGRPSTHPGILEFVSEVAALTQPDRIHWC
FT                   TGSDEEWTVLTDALVSTGTFTPLNPDLKPNSFHAASDPMDVARVEGRTFICSVDERDAG
FT                   PTNNWMDPQEMKAIMRDLYAGCMRGRTMYVIPFVMGHLDAEQPMFGIEITDSAYVTASM
FT                   RVMARMGSNVLERMEELEAEFVPALHSVGHPLEPGEADVVWPCNDTKYIVQFPEEHAIW
FT                   SYGSGYGGNALLGKKCYALRIASVMARDEGWLAEHMLILKLTSPQGVVKYVAAAFPSAC
FT                   GKTNLAMLRPTIPGWKVETLGDDIAWMRVGEDGRLWAVNPEYGFFGVAPGTNEHTNPNA
FT                   MTTINKGNSVFTNVALTEDGDVWWEGLENPPARATSWTGQPWTPESEEPSSHPNSRYCT
FT                   PIKQCDILAAEYDDPRGVPIDAILFGGRRETTVPLVFEARDWTHGTFLGATLSSETTAA
FT                   AVGAVGVVRRDPMAMLPFIGYNAGDYFNHWITVGKDNDEALLPRIFYVNWFRRDADGGF
FT                   LWPGFGENSRVLKWVVERIDGQAAAVETPIGYVPTPESLDTDGLDLSAEDLAAALAVDP
FT                   EEWRAEVPQIQEWFEKFGEDLPAVLWTELDGLRARLGS"
FT   gene            202663..202735
FT                   /locus_tag="Noca_R0006"
FT                   /note="tRNA-Arg1"
FT   tRNA            202663..202735
FT                   /locus_tag="Noca_R0006"
FT                   /product="tRNA-Arg"
FT   gene            complement(202837..204369)
FT                   /locus_tag="Noca_0191"
FT   CDS_pept        complement(202837..204369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0191"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mbu:Mbur_0510 external sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79736"
FT                   /db_xref="GOA:A1SD51"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD51"
FT                   /protein_id="ABL79736.1"
FT                   /translation="MARLLAPVNVHLAVVVVVLAMLGIFGLMSSAHTVDRLTQETTPIA
FT                   ADNAAVQRDMLILQSSTHAWVQSGQRVVLTPYRIAEARLEARMERLEEYAEPGSDLDAA
FT                   VDQQAEAVARWRAYSDARIARPGGMETYDSREFMDAKMLFDRFGLAHAATTAAFDREID
FT                   AAQHAARVVLTGTVAAMVVVGLTGLAILQYTRRRLLRALELPLRNLESVAHRLAENDTS
FT                   ARAEPVGPREVQAVTQALNTLAAAHERAVAVEERLRADQQALDSAKDDFVSNVSHELRT
FT                   PLTTLNGYLEMVHDEFEGRLSPRHQKMMDTSQRNVDRLKTLIEDLLTLSRSETKEPARD
FT                   VVDGRELVAEVVDDLRVTAAQRAIRIAVHDELDDVPWIVGDRSQLLRALLNVVGNAVKF
FT                   SHQCGLVEVGMARQANWLTIEISDHGLGIPEDEIGRIGSRFFRGSNAISQAIGGTGLGL
FT                   RITQSIIDAHDGEIQIRSRQGAGTTVTVRLRALSTATDAEPPAASAEPCPQP"
FT   sig_peptide     complement(204274..204369)
FT                   /locus_tag="Noca_0191"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.774 at
FT                   residue 32"
FT   gene            204621..205559
FT                   /locus_tag="Noca_0192"
FT   CDS_pept        204621..205559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0192"
FT                   /product="phosphate ABC transporter substrate-binding
FT                   protein, PhoT family"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   tth:TTC1726 phosphate-binding protein; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79737"
FT                   /db_xref="GOA:A1SD52"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD52"
FT                   /protein_id="ABL79737.1"
FT                   /translation="MRPRHSLLAAMAGVAITLAACGGSAEQDTDAASTGVVIVDGSSTV
FT                   YPMSEAAYQLMSGEYPDIHVSVTASGTGGGFAKFCVGETHISNASRPIDPDETKLCEEN
FT                   GVAYTELQVGIDALTVVVHPRLGVDCLTTDQLVELWRPGADVARWNDLDPSFPDQKVVL
FT                   FGPGTDSGTYDYLADVIGDPSEATRDDYESSEDDNVLVQGVAGTPGATGYFGYTYYEEY
FT                   ADALKAVAIDDGNGCVAPSARTAGTGKYTPLSRPLFIYVNDRSYAENTAVKRYTDFYIA
FT                   NLSTIAHAAQFIDLNEAQNAETREALEGMRG"
FT   sig_peptide     204621..204716
FT                   /locus_tag="Noca_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.863 at
FT                   residue 32"
FT   gene            205714..206400
FT                   /locus_tag="Noca_0193"
FT   CDS_pept        205714..206400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79738"
FT                   /db_xref="GOA:A1SD53"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD53"
FT                   /protein_id="ABL79738.1"
FT                   /translation="MLAVGLPMLAAGTALARRGSVRGLVLWLGAAAYLAYQGVMFCFGT
FT                   PINALFLAYVALLGLGVWSLAALVAVTRNPTVCSAPGAGTPWRPVAGLLGAFAVLNGLA
FT                   WLARVAPVTWTGDPPEALAGSGLLTSPVWVQDLAFWIPAGMVLSALTWRRHPRAAVLAG
FT                   GMLAFYVVECVSVASDQWWGVRADPDHPAVASMSAVPGSLAVAALAAVPLLWLLARLHG
FT                   AARATG"
FT   gene            206511..208160
FT                   /locus_tag="Noca_0194"
FT   CDS_pept        206511..208160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0194"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: sth:STH749 two-component sensor kinase,
FT                   probably involved in phosphate sensing"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79739"
FT                   /db_xref="GOA:A1SD54"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD54"
FT                   /protein_id="ABL79739.1"
FT                   /translation="MDQSERLRRALRPFAWVDGDPDPRGLQAGFVLLVVLDRLLRRAAG
FT                   VPSGDGNWPLRGAALALLILLVVMVLPRSWRRTPVIAALAVADLGVVGVSSLGPQDGGT
FT                   SLLVVLPALWLGNRLRMPGALITVAGSLLLITLPSLAVHGLEGEGLSRAVPMPIAAGLV
FT                   ALALAAGLDLAELARRRAEEGEQRLQRTLETLEAERQTSQEVFDGADVGLMLLDERGRL
FT                   VGMNRRYEEFIRLSLPDDDLPWPGNTFAADGTTRLTADQLPSARAARGEEFEDYRMWSG
FT                   ADPATRRAVSVSGRRSVSPAGNVVGAVVAATDITELMRALAVKEEFVATVSHELRTPLT
FT                   SIVGYVAILLEDDTLSAQAVAQLRVVDRNAARLTALVEALLQEAHHADGPVPLEREEVD
FT                   LARIARASVDAAAPTALAEGVEIECDLRDPVLVVADPQLLAQVVDNLVSNAIKYTPRGG
FT                   RARVSARRDGERVELTVADNGIGISEAERGQLFTRFFRTRAATESAIQGVGLGLSIAKA
FT                   IVESHGGQIEVDSEAGRGSVFRVWLPVGDVPS"
FT   gene            208335..208481
FT                   /locus_tag="Noca_0195"
FT   CDS_pept        208335..208481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79740"
FT                   /db_xref="InterPro:IPR009409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD55"
FT                   /protein_id="ABL79740.1"
FT                   /translation="MKTRLTCPCGTTITGADEDELVELTQQHLAAEHPGMEYGRDEILF
FT                   IAT"
FT   gene            complement(208506..209549)
FT                   /locus_tag="Noca_0196"
FT   CDS_pept        complement(208506..209549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0196"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: dge:Dgeo_2243
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79741"
FT                   /db_xref="GOA:A1SD56"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD56"
FT                   /protein_id="ABL79741.1"
FT                   /translation="MAKVTLQSIADRVGVSRMTVSNAFSRPDQLSGELRERILAAADEL
FT                   GYVGPDPAARALARGRTGSVGLLLTDELGEAFQDAVATQFLTSVADALTHEGLAVTLLT
FT                   SGGAAGAPSDYVPARDVAMDGAIVYICDPASPDIAWLERRGLPLVSVDREPAPDAPSVN
FT                   VDDRAGARAAAEHLIELGHTRVAIITLRSTFDVAGVPTANRPASERMTGWREALEAAGI
FT                   EPVVAAAAFRPRPSVEEIARDLLDRPDRPTAVLCFSDAFAVTTIQVAESLGLRVPEDLS
FT                   VVGYDDSPLATAIRPQLTTVHQEVARKGQEAVRSLMAIMGPDRPDPVERILLPTALVVR
FT                   DSTAPPP"
FT   gene            complement(209959..212736)
FT                   /locus_tag="Noca_0197"
FT   CDS_pept        complement(209959..212736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0197"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: sco:SCO2226
FT                   bi-functional protein (secreted alpha-amylase/dextrinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79742"
FT                   /db_xref="GOA:A1SD57"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD57"
FT                   /protein_id="ABL79742.1"
FT                   /translation="MRQLISAPLVLAGAMTLGVTLAAPAGAAAPARADGPGHRPSAYAQ
FT                   HAPRPGVTDEDFYFVMGDRFENGDPDNDRGGLTGDRLTTGFDPAAKGFYNGGDLDGLRS
FT                   RLDYIQGLGTDSIWLTPIFKNKPVQLEDGPSAGYHGYWITDFTTVDPHLGTNQDLADLV
FT                   DAAHDRGMKVYFDIITNHTADVIGYEEGDRTAYVSKDAVPYRDAAGNPFDDRDYAGTSQ
FT                   FPVLDPATSFPYTPVLDAGEQDLKVPAWLNDLTNYHNRGNTTFSGEDSQYGDFFGLDDL
FT                   FTEKPAVVDGMIDIYRTWVEDFDIDGFRIDTMKHVDDAFWQRFGPTMQQLAAADGNPGF
FT                   FMFGEVALDGSDAAAKAFTSRYTTTDRMQAVLDFPFQDAARGFASKSLDSDRLARFFRN
FT                   DDWYTDADSNAYSLPTFLGNHDMGRIGHFLEADNPGADDAELVARDRLAHELMYLSRGN
FT                   PVVYYGDEQGFTGDGGDQLARQTMFASQVPEYRDDDQIGTDRTGADDNFVTDAPLYRAI
FT                   RDLADLTERDPALRDGAQQVRYSSPGAGLFAFSRVDREHRVEYVVALNNSEQADSGRVP
FT                   TYLKKGEFRKVYGPGPARLVSRADRGLDVALPALSTSVYRSVDRIPRAERAPQISVARP
FT                   VPSSIAHGRMHVRAKVSGSSFYEVTFQRRIGDGAWQTIGVDDNAPYQVFDDVADQTPGT
FT                   AVSYRAAVLDNAGHTRGSRARTTAVPRTSVVVTGPADGGTVSVVDPVTVTASVDPERPL
FT                   QSVAFERSVGDGPWTSLGTDSSAAAYTVTDDVSDLPLGTEVRYRATLSEAGVVQGTSAP
FT                   VRVTTAEPAPAVDSVTVAGSLQSELGCPEDWQPGCAATHLTFDRTDGRWHGTFTVPAGD
FT                   YEWKVAINDSWDVNYGAGGAAGGSNLALPVPAGGATYVFTWDQVSHEPSVAPAG"
FT   sig_peptide     complement(212653..212736)
FT                   /locus_tag="Noca_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.487 at
FT                   residue 28"
FT   gene            complement(212830..214140)
FT                   /locus_tag="Noca_0198"
FT   CDS_pept        complement(212830..214140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0198"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: sil:SPO1469
FT                   3-ketosteroid dehydrogenase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79743"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD58"
FT                   /protein_id="ABL79743.1"
FT                   /translation="MERIEVDVAVVGAGACGVLTALRAAEDPDLVIGVFEKSTREGCNA
FT                   EISSGSLAAGGTRFQRAAGIDDSPARHAEDILAASGDTAAASVVEALCAAAPQYVEWLA
FT                   DRLGYPIEIGTDLPRAGMSVPRLHSDVGRQGGRRLMRHLRDALAARPNVALVDEAPAMR
FT                   LTASADGRVTGLVVEQNHTEIEASASTVVLALDGFAANPALMKEHCAALGDPFYGGVST
FT                   STGDAVAWLTELGADFRNMGACLRSGLVVVGHGTRVSPSLPFYGAVLLDLEGRRFVDEE
FT                   AHGYSSLAGLLQGLPAQRAALVWDAEAHAATRESELMRETIRAVGFTTYDDRAGLAAAL
FT                   GADPELEPLPGRRRLAPPYHLAWVTHGVLATQGGAVVDPRGQVLRPDGSAIPGLRAGGG
FT                   TAAGLAGPDSSGYSSGNGLLSAFGMGWIVGTELAGGR"
FT   gene            complement(214140..214934)
FT                   /locus_tag="Noca_0199"
FT   CDS_pept        complement(214140..214934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0199"
FT                   /product="Hydantoin racemase-like protein"
FT                   /note="KEGG: sil:SPO1461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79744"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD59"
FT                   /protein_id="ABL79744.1"
FT                   /translation="MRIWHQSFTVLDDVPHYRDALQRHLTAQAAPGTTVELHGMRPGTY
FT                   PSAYPGTHIGHAYLAGLHKEQFVGAALRAQDEGYDAFFIATIPDTAYEEVRSLVDLPVV
FT                   AFGQTSVAMASMLGDRVGIVNFIAALEPQLRRNLRNYRLDSLVGPIVQVEAAFTDVMAA
FT                   YADPGPLLAAFEAAARRAIAEGANVIVPGEGPLNVFLADQGVSRVDDVPVLDSLGTCVR
FT                   VAEVRAAQHRATGLHPARTGFHYSRPERGLVDAARAFYGLDL"
FT   gene            complement(214931..216397)
FT                   /locus_tag="Noca_0200"
FT   CDS_pept        complement(214931..216397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0200"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bxe:Bxe_B1003 putative succinate
FT                   dehydrogenase/fumarate reductase, flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79745"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD60"
FT                   /protein_id="ABL79745.1"
FT                   /translation="MSAPVAEYDVVVVGGGVAGLSAACAAAEAGARVVLLERSTEAETG
FT                   GNTRYTEAFLRMRSLEETADGLEDALVDDFMGHPDPSVVRDAALPAERRSALYRAHHVV
FT                   DPDYVATFAAEAPETLAWMGGHGMRFEFLPTPFLTTSTTRMAPVGGGLAIVETMGKAAR
FT                   GLGVEFRFETTARRLLTDPDGRAGVAGVLAHTPTGPVELRGRVVLASGGYQGNAELMAR
FT                   YHGERGLTTRPVARGGNHNKGEGLEMALALGAATAGNFSLFHAEPVDPRSGEPEAAIFC
FT                   FPYGILVNREGRRFVDEARGPVDAWYERTTRDIQAQTEGVAWVILDQQGLAVPNIRSGI
FT                   RTDQAPVTADTLEALAERIGVPADTLVATVASYNSACRDGAFDHTAPDGLATSGLVPPK
FT                   SNWARPIAEGPFEAYPIMAANVFTFGGLKTTPAAEVVDRDGRPIPGLYAAGELTGLYYS
FT                   NYTGSTSVLRGATFGRIAGSAAAATIGVGA"
FT   gene            complement(216394..216990)
FT                   /locus_tag="Noca_0201"
FT   CDS_pept        complement(216394..216990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0201"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG:
FT                   bur:Bcep18194_C7071 isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79746"
FT                   /db_xref="GOA:A1SD61"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD61"
FT                   /protein_id="ABL79746.1"
FT                   /translation="MTDNRKALLLLDYQVALCEEGPHLRMPPLAAQVAERDVLATAERV
FT                   LGAARDAGWLVVHVRLAFDPTYRLRTNRLARFDVYPDQGAMLADSPEAQIVKALAPIEG
FT                   EPVVDKGCVDPFVGTPLLQVLAAEGVGEVVLGGVATNLVVESAARHASDAGLQVTVVED
FT                   MCASFRPDFHEFSVQNMLPLFATVTSANELIGGLS"
FT   gene            complement(217019..217738)
FT                   /locus_tag="Noca_0202"
FT   CDS_pept        complement(217019..217738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0202"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   sil:SPO0595 gluconate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79747"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD62"
FT                   /protein_id="ABL79747.1"
FT                   /translation="MVSPFDLTGQVALVVGGAGGLGARAATALAAQGATVEVADLAGAD
FT                   RHVDVTDEASVAGLVADVVAAHGRLDVVVNAAGVMLRKAYDETTVEEFERVVRVNLTGT
FT                   WLVGREAGKAMTPQRSGRIVNLTTVYAERVGPVPESAYYASKAGVANVTRALAAELGPH
FT                   GITVNCLAPGVFYPTPMTAPLGADPDRLAWFADRTMLGRLGDPAADLDGPLLLLASPAS
FT                   SYVTGQVVYVDGGWSAW"
FT   sig_peptide     complement(217646..217738)
FT                   /locus_tag="Noca_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.798 at
FT                   residue 31"
FT   gene            complement(217732..219144)
FT                   /locus_tag="Noca_0203"
FT   CDS_pept        complement(217732..219144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0203"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bbr:BB3064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79748"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD63"
FT                   /protein_id="ABL79748.1"
FT                   /translation="MIPGLPIEGELPDRVGVLVLGSGLAGCAALLAAAEAGQYAVLLEK
FT                   TGAIGGSTVRSAGLSAFAGTPEQVAQGIGDSVELLKKDLMETGRHVCDEALVDLYCAHQ
FT                   LETYEWLTGHGVRYGEVHAASGQSVPRSHPTDTTGMLVTLLKAAGRLGARILLDTAAER
FT                   LVREGGQVIGVDVRTADGSRRRILADAVVLATGGFARSPELLTRFAPQMANALTAGGDG
FT                   CTGDGLLMGWQLGAGVVDTPYVKGTYGIFHEAHPDEDGTGILAVYKGAIAVNREGRRFV
FT                   DESLPYKEIGDAALAQPGVTTWQVFDAGVMAQSNDEVPIYEFAGRDRAGMLLKADTVEG
FT                   LEALVGLPDGSLVATVADYNARIADGRPDPLGRAHLSGGVDTPTPLDRPPFYAHPSRTV
FT                   VLATYCGLTVDTRLRVLDVFGEPIERLYAAGEVIGGFHGGGYMTGTSIGKAGIFGRLAG
FT                   QHAAAEESELTW"
FT   gene            complement(219141..220118)
FT                   /locus_tag="Noca_0204"
FT   CDS_pept        complement(219141..220118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0204"
FT                   /product="2,3-dimethylmalate lyase"
FT                   /EC_number="4.1.3.32"
FT                   /note="KEGG: bbr:BB0718 carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79749"
FT                   /db_xref="GOA:A1SD64"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD64"
FT                   /protein_id="ABL79749.1"
FT                   /translation="MNSSSHQEFPHLADLVGVGPAPTAHDRRTALRTALREATAGAGPL
FT                   LLPGVTDALGARLVEAAGFGAAYATGAGLANAQYGLPDLGLVSLGEVADHVGRITEATR
FT                   LPVVVDADTGYGGPLAAMRTMRLLERAGAAGIQLEDQEMPKRCGHFDSHTLIPLGHMQA
FT                   KIAAVLDAREDDATVLVARTDARSAEGIDRAVERARAYVEAGADVIFVEAPRTVAELTL
FT                   VGRELAGTPLVVNVVEGGKTPHLSAQEYADLGFTVVLHANYLMRSMMSAGRAALAHLAA
FT                   AGETVTRAEQMATWSERQSLFHLPAFTAAEAYFDQPLDVLRSER"
FT   gene            complement(220244..221431)
FT                   /locus_tag="Noca_0205"
FT   CDS_pept        complement(220244..221431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0205"
FT                   /product="RNAse Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: rme:Rmet_5998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79750"
FT                   /db_xref="GOA:A1SD65"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD65"
FT                   /protein_id="ABL79750.1"
FT                   /translation="MCATPDRPISRRGLLHTGGLATAAIAASSALPPTRAEAATVRRST
FT                   RATRDYRTKVVLLGTSGGPIWWRGSTRRGTSSAVVVGDAQYIVDLGAGALGSVRDAGLL
FT                   GSADGKNDLHALRGVFLTHLHSDHVSDYPTLVIEGWIGGGLGDAERALQVYGPGRRDAL
FT                   PHTFPAGRPEPSPVIPDNPGPGTVEMTESLFAAFATDINDRVFDSASPDIRSRIQPHDI
FT                   ALPADVAAPEAGAVPRMSPFSVYEDDRVRVTATLVDHGQMLPSFGYRFDTEDGSVVISG
FT                   DTTVSENLVELAADCDVLVHEVIDQAWVEESISALPAPDEVKAAYKNHMLGAHTTIPQV
FT                   ARVATEAGARTLVLHHFVPGHLPERRWRRVSRNFAGELVVGQDLQRIGVGRRRRG"
FT   sig_peptide     complement(221315..221431)
FT                   /locus_tag="Noca_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 39"
FT   gene            221618..222793
FT                   /locus_tag="Noca_0206"
FT   CDS_pept        221618..222793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0206"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: nfa:nfa33590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79751"
FT                   /db_xref="GOA:A1SD66"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD66"
FT                   /protein_id="ABL79751.1"
FT                   /translation="MTVLDEIRRLEPEFRAGEEEAAELRRLPDQTWKQMLESGLLRGLQ
FT                   PRRWGGGELSLREHLTGVYELGRIAPSAGWVSGVVGSHPWQVALYDEETQQEVWGEDPT
FT                   FLPSSSYAPTGKIVPVDGGYRVSGRWSFSSGSDHCQGVILGGFAGTIEVAPGVEVPNFG
FT                   SALLLRDQYVIEDTWHVAGSRGTGSKDIVVDDAFLPARRFLSSPLYEYNADRPAPGIAT
FT                   NPNPLYQVPWAVMFNLVLVAPMLGLGRRFLDDWTAETTTRRANWGGMVKDDALMQMHLA
FT                   EAEWVHDAAVKKMYDAIDTITEAAEAGVRLDKRERARMRWNITRGCQQVGFAINDLMRV
FT                   ASGRTVFTSHPLHRLYQDVTAELGHAFLVSDGVGQYYGASLLDSSAPEVML"
FT   gene            222790..223707
FT                   /locus_tag="Noca_0207"
FT   CDS_pept        222790..223707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0207"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79752"
FT                   /db_xref="GOA:A1SD67"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD67"
FT                   /protein_id="ABL79752.1"
FT                   /translation="MITQLAYLGIASPNYQQWRDYGTRLLGTQLAADGPDGAVRLRVDD
FT                   KGYRIAVHPAEQDEFRYAGWACHNETELRSYVAELRGKGLEVHEGTPEELKERQVAELY
FT                   WIQDPWGNRHELVWGQFSMPNSFWPARKMNGFVTGDLGLGHIVMIVPDLQAADAFYAET
FT                   LGFRLSDRVVSDIFNLRFYHCNGRHHSLAVAEIPGMTGINHLMLEVENMDDLGSAIDLF
FT                   TADQEREILLSLGRHTNDLMTSIYVQTPSSMQIEYGFGGIAVDDLTWVAGTHDVPSIWG
FT                   HHRSQAYLDGPPGIFQMLDAEAPA"
FT   gene            223704..224579
FT                   /locus_tag="Noca_0208"
FT   CDS_pept        223704..224579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0208"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ttj:TTHB237
FT                   2-hydroxymuconic semialdehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79753"
FT                   /db_xref="GOA:A1SD68"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD68"
FT                   /protein_id="ABL79753.1"
FT                   /translation="MTAVAPAPVERSGIRESDVAIAGGRHLRVLEAGEPGMPALLFLHG
FT                   SGPGVTARANWENVMAGLGDRFHCIAPDILGFGESSHADPQPQGFKANAEVRIDALLQM
FT                   LDALGVSRVTVVGNSMGGMYSLRLCQLRPDLVEKMVLMGSGGMPGLAPTPQLIKLVTFF
FT                   DDPSLEAMTALLTEFVHDKTAFGDRIEDFAAGRMALVTRPEIETAHRAMFGEGEMLSFS
FT                   PAELARLDVPTLVVHGRQDVIVPIECSLYLAEHLPQADLYVMNNCGHWTQVEQPDRFRT
FT                   ILRDFADGRL"
FT   gene            224615..225790
FT                   /locus_tag="Noca_0209"
FT   CDS_pept        224615..225790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0209"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: bur:Bcep18194_B1413 acyl-CoA
FT                   dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79754"
FT                   /db_xref="GOA:A1SD69"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD69"
FT                   /protein_id="ABL79754.1"
FT                   /translation="MTLAEKARAAAPVLAASDAESGARGRLTEEAWAALQSIGVMRALQ
FT                   PARWGGGETDLVEYVDAIIEIGRHSASAGWVASVVGVHPWQIALFPDETQTEIWGATPD
FT                   RAIASSYTPTGSIEKIAGGYRVSGRWSFSSGIDWCEGVILGGIAGTREIDGVEHPDFTA
FT                   VILDRADFTVERTWDVAGLRGTGSNDVVVDGVVVPERRGQSHLFYTHGLGTPLPGQELN
FT                   DGPLYRVPWAGLFNLIIAAGTVGAVQGFVDAWIAETRTRRTNYGQMLREEGVVQKHLAN
FT                   AEWLLDAARLKVRRAAVELMAHAEAREVPTKEQRAYYRWDVAKAANAATDAAQELMRVA
FT                   SGRSAFLDHPLQAKYQDVVSASSHAFLYADPLARAWAGRHLGAENLVEVHL"
FT   gene            225787..226626
FT                   /locus_tag="Noca_0210"
FT   CDS_pept        225787..226626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0210"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: ttj:TTHB237
FT                   2-hydroxymuconic semialdehyde hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79755"
FT                   /db_xref="GOA:A1SD70"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD70"
FT                   /protein_id="ABL79755.1"
FT                   /translation="MIRTRDVEVGDLSFRLYETGETGAEAVLFLHGSGPGATGLSNWER
FT                   IIEDLGDRFHCLAPDMIGFGDSAHPVDPPRGMGPFNELRAQALLGLLDVLGLEKVHLVG
FT                   NSMGGQLALLMVLAQPDRVGKILLMGSGGAPDLPVSPGLAHLRTFYDAPSAESLERLLE
FT                   QFVFDLEPMRPVIDRVVKERMAYVERADVRRSHAASFDPDGPRRFFTPEELAGIEHDVL
FT                   VVHGRDDRIIPTQASRWFADHLPNANLYVIGRCGHWTQIEHPTTFETLLTGLVDGVI"
FT   gene            226637..227491
FT                   /locus_tag="Noca_0211"
FT   CDS_pept        226637..227491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0211"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rha:RHA1_ro04906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79756"
FT                   /db_xref="GOA:A1SD71"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD71"
FT                   /protein_id="ABL79756.1"
FT                   /translation="MRIANHDGRAVLVLGEDKGVDIERASHGELGPSIADLYPRWDEVV
FT                   AWVSTLGDVGDLVADVVIDPDLLGAPSPRPTQAIAIGLNYEEHAHETGYQVPTQLPPVF
FT                   AKFASSITGPRGLVDLPPGGHTDWEVEVVAVIGRTAHRISPDEAWGHVAGLTVGQDLSE
FT                   RISQMAGPAPQFGLAKSFPGFSPMGPWLVTPEELADPDDLALGCAIDGETVQDGRTSKL
FT                   IFSIPRSIAALSQVLTLLPGDVVFTGTPDGVGLGRSPQRFLRPGETLRTWVEGIGEMVH
FT                   TFR"
FT   gene            complement(227624..227929)
FT                   /locus_tag="Noca_0212"
FT   CDS_pept        complement(227624..227929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79757"
FT                   /db_xref="GOA:A1SD72"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD72"
FT                   /protein_id="ABL79757.1"
FT                   /translation="MDTRSADLDTVSTRAGTATLGLGLLFLAATIFIFVLSLSDLVDPP
FT                   TWVRVLGLVWLPLGFFGAPLTYAVARAGPGRNRGRLGLALMLVPLAAFVALLFVAG"
FT   gene            228226..230379
FT                   /locus_tag="Noca_0213"
FT   CDS_pept        228226..230379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0213"
FT                   /product="putative superfamily I DNA and RNA helicase"
FT                   /note="KEGG: fal:FRAAL4811 putative superfamily I DNA and
FT                   RNA helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79758"
FT                   /db_xref="GOA:A1SD73"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD73"
FT                   /protein_id="ABL79758.1"
FT                   /translation="MEPTTTSAFDLPAHLAAKADPGLIGRDERHFAAIAESLKVTIAEL
FT                   TDRLDAARRAPGGNGQEALERDQEVHRLTARLRALRRYGLDLCLGHVVGADDGEPAYVG
FT                   RLGLTDTAGRRLLLDWRSPAAEPFFGATHANPMGLASRRRYRWTRGRVTDYWDEVFTAD
FT                   GLDGHAAALDDQSAFIASLGATRSPRMRDVLGTIQADQDAIIRASSRGALVVDGGPGTG
FT                   KTVVALHRTAYLLYADPRLGHRRGGVLFVGPHQPYLAYVSDVLPSLGEEGVQTATVGDL
FT                   VPEGATAPPEADPAVARLKASARMVAAIEPAVRLYEELPTEGMAVETPYADLWVSVEDW
FT                   AEAFGAADPALPHNEARDDVWLALVAILLDKADPDDVPVDRLRRSLAHHEGLVSAFDRA
FT                   WTVIDPYDLVGDLWSVPAYLRRCAPWLEPDEVRLLQRADAQAWTVSDLPLLDAARQQLG
FT                   DPGASRRRRRREAALQAQAEEMSHVVDHLIATDDSEMQVMSMLRVEDLQGALVDEDVVP
FT                   AADPDQLAGPFAHVVVDEAQELTDAEWQMLLLRCPSRSLTVVGDRAQARHGFAESWQER
FT                   LQRIGLDRVEVAALNLNYRTPAEVMAEAEPVIRAALPDANVPTSVRRSGIPVHHGSVAD
FT                   LEVIVDDWLAEHAEGTVCIVGDHPLAPRPRVRSLAPELVKGLEFDLVVLVDPGRFGDGV
FT                   EGAVDRYVAMTRATQRLVLLTSR"
FT   gene            complement(230366..230893)
FT                   /locus_tag="Noca_0214"
FT   CDS_pept        complement(230366..230893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79759"
FT                   /db_xref="GOA:A1SD74"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD74"
FT                   /protein_id="ABL79759.1"
FT                   /translation="MEKIMWLVLGGTTFAAALRARTSRRARYVARGALGLLFLAFGVNA
FT                   IYLALDNGYYDDFADPSPFGFVRDTWESVVLPHQGVFIGLLIGFEAAAGVLVLSGGRWT
FT                   QAGLIGLIGFHVGQLAFGGMLWAWAAVMLVALVLLLRAERHPPEPSAAGPDRPRHRHRD
FT                   RGVPTAGGLTGS"
FT   gene            complement(231042..231788)
FT                   /locus_tag="Noca_0215"
FT   CDS_pept        complement(231042..231788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0215"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sme:SMc02358 putative high-affinity branched-chain
FT                   amino acid transport ATP-binding ABC transporter protein;
FT                   TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79760"
FT                   /db_xref="GOA:A1SD75"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD75"
FT                   /protein_id="ABL79760.1"
FT                   /translation="MTDHQAGDVRTIAEPPLLRVRDLAAAYGPKQVLYGVDLEVRAGEI
FT                   VALMGHNGAGKTTTIRTVLGALRARSGEVSVAGEDLTGQPVRRLVRAGVALVPSERFVF
FT                   PDLSIRDNLLLGAANAPRDADSAARLREVEEAFPLLSERSSQLAGQLSGGQQRMVSLGI
FT                   ALMAQPRLLLLDEPSLGLAPSIVEAIFGRLRALATSSGLGILLLEQNVKQALQIADRAY
FT                   VMRSGRVILEEPAAQMRRRPDFWDLF"
FT   gene            complement(231838..233535)
FT                   /locus_tag="Noca_0216"
FT   CDS_pept        complement(231838..233535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0216"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family / amino acid/amide ABC transporter
FT                   membrane protein 2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: dra:DRA0261
FT                   branched-chain amino acid transport system ATP-binding
FT                   protein; TC 3.A.1.4.-; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79761"
FT                   /db_xref="GOA:A1SD76"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD76"
FT                   /protein_id="ABL79761.1"
FT                   /translation="MWLNYLVQAVLLASLALSVNLLVGYAGQVSVAHAAFAGVGGYTIA
FT                   YLTTARDWPFVTALVAATLIAAAVGVVIGLIALGLAEEFLILMTLAFSLAVIGIFATFD
FT                   ALGGVMGITNVTGLSILGHEMTGPRDWLVPALGTLVVTFAVCWRIGESPYGRVLKGIRE
FT                   DSDATRSLGKNTFAYKVGIFAITAGMAGWVGGLYSGWLGLATPSAFGFPLAMSVFAMVI
FT                   VGGSANLFGSVLAAGVLTLIEPTLREALAMQSSQAALVQIVLYGALLVVMMILRPQGLL
FT                   AERFRHVTPPASGPVELVAERGAPVVRRLDAHPVVLRAEGLEKRFGGIVAARNLSLELR
FT                   RGTITALVGPNGAGKTTAFNLLTGAIAPDRGSVLLDGQELVGRRPDEIVRAGLVRTYQD
FT                   VRLLGRLTCLENVMLGVPDQHGEHLGRLFVPGRAVSRADRAVAERALEWLGFVGMAEQA
FT                   GVPTEALSYGQTKLVSLARALATEAPVLLLDEPASGVDSAWVETMLRMIDAVRAEGRTV
FT                   CLVEHNLDVVRELADHTYFMELGEITASGTIAELTSSARLTEAYFGAQ"
FT   sig_peptide     complement(233431..233535)
FT                   /locus_tag="Noca_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.949 at
FT                   residue 35"
FT   gene            complement(233538..234467)
FT                   /locus_tag="Noca_0217"
FT   CDS_pept        complement(233538..234467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0217"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: gka:GK2979
FT                   branched-chain amino acid ABC transporter (permease); TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79762"
FT                   /db_xref="GOA:A1SD77"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD77"
FT                   /protein_id="ABL79762.1"
FT                   /translation="MDSLISADFWQLTANGLVRGSFYAALGAGLALVLGVTARFHFAYT
FT                   LTYTFAPYAAFLAMDRQGVSFWPAALLGLAAAVVLSVLIELLVYQPVARRAGDRAMLAV
FT                   LVTSIGVSAAGIAALQLVAGTSSVPFYGPAMTISEYGPVRVSSFELYQVLTCVGLVVAL
FT                   AAFLALTPLGRSIRAVRSNPGLAGLLGIGVTRVNLTVFAIAGLFSGAGALWYGLLYTVE
FT                   PVMGDKVVIYGFVVAFLAGTRTSPLRALPVGLGLGLLEQWSSMWVSVQWTQTAVFTVLV
FT                   VYLVALSGRGRWGRLLSPRPRARLEKAV"
FT   gene            complement(234534..235880)
FT                   /locus_tag="Noca_0218"
FT   CDS_pept        complement(234534..235880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0218"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: nfa:nfa52540 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79763"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD78"
FT                   /protein_id="ABL79763.1"
FT                   /translation="MSVLPSTRRGPRARSTSRSVRRSVALGAALALALSLSACGEDKPE
FT                   VSAAETQAQAADLVDLLAIPEGTDLGGDLTWKMGAALTLSGPSAANGESMKNAIDLAVE
FT                   QVKAAGGPTIEVLTKDIKGPDPVAAKQAAEELAAAGVPAKITSMGDGLGAMLENTAKDQ
FT                   ILSLDGVGGAQVFTQGVDYFFGTREVAPSDAVPGALEWLKQSDPEATTVGLVGVDLGPF
FT                   NDPIKADITAKIDASGLQFNGLWETVAPTSQDYASVISKIKENQPDMLLVAFGGGAPGA
FT                   FAAQAKAAGLDSLLMGIEFTEEAVKASKGVLDSDGFHFAMDYFDAENPANPLAELFVDS
FT                   YEKAYGVKPDFYAANAYEEVLMFWDLVRRVVADGGDPNDSAALKAALEADPTFASVYGA
FT                   GEGDGPGTLAIDLKTHGVASRPMGVYEYQDGAVSTLATFDVNAAGFALN"
FT   sig_peptide     complement(235734..235880)
FT                   /locus_tag="Noca_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.484 at
FT                   residue 49"
FT   gene            236113..236748
FT                   /locus_tag="Noca_0219"
FT   CDS_pept        236113..236748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0219"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1732c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79764"
FT                   /db_xref="GOA:A1SD79"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD79"
FT                   /protein_id="ABL79764.1"
FT                   /translation="MPRKTTRRHRQGDESRHRILATTLEIAAERGYEGTTVGLVTERTG
FT                   LPASSVYWHFKNKDELLAETLEYSYRQWREATPTWEGVDDEGVPDLRAEVRRRLRAASR
FT                   ALLESPEFWRLGLMLALERRAKEPAARGRYVEVRLETAAAIARWWASVLPAELRERDDE
FT                   LPDRLARVHLALMDGFFVGRRADPRWDVGAMVELMAEGMAAYVEGVAR"
FT   gene            236745..237353
FT                   /locus_tag="Noca_0220"
FT   CDS_pept        236745..237353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0220"
FT                   /product="regulatory protein, TetR"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1732c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79765"
FT                   /db_xref="GOA:A1SD80"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD80"
FT                   /protein_id="ABL79765.1"
FT                   /translation="MTAAEGQDGSRQRIVAAAAEIAAEAGYEGTTISKVVKRSGLPVSS
FT                   VYWFFKDKDELIAEVVRSSFDTWIGDQPTWDPLPKGVSVGDGLRAVLDKSALSLAAAPD
FT                   FLRIGLMLTLERRETEPAARTLFLDIRIAIEDELTRWFAAAIGTRKVRRAPDLPRRLAR
FT                   MVIAGTDGLFLAHQIHDVADTHEYVDILVTIVESAIAAA"
FT   gene            237463..238644
FT                   /locus_tag="Noca_0221"
FT   CDS_pept        237463..238644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0221"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: nar:Saro_1462 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79766"
FT                   /db_xref="GOA:A1SD81"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD81"
FT                   /protein_id="ABL79766.1"
FT                   /translation="MSDPNPAHFRQVLGQYPTGVAVVTALDESGAPLGMTVGSFTSVSL
FT                   DPPLVAFLPDQGSSSWRALRASGDRFCVNVLGADQEDVCRAIAVRKVDKFAGIPWRPSP
FT                   AGNPVIDGAVAYLDCTTEQVHDAGDHHIVVGRVHQLDLVGGDQPLLFFRGGYGSFTPLS
FT                   LASGDSDLLDHLRLVDLARPQMDRLAARFDTEVTAIALVRDELVLAAAAGRTRLAVAPT
FT                   RVGQRLPFMPPLGSCFAGWGDDAVRAAWVGGLSDLVDPDTRDAVRAVPGLVRRRGYSIA
FT                   LGHGDGARLETLSTRFHEGDAQVSKAALREAIAQSVSGYNPASYGAGPVELRSLSAPVF
FT                   ANDGRVAFTLTLWGPPGAIDAAEVDRHVEELLAATGAATIAIDGRVPLDAAIA"
FT   gene            238856..239734
FT                   /locus_tag="Noca_0222"
FT   CDS_pept        238856..239734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0222"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding;
FT                   KEGG: mtc:MT0390 carbon monoxide dehydrogenase, medium
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79767"
FT                   /db_xref="GOA:A1SD82"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD82"
FT                   /protein_id="ABL79767.1"
FT                   /translation="MQVPAPIEYERATSVEHAIGLLARLGDEARLIAGGHSLLPMMKLR
FT                   LANPEYLVDINDLHDELSYIDIGPTGVRIGALTRHRELLESDALAEVCPIFRDAERVIA
FT                   DPPVRNRGTLGGALCQADPSEDLSSVCTTLDASCVIRGRDGERVVSMDDFHLGPYETVV
FT                   RHDEMLIEVRIPVRPHGSSAYAKVDRRAGDWAVTAVGAALWLDEHDSIADARVGLAAVG
FT                   PNTTGIPAISAALRGRAPSEEAWAEAGAIAAASCRPVTDGRGSADYKRHLAGELTRRTL
FT                   RTAWERVVTWR"
FT   gene            239725..240201
FT                   /locus_tag="Noca_0223"
FT   CDS_pept        239725..240201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0223"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rha:RHA1_ro05231 possible carbon monoxide
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79768"
FT                   /db_xref="GOA:A1SD83"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD83"
FT                   /protein_id="ABL79768.1"
FT                   /translation="MEVTLTVNGEVVTRDVEARLLLVHFLRDDLGLTGTHWGCDTSNCG
FT                   SCVVLYDDEPVKSCTVLTAMAAGHDVRTVEDLEQDGELDPVQQGFMECHGLQCGFCTSG
FT                   MLMSARALLDRDPDPSEEDIREAISGQICRCTGYASIVRSVRWAADHPEGRIEA"
FT   gene            240198..242573
FT                   /locus_tag="Noca_0224"
FT   CDS_pept        240198..242573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0224"
FT                   /product="carbon monoxide dehydrogenase, large subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, large
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mmc:Mmcs_0491
FT                   carbon-monoxide dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79769"
FT                   /db_xref="GOA:A1SD84"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD84"
FT                   /protein_id="ABL79769.1"
FT                   /translation="MTATVPIGHGRMLRKEDRRFVRGRGKYLDDIALPGMLHLAVLRSP
FT                   VAHARILSIDTLAAEAHPKVKAVVTGALLAERGLAWMPTLSGDVQAVLATDKVRFQGQE
FT                   VAFVVAEDRYSARDALELIDVEYDVLPPVVDVRRALDADAPLIRDDVAGKTDNHCFDWE
FT                   TGDAAATDAVFDRAEVVVRQEIVFPRVHPAPLETCGAVADYDRVEQKLTLWATTQAPHA
FT                   HRTLYSMFAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVGSMVTGRPVKWTEDRTE
FT                   NLVASGFARDYVMQGEIAATRDGRILALRSHVLADHGAFNGTAAPRKFPGGFFGVFTGS
FT                   YDIEAAYCSMTAVHTNKAPGGVAYACSFRIAEAVYLVERMVDLLADELGIDPVELRLRN
FT                   FIRSDQFPYTSRTGWVYDSGDYATTMQEALRIAGYDELRAEQAARRAAGDGQSLMGIGV
FT                   SFFTEAVGAGPRKDMDMLGLGMADGCELRVHPTGSAVLRIAVQTQGQGHETTFAQLVAE
FT                   ELGIHPENIDVVHGDTDNTPYGLGTYGSRSTPVSGAAAVIASRRVREKARLIAAGMLEV
FT                   APDDLEWTKDAAGGRFGVRGVPGASVTIEQVAMRAHGADELPEGVEGGLDAQVSYNPDN
FT                   LTYPYGAYICVVDIDPGTAVVKVRRFVAVDDCGTRINEMIVEGQIHGGLTDGVGMALME
FT                   YIGYDEHGNCLGGSLMDYLIPTAKEVPDWETGMTVTPSPHHPIGAKGVGESATVGSPPA
FT                   VVNAVIDALAPYGVRHADMPLTPSRVWEAMHGRATPPQ"
FT   gene            242554..243147
FT                   /locus_tag="Noca_0225"
FT   CDS_pept        242554..243147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0378c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79770"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD85"
FT                   /protein_id="ABL79770.1"
FT                   /translation="MPRLLSDATALVLAAGGSSRLGRPKQLLPLGGATLLDATLSAVRR
FT                   CGFGQVVLALGGAADEVAATVDLSGVDVVRNPGFGAGCSSSIAAALPAISATSEGLVLM
FT                   LGDQPEVSPAAVAAVAAVDADLAVCRYDNGLGHPFWLGRSRFGELANLHGDKAVWKLVD
FT                   AAGDALVTVPVVGDVPADVDTEADYRALLARWDR"
FT   gene            243144..244100
FT                   /locus_tag="Noca_0226"
FT   CDS_pept        243144..244100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0226"
FT                   /product="LysR, substrate-binding protein"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mbo:Mb0384 probable
FT                   transcriptional regulatory protein (probably LysR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79771"
FT                   /db_xref="GOA:A1SD86"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD86"
FT                   /protein_id="ABL79771.1"
FT                   /translation="MTPTQLRAFATVVRLGSVKAAAAELEVSEAAVSLHVGQLRKELGD
FT                   QLFNRTASGLAFTPGGLRLASRAVELLGLQDRTVLEVREAGVGRRMLRLGTTSLFAEYA
FT                   APGLIGLFADRARDLDVELSVHRARDFEQLLLTRTVDAVVGPRPATGDPALISKLFLNY
FT                   QVLAVVGPEHPVTRGQPGIAMLRDQTWLLGPSAADDAGVIPGLLQRIGVPEERQQIFQS
FT                   HAAALEEAKRGRGITLAVAFAVAQDLATGALVRVPGRPVQGQGSWNISILGGERATPAA
FT                   EEMARFVTTPRATQAMLRGRGVTHGRFKPAVHVTLWS"
FT   gene            244209..244517
FT                   /locus_tag="Noca_0227"
FT   CDS_pept        244209..244517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79772"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD87"
FT                   /protein_id="ABL79772.1"
FT                   /translation="MTPPLTSRRRSVPVESDGHSRGNPRMYELIENAPRSTSEGPGKSP
FT                   TVWAFPEFVEFLKVAGQPVQGPWPPHQHPRPDPTDVESLPVAIPDPAAEPRHRTEGA"
FT   gene            244517..245392
FT                   /locus_tag="Noca_0228"
FT   CDS_pept        244517..245392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0228"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0489 carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79773"
FT                   /db_xref="GOA:A1SD88"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD88"
FT                   /protein_id="ABL79773.1"
FT                   /translation="MYPSRFRYEAPRSIDEAIQLLHEGAGEAKVLAGGQSLVPLMKLRF
FT                   AAPELLVDINNLPGLDHLDVAADGGIRVGALCRHRDLERSLEVARAQPVMAAAAPLIAD
FT                   PIVRTRGTLVGSLCHADPQGDWAAVVTALGGHVVAQGPGGRRSIPITDFVTGPFQNVLE
FT                   YDEVAVEAVLPAPRARVAGGFLKLERRVGDFATAGTAVALELDGDRVTRAGIALTGVGS
FT                   RTVDARAAAEALVGQPLTAEAIGRAADLAAEVAQPTSDHRGSASYKRHVIHTFVTRILT
FT                   RVTQTSEAAA"
FT   gene            245389..245934
FT                   /locus_tag="Noca_0229"
FT   CDS_pept        245389..245934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0229"
FT                   /product="carbon monoxide dehydrogenase, small subunit"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rxy:Rxyl_0111 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79774"
FT                   /db_xref="GOA:A1SD89"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD89"
FT                   /protein_id="ABL79774.1"
FT                   /translation="MTSLFEEVPAAAAEGVPVRRITVRVNGTPRTADVEPRLLLAHLLR
FT                   QGFKLTGTHTGCDTTNCGACTVLVDGLPVKSCTMLAVQADGHEVTTVEGLAGPSELHPL
FT                   QEGFKDEHGLQCGFCTPGMMLAAKALLAENPDPTEDEVRFALSGNLCRCTGYQNIVKSV
FT                   LWAAKQMNGASADEGSAE"
FT   gene            245931..248345
FT                   /locus_tag="Noca_0230"
FT   CDS_pept        245931..248345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0230"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="KEGG: rha:RHA1_ro05232 possible carbon monoxide
FT                   dehydrogenase; TIGRFAM: carbon-monoxide dehydrogenase,
FT                   large subunit; PFAM: aldehyde oxidase and xanthine
FT                   dehydrogenase, a/b hammerhead; aldehyde oxidase and
FT                   xanthine dehydrogenase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79775"
FT                   /db_xref="GOA:A1SD90"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD90"
FT                   /protein_id="ABL79775.1"
FT                   /translation="MTATEPAPTTSRALDEIKIGGMGASRRRVEDNRFIRGRGHYVDDV
FT                   VLPGMLHMEILRSPVAHARIVSIDTTRAWNMPGVRLVLTGEMMATRNLAWMPTLSYDTQ
FT                   AVLATDKVRFQGQEVACVIADDPYIAKDACEAIEVEYEQLPVIVNPTQAMAPDAPIIRD
FT                   DKEGQADNVIFDWEVGDKEGTDRAFAEADHVSTIRMHYPRSHPSPLECCGSVADFDRAT
FT                   GKLTIYMTTQAPHIVRAAVALIAELPEHMIRIVSPDLGGGFGNKVPVYPGYVMTILASI
FT                   LLERPVKWIEDRSGNLISTGFGRDVYLEGELALRRDGKILAVRMHTDSDHGAFFGDAQP
FT                   SKFKIGLLHSTFSCYDIPTAHLTARGVYTNKAPGGVAYRCSFRVTEAMFFQERMMQAAA
FT                   DELGIDQAEFRRMNFVRDDDFPHRTPFGFLTDSGQYAKCLQVGLDAIDYEGFRREQAEA
FT                   AKQGRLLGIGISCMTEPLGAGNSREYDILGIKMFDSAELRVHMTGKAILRTGAKTQGQG
FT                   HETTWAQIVAHELGLPADDVVVEEGDTDTAPFGMGTYASRSTPVAGAAVAMVARKIRAK
FT                   ARKLAAHLLEVSEEDVEWELGRFYVRSAPDRGVTIQECAMAAYSNMPDGLEPGLEANAY
FT                   YDPPNLTWPFGCYIVTVEVDPMTGVWDVLRVVAVDDCGVRINPMIVEGQIMGGLTEAYA
FT                   MSSMQFITFDADGNCIGSNFMDYLLPTAWETPGYELHEVVTPCPHHPIGAKGIGECATV
FT                   GGPAAFVNAVMDALKQYGVRNVDMPLLPDRVHEAITQRHDVSGAPPIRTDA"
FT   gene            248342..249241
FT                   /locus_tag="Noca_0231"
FT   CDS_pept        248342..249241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0231"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; YHS domain
FT                   protein; SMART: TRASH domain protein; KEGG:
FT                   rha:RHA1_ro05233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79776"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD91"
FT                   /protein_id="ABL79776.1"
FT                   /translation="MNEPDLIADLGGQEYAVATVVWRQAPSSGQIGSRAYVTADGHVHG
FT                   WIGGACAEPTVIREAQRVIRDGEPKLLYLGASEDLVLPEGMTAIPMSCQSEGALQIYIE
FT                   PVHPPVHLVVVGRSPMAQTLAALARALGWRTDLVDGPDFTGADIDQRSVVVVATQGHGD
FT                   EDVVRHAASAMPAYVGLVASRKRGDAVLGYLAERGVPQHLLERVRTPVGIDLGRTSHQE
FT                   IAVSILAELVQVRAAGGISAEPVRRTLPLLETPEALDPVCGMTVPADDAHFPAEVDGTT
FT                   YHFCCVGCRDAFLAKVEA"
FT   gene            249243..249839
FT                   /locus_tag="Noca_0232"
FT   CDS_pept        249243..249839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0232"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   rha:RHA1_ro05235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79777"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD92"
FT                   /protein_id="ABL79777.1"
FT                   /translation="MLLSNDFEVGQPIDKVWAFFGDVPQVAACLPGAELTEDLGDDTYG
FT                   GGVGIRMGPVKLEFDGKARILERDDATKRMVIDASGADTKGRGQASMTVTAALTSVGRG
FT                   TKVHLEQDLQLSGAAAQYGRGMISDVTTVLMGQFAANAQQRIDALERGETVSATAKPAS
FT                   GLAIGLQAARMALMRVFRRFFLPYRPADRPELRSR"
FT   gene            249839..250090
FT                   /locus_tag="Noca_0233"
FT   CDS_pept        249839..250090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79778"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD93"
FT                   /protein_id="ABL79778.1"
FT                   /translation="MLWWIGNIVLLVAVVPVLVALLNRVLAALERIRGAADDILAGGGA
FT                   LAADLEDVPETMATTGATVEAVSQGAVRYAGSVAKLLG"
FT   sig_peptide     249839..249922
FT                   /locus_tag="Noca_0233"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.701 at
FT                   residue 28"
FT   gene            250334..250588
FT                   /locus_tag="Noca_0234"
FT   CDS_pept        250334..250588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79779"
FT                   /db_xref="GOA:A1SD94"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD94"
FT                   /protein_id="ABL79779.1"
FT                   /translation="MTVMAETGWTIGYTVGIVVVLVVVALVVPILLLAHRIGKQAAAID
FT                   ASLRQSVTNTAGLAGLNTTIESANTIVAGLNRGRKRLGG"
FT   gene            250590..250877
FT                   /locus_tag="Noca_0235"
FT   CDS_pept        250590..250877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79780"
FT                   /db_xref="GOA:A1SD95"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD95"
FT                   /protein_id="ABL79780.1"
FT                   /translation="MTVLLTDTQESLWWGAVIGGFVVVLAVAALLTILVLEVRTIDTRV
FT                   ASVKATLLEAETNTNDTALIATTAAGVDAVLAEGLEHHLFLGRVLGKVRM"
FT   gene            250874..251236
FT                   /locus_tag="Noca_0236"
FT   CDS_pept        250874..251236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79781"
FT                   /db_xref="GOA:A1SD96"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD96"
FT                   /protein_id="ABL79781.1"
FT                   /translation="MTTLVVLSVVDIALLIAGLAFYLYVVGTQLMRIAVNLEECAEIVH
FT                   RIEANAQPILGGLEHINRTGGVVAGALPLLYGMAEGIVAGATYQPPTTARPPAAPASGR
FT                   RRSRLHETVGYEPVGG"
FT   gene            complement(251277..251729)
FT                   /locus_tag="Noca_0237"
FT   CDS_pept        complement(251277..251729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79782"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD97"
FT                   /protein_id="ABL79782.1"
FT                   /translation="MIRLGSLAGYPFDGPRVLAGWAPPAVPAVYAILYRPDTAREQYAV
FT                   IYVGHSEDLSAEGFPFRHPAAPCWVERAGGRFGVHVATYEIPGGQAGHRTQLAEELVSV
FT                   YRPQCNDRQFDATWREEWIGSYRAPTTGPLTTRRSPAGGESSTESA"
FT   gene            complement(251737..252864)
FT                   /locus_tag="Noca_0238"
FT   CDS_pept        complement(251737..252864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0238"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A; KEGG: rxy:Rxyl_0115 VWA
FT                   containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79783"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD98"
FT                   /protein_id="ABL79783.1"
FT                   /translation="MAESAEPDPGHAFVETLVGFARELRAAGLPVGTGDGVTFCAAMEP
FT                   LDPTDLMDLYWGGRATLVTRREQIPTYHETFLRYFLDHPAPKPDEARPFTIQQREEART
FT                   ALQVPETEQHGEERQEEEAILGLMASDVSALKHKAFASCTPEELAALRRIMRTVRLTPP
FT                   RRRSRRTAAASAGTRPDLRRTVREAMRTHGDPARLRWRQRRKRPRPLVLVLDVSGSMAD
FT                   YSRALLQYAHITSRATSKVEVFCFGTRLTRITRELEHRRPDQALDRAARAVVDWEGGTR
FT                   IGGSLDAFVRDFGRRGTGRGGIVVICSDGLDRGDPALLASAMQRLSRLCHRVVWLNPHG
FT                   AEPASLGMAVATPYVDQVLTARSLADLEAFARSLG"
FT   gene            complement(252857..253732)
FT                   /locus_tag="Noca_0239"
FT   CDS_pept        complement(252857..253732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0239"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: rxy:Rxyl_0114
FT                   ATPase associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79784"
FT                   /db_xref="GOA:A1SD99"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SD99"
FT                   /protein_id="ABL79784.1"
FT                   /translation="MSRPGGVAELTDALRVDGYLADRGLSTATYVALALDRPLLLEGEV
FT                   GTGKTEIAKALSRVLGRRLIRLQCYEGIDTNQALYEWDYARQLLQIRALSDRSLDDEAA
FT                   VDALFGPKFLLERPLLDAVRAGDRAVLLVDEVDRADDEFEAFLLELLSDFQITIPEVGT
FT                   IVAERPPLVVLTSNRTRELHDALKRRCLYHWVDHPDAERELEIVLVRVPGVAESLARKV
FT                   VTAVQRLRQLDLAKPPGVAETIDWVRTLDVVGADDLDPQTIEDTLGAVVKEHDDLDVVR
FT                   AHVHELAPGG"
FT   gene            complement(253754..253996)
FT                   /locus_tag="Noca_0240"
FT   CDS_pept        complement(253754..253996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA0"
FT                   /protein_id="ABL79785.1"
FT                   /translation="MAEPNEVLRALWDADEATEAAVELEHAAPAKVCKRTRGMTFDGMA
FT                   EPGTDLNEAWRDLLAREGKLGTGETIRDLVLGRDA"
FT   gene            complement(254151..255320)
FT                   /locus_tag="Noca_0241"
FT   CDS_pept        complement(254151..255320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0241"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   tfu:Tfu_0068 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79786"
FT                   /db_xref="GOA:A1SDA1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA1"
FT                   /protein_id="ABL79786.1"
FT                   /translation="MSASRLLPTDEAVDLIALVRQIAAEELAPRSAEAEATETFPRDVF
FT                   AMLGRTGLLGLPYPEQHGGGGQPYEVYLQVLEEVGAVWASIGVGISVHALSCFGLATAG
FT                   TAAQQAEWLPAMLGGELLGAYCLSEPHAGSDPAAMRTRARRDGDEYVLNGAKAWTTHGG
FT                   HADFYKVMARTGDQRGDISCFLVPADTPGLSADPPEHKMGLTGSATATMRFDDVRIPAE
FT                   RLLGGEGDGLKIALAGLDAGRLGIAAVATGLAQGALDRAVAYAQERETFGRRIIDHQGL
FT                   AFVLADMEAAVQSARATTLHAARLKDAGLPYGREASVAKLVATDNAMRVTTDAVQVLGG
FT                   YGYTRDFPVERYMREAKVMQIFEGTNQIQRMVISRALDRSTAGTLTVAP"
FT   gene            255363..255929
FT                   /locus_tag="Noca_0242"
FT   CDS_pept        255363..255929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0242"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tfu:Tfu_0069
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79787"
FT                   /db_xref="GOA:A1SDA2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA2"
FT                   /protein_id="ABL79787.1"
FT                   /translation="MPPPRHQLLDELIELFLAEGFLEFGIGDLAARLRCSRTTIYRVAE
FT                   TKEQVVLAAVRGFFRRAAERIEAQVAAEPDPGARLAVYLTAVAEELAPASARFYADLQA
FT                   YAPAAEIYEANTRLAAERVQELVGAGVAAGALRRVDASFVGAAVAQVMSAIQGGRIAAA
FT                   SGLQDAAAYRALAELVVHGVGGSTP"
FT   gene            255984..256661
FT                   /locus_tag="Noca_0243"
FT   CDS_pept        255984..256661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0243"
FT                   /product="reduced coenzyme F420:NADP oxidoreductase"
FT                   /EC_number="1.6.99.-"
FT                   /note="TIGRFAM: NADPH-dependent F420 reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent; KEGG: tfu:Tfu_0970
FT                   NADPH-dependent F420 reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79788"
FT                   /db_xref="GOA:A1SDA3"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA3"
FT                   /protein_id="ABL79788.1"
FT                   /translation="MSDLPESLAGTTVAVLGGTGPQGRGLARRFAAAGLPVVIGSRSAE
FT                   RAAATAADLAAATGGDVTGADNAHAATTGDLVVVAVPWEGHGELVGGLATELAGKVVVD
FT                   CVNPLGFDKQGAFALAVEEGSAAQQAQALLPESTVVGAFHNVSAVKLEDPEVASVDTDV
FT                   LVLGDVREATDLVQDLCATIPGVRGVYGGRLRNAHQVEALTANLISVNRRYKSHAGVRV
FT                   TDL"
FT   gene            256882..257550
FT                   /locus_tag="Noca_0244"
FT   CDS_pept        256882..257550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79789"
FT                   /db_xref="GOA:A1SDA4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA4"
FT                   /protein_id="ABL79789.1"
FT                   /translation="MNLTLATLVGLAGTLLAAGYTVPQFSKLRRMATAAGVSVAALASS
FT                   TISGVAWTVFGVLEHDIWVALPAAVAVPATVGALVLAWLRGGSRERLWLPAAWLATVSL
FT                   AGLATLWVGPTPATVVLGFSVALLVTPAALTAWRSRDVSAIAASAWALMILDALLAGAY
FT                   GLLAGVDANLIYAAVATIGSLAVLLRIAVPAHVHARLVPLPALADAEVEVVPEDLSLVA
FT                   "
FT   sig_peptide     256882..257013
FT                   /locus_tag="Noca_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.395 at
FT                   residue 44"
FT   gene            complement(257634..258317)
FT                   /locus_tag="Noca_0245"
FT   CDS_pept        complement(257634..258317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0245"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: sma:SAV7039 sugar acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79790"
FT                   /db_xref="GOA:A1SDA5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA5"
FT                   /protein_id="ABL79790.1"
FT                   /translation="MNPLARALGHGVLNRGVHAVWRWLDRAGEIVPGTHAAAAFGSFGA
FT                   GSCIDFPPATLLNCRSIHVGSGVLVGRQATLSVGYGADDPNIPDRALVIGDRSSLGARV
FT                   SITAHSSITIGESVFFGQSVFVTDASHGYQDPTRPIGEQFGAHQPVSIGSGSWIGHGAV
FT                   ILPGARIGRNAVVAAGAVVRGEVEDFAVVAGNPARVVRRLEPDVGWVDSRGDVRPVLEG
FT                   LFGSD"
FT   gene            258374..258877
FT                   /locus_tag="Noca_0246"
FT   CDS_pept        258374..258877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0246"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79791"
FT                   /db_xref="GOA:A1SDA6"
FT                   /db_xref="InterPro:IPR019099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA6"
FT                   /protein_id="ABL79791.1"
FT                   /translation="MKAVVRRVALEVLGWVLVVAGIAALVLPGPGLLMIFAGLVILSQE
FT                   YEWAERRVEPVKIRALRGAAEGVENWRRVTFSTAIAVGLVGCGAVWIWGPEAPGWWPVA
FT                   ERWWLPGGAATGVTQVASGFIAIGLIVYSYRRFRVRGEPVPELPDDDDDDNDDNDSRGA
FT                   AERD"
FT   sig_peptide     258374..258487
FT                   /locus_tag="Noca_0246"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.699 at
FT                   residue 38"
FT   gene            complement(259106..260992)
FT                   /locus_tag="Noca_0247"
FT   CDS_pept        complement(259106..260992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0247"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: sth:STH843 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79792"
FT                   /db_xref="GOA:A1SDA7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA7"
FT                   /protein_id="ABL79792.1"
FT                   /translation="MTTSPTAEGILGERARREAGPRLGGRAETVVDTEVVHHEDARAGW
FT                   SDSAARAVLQLMVESVAEMVGFEVATLSVVLDGDLVTMAYTGPEEFRDYLMAPDPVTVL
FT                   DPVLARAESWGRFHFLAAEDYDATTLEGHWMVVADGQVDVPDAWHPMDVLVGLLTDDDG
FT                   RLVGAMSVDRPVSGRRPDPAQRRLLERYAAQAERAVMTAFEREELVQQVAHSEAARRLI
FT                   RSASMPDQASLQAVLDHTHRPLVEGFGAAGSWLQVLDPDSGGVGYARTREGEVVSLSDR
FT                   MIALAHGLAPRLWEAQQVLVVAEGVEPSLSAESGAGPLLEEARRQIAELGLTSAMAVPL
FT                   GAGTECLGFLVLSRRAQDPPWSTVEIGSALQIGYDLGAALMTVRALERERSLVRELQQL
FT                   DDYRSQLIATLSHELRTPLTVISGNLELLGDLSLDETAQHYQEAMTRGTTRMQKVVDDL
FT                   LLLARVSDPQHPLVQVPVDLNAVTRTTVDLLTAPALAKGLSLRLQHNPREHLVPGDPGE
FT                   LDRLLTNLVSNAVKYTPAGGTVTVTVERRGDAAVLEVADDGLGISEEDQVGLFRPFFRT
FT                   TNPDALREPGTGLGLAIVATIVERHGGEVRVRSRLGVGTTFTVTFPAAAPAG"
FT   gene            complement(260989..261486)
FT                   /locus_tag="Noca_0248"
FT   CDS_pept        complement(260989..261486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0248"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79793"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA8"
FT                   /protein_id="ABL79793.1"
FT                   /translation="MKRLLLPLGGLALVCSGFGAGIAVSATAADDADRAAPVVVTREPL
FT                   AEVTAPPGAPHRTLGLSKVVVMPGARLAAHHHPGAQLGYVAEGTLTYTVESGQARLMKG
FT                   PGDDATLVRTIDPGETVKVRPGRWLVEEQGEVHHARNAGTTPIVIYIATLLRTGAPAAI
FT                   AD"
FT   sig_peptide     complement(261400..261486)
FT                   /locus_tag="Noca_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 29"
FT   gene            261623..262567
FT                   /locus_tag="Noca_0249"
FT   CDS_pept        261623..262567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0249"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO6360 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79794"
FT                   /db_xref="GOA:A1SDA9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDA9"
FT                   /protein_id="ABL79794.1"
FT                   /translation="MIRAHALTKRFATEKGQSRVAVDGIDFVVGPGRVTGFLGPNGAGK
FT                   STTMRMILGLDAPTSGTVSVNGHRYAAAPAPLREIGALLDAHAIHPGRSARDHLRWMAA
FT                   SNGIPTTRVGEVLELVGLESVAGQRAGRYSLGMGQRLGIAAAMLGDPPVVVLDEPVNGL
FT                   DPEGIRWVRTFARQLADEGRTVFISSHLMSEMALMADHLLVIGRGSILADCSMSEFMTD
FT                   HAASYVRVKAPALGDVADLLGRRGLEVSRVDDELRVAGLDAPAVGELVFGHGLVLHELT
FT                   LVRSSLEDAFMALTADSVEYHAAPEPARTGALR"
FT   gene            262564..263382
FT                   /locus_tag="Noca_0250"
FT   CDS_pept        262564..263382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0250"
FT                   /product="putative ABC transporter transmembrane protein"
FT                   /note="KEGG: fal:FRAAL2980 putative ABC transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79795"
FT                   /db_xref="GOA:A1SDB0"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB0"
FT                   /protein_id="ABL79795.1"
FT                   /translation="MTATLTETGSLLVAADAPRPGFVDALRAEWVKLRTVRSTWWTLVA
FT                   TFVLGAGLTILMCWANADWLASAEADESPGSFITWGMMIAQITAVVLGALVVTTEYGTG
FT                   MIRSTFAAVPHRGRVLAAKSLVLVAVLLVVGTGTALVGYLGGNYFLDREGIGMPLEGDV
FT                   LRSMYGSGLYLAGIGLFTVAVGFLLRHTAGTISVVLALMLILGNMVNLVPGSFGEWLTK
FT                   LMPGNAGSVVATPVSFNPNLLDAWTGFAVFGLEIAVLLAAAYVVLRRRDA"
FT   gene            263534..266875
FT                   /locus_tag="Noca_0251"
FT   CDS_pept        263534..266875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0251"
FT                   /product="DNA helicase/exodeoxyribonuclease V, gamma
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, gamma subunit;
FT                   PFAM: Exodeoxyribonuclease V, RecC subunit; KEGG:
FT                   mtc:MT0659 exodeoxyribonuclease V, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79796"
FT                   /db_xref="GOA:A1SDB1"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB1"
FT                   /protein_id="ABL79796.1"
FT                   /translation="MTLQIHRASRTDVLADALGDLLRTPLADPFAEEVVVVPAKGVERW
FT                   LTQRLSHRLGAGPRGDDGVCAGVRFLNPRSLVSLLLGRERDDPWDPERLVWPLLATIDE
FT                   SLGEREFATLGRHLGHGVDGADGELRRNRRYSVALRLAHLFASYALQRPSLVTAWREGR
FT                   DGEHGGEQGLPPDLAWQPELWRRLIAQVDAPPPDVRHAQTCAALQAGGDGLPLPDRLSL
FT                   FGHTRIPVTEVALLKALGEHRDVHLFLPQPSPVLWDDLADLGGPGGVVPRAADDSVERV
FT                   GHPLLASLGRDARELRRLLDGVSSEEVRPPAGTPTGSTTDPVTLLGWLQHDLRANHAPS
FT                   YDERSTRELDPDDHSLQVHACHGPARQVDVLREVLVGLLEDDPTLEPRDVLVMCPDIET
FT                   YAPLISAGFGLATTDGHPAHRLRVKLADRALTSTNPLLAVAGDLLDLAGGRVTASDVLD
FT                   LAGTDPVRRRFGFTDDELDRVSRWVARAGVRWGLDEESRAAFRMERFPHNTWRTGLDRI
FT                   LLGVAMSGDDHHHLGRGLPLDDVASSEIDLAGRLAELVARVDRTLTVLAGARTVADWAT
FT                   GLRDGVRSLVDVAADDAWQVPQFERELGRAAASSHEGGLELRLADVRAMLESRLAGRPT
FT                   RANFRTGSLTVATMVPMRSVPHRVVCLVGLDDGVFPRAGAVDGDDVLGRHPLTGERDVR
FT                   SEDRQLLLDAVLAATEHLVITYSGADEQSGASLPPAVPLGEILDAADRTTNAPVRDRVL
FT                   TRHPLQPYDARNFTRERPFSFDTAALAGARSARGVRREPPPLLDGPLPPRLALDGRAAD
FT                   VSLQDLRDFLGHPVRAFLRGRLDVATPFEPDDLADAIPVSLDSLEKWQIGDRLLRQLLA
FT                   GQDPVAVLTAEQLAGTLPPRGLGTLALHEVAEECQRLWSRTADLRDGERRSVDVDVDLR
FT                   DGRRLTGTVPGVYGSRVVSLGYSRLNARQRLHAWVDLLALSATYPDQHWTAHAVGKDRA
FT                   GPKRALCGPLDHRAVGWLRDLVDLRDRGLCAPLPVPVKTGAAWADAHARELMGQDHPPV
FT                   EAARREWETDPHNQFGITGEDADPYHQRVYGPAAPVEALLDAGLGEHAWAIWEPLLTGG
FT                   ERVGPL"
FT   gene            266872..270207
FT                   /locus_tag="Noca_0252"
FT   CDS_pept        266872..270207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0252"
FT                   /product="exodeoxyribonuclease V, beta subunit"
FT                   /note="TIGRFAM: exodeoxyribonuclease V, beta subunit; PFAM:
FT                   UvrD/REP helicase; KEGG: mmc:Mmcs_0900 exodeoxyribonuclease
FT                   V, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79797"
FT                   /db_xref="GOA:A1SDB2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB2"
FT                   /protein_id="ABL79797.1"
FT                   /translation="MNAVRPFAITDPLPAGTVLLEASAGTGKTWTIGALLTRYVAEGVA
FT                   RLDQLLVVTFGRAASQELRERVRAQLVEAERVLGDDPVAGDSGDPGDPGDPGDSELVTL
FT                   LRSWGADERRRGHRRVTEALAGFDAATIATTHQFCSMVLDSLGVAGDTDSRARLVEDLD
FT                   DLVKETVDDLYLRAFADAEPAFTHDEAMAIARAAVGDPQARLEPAGADRSTIAGRKVSF
FT                   ADAVRTELDRRKRRLGILSYDDLLSQLADALAQPGSAAAQRMRARWRIVLVDEFQDTDP
FT                   VQWEVLDRAFSGHATMVLIGDPKQAIYAFRGGDVTTYLRAAETAQTRQTLAVNRRSDGP
FT                   LLAAVQTLLAGAELGDERIVVHDVTAHHGESRLAGAPVPHPFRLRVVRRDTFGRRGGST
FT                   LTVGQVRPHVARDLALDVRRLLASGATWCGEPIRPRDVAVISYRHADLATVREALLEVG
FT                   VPAVIAGGGSVFATPAAIEWLTLLEALEQPHRSTRVRSAALTCFFGHTAVELDARGDDL
FT                   TDEVADTLRGWVELFAGRGLAAVLEAANVAGLPERVLAEIGGDRRLTDLRHIGEALHEV
FT                   TLVARHGLPSLLTWLRGQVTEGRAGRGVERTRRLDSDAAAVQLVTIHASKGLEYPVVYV
FT                   PALADRFVPKPTRPLFHDDGGTRCLDVGGARSDDGWADHCRRWADEEAGEWLRLLYVAT
FT                   TRAKSQVVAWWAPTKNAVASPLHRMLMRDGDGPDGEMSASVPAAPAVPDDDAVVTLFSR
FT                   WRERGGPSPEAAIHADPGADPPRPATPDLAARTFTRTIDTEWRRASYSSLSRVEVAAPA
FT                   GAVVSEPEITGKEDEALAPEAVPVAPLLASDVPSPMAGLPVGATFGSLVHAVLEHTDPE
FT                   AVDLRAELLGHIDEQLGWWPVDLDREELADALVAVCDSPLGPLAAGTTLRQVTLGDRLR
FT                   EMEFELPLGDGLLGDLRPLLERHLPPGDPVRAYTAHLDGPLGEQTLRGYLTGSVDVVLR
FT                   LRSEAGPRYLVVDYKTNWLGPTDEPLTAHSYASVALDAAMGHSDYPLQALLYVAVLHRF
FT                   LRWRQPGYDPEQHLGGVLYLYLRGMCGPDTPSVDGAPCGVFAWRPPVALVEELSDLLDG
FT                   GARD"
FT   gene            270200..271954
FT                   /locus_tag="Noca_0253"
FT   CDS_pept        270200..271954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0253"
FT                   /product="DNA helicase/exodeoxyribonuclease V, alpha
FT                   subunit"
FT                   /EC_number="3.1.11.5"
FT                   /note="KEGG: mpa:MAP4091c exodeoxyribonuclease V alpha
FT                   chain; TIGRFAM: exodeoxyribonuclease V, alpha subunit;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79798"
FT                   /db_xref="GOA:A1SDB3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB3"
FT                   /protein_id="ABL79798.1"
FT                   /translation="MTELFEPVDEHDWRIATGATGLLATFNAAGVLTSSDVHVATRIGV
FT                   LGGETDERMLLAVALTVRAVRRGSVCLDLAGVAATAPDLPWPDEWPVAGSPLVHAGVVR
FT                   WDHELLYLDRYHRLERQVHDDLAARLALAPPAVDEQRLEAALARLGGGHFSEEQRAAVV
FT                   AAVRRRTTILTGGPGTGKTTTVARLLALLADQAAGRGSRLSIALAAPTGKAATRLQEAV
FT                   VTELAAVATAWPEAPALVGRLDGLTLHRLLGWRPDNATRFRHDRANRLKYDVVVVDESS
FT                   MVELTMMGRLLEALRPDSRLVLVGDPQQLTSVGAGAVLSDLVAGYEGRPDSPVAALSTN
FT                   FRSEEDIKSLAAALRSGDADEVIAVLRAPSEQVSWVETSDAAEVEAALRPDSLASARAV
FT                   WAAARDEDAERALAELDRYRLLCAHREGLYGVRRWNHLVERWLAEDPDVEIYDEWYVGR
FT                   PLLVTSNDYALDVYNGESGVVVRQDQRRRVFVAGSERLKEFAPGRLEAVETMHAMTIHK
FT                   SQGSQADRVSVLLPDEGSRLLTLELFYTAITRARHHVRVVGSEAAVRAAVDTRAQRATG
FT                   LRARLADG"
FT   gene            272008..272631
FT                   /locus_tag="Noca_0254"
FT   CDS_pept        272008..272631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0254"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   pac:PPA1121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79799"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB4"
FT                   /protein_id="ABL79799.1"
FT                   /translation="MPYLLRVELPDVPGSLGRLATAIGEAGGDIEAIEIVEKRHGGTAV
FT                   DDVFLEMDPGAMPDSVVSTVNALDGVRVLWVGRYAAGGNLFLDLEAVEELTEDPEHALG
FT                   RLIDRLPVVFRADWAARVSKADGVVYATGAAPKELAWQPIERAETIGSADENNIHCAAR
FT                   LNKSEIVVIGRRGGPAFLDSEIARLGHLTGLAMSIARAARAATP"
FT   gene            complement(272737..274059)
FT                   /locus_tag="Noca_0255"
FT   CDS_pept        complement(272737..274059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0255"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sma:SAV5597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79800"
FT                   /db_xref="GOA:A1SDB5"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB5"
FT                   /protein_id="ABL79800.1"
FT                   /translation="MLHHAEVTATTPAPRSALAEPTTKPPGRWIAAITLASIGLWAGFF
FT                   GPIQVLLAQQAEAIAPDDKKVVLSVVLGLGAFVSVVCNPVFGAFSDRTTLRAGRRLPWI
FT                   AGGAVGGALSLLLLSVADNVVVMAIGWCGVQATLNAMLAAVTATVPDQVPVGERGRVGG
FT                   ILAVAQTVGVVGGTGIASATGSIAAGYVVTAGVLIVLTLPYCVGSRDVPLAPDELPPPF
FT                   DWGGFLRSFWVSPRRHPDFAWAWITRFLVNLGNALGLLYLLYYLQDVIGVDKDEADDRV
FT                   FLLTAIYAAVIMATTVVFGVWSDRTGKRKVFVIWSGVVGSLASLLLAVGQTWPAAVAAA
FT                   VLMGVGYGIYTSVDFALITQVLPGAEDRAKDLGVINIANALPQVFAPFIAAVILLVVEA
FT                   AGGVTETGGDRFSVGYCVLYSVAFLVAVLGSVFVTKIRSVP"
FT   gene            complement(274119..275576)
FT                   /locus_tag="Noca_0256"
FT   CDS_pept        complement(274119..275576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79801"
FT                   /db_xref="GOA:A1SDB6"
FT                   /db_xref="InterPro:IPR005065"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB6"
FT                   /protein_id="ABL79801.1"
FT                   /translation="MRALTATLSLLLAGALAAPAAADPAPTDPAYTQRDAQNITDAYGR
FT                   IDGEGGQLRNPAYLPALVAASTQRGVDQLLTQVASPTRPALTPGNVFPGWNVGNPLRAG
FT                   WDGTRGVSRAVTFTNEYGAQLRGHVWKPLPGARDPYTGRRLHGPFPGVVITEGSVQGSE
FT                   GMYEWLAQDLAERGYVVLTYDVQGQGTSETFPHQESPVPVDGLPFCNPFAAPDDGEMSG
FT                   CPGVPSQQLSNFVVGTEAALDFITSRANPFRRSLDRSPDPHPATPGRTTRIAIIGHSMG
FT                   AAAVSKVQGTDRRVAAVVALDKLAGPDSSGALDGAGNRPVVPALAVQSEYGFTVSPWFL
FT                   SGGSSLSPQPSPDGPDPMRERATGYDAWRAAGVDAMLVVPRASTHLEYTDIPLVLPASR
FT                   YGQDLTSVYVQRWLDRYLKHRDDTAALLADSFRYLEPAGDGVWSPVRLHRDDLLSFYYC
FT                   SAYGLDTPRGEVADGDVTGVGCPSSIG"
FT   sig_peptide     complement(275508..275576)
FT                   /locus_tag="Noca_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.963 at
FT                   residue 23"
FT   gene            complement(275612..276055)
FT                   /locus_tag="Noca_0257"
FT   CDS_pept        complement(275612..276055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0257"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: sma:SAV7465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79802"
FT                   /db_xref="GOA:A1SDB7"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB7"
FT                   /protein_id="ABL79802.1"
FT                   /translation="MTLDGEYEPNPQQWVRDQVEEFEASNGQRANILMDHPEWPIVVIT
FT                   SRGATSGKLRKNPVMRVEKDGVYAAIASKGGTPEHPSWYHNFVAHPEVDLQDRSEKHSY
FT                   RARIAEGAERAEWWERAVAQYAPYAEYQEKTDREIPVFLLERV"
FT   gene            276111..277028
FT                   /locus_tag="Noca_0258"
FT   CDS_pept        276111..277028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0258"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: nfa:nfa51380 putative
FT                   dihydroxynaphtoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79803"
FT                   /db_xref="GOA:A1SDB8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB8"
FT                   /protein_id="ABL79803.1"
FT                   /translation="MSAIDGVSEIFDADAWDVVPGFEDLTDLTYHRAREHGTVRVAFDR
FT                   PDVLNAFRPHTVDELLRVLEHARTSSDVGCVLLTGNGPSAKNGKWAFCTGGDQRIRGRA
FT                   GYQYAEGETAETVDKAKLGRLHILEVQRLIRFMPKIVICVVPGWTAGGGHSLHVVCDLT
FT                   LASAEEARFKQTDADVGSFDGGFGSAYLARQVGQKFAREIFFLGQEYSAEDGVRMGTVN
FT                   RAVPHAELEATALEWGRIVNGKSPTAQRMLKYSFNAIDDGLVGQQLFAGETTRLAYMTD
FT                   EAQEGRDQFLEKRDPDWSPFPWYY"
FT   gene            277105..278469
FT                   /locus_tag="Noca_0259"
FT   CDS_pept        277105..278469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cef:CE1017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79804"
FT                   /db_xref="GOA:A1SDB9"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDB9"
FT                   /protein_id="ABL79804.1"
FT                   /translation="MLRGQDGPQPVSRAESLYTALVRRNPETEQEMPAQVRRSIAPNGL
FT                   RQVLANALQSSGDQLVNASTVLPWLFGALGVPAALTGLLVPVRESGSMLPQAALTPLVL
FT                   RARYRKRIFVAGALVQAVAVASMAAIAALGSGLAAGLVIVASLVVFALGRCLCSIASKD
FT                   VQGRTIPKGERGQINGLATTAAGLVAITLGLAVRLLGGEDLSAGQLAGLLAAGAGLWVA
FT                   VAVVYTGIREPADDPAGGAPARSPADDADTWFTRSLRLLKEDEHFRDFVGVRSLLLVSS
FT                   LSPPFVVTLSTQAGAGGLAGLGGFIVASGVAALIGGRLFGRFADRSSRRLMSTGAGVAS
FT                   AVVIATVVVVAVPGSTGEGRSGNILFIGAYFLLTLMHTGVRVGRKTYVVDMAEGDRRTE
FT                   YVAVSNSAMGLILLVVGGVSSALAIVHISWALLFLAGMGLVGVVAGARLPEVEHR"
FT   gene            278976..280460
FT                   /locus_tag="Noca_0260"
FT   CDS_pept        278976..280460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0260"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   rha:RHA1_ro02720 NAD(P) transhydrogenase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79805"
FT                   /db_xref="GOA:A1SDC0"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC0"
FT                   /protein_id="ABL79805.1"
FT                   /translation="MAATAQTASRLVKLGYDVVVESGAGGPASQPDEAYAEAGVTVSSA
FT                   EEVWSSDVVVKINAPTDDEVARLGRGATVVSLMAPARSPELVERLAAAGVTALAMDAVP
FT                   RISRAQSMDVLSSMANVAGYRAVVEAAHAFGRQFTGQVTAAGKIPPARVFVVGAGVAGL
FT                   AAIGAAGSMGAIVRAFDVRPEVAEQVESMGAEFVTVDMQSEVSSDGYAKEMTAEQEKAT
FT                   AVMYDEEARAADIVITTALIPGRPAPRLIGEETVAGMRPGSVIVDMAAANGGNVAMTVA
FT                   DEEVVTDNGVRILGYTDLAGRLAAQTSQLYGTNVVNLLTLMTPEKDGALTLDLDDPVQR
FT                   GLTVVREGEVLWPPPPVQVSAAPKAPAPTAPAEPPPPKKKRPMWLVFAAASVLLFLVAT
FT                   TAPAPLPEHFFVLTLAIVIGYYVIGHVHHALHTPLMSVTNAISGIIVVGAMLQLGVDDA
FT                   AVRTLSFVAVLLASINVFGGFAVTRRMLGMFRKADQ"
FT   gene            280460..281875
FT                   /locus_tag="Noca_0261"
FT   CDS_pept        280460..281875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0261"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79806"
FT                   /db_xref="GOA:A1SDC1"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC1"
FT                   /protein_id="ABL79806.1"
FT                   /translation="MSAVSISVGAYLVASLLFILSLAGLSRHESARNGVNYGIAGMALA
FT                   LAATVGLLVHDTDEALPLVLLVVAMTVGAAIGLWRARVVAMTGMPELIALLHSFVGLAA
FT                   VLVGWNGYLHDEGLTGSLFRIHSAEVVIGVFIGAVTFTGSIVANLKLSARMKSAPLMLP
FT                   GKNAINLGALAVFAALTVWFTASPNLGVLIAVTAVALALGWHLVASIGGGDMPVVVSML
FT                   NSYSGWAAAASGFLLDNNLLIVTGALVGSSGAYLSYIMCEAMNRSFISVIAGGFGIEVA
FT                   ASGDTDYGEHHEISAEEVAELLADASSVIITPGYGMAVAQAQYPVAELTSKLRARGVDV
FT                   RFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFPSTDVVLVIGANDTVNPAAL
FT                   EEPGSPIAGMPVLHVWEAKDVIVFKRSMAVGYAGVQNPLFFRDNTHMLFGDAKDRVEDI
FT                   VRQLSDIPQQVSR"
FT   sig_peptide     280460..280555
FT                   /locus_tag="Noca_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.548 at
FT                   residue 32"
FT   gene            complement(281930..282394)
FT                   /locus_tag="Noca_0262"
FT   CDS_pept        complement(281930..282394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79807"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC2"
FT                   /protein_id="ABL79807.1"
FT                   /translation="MTGRLSAKVLVVSPLSVEVNVTPVERTSVYDEPERVSTSTVPVVV
FT                   SRPPPSIGPCRTWSRVSVPVSGTTVAVGPATWVAAQLAVSHPRLGVPATLPRVIRAARP
FT                   ACGALACAANDTPTRPGKVATSTAAIVTLSMARTIAGKPARHRGSAAGLD"
FT   gene            282485..282982
FT                   /locus_tag="Noca_0263"
FT   CDS_pept        282485..282982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79808"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC3"
FT                   /protein_id="ABL79808.1"
FT                   /translation="MAAYGDRLLIGAGSDGGRLTVFEKVGDGPFRVLARSRAVHDFDVA
FT                   YSGREPVLAWSRGRLRQLSLVVGGRLVNTRTPTEAVALATDGRLVHVVFSTVARTTCGP
FT                   AGCLHSGVYHVGLRGRRVAIKASLVQAGSSSPFRLAADTSGRTLGVVVSRNGVTRLYQR
FT                   SF"
FT   gene            283044..284195
FT                   /locus_tag="Noca_0264"
FT   CDS_pept        283044..284195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0264"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: cya:CYA_2465 GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79809"
FT                   /db_xref="GOA:A1SDC4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC4"
FT                   /protein_id="ABL79809.1"
FT                   /translation="MGTPADDWFGQAFSKAWRDKAEEIGRFNLAIFGKTGVGKSTLVNA
FT                   IFGSEIAATGIGEPVTRAEHLYLHQSGTLGVLDTRGLEVGRDNDALIAELKDYLHGMRR
FT                   RPLADQLHVAWYCVRAGDRRFEATEAEFVRALHELGLPVILVLTQVPRSIGPGGDARVH
FT                   PDAEALAASIAELRLPIVDGLIHYTMALEDDFTGQAAYGLQELLDATFRGAPEGVAHAI
FT                   TAAQRIDFVRKRERAEKAIKAATGAATTAGASPIPFSDAAILVPLQIGMMASIAVTYGV
FT                   PLERSTAASLAATAAATTAGRSLVTNLVKFVPGAGTMVAAPISATVAGTFTYAMGQAWL
FT                   RVCERLARGELGVVGGALDGESVRKVFLEEFKTQAARRRVGRR"
FT   gene            284215..284913
FT                   /locus_tag="Noca_0265"
FT   CDS_pept        284215..284913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0265"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: sal:Sala_2748 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79810"
FT                   /db_xref="GOA:A1SDC5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC5"
FT                   /protein_id="ABL79810.1"
FT                   /translation="MVVRIVVLTGAGISAESGLPTFRDADGLWHGHRVEEVATPEAFER
FT                   VPALVHRFYDERRAALATVRPNAAHEALARLEQALGDDLLVVTQNIDDLHERSGSRQVL
FT                   HMHGRLRSALCGSCAGHFDWVGDLGDAPPCPRCGRRELRPDVVWFGEAPYDMDRILGAV
FT                   GRADLFVSVGTSGAVYPAAGFVQYAAGQGARTLELNLVPSEGSHLFDESRHGPASRLVP
FT                   EWVAEIFDTP"
FT   gene            285056..285760
FT                   /locus_tag="Noca_0266"
FT   CDS_pept        285056..285760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0266"
FT                   /product="lipoprotein"
FT                   /note="KEGG: sco:SCO7393 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79811"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC6"
FT                   /protein_id="ABL79811.1"
FT                   /translation="MARIAMAAVGLGTAALLTACGGGDDFTDQSADDIVSAAKSEMGDL
FT                   KAVKVSGSVTSDGQQIDIDLQSSSEGSCTGTIGVAGGTTELLGVDGSTWMKPDEAFWRA
FT                   TAGDAADSVITAVGDKWVVIPAEDDSFNTFCDLDDLLDQLLKDDEEDGSTYSKNGTEDV
FT                   DGETAVKVDNEDPEDGTSTGYVLVDEPHYLVKIEKTDGADTGNITFSEFDEEFDVEAPG
FT                   ADEVVDLDQLGA"
FT   sig_peptide     285056..285169
FT                   /locus_tag="Noca_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.712 at
FT                   residue 38"
FT   gene            complement(285767..287506)
FT                   /locus_tag="Noca_0267"
FT   CDS_pept        complement(285767..287506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0267"
FT                   /product="maltooligosyl trehalose hydrolase"
FT                   /EC_number="3.2.1.141"
FT                   /note="KEGG: nfa:nfa18050 putative glycosyl hydrolase;
FT                   TIGRFAM: malto-oligosyltrehalose trehalohydrolase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79812"
FT                   /db_xref="GOA:A1SDC7"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012768"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC7"
FT                   /protein_id="ABL79812.1"
FT                   /translation="MTHGPFDVWAPLPRRLRLAVAGETVAMRRGEGDWWTPAGPVPAGA
FT                   ELDYGYLVDDGEAPRPDPRSRRQPGGVHQLSRTFDPASYPWTDQAWTGRQLAGSVVYEL
FT                   HVGTFTPEGTFDAALEKLPHLREIGVDLVELMPVNAFNGTHNWGYDGVGWFAVHEGYGG
FT                   PAGYQRFVDGCHAAGLGVIQDVVYNHLGPSGNYLPELGPYLKQGANTWGDFLNLDGPGS
FT                   DEVRRYILDNVRMWLADYHVDGLRLDAVHALNDAGHQHLLEELAAEVAALSAHQRRPLT
FT                   LIAESDLNDTRLVRPREAGGYGLDAQWSDDFHHAVHVALTGETAGYYADFEPLSALAKV
FT                   CERGFFHDGTWSSFRGRDHGFPVDLRTMPTWRLVVCSQNHDQIGNRARGDRITEVLDDD
FT                   QLACAALLTLCGPFTPMLFMGEEWAASTPFQFFTSHPEPDLGTATAEGRIAEFERMGWD
FT                   PAVVPDPQDPATFERSKLDWAEATRGRHARMLDVYRRLARLRREHEALTDPSFGSVRCT
FT                   ADEHTRVFTMRRGDLLVAVNFGDAAATVETAAATLLFQTGAGLTLDAGRLSLPPHAGAL
FT                   VGP"
FT   gene            complement(287511..289760)
FT                   /locus_tag="Noca_0268"
FT   CDS_pept        complement(287511..289760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0268"
FT                   /product="maltooligosyl trehalose synthase"
FT                   /EC_number="5.4.99.15"
FT                   /note="KEGG: lxx:Lxx02190 malto-oligosyl trehalose
FT                   synthase; TIGRFAM: malto-oligosyltrehalose synthase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79813"
FT                   /db_xref="GOA:A1SDC8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012767"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC8"
FT                   /protein_id="ABL79813.1"
FT                   /translation="MRAPVSTYRLQITPEFDLFEAARRLPYLRALGADWVYLSPLLASE
FT                   PGSNHGYDVVAFDRVDPARGGAEGLAVLSAEARRLGMGILVDIVPNHVGVATPAENAWW
FT                   WDLLQHGRASKHADAFDVDWDAGDGKVLIPVVGDGDGGSIRVEDGEVRYHDHRFPLAAG
FT                   TSAHEEQHYRLVSWRDADDKLNYRRFFAVNTLAGVRVEEPEVFAQSHVEIRRWFAEGLV
FT                   DGLRVDHPDGLRDPQGYLDDLADLTGRAYVLVEKILEPGEKLPRSWATQGTTGYDGLAL
FT                   VDRVLTDPTGQAPLDRLEARLRGAPVDWPDLIHGTKRAVADGILQSEVRRIVREIGPED
FT                   PAPYRDAVAELLTCFPVYRSYLPEGRDHLAEAFARARRTRPDLAATYDALEPVLTDAAS
FT                   PPALRFQQTSGMVMAKGVEDCAFYRWSRLTSLTEVGGDPSVFAVTVAGFHEAMAARQRD
FT                   WPHTMNTLSTHDTKRGEDVRARITALAEMPDTWAAALERLLALAPVPDPGFGSLLWQAV
FT                   LGAWTPEHLPDLRDRLHGYAEKAMREAGDRTTWTEPDATYEAAVHAAVDAAFDSTDVRA
FT                   VLADLAARIDAPGRSNSLAAKLVAITMPGVPDVYQGSELFETSLVDPDNRRPVDFDHRA
FT                   AVLAGTDADDAVDKLHVTCSALTLRRDRPELFTTYAAVPATGTAADHVLAFDRGGAISV
FT                   ATRLPVGLAARGGWGDTVLELPAGRWHDVLTGSSTEGRLADLLAALPVAMLVRAD"
FT   gene            complement(289765..291966)
FT                   /locus_tag="Noca_0269"
FT   CDS_pept        complement(289765..291966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0269"
FT                   /product="isoamylase"
FT                   /note="KEGG: mpa:MAP3262c GlgX_2; TIGRFAM: glycogen
FT                   debranching enzyme GlgX; PFAM: glycoside hydrolase, family
FT                   13 domain protein; alpha amylase, catalytic region; SMART:
FT                   alpha amylase, catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79814"
FT                   /db_xref="GOA:A1SDC9"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDC9"
FT                   /protein_id="ABL79814.1"
FT                   /translation="MQVWPGRAYPLGATFDGSGTNFALFSEVADRVELCLFDAEGSEGY
FT                   RETRVELTEVDAYVWHCYLPAVQPGQRYGYRVHGPWDPENGQRCNPNKLLLDPYAKATS
FT                   GEIDWDQSLFSYNFGDPEDSDARNDEDSAPHMTHGVVINPFFDWEGDRRLDYDYNESII
FT                   YEAHVKGLTQLHPDIPEELRGTYAALGHPAITEHLTKLGVTAIELMPVHQFIQDSTLLD
FT                   KGLRNYWGYNTLGFFAPHADYAATGQPGQQVQEFKSMVKAMHAAGIEVILDVVYNHTAE
FT                   GNHLGPTLSFKGIDNAAYYRLVEDDQRYYMDYTGTGNSLNVRHPHSLQLLMDSLRYWVT
FT                   EMHVDGFRFDLASTLAREFYDVDRLSTFFELVQQDPVVSQVKLIAEPWDIGPGGYQVGG
FT                   FPPQWTEWNGKYRDTVRDFWRGEPSLGEFASRLAGSADLYEHSGRRPVASINFVTAHDG
FT                   FTLRDLVSYDEKHNEANGEDNNDGESHNRSWNHGVEGPTDDPEILEFRAREQRNFIATL
FT                   LLSQGVPMLLHGDEMGRTQQGNNNTYAQDSELSWVHWDEADKPLVEFTAALSRLRRAHP
FT                   TFRRKRFFTGGTVRVPDGGDGDRLNDIVWLHLDGRPMEDNDWTQSDSGAGAQALGMYLN
FT                   GHGIAGRDERGGPIVDNHFLLYFNADGPAEVTLPPDEYADAWDVVVDTGGLVDDQTALA
FT                   AGSTCSMASRSLIVLREHREPEAEVDHSVAASVAQARRG"
FT   gene            292108..293601
FT                   /locus_tag="Noca_0270"
FT   CDS_pept        292108..293601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0270"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro04813 multidrug resistance transporter, MFS
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79815"
FT                   /db_xref="GOA:A1SDD0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD0"
FT                   /protein_id="ABL79815.1"
FT                   /translation="MPAPGMSATGWALLSDVALSDVSRASVGLRSERGPVLLAVMLSNG
FT                   LVAIDSTILATAVPAVVTDLGGFTQFPWLFSVYLLAQAVSVPIYAKLADLYGRKPMLLL
FT                   GIGLFVLGSLLCGLAWGMGALIAFRALQGLGAGAVQPIGLTVVGDIYSIQERAKVQGYL
FT                   ASVWAISAIVGPTLGGAFSDYLSWRWIFFVNLPLGVAAAWMFWRRFDERVERRRHRIDH
FT                   AGAVLLAGGGLLLMLALLEGGVRWPWSSVTSVALFSGAAVLLVGFVLVERRAAEPILPL
FT                   WVFRHRVLGSAMSASLIVGVLVMGLASYVPLYAQAVLGHGAVVAGFALAGMTLGWPLAS
FT                   SSAGRLFLTIGPRSTMMLGGATTAAGAALLLTVGADSSFLHLAVPCFVMGLGFGLVASP
FT                   AVIAAQSAVTWQDRGVATGSTMFARSMGSAIGVAVFGAVANGVVASRLGSRAGSLELVT
FT                   PRVLEPAIGAVFLTSAVVALSLVAISAVMTRRIAEPVTD"
FT   gene            293627..294772
FT                   /locus_tag="Noca_0271"
FT   CDS_pept        293627..294772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0271"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   rha:RHA1_ro08138 long-chain-acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79816"
FT                   /db_xref="GOA:A1SDD1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD1"
FT                   /protein_id="ABL79816.1"
FT                   /translation="MKRSIYDDDHEAFRDSVREFLERSVIPQVEQHAADKAIPRDFWTE
FT                   AGRQGFLGLEIPEEYGGAEAGDYRFNAVLLEELNKVNAALGSCVGIHADITAPYLVELG
FT                   TDEQKQRWLPGVAAGEVLLAIGMTEPSGGSDLAALKTTAVKDGDSWVINGSKTFITNGY
FT                   SADLVLVAARTSPEKKARGITLFAVESTAPGYSRGRKLDKIGQDESDTAELFFENVRVT
FT                   DAEIVGELDGGFIHMMQKLPQERLGCAISNVAHAKQILLETLQYAKDRKAFGQGIGSFQ
FT                   YNKFLLAELFTRIEVTEAFIDQCVVAHAAGELTPIDAAKAKWWSSQVQNEVLDHCVQLH
FT                   GGYGYMNEYRVARAWRDARVSKIWAGSNEIMKELIGRDLGL"
FT   gene            294848..295579
FT                   /locus_tag="Noca_0272"
FT   CDS_pept        294848..295579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0272"
FT                   /product="protein of unknown function DUF125,
FT                   transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125,
FT                   transmembrane; KEGG: sma:SAV6445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79817"
FT                   /db_xref="GOA:A1SDD2"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD2"
FT                   /protein_id="ABL79817.1"
FT                   /translation="MTTSEIEVPAGPHESEPHIRGFNNRLNWLRAAVLGANDGIVSTAG
FT                   IVIGAIGATSDRNAIVIAGVAGLAAGAMSMAAGEYVSVSTQRDSELALLEKERRELLEE
FT                   PEEELAELAGLYAAKGLPDDLALEVATVLTAQDALAAHAEVELGIDPDDIASPLHAAWA
FT                   SMLAFTIGALLPLLSITLASAETRVPLTVGVVVLALAITGWASARLGYSSPARAVARNV
FT                   AGGLFAMAVTFAIGSALGTQI"
FT   gene            295784..296350
FT                   /locus_tag="Noca_0273"
FT   CDS_pept        295784..296350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0273"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: 2',5' RNA ligase;
FT                   KEGG: tfu:Tfu_0243 2',5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79818"
FT                   /db_xref="GOA:A1SDD3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD3"
FT                   /protein_id="ABL79818.1"
FT                   /translation="MRMFVALVPPAEAVEHLDAFLEPRRSAAAFRWAGVEQLHVTVAFL
FT                   AEVEERRLEDLVERLGRAAARRSAFDTAITGGGAFPNVGRARVLWAGLALDEHGRTQLD
FT                   RLATGCRTAANRAGVPVDGQRFRPHLTVARIAHPTEATSWVRLLDGYAGPAWRADRVEL
FT                   VASYLGEGPRGRPRYETVAELELAG"
FT   gene            complement(296357..297100)
FT                   /locus_tag="Noca_0274"
FT   CDS_pept        complement(296357..297100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0274"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: lxx:Lxx23800
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79819"
FT                   /db_xref="GOA:A1SDD4"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD4"
FT                   /protein_id="ABL79819.1"
FT                   /translation="MTEAGSGQGGEDLRRFMLEHRFGMDEIVTKLTILRDEFTHLRDYN
FT                   PIESVSSRLKSPESLVEKMLRKGLVLDERPSFDQIRATVTDIAGVRVVCSFVSDVYRVF
FT                   DMLVEQEDVSTVEVRDYIATPKPNGYRSLHALVEVPVFLSEGPVPVLVEVQFRTIAMDF
FT                   WASLEHKIYYKYRREVPAELLERLHDAAETAYALDATMERLHEEVRGLDELPPDVLAQL
FT                   RDGGERPDAALREALRKLGATPETA"
FT   gene            complement(297539..298180)
FT                   /locus_tag="Noca_0275"
FT   CDS_pept        complement(297539..298180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0275"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: sma:SAV4178 putative
FT                   uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79820"
FT                   /db_xref="GOA:A1SDD5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDD5"
FT                   /protein_id="ABL79820.1"
FT                   /translation="MRTHVVDHPLVAHKLTHLRNEETDSPTFRRLADELVTLLAYEATR
FT                   DVRVEPIDVVTPVSPTTGVQLAKPRPLVVPILRAGLGMLDGMMRLLPTAEVGFLGMIRN
FT                   EETLQASTYAERLPEDLSGRQCYVLDPMLATGGTLAAAIRFLTDRGADHITAICLLAAP
FT                   EGCARLEQELDGLDVPVTIVTAAMDERLNEKGYIVPGLGDAGDRLYGIVG"
FT   gene            298300..298785
FT                   /locus_tag="Noca_0276"
FT   CDS_pept        298300..298785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79821"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD6"
FT                   /protein_id="ABL79821.1"
FT                   /translation="MADQVDGIDFALAAYREGGAWTVQELAHDVLEDIDTLSAALRRFP
FT                   GDGGAVGMVAIEEDFFVVVRVAGPTTRVLLSDITAADEWELASSAVEFLGLPLPEDEDD
FT                   PVPAGDLDLLGDLGMHAMDMGVLLDDIDLYPDEMLSDVARRLGFGKLFDDAVGLTSA"
FT   gene            298809..299240
FT                   /locus_tag="Noca_0277"
FT   CDS_pept        298809..299240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0277"
FT                   /product="tRNA-adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="PFAM: CMP/dCMP deaminase, zinc-binding; KEGG:
FT                   fal:FRAAL0635 tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79822"
FT                   /db_xref="GOA:A1SDD7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD7"
FT                   /protein_id="ABL79822.1"
FT                   /translation="MRTALDEARAALASGDVPIGAVVLDPDGTPVARGRNVREADHDPT
FT                   GHAEVVALRAAARARGEWRLEGHTLVVTLEPCTMCAGAAVLSRVERIVFGAWDPKAGAV
FT                   GSLWDVVRDRRLNHRPEVISGVLAEESAGLLEDFFLTQR"
FT   gene            299282..299674
FT                   /locus_tag="Noca_0278"
FT   CDS_pept        299282..299674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0278"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: lxx:Lxx15560 lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79823"
FT                   /db_xref="GOA:A1SDD8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD8"
FT                   /protein_id="ABL79823.1"
FT                   /translation="MHSYRGAMDYKIELIPLAVRDVDRSIAFYGDSLGWSVDHDQTVSP
FT                   TLRFVQVTPPGSACSICFGVGLEMMPAGSSQFIQVVVADADAALAELRERGVGCEGVDD
FT                   QPWGRFVYFQDPDGNRWALQQVVRPS"
FT   gene            complement(299702..301321)
FT                   /locus_tag="Noca_0279"
FT   CDS_pept        complement(299702..301321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0279"
FT                   /product="glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   mmc:Mmcs_5268 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79824"
FT                   /db_xref="GOA:A1SDD9"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDD9"
FT                   /protein_id="ABL79824.1"
FT                   /translation="MRKTTLAALPAAALGAVAAHDLLQRRHAILRNFPVVGHARYWLEA
FT                   LGPELRQYIVASNDEERPFSRDQRRWVYASAKLQNNYFGFGTDNDLEHSSGNVIVHHRT
FT                   FGRSYPTHGAVGQEARLPSAKILGGPRGRRRAFRPASVVNVSGMSFGSLSGNAVEAINR
FT                   GAAEAGCLHNTGEGAVSPYHRQGADLVFQIGTAYFGCRDDDGRFSLPRLKDLVESAPVR
FT                   ALEIKLSQGAKPGLGGVLPAAKVSAEIAATRGVPAGLDCLSPSRHAEFDDVDSLLDFVE
FT                   LLADETGLPVGIKSAVGDLGFWRDLTEEMAKGQRGVDFVTIDGGEGGTGASPLIFTDAV
FT                   SLPFRLGFARVYAEFARRGLHEDVTFIGSGKLGLPDNAVVAFALGADLVNVAREAMLAV
FT                   GCIQAQKCHTGECPTGVATQNPWLAHGLDPVEKSGRVANYVRTLRRDLLKVAETCGVEH
FT                   PGLIGPHDVEILDNLSDGRLLDEVYGYDPGWGFPSARDRQEIAAIMSATEEPETRTEGP
FT                   PETAEEGAPGTEHAGDEEPSGD"
FT   sig_peptide     complement(301265..301321)
FT                   /locus_tag="Noca_0279"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.686 at
FT                   residue 19"
FT   gene            301391..302623
FT                   /locus_tag="Noca_0280"
FT   CDS_pept        301391..302623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0280"
FT                   /product="(S)-2-hydroxy-acid oxidase"
FT                   /EC_number="1.1.3.15"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: nfa:nfa32960 putative L-lactate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79825"
FT                   /db_xref="GOA:A1SDE0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE0"
FT                   /protein_id="ABL79825.1"
FT                   /translation="MKRQLPRRRDLAPLVRFRTPVLSPRGRRLRDALTIEDLRRAARRR
FT                   TPRAAFDYTDGAADDEISLARARQAFRDVQFNPGVLRDVSSVDTSREVLGARASLPFGI
FT                   APTGFTRLMHTEGEVAGATAAAAAGIPFALSTMGTTSIEDVAAAAPSGRHWFQLYMWKD
FT                   RDRSMALVERAARAGFDALLVTVDVPVAGARLRDVRNGMTIPPTLTPRTVLDAIPRMRW
FT                   WFDLLTTEPLAFATLDSWSGTVAELLDTMFDPTVTFEDLAWIKEQWPGRLVVKGIQTVD
FT                   DARRVADLGADAVLLSNHGGRQLDRAPIPFRLLPEVVAAVGQDVEVHLDTGIMSGQDIV
FT                   AALAHGARFTLVGRAYLYGLMAGGRDGVDRAVEILRSQVERTMRLLGVRSLGDLEPGHV
FT                   TQLDRLEPRRR"
FT   gene            302655..303251
FT                   /locus_tag="Noca_0281"
FT   CDS_pept        302655..303251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0281"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79826"
FT                   /db_xref="GOA:A1SDE1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE1"
FT                   /protein_id="ABL79826.1"
FT                   /translation="MNRYAAALVVALSALVAPPAHAASAHATSAAQEAWSPRPEIYPAT
FT                   VTRTDLAVPMSDGVVLRGDLVLPAGADGRAVRGRFPVIVTITAYNKTALSSGGGVAGAP
FT                   PAYLVQRGYAQLTVDARGTGSSEGQWSAFGARENEDSAEVVEWAHSRKRPWSDGRVGMS
FT                   GPITARLYTSSVSGDGMLSVSVSDVAPDGTVSRLS"
FT   sig_peptide     302655..302723
FT                   /locus_tag="Noca_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.823 at
FT                   residue 23"
FT   gene            303375..303464
FT                   /locus_tag="Noca_R0007"
FT                   /note="tRNA-Ser2"
FT   tRNA            303375..303464
FT                   /locus_tag="Noca_R0007"
FT                   /product="tRNA-Ser"
FT   gene            303599..304468
FT                   /locus_tag="Noca_0282"
FT   CDS_pept        303599..304468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sye:Syncc9902_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79827"
FT                   /db_xref="GOA:A1SDE2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE2"
FT                   /protein_id="ABL79827.1"
FT                   /translation="MTRIPLEEAPRIPINVAIAGVQKAGTSSLFDLLRKHPEVCAGPRK
FT                   EWHFFDDEKRSWADPDYSDYWAPGRTDRQRIAIDGTPAYTFWPHAMERMHAYRPDMRLI
FT                   VSLRDPIERAFSHWAMYYGKLPAFPSFSQLAQGPRREGLLERIPEGWNHLRMRRWSMIP
FT                   RGLYGAQVARGLELFSREQWLFLDFHRFVGEHRETLDRVTSFLGLDPYPKEPRLRVIQS
FT                   TRQDLVAAAPTAADVSRLVEVYADDLDLLTRLTGLDVSDWPTRRVRDGLLDPADLADRL
FT                   GRKAGLLG"
FT   gene            304562..304891
FT                   /locus_tag="Noca_0283"
FT   CDS_pept        304562..304891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro00038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79828"
FT                   /db_xref="InterPro:IPR015057"
FT                   /db_xref="InterPro:IPR038070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE3"
FT                   /protein_id="ABL79828.1"
FT                   /translation="MVSWDGDAVAALDRAGRGGAMHTKTWSVEIFIGEHDGQTRAEARL
FT                   ATEPSATRLTGWGIARLNPADPEVPEIGDELATARALADLAHQLLETAAVDIGAVTSKP
FT                   VHLTH"
FT   gene            complement(304960..305166)
FT                   /locus_tag="Noca_0284"
FT   CDS_pept        complement(304960..305166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0284"
FT                   /product="putative signal-transduction protein with CBS
FT                   domains"
FT                   /note="KEGG: fra:Francci3_4502 putative signal-transduction
FT                   protein with CBS domains"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79829"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE4"
FT                   /protein_id="ABL79829.1"
FT                   /translation="MHATKGDHLVIHGTHVGEPLRDGEIVEVRGPDGAPPYVVRWADNG
FT                   HESLTYPGPDAEVHHLHHKGEGG"
FT   gene            complement(305359..305565)
FT                   /locus_tag="Noca_0285"
FT   CDS_pept        complement(305359..305565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0285"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: sco:SCO0174 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79830"
FT                   /db_xref="GOA:A1SDE5"
FT                   /db_xref="InterPro:IPR015035"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE5"
FT                   /protein_id="ABL79830.1"
FT                   /translation="MYAIKGDRLLVQGIRAGEPLRDGEIIAVHGDQGAPPYLVRWTDDG
FT                   HVSLTYPGPDAWIQHFVHAPGRD"
FT   gene            305919..306359
FT                   /locus_tag="Noca_0286"
FT   CDS_pept        305919..306359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79831"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE6"
FT                   /protein_id="ABL79831.1"
FT                   /translation="MRPALLALLAALLALAVAPYPQPSAAASCVAPYLVEDGQLVLQRG
FT                   VRTEVEGEAFVDGCRDTMSCSAGPGCEDCHYNDPEPVPYDDVVLRLRQGGHTWVLGSAD
FT                   ADRAEDGLAGRVSWQVDLPAGVRPGPARLLADHAHPVVVRIR"
FT   sig_peptide     305919..305999
FT                   /locus_tag="Noca_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.580 at
FT                   residue 27"
FT   gene            306377..306943
FT                   /locus_tag="Noca_0287"
FT   CDS_pept        306377..306943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0287"
FT                   /product="putative siderophore-binding protein"
FT                   /note="KEGG: mbo:Mb3555c possible siderophore-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79832"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE7"
FT                   /protein_id="ABL79832.1"
FT                   /translation="MAPMVCFEFEGKQPTVHPEAFVAPTATLIGDVTVERGASVWYGAV
FT                   LRADICTIVVREGANVQDNSVLHAAPGETLVIGRDATIGHGCVVHCREVGEQALVGNGS
FT                   TLLDRAVVGPRTLVAAGSVVTPGTELPGGMVAAGVPARPTKPIEGTSSEFWVEQNPPYY
FT                   RELAQRHLAGVAVVEPEPVVREVES"
FT   gene            306940..307707
FT                   /locus_tag="Noca_0288"
FT   CDS_pept        306940..307707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0288"
FT                   /product="short chain enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   nfa:nfa50130 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79833"
FT                   /db_xref="GOA:A1SDE8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE8"
FT                   /protein_id="ABL79833.1"
FT                   /translation="MSVRVEVDGPVTTVVLDRPETRNAVDGPTAAALAAAFRAFDEDDT
FT                   QSVAVLHGEGGTFCAGADLKSIGTERGNQVAEPIDAADGPMGPTRMRLSKPVIAAIEGY
FT                   AVAGGLELALWCDLRVAADDAVLGVFCRRWGVPLVDGGTVRLPRLIGTSRALDLILTGR
FT                   AVGAEEAERIGLVNRVVPAGRARAEAEALARSLAVLPQECLRQDRLSVLDQEGRTEAEA
FT                   LAGELRHGLVSLAADALGGAARFAAGEGRHGRF"
FT   gene            complement(307692..308072)
FT                   /locus_tag="Noca_0289"
FT   CDS_pept        complement(307692..308072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79834"
FT                   /db_xref="GOA:A1SDE9"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDE9"
FT                   /protein_id="ABL79834.1"
FT                   /translation="MNERTTGRLQLTSRALSGLLVGGLLGVMLAVALVTRMEALGTGTQ
FT                   ESPEGASADPAREAIDRHHCSTRGFGTETIPSSALIRTGSGDLLLVSFDRGWEVHQDSD
FT                   SAAELVAVCLEDLPPGVTQKRP"
FT   sig_peptide     complement(307911..308072)
FT                   /locus_tag="Noca_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.664 at
FT                   residue 54"
FT   gene            complement(308206..308595)
FT                   /locus_tag="Noca_0290"
FT   CDS_pept        complement(308206..308595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79835"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF0"
FT                   /protein_id="ABL79835.1"
FT                   /translation="MPHRIPRRTRLALGAVKLTVVAATVVAGLSTPVTQAGAGYAGHRV
FT                   GEVADLPSPVARILAKHDCSTSGFADAAPASAVIRTATGRFRHVSFDEGWAVYTRRGAA
FT                   SLVAVCLDRAPEDREPTKAREPRPR"
FT   sig_peptide     complement(308479..308595)
FT                   /locus_tag="Noca_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.762 at
FT                   residue 39"
FT   gene            308745..309644
FT                   /locus_tag="Noca_0291"
FT   CDS_pept        308745..309644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0291"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_5"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: fal:FRAAL1932 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79836"
FT                   /db_xref="GOA:A1SDF1"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF1"
FT                   /protein_id="ABL79836.1"
FT                   /translation="MPQPNPWFATPADAAARLAGAGYLADPATATTTYLAGALEKPLLV
FT                   EGPAGVGKTELAKAVAGVTGSELVRLQCYEGLDEARALYEWNYKKQLLSIQAAAAISST
FT                   TATLTSARDLLNHEIFSEEFLLTRPLLTAIRREEPTVLLIDEVDKTDVEVEGLLLEVLS
FT                   DFQVTIPELGTVRAVRRPFVVLTSNATRELSEAVKRRCLYLHLDYPDAEREREIVGSQV
FT                   PDLDGRIAAQLVAMIGRLRDLDLKKAPSIAESVDWARTLVALEIGDLDDKVVDDTLGVV
FT                   LKHASDQERAVKELRLRK"
FT   gene            309655..311022
FT                   /locus_tag="Noca_0292"
FT   CDS_pept        309655..311022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0292"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; KEGG:
FT                   fal:FRAAL1933 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79837"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF2"
FT                   /protein_id="ABL79837.1"
FT                   /translation="MSLVDRHIAFLESLRGAGMSVSLAEDLDALRALRALDWDDRATVR
FT                   AGYAATLVKKQSQRPTFDALFDVYFPRMVGAGAAAGDLEDPDTGVRDNADALARFREQL
FT                   AEAMATGDRQAMVALAAEMVARFGAMPGRGPGLSSWSAYTALQRVAPGELVDRIVQALL
FT                   AEGLSEDEARREAGRRLGSFTTLVEGDARRRIAEEKGPEHVANVAVRPTIDRLDFTAAR
FT                   KADLEEMRREIYPLARRLATRLTQEHHARRRGPLDFRRTMRAAMSTGGVPLVTHHRPKR
FT                   PHRTELVVLCDVSGSVANFAQFTLLLVYALQDQFGSVRAFTFIDHVHEVTGHFKPGADP
FT                   AEVMADLAASTAHAALWGRTNYGRAFAKFEEQHADALGPKSALLILGDARSNYSDLHLD
FT                   VLKRLAGSARHSWWLNPEHRRHWDTGDSAATRYGAVVPMVECRNLTQLGEFVHDIL"
FT   gene            complement(311035..312474)
FT                   /locus_tag="Noca_0293"
FT   CDS_pept        complement(311035..312474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0293"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: blo:BL1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79838"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF3"
FT                   /protein_id="ABL79838.1"
FT                   /translation="MSADITSVTGGSTGLAATYAAVRALADAYDEAGSRLRGWAALGAE
FT                   TMTNPDLAESAVLAPLTFAEAEAAVLAATTGPDGVLVESLGWEADALAVRAVVTALEAT
FT                   DALVRTAVDELDRAVGRTVGFTLGATAPALVPVLAATLPLVPPAVRRELEDRLEQWVVD
FT                   HPGVVQHAANGGGGLLEGLWDGVTPLAPGGLLGVPLLAPDTEAGAGLLALLYGPEGHAG
FT                   VSEVHPQVCTDPSQPTDLEGLVAHLAAVAGLSPEPDSPLNGTIEIQTLDAGTDGVRHIV
FT                   YLPGTDDLTTLPWTQDGDIRDGGTDLHSDAGHQTIYQQGILQAMAQAGIGPHDPVLLVG
FT                   HSLGGMEAAAILGHDSGFNVTNVVTAGAPTAQVDGFPAGSHVLSLEHHGDLVPAGDGAP
FT                   NPDTVEQTTVTFEDDPTGIVDAHGYGHYLAGAAAVDDATDPSVQEQLASLHAHGFLGDA
FT                   GGAGGPAAIVTSHVFQIVRQP"
FT   sig_peptide     complement(312394..312474)
FT                   /locus_tag="Noca_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.655 at
FT                   residue 27"
FT   gene            complement(312521..312925)
FT                   /locus_tag="Noca_0294"
FT   CDS_pept        complement(312521..312925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79839"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF4"
FT                   /protein_id="ABL79839.1"
FT                   /translation="MYGDTGTIRALAARLRERADEIRAEAARLLARAEQVPWEGLAAEA
FT                   MRGHARDRVAALARTAALHEDAADALDRHAREVDRVKDLIAAIERKVRGLLSGLKDRLV
FT                   PDALDGVLHRFVPPLPGSRDWLDVDLPGLG"
FT   gene            complement(312991..314172)
FT                   /locus_tag="Noca_0295"
FT   CDS_pept        complement(312991..314172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0295"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmc:Mmcs_4698 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79840"
FT                   /db_xref="GOA:A1SDF5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF5"
FT                   /protein_id="ABL79840.1"
FT                   /translation="MTDRFQVASRANVPPFHVMDLLAASAERQRTHGDVLNLLAGQPMT
FT                   GAPAPVREEAKRLLDSGDPLGYTPAAGIRELREAIAGHHRRAHGIEVDPDHVVVTTGSS
FT                   GGFLLAFLAAFEVGDRVAMARPGYPCYRNVLTALGCEVVEIPTGPETRFQPTVEQLDGL
FT                   ADIRGLVVASPANPTGTMLLPSELAALAAYCEERGIQLISDEIYHGIEYAPLSGAEPLA
FT                   RSAWETSREAVVFSSFSKYFSMTGWRIGWMLAPDRLRRAVDVLTGNFTICPPVIAQRAC
FT                   LAAFDDASYAELDGHVARYAENRRILLDGLPKLGITELAPADGAFYVYADVGHLTDDTM
FT                   RFARDLLARTGVAVAPGVDFDTVVGPRFVRLSFAGPGADIELALERLSTVLDR"
FT   gene            complement(314330..315811)
FT                   /locus_tag="Noca_0296"
FT   CDS_pept        complement(314330..315811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0296"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mbo:Mb1848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79841"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF6"
FT                   /protein_id="ABL79841.1"
FT                   /translation="MGRGTDIPAVLPAELLADAPSYDVVVVGFGIAGGCAALEAARAGA
FT                   RVLLLERAAVHGGTSSLSGGHFYLGGGTAVQVATGHDDTPEEMYKYLVAVSKEPEHDKI
FT                   RAYCEGSVEHFDWLEALGFEFERTYYPEKAVIQPGTEGLMYTGNEKVWPYREQARPAPR
FT                   GHKVPVPGDTEGTRMVMDLLHERVEEAGVEVRYETGATNLVADGSGTVRGLAWRSFEET
FT                   GYVAAAGVVIAAGGFVMNPDMVAAHTPRLAEKPFTLGSTYDDGLGIRLGASAGAELKHM
FT                   DEPFITAPFYPPSALVTGFLVNKLGERFCAEDSYHSRTSQFVMEQPDSTAYLIVDSEHV
FT                   EYPKFPLVPLIDGFETISELEDALELPAGSVAKTLERYNELAEAGEDADFHKAPEWLAP
FT                   QGAGPWAVFDLRLGHAMYAGFTLGGLRVSVDGEVERPDGSVIPGLYAAGACASNIAQDG
FT                   KGYCSGTQLGEGSFFGRRSGRAAAASASAASTGSG"
FT   gene            316135..316833
FT                   /locus_tag="Noca_0297"
FT   CDS_pept        316135..316833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0297"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: fal:FRAAL5492
FT                   hypothetical protein; putative thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79842"
FT                   /db_xref="GOA:A1SDF7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF7"
FT                   /protein_id="ABL79842.1"
FT                   /translation="MRDVDGAELSFDAWSGHKRVLVVWASWCGCRYELGGWQRLQAELA
FT                   DAGLRLFSVALDADPEDARPWIEAAAPTYPVGVDTAHVTAERYGITNVPSVVWVDERDR
FT                   IVKPPTIAPGDDRFVEFTRIESARHHDLLRAWVREGVLPEPAESAPERSDAEQLALAHR
FT                   RIAAHHQRSGRTGAAQAQLARAQELAPWDWTVRRGGIAMTGGDPFLGPEFTAFWEVWDA
FT                   AGRPGYTPTG"
FT   gene            316905..318422
FT                   /locus_tag="Noca_0298"
FT   CDS_pept        316905..318422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0298"
FT                   /product="potassium/proton antiporter, CPA1 family"
FT                   /note="PFAM: TrkA-C domain protein; sodium/hydrogen
FT                   exchanger; KEGG: sco:SCO3185 putative Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79843"
FT                   /db_xref="GOA:A1SDF8"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR030151"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF8"
FT                   /protein_id="ABL79843.1"
FT                   /translation="MSFDVHDLDTFILVGSAVTLLAILAVRVSTGAGLPSLLIYLLMGA
FT                   ALGESGVGIQFENYEVAHAVGFAALAMILAEGGLTTNWPEMRGCIRLGVSLATLGVAVS
FT                   VTVVAVGAHYLLGMPWQLAVLLGAVTSPTDAAAVFSVLRVVPLPKRLTGTLEAESGLND
FT                   APTVVLVTLISSGAVEDNGALAMVGIVGYELAIGVALGLAAGYGGAWVMRRAALPSSGL
FT                   YPLAVMTLAFLGYGAAAFVHGSGFAAVYVAALVLGNSELPHRAATRSFAEGLAWLSQIG
FT                   LFVTLGLLLSPGRISLSTVGLAIVAGLVLTFVARPLSVLASAVVQPLPWRELSFVSWAG
FT                   LRGAVPIVLTTIPLAEGVDDAERLFDLVFVMVVLYTVLTGPTLPLVARVLRVARRSEPR
FT                   GLEVEAAPLERIAADLLQVSIAPGSRMHGVEVGELRLPRGASVSMVIRDGNTLVPERRT
FT                   VLRQGDDLLVVTPRKLRWQTEERLRQVSARGRLAQWLVEKPARRPQP"
FT   gene            complement(318446..318946)
FT                   /locus_tag="Noca_0299"
FT   CDS_pept        complement(318446..318946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0299"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pac:PPA2178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79844"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDF9"
FT                   /protein_id="ABL79844.1"
FT                   /translation="MPQGARSAITISALGLLLVVAALWGWSAATDPLPAKVDTPICVDR
FT                   TVAAGTKVFAQDVTVSVYNAGTREGLAGRTMQLLTDDGFAEGNSGNVSARVEVVQIWTL
FT                   DPTNPAVQLVASRLGPDVEIERRDGPGAGISIVVGDGFQDLVEGRRSVQAEDDATICSP
FT                   PVG"
FT   sig_peptide     complement(318839..318946)
FT                   /locus_tag="Noca_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.302 at
FT                   residue 36"
FT   gene            complement(318946..319242)
FT                   /locus_tag="Noca_0300"
FT   CDS_pept        complement(318946..319242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fal:FRAAL0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79845"
FT                   /db_xref="InterPro:IPR014447"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG0"
FT                   /protein_id="ABL79845.1"
FT                   /translation="MIFKRVGDGRPYPDHGLSSRAWAAVPPRQVRLDQLVTTKDTLQLA
FT                   ALLDEDSTFYGDLFAHVVEWRGDLYLEDGLHRALRAALQQRNVLHARVHTLED"
FT   gene            complement(319285..319470)
FT                   /locus_tag="Noca_0301"
FT   CDS_pept        complement(319285..319470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79846"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG1"
FT                   /protein_id="ABL79846.1"
FT                   /translation="MDHPSTPDRDLEPDHDRDRDQRTRLRLRHAQRLTTLMEERRDLRG
FT                   VHALADYFDDAVRWSA"
FT   gene            319580..320071
FT                   /locus_tag="Noca_0302"
FT   CDS_pept        319580..320071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa48960 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79847"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG2"
FT                   /protein_id="ABL79847.1"
FT                   /translation="MAYQAAETGIRSSFVDDIDQICQLKYRYLRTLDTKRWDEFADCFL
FT                   PAATGDYDGLVFADRAALVAYLREHLGEGLLTLHQAHHPEIAVDGDTATGRWYLQDKVI
FT                   VPAFKFMLEGAAFYEDRYARTPDGWRVAHTGYRRTFEMTYDLADLPGLKINGPGEHTHV
FT                   "
FT   gene            complement(320191..324171)
FT                   /locus_tag="Noca_0303"
FT   CDS_pept        complement(320191..324171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0303"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5734 ATP/GTP binding protein (membrane
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79848"
FT                   /db_xref="GOA:A1SDG3"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG3"
FT                   /protein_id="ABL79848.1"
FT                   /translation="MSTTLRGTRLDAPELPTGQVVLQPPPRIEPNEGASGVLMNAIPML
FT                   GSLGSIVLVATMGRASGGRGFLAAGMFLFATLGFIVVQLDRQRKQRTQQVSGSRTEYLR
FT                   YLANVRKVAREAADQQRRALTWQHPDPSALPALADERSRVWEHTTSDPTFLHVRYGVCA
FT                   QPLSLELVPPESTPIDQVDPAAASALHRLLVVHRLQPDLPASIDLRAFDRIEVCGPEEP
FT                   ARSLARSLICSATVFHSPDQLAVAVLTSEQHLARWDWLKWLPHAQSGRLSDAVGPMRMV
FT                   STSLADLAALLPADLGERPRFGADERPATPHLLLVVDDGELPPGNHVVPPDGLHGVTLL
FT                   DLPARWDDLEDATRLRLQLTAEPADDGRHPVLALRLREQPIRARADQCSIATAEALARR
FT                   LTPLHTIAAGGVEPGTGEIAGTADYLELLALGDVHTLDPATAWRPRPARDRLRVPIGLG
FT                   EGGSVVHLDIKESAQQGMGPHGLVIGATGSGKSEFLRTLVLGLALTHSPEQLNMVLVDF
FT                   KGGATFAGMADLPHVSAVITNLAQELTLVDRMQDALSGEMVRRQELLREAGNYASVRDY
FT                   ERARVAGEDLVPLPSLFIVVDEFSEMLSAKPEFIDLFVAIGRLGRSLGLHLLLASQRLE
FT                   EGRLRGLESHLSYRIGLRTFSAGESRTVLGVPDAYELPADPGLGYLKPDPATMLRFKAA
FT                   YVSGPPSGRVRVRRDEGGHLRGILPFTIAEVQALDVADPEPEPVAVEQPGDQESLLDLA
FT                   VRRMVGHGPAAHQVWLPPLDVPDTLDDLMPDLTEDPRHGLVSAHWRQLGGLIVPLGTAD
FT                   RPREQRRDTFTVDLGGSGGHAAVVGGPRSGKSTLLRTMVASISLTTTPQESQFFVLDFG
FT                   GGTFTPYADLPHVAGVGTRSEPDVVRRIVAEVRGVVDRREAYFRAHGIDSIETYRSRRA
FT                   AGRADDGYGDVFLVVDGWSTLRADFDDLELELQQLATRGLTFGLHLLVGAARWADFRAA
FT                   VRDLFGTRLELRLGDPMDSEIDRKVAALVPAGRPGRGLTASRLHFLAALPRVDGSADVE
FT                   ALGDGVDHLVKRVAAAWAGPTGPKLRLLPERIGLDDVRTLARPAAEDRRLLLGVTESDL
FT                   GPVALDGDAEPHLLVFGDGRSGKSALLRAYAREVMRTRTPQQAQLVVVDYRRSLLGEVP
FT                   EEYLVDYLTSARLAQPALQDLASYLESRIPGPDVTPDQLRNRSWWTGAEVFVLVDDYDL
FT                   VATQQGSPVQALQPLLPQARDLGLHLVVARRSGGASRALYEPVIQSLRDLAMPGLLLSG
FT                   SPDEGPLLGTHKPQPAPPGRGRLVTRDRGAEVVQLAWCEPSL"
FT   gene            324276..325691
FT                   /locus_tag="Noca_0304"
FT   CDS_pept        324276..325691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79849"
FT                   /db_xref="GOA:A1SDG4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG4"
FT                   /protein_id="ABL79849.1"
FT                   /translation="MAGTHAPADILALSVHGPVGVLDLVVPGTATAADVAEEYAVRAGL
FT                   DAAPVLRSRLGHGLEPATTLARAGVVTGDLLVADPSAPGVPADRAAEPVAGGRHAARSG
FT                   PAADGSPRPRPDTLPMLGLAVAAAAAGLAGWCAATAPGGALRATAIGLLLVAAVLGVLP
FT                   IGRRAAHRVVAAPAFGAAAAFAMAWDPHGVRLPMVLGVTGLAAALVAAVGRALAARPGE
FT                   ALRVWVLAGVAGFVGTGLASLGGAPPRLVWSLVLLGALLAARFVPAVAVDVPDQYLIDL
FT                   DRLAVTAWSAREQPSGRRGRTVVPLDAVDAVAARGTRIVTAASAAVLAAVLLSAPLLLA
FT                   AATLPIDRVGARVLVGCAGAGLLLAARSYRHAAARALLRIAGLACGTVLATALLGAAGR
FT                   AGWWLAGLAVLTAAALVVAAVAVGRGWRSAWWSRRAEVAEGLAGATAVGALVVASGWFR
FT                   QLWELASLWKLGA"
FT   gene            325817..326134
FT                   /locus_tag="Noca_0305"
FT   CDS_pept        325817..326134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79850"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG5"
FT                   /protein_id="ABL79850.1"
FT                   /translation="MSQAPEMGQGERTLTRAAGLVADAKADFDGLSKSLEQQILAQQGK
FT                   WVGAGGSAFFTLHQAWTDRQRIITNALNEFEASLTSTERDNMSTDETQSSSYHRVAGRL
FT                   G"
FT   gene            326167..326463
FT                   /locus_tag="Noca_0306"
FT   CDS_pept        326167..326463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0306"
FT                   /product="protein of unknown function DUF909"
FT                   /note="PFAM: protein of unknown function DUF909; KEGG:
FT                   cgb:cg0672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79851"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG6"
FT                   /protein_id="ABL79851.1"
FT                   /translation="MTLDGLRVNHAGLDTVADDLGQAVKRIDDRLNRLESELAPLRSDW
FT                   SGSAQQAYTAAKAKWDGAMQEMKGLLQETSSTVVQSNAEYRAADQRGAASFDI"
FT   gene            326594..327949
FT                   /locus_tag="Noca_0307"
FT   CDS_pept        326594..327949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0307"
FT                   /product="CD9/CD37/CD63 antigen"
FT                   /note="TIGRFAM: CD9/CD37/CD63 antigen; KEGG: sma:SAV2527
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79852"
FT                   /db_xref="GOA:A1SDG7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG7"
FT                   /protein_id="ABL79852.1"
FT                   /translation="MTQATAGRSGLVRVTVASGARRVDLVLPGAVPVAELVPELARSVG
FT                   LLDPATVYAGYRLVTAEGRRLAGDAGLVIQGVEDGGLLTVAAGVDDEPPRVYDDVVEAM
FT                   TDVVEHDLRPWEPASGRRTALVAAGLLMALGAVALLIQRGSLLAGATAVVVAVTLTAAA
FT                   VVLSRAQREAEAGVAVAWMATGYAAVAGLLLVTEDDPFFGLPVAAAGGAVLLTGLAGLV
FT                   GLGAGRALAIPPVVVGAVFLATGLVMRAAEFDPAAVLTSTLVLVVLAGSVLPWLALAVT
FT                   GTSVDPMYTVADVTAEPRPIDPARVAADARVAHEILVAVSATVGLLLVVVAPLAVSLGV
FT                   AGTVLAVLCCLVVMLRTRQYRTGSEVLVGLVSGVVGLLAVAASMLWLHPDWRPTAAVVL
FT                   AATGAALLALTMLPAPPSVRRGRLGDLAETVALLGLLPLLVLATGLFDAIRS"
FT   gene            327960..329408
FT                   /locus_tag="Noca_0308"
FT   CDS_pept        327960..329408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0308"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79853"
FT                   /db_xref="GOA:A1SDG8"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG8"
FT                   /protein_id="ABL79853.1"
FT                   /translation="MATKKDLVEAYSFSRRRLVTAFVSGAPGGREVEPSRPGRTIIGGL
FT                   ALAVLLAAGAAIAGVLSPRTPDDWASNGLIVSKETGQAYVVLPAADGSAPEPDAPVELR
FT                   PVINITSARLILGADVEPMLISQDTIDDQRVGDDIGILGAPASLPAPGLLVETGWTACT
FT                   ADDRGMRVRVAVDPDVLPAPDAAQVVEVGGSFYLVASAQVGGDAAAAYALRLPGGDTVD
FT                   NLLGALDLPARVFAPTVPRGWLDLFPAGAALGWESFGLAGVGGRPDGWDAAQVPGRARV
FT                   GDVLRDATGDAVVLTADGPAELDPFALAVYSNTPIPGGGTPRVLPVDRFPDLARTRLPG
FT                   PDRHWPTTTVEPTETDPCAVLTTAGEEPAVVQLAQRPGPGYDARDVVPGHADVTVDPGR
FT                   GAYVRSASPEGARAPQPVAIDAKGRANPLDGDETAGLLGYADFPAPVVPDTWVKLFGAG
FT                   VPLSQNLALCPPAAAGAQDGPSCA"
FT   gene            329399..330673
FT                   /locus_tag="Noca_0309"
FT   CDS_pept        329399..330673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0309"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0380 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79854"
FT                   /db_xref="GOA:A1SDG9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDG9"
FT                   /protein_id="ABL79854.1"
FT                   /translation="MRVTAAAVGTAVVVAVLGSAPAAPAAPAAAAAVPPSCADFQPEMP
FT                   VEQYDGASEPLRLLGVEKAQHVLAGPGRPGAGVAVAVLDSGVRRGPGMDVVAGPNLAGL
FT                   DELVDWHGTAVAGIIAGAPLPDGSPVGIAPGARIVDVRVYDSRDPQSDRGEQPVTPASV
FT                   AAGLDWVARFARDRGIGVANVSAAVPASPALAAAVRRAWRAGVVVVAATGNRPEEGGFL
FT                   FPELGGEERRPGEDAAGEVFPAGYPHVVGVNATRTGEPSGSPVTDFVLPSSDTDVAAPT
FT                   YGALSVAVNGATCVIPEVATSWSAAEVSGVLALLRSHYPRDRPAQAVARLLNTANGTTA
FT                   APTRLTGVGVVQPYQALTRPLEPRPDGAVELTTVEHDAVRAAAPERPADLLADTRRDVV
FT                   WWGLIGAGGLVVALVLRPVLARRRT"
FT   sig_peptide     329399..329494
FT                   /locus_tag="Noca_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.549 at
FT                   residue 32"
FT   gene            complement(330706..332175)
FT                   /locus_tag="Noca_0310"
FT   CDS_pept        complement(330706..332175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0310"
FT                   /product="multicopper oxidase, type 3"
FT                   /note="PFAM: multicopper oxidase, type 1; multicopper
FT                   oxidase, type 2; multicopper oxidase, type 3; KEGG:
FT                   nfa:pnf1230 putative multicopper oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79855"
FT                   /db_xref="GOA:A1SDH0"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH0"
FT                   /protein_id="ABL79855.1"
FT                   /translation="MRGTAALGGATALAGLASCSRSGGTAVGPTAPAVTAAEDARRRAG
FT                   GQLVTARLTPRPVTLDLGGRAVDTWAYGDAVPGPLLRARAGDLLRVEVDNQLPVDTSVH
FT                   WHGIALRNDMDGVPGVTQDPIGAAATFRYEFTVPDPGTYFYHPHSGVQLDRGLYGVLLV
FT                   DGPDEEDADQEWVVVLDDWVDGTGRTPDQVLESLRAGGGGGHGSMAGMDHGSMMGGGGG
FT                   MQSRLLGGSGDVRYPLYLVNGRTADDPATLRGRPGQKVRIRVVNAGSDTAFRVAVGGHR
FT                   LTVTHSDGFPVTPVSTDALLIGMGERFDVTVTLGDGVFALVAVAEGKNGGGLAVVRTGA
FT                   GTTPGPDAWARHRGQPALLGADLTPTESVRLPDRAVDRRHDLVLAGTMASYRWSINGRM
FT                   FPDDEPLPVAEGERVRLRFVNRSMMFHPMHVHGHTFALATGGARKDTVIVRPMEALEVD
FT                   LDADNPGQWAAHCHNIYHAESGMMTTLSYRA"
FT   sig_peptide     complement(332065..332175)
FT                   /locus_tag="Noca_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.848 at
FT                   residue 37"
FT   gene            complement(332277..332474)
FT                   /pseudo
FT                   /locus_tag="Noca_0311"
FT   gene            332756..333457
FT                   /locus_tag="Noca_0312"
FT   CDS_pept        332756..333457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0312"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rha:RHA1_ro11203 response
FT                   regulator, two-component system"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79856"
FT                   /db_xref="GOA:A1SDH1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH1"
FT                   /protein_id="ABL79856.1"
FT                   /translation="MSGRRALVVEDEPELARLVGSYLERDGFAVTIVHDGLEAVARSRE
FT                   VDPDVVVLDLGLPGLDGVEVCRRLRTFSDGYVVMLTARSDEVDTLIGLSVGADDYLTKP
FT                   FSPRELVARVQAMLRRPRPLGHMDADAGEALSFGDLTIELAGRDVWLEDRAVPLTRTEF
FT                   DLLATLAQRPGMAFSRRQLIDAVWGPAWVGDEHLVDVHVGHLRHKLGDSAAEGRYVRTV
FT                   RGIGYRMGRGA"
FT   gene            333454..334545
FT                   /locus_tag="Noca_0313"
FT   CDS_pept        333454..334545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0313"
FT                   /product="ATP-binding region, ATPase domain protein"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: rha:RHA1_ro11204 histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79857"
FT                   /db_xref="GOA:A1SDH2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH2"
FT                   /protein_id="ABL79857.1"
FT                   /translation="MTRPRFAARLLVAQALVLLAGALTTWLVASVVGPGIFHDHLEQAG
FT                   VAHTASETEHVEDAFASALLISIALALVASVLAALAVSWYFSRRVQRSIGNVADAAAQI
FT                   AAGEYGARVRDPGLGGEFSTLATSYNRLASRLEATETTRRRMLADLAHEMRTPLATIEA
FT                   HLEAVEDGVRPLDADTLAVIGSATSRMRRLAEDVAAVSTAEEGSLQIEKRRVAALDLAR
FT                   TAADLVQDRFDAKGVRLHRELEDAGRLEVDPERIGQVLGNLLDNALRHTPTGGAVRLSC
FT                   RRIDSWVEYQVADTGEGVTAEHLPHLFDRFYRADAARDRAHGGSGIGLAIAKALVEGHG
FT                   GGIFATSEGRGRGATFTVRLPDR"
FT   sig_peptide     333454..333603
FT                   /locus_tag="Noca_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.364 at
FT                   residue 50"
FT   gene            334652..337108
FT                   /locus_tag="Noca_0314"
FT   CDS_pept        334652..337108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0314"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rha:RHA1_ro11210 probable
FT                   copper-exporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79858"
FT                   /db_xref="GOA:A1SDH3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH3"
FT                   /protein_id="ABL79858.1"
FT                   /translation="MATSAQHEHEHEHQHEHQHGAPHGAGTTTAVLEVSGVHWASSKSV
FT                   AEAVLSRQPGVLSVEANPVAQTATVTYDPRRTDLVRLRDWVRECGYHCAGRSVPRHVCD
FT                   PMAEPVPTEGHEGHEGHDGHRPEHDAMTHDATTQGGHAHGGHAHGGHAGMSMADMARDM
FT                   RNRFLVALVLSVPIALYSPMGRDMLGFDAATPFGLRDDVLALVLSLPVVLYSAWIFFDG
FT                   AWRALRARTLDMMVLVAVAVGAGWLYSLGVTLTGGGEVFYEAATMLTTFVLLGHWFEMR
FT                   ARGGANDAIRTLLDLAPPVAEVLRDGEVVTVPTAEVVIGDLLLVRPGSRIATDGLVEEG
FT                   ESEVDESMVTGESMPVAKGPGDAVIGATVNTTGTLRVRATKVGADTALAHIVALVQEAQ
FT                   NSKAPGQKLADRAAYWLVLVALVAGVGTFLTWLAVGRPVDEALLFAITVVVITCPDALG
FT                   LATPTAIMVGSGLGAKRGILFKNATAIESAARLDTVVMDKTGTLTRGEPEVTEVVLAPG
FT                   VDEHRLLALVGAVERESEHPLARAVVEHADHAGVPRLRATGFANVAGHGAVAEVDGHRV
FT                   VVGNRRLMDREGVALDVLAEQRETIASGGRTAILVAIDGAASAVVGLADAVRPTSAAAV
FT                   AALHEAGVQVVMLTGDNEATARRIADQLGIDDVIAEVLPEDKAAQVVALQRQGRRVAHV
FT                   GDGVNDAPALAAADVGIAIGAGTDVAIETADVVLMRSDPLDVPTALTIGRGTRRKELQS
FT                   LGWAIGYNAIALPVAAGVFEPALGLTLRPEVAAMTMSGSSILVAVNALLLKRLRLPEVG
FT                   RRHEHV"
FT   gene            337121..337762
FT                   /locus_tag="Noca_0315"
FT   CDS_pept        337121..337762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0315"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   nfa:nfa38100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79859"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH4"
FT                   /protein_id="ABL79859.1"
FT                   /translation="MIPHPARSRRGSPMGKTLTALVAALATMLVLSSCGGGENGDGEPA
FT                   AHTAADGQRFNDADVAFATDMVQHHAQALAMVDQTMGRDLGPRVERLAESIRAAQGPEI
FT                   ETMTGWLTDWDQPIPETVRDHANAHGGHVETDPDMPGMMSPEQMAELEAAPDAEFAQLF
FT                   LTMMIDHHEGAVEMARAEQRDGLHPDAVALAEQIESAQNREIATMQRMLS"
FT   sig_peptide     337121..337243
FT                   /locus_tag="Noca_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.530 at
FT                   residue 41"
FT   gene            complement(337850..339403)
FT                   /locus_tag="Noca_0316"
FT   CDS_pept        complement(337850..339403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0316"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   mpa:MAP2359c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79860"
FT                   /db_xref="GOA:A1SDH5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH5"
FT                   /protein_id="ABL79860.1"
FT                   /translation="MMMHPILQAATSSTELGFPWWLQVTHLVNFLFLGLLVRSGWEILA
FT                   SHPRLYWRNDCGPDTEWLKFTKDKVPSEIGAFTARDDQRDLHPLISLPGRAKIGIGRAW
FT                   HGLITTLWVLNGLIYVVLLFGTGQWRRLIPTSWSVFPEAWDSLKIYAGFGVPSIEHFQP
FT                   YDALQQLMYTFVVFVLAPLMIVTGPVMSPAVVGRYPWYPKLFGGRQAARSLHFLGMAFF
FT                   VVFAVMHVALVLLVHREHNLVHMMMGEEYDAALVGQAVTRVIVGVVVVVALWIAASYVS
FT                   LIDVRKSQRVLYGLQAPIKKLVLNPMTSRQRARQVFTEDDISPFHWVNTRPPDLSQSPE
FT                   WLALRDGGFRDFRLEVGGLVREPRSFSLDELREIAAQDQITMHTCMQGWTGIAKWSGIP
FT                   LREVLAQVEPLEGADYVMIESFGTAQHMHDGRPVEPYYTVLTKAMAMEDETILAWGMNG
FT                   APLPEMYGAPLRLRTESMHGYKMVKWVRSVSWIHDYKEVGDGMGGTREDSGYQDMDARI
FT                   "
FT   gene            complement(339643..339731)
FT                   /locus_tag="Noca_R0008"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(339643..339731)
FT                   /locus_tag="Noca_R0008"
FT                   /product="tRNA-Ser"
FT   gene            339855..339945
FT                   /gene="ffs"
FT                   /locus_tag="Noca_R0009"
FT   ncRNA           339855..339945
FT                   /gene="ffs"
FT                   /locus_tag="Noca_R0009"
FT                   /product="SRP RNA; RNA component of signal recognition
FT                   particle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            340151..342187
FT                   /locus_tag="Noca_0317"
FT   CDS_pept        340151..342187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0317"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sco:SCO4067 DNA polymerase III subunit gamma;
FT                   TIGRFAM: DNA polymerase III, subunits gamma and tau; PFAM:
FT                   AAA ATPase, central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79861"
FT                   /db_xref="GOA:A1SDH6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH6"
FT                   /protein_id="ABL79861.1"
FT                   /translation="MESPLALYRRYRPETFAEVIGQAHVTEPLRVALANNRVNHAYLFS
FT                   GPRGCGKTTSARILARALNCDQAPVADPCGECESCRDLARGGPGSIDVIEIDAASHGGV
FT                   DDARDLREKAFFAPVRSKYKVYIIDEAHMVTTQGFNALLKLVEEPPPHLRFIFATTEPD
FT                   KVLPTIRSRTHHYPFRLIPPRLLSSYLSELCAKEGVAIDPAALPLVVRAGGGSARDTLS
FT                   VLDQLLGGAGPAGVTHELAAGLLGYTPDTLLDEVVDAFAAGDGAAVFRVVDKVVETGQD
FT                   PRRFTEDLLRRLRDLVIVAAVPDAPATGLIDVSEDQGERLVAQAARFGAAELSRAADIA
FT                   ATGLTEMRGATAPRLLLELLCARILLPGADHATDGVLARLDRLEKRLTITGVPTPTAAA
FT                   PAPPAQDRPTPPPARPAAPDPAAERPDPVAAPPPAAPPAPQAPPVSAPTAEPEPAAEPP
FT                   MAEPPVAEQTSAEPAEPPPASAPAGAAGGLTLVDVRRLWPDIVDATKLRRRVAWMHLTQ
FT                   NCQVVGVDGQTLTLGFTNAGARDSFVNGGCDEVLRQAAIDVVGADWRIETIIDPGARAD
FT                   VPVVTTPAVPAADPAPAPEAGPPAEEAPQPRRTSDPESIAAAREAIQQTRAGDEPRPEG
FT                   PDWAAADADAHPDDLDADQQGMSTAELLQRELGAQMIEEIRHQ"
FT   gene            342243..342617
FT                   /locus_tag="Noca_0318"
FT   CDS_pept        342243..342617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0318"
FT                   /product="conserved hypothetical protein 103"
FT                   /note="PFAM: conserved hypothetical protein 103; KEGG:
FT                   rha:RHA1_ro04210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79862"
FT                   /db_xref="GOA:A1SDH7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDH7"
FT                   /protein_id="ABL79862.1"
FT                   /translation="MSQNPFEALGGGGFDMNALLQQAQQMQEQLQSAQERLTETVVDGT
FT                   VAGGAVTVKVNGVGELVGVEIRAGGFDGSDPDDLSDLGDMIIAAYRDAKAQADALAGEA
FT                   LGPLAGGAEGLPGMPGQLGF"
FT   gene            342619..343218
FT                   /locus_tag="Noca_0319"
FT   CDS_pept        342619..343218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0319"
FT                   /product="DNA replication and repair protein RecR"
FT                   /note="KEGG: sco:SCO3618 putative recomination protein;
FT                   TIGRFAM: recombination protein RecR; PFAM: RecR protein;
FT                   TOPRIM domain protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79863"
FT                   /db_xref="GOA:A1SDH8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDH8"
FT                   /protein_id="ABL79863.1"
FT                   /translation="MYEGVVQDLIDELGRLPGVGPKGAQRIAFHLLQADPADVRRLADV
FT                   LLEVKAKVKFCSICFNVSQDDQCRICRDPRRDPSVLCVVEEYKDVVAIERTREFRGRYH
FT                   VLGGAISPIDGVGPEQLRIRELMVRLADGTITEVILATDPNLEGEATATYLTRMLKPLE
FT                   LRVTRLASGLPVGGDLEYADEVTLGRAFAGRRSADD"
FT   gene            343211..343804
FT                   /locus_tag="Noca_0320"
FT   CDS_pept        343211..343804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79864"
FT                   /db_xref="InterPro:IPR032025"
FT                   /db_xref="InterPro:IPR038312"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDH9"
FT                   /protein_id="ABL79864.1"
FT                   /translation="MTETTIDHETEEFAQQIADQVESFLIALQAIAREADGGRAISLLL
FT                   LEISQVLLAGARLGAQRDFKPEGEYQPDVGPEPDLDEMRLRLASMLDSVDTYSFVFDPY
FT                   VPDVVESQLSDDLTSIATDLENGLRHYRLGNVDEALWWWQFSYVASWGNLAGAALNALL
FT                   SIVAHDRLDAEFTGEDEQLALADEMLEGGEPTAR"
FT   gene            343857..345131
FT                   /locus_tag="Noca_0321"
FT   CDS_pept        343857..345131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0321"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tfu:Tfu_0043 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79865"
FT                   /db_xref="GOA:A1SDI0"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI0"
FT                   /protein_id="ABL79865.1"
FT                   /translation="MGIVVQKYGGSSVADAAGIKRVAQRIVNTRKAGHDVVVVVSAMGD
FT                   ETDNLRDLAEQVTPLPPPRELDMLLTAGERISMALVAMAIAALGHEAKSFTGSQAGVIT
FT                   DSAHGKAKIIDITPGRIEKALKDGAIAIVAGFQGVSQDTKDVTTLGRGASDTTAVALAA
FT                   ALGAEVCEIYSDVDGVFTADPRIVPAARKLARVSTEEMLEMAASGAKILHLRCVEYARR
FT                   YDMPIHVRSSFSQKEGTWVIPDSKAGEDEMEQAIIAGVAHDRSEAKITVVGVPDKVGEA
FT                   ARIFEALAATEVNLDMVVQNVSAAATGLTDISFTLPRADGQSAMGALARIQDEVGYDKL
FT                   LYDDQIGKVSLIGAGMRSHPGITARFFASLAAAGVNIEMISTSEIRISVIVDEAQVDEA
FT                   VRATHTAFDLDAEEVEAVVYGGTGR"
FT   gene            345259..346284
FT                   /locus_tag="Noca_0322"
FT   CDS_pept        345259..346284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0322"
FT                   /product="aspartate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: nfa:nfa3190 putative aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase, NAD -
FT                   binding; Semialdehyde dehydrogenase, dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79866"
FT                   /db_xref="GOA:A1SDI1"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI1"
FT                   /protein_id="ABL79866.1"
FT                   /translation="MLNIGVVGATGQVGVAMRQILEERGFPVGDVRFFASARSAGTVLP
FT                   FAGREVVVEDAATADPSGLDVALFSAGATTSRNLAPKFVDAGVIVVDNSSAFRKDPDIP
FT                   LVVAEVNPDAARPVLEAGHGIIANPNCTTMAFMPVLKPLHDEAELVRLIASSYQAVSGS
FT                   GVAGVEELATQVAAAGDKARELAYDGEAVTFPEPQKYARTIAYNVLPMAGSIVDDGLHE
FT                   TDEEQKLRNESRKILGIPDLRVSGTCVRVPVFTGHSLSLNVEFARPLSVDRALELLAGA
FT                   PGVEVTDIPNPLQAAGKDPSYVGRVRQDGEHGLALFVANDNLRKGAALNTVQIAELLVA
FT                   R"
FT   gene            complement(346350..347027)
FT                   /locus_tag="Noca_0323"
FT   CDS_pept        complement(346350..347027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79867"
FT                   /db_xref="GOA:A1SDI2"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI2"
FT                   /protein_id="ABL79867.1"
FT                   /translation="MADGEPEQDADQHTDRDQPSLELPRLGWRRRRRTQEAPEPQPEPH
FT                   AGQQAELHAGQQAGQAREGTRPLVEETAPRTVAAPVRAAEPAAEPEPEREPKVRRPGGL
FT                   PVVVLTGVVVGLGIVGLTWASLRLCESVQGTSSCGDAGYGLLIVILVVMVILGALLLRL
FT                   ARVPEPGSTSFLAVGLTSVLALVFLVDSLMDRPMVVVIPLISAATFTLAHWVTRTFTGP
FT                   AAG"
FT   gene            complement(347117..347193)
FT                   /locus_tag="Noca_R0010"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(347117..347193)
FT                   /locus_tag="Noca_R0010"
FT                   /product="tRNA-Pro"
FT   gene            complement(347295..348257)
FT                   /locus_tag="Noca_0324"
FT   CDS_pept        complement(347295..348257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0324"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: mmc:Mmcs_4826
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79868"
FT                   /db_xref="GOA:A1SDI3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI3"
FT                   /protein_id="ABL79868.1"
FT                   /translation="MTAIVPRARSLAQVTALGLIRSLSLAGSLLGGGLTAYALAEARAY
FT                   TLRRVTVPVLPPGSPDLRVLHLSDIHMTPGQTRKQAWLRGLADLDPDLVVNTGDNLSHH
FT                   ASVPVVLDSLGPLVDVPGVFVLGSNDYFSPTLRNPLRYLLPDDGTRHTDSAQLPWRDLR
FT                   EQLTDRGWLDLSNARTTLEVRGLRIGFAGVDDPHLGYDRLDLVAGPADPDADLRLGVAH
FT                   APYLRVLDRFAADGYDAILAGHTHGGQVCLPGIGALTTNCDLEPERVKGLHRHPASSAP
FT                   GDPGSAWLHVSAGLGTSPYARIRVACRPEATLLTLVARD"
FT   sig_peptide     complement(348141..348257)
FT                   /locus_tag="Noca_0324"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.904) with cleavage site probability 0.701 at
FT                   residue 39"
FT   gene            348333..348797
FT                   /locus_tag="Noca_0325"
FT   CDS_pept        348333..348797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0325"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG: tfu:Tfu_0108
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79869"
FT                   /db_xref="GOA:A1SDI4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI4"
FT                   /protein_id="ABL79869.1"
FT                   /translation="MSALKERLRADLTASMKARDEVRSSTLRMVLTAITNAEVAGKEHR
FT                   ELSDDDIIGVLSTEAKKRREAAAAFGEGGREEMAAKETAEAAVIADYLPAQLSEQEIAD
FT                   LVTSAIAQTGAAGEGMRAMGKVMGMIQPQVKGRADGGVVAAEVRRQLGAS"
FT   gene            complement(348827..351250)
FT                   /locus_tag="Noca_0326"
FT   CDS_pept        complement(348827..351250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0326"
FT                   /product="glycosyl transferase, family 51"
FT                   /note="PFAM: glycosyl transferase, family 51;
FT                   penicillin-binding protein, transpeptidase; PASTA domain
FT                   containing protein; KEGG: tfu:Tfu_0109 PASTA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79870"
FT                   /db_xref="GOA:A1SDI5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI5"
FT                   /protein_id="ABL79870.1"
FT                   /translation="MPVPRDERLPASRVASHLAVMLVVAAVMGVVVAGLAIPFAGVLGV
FT                   GARQVSEAMDNLPAELQTDPLPQKTRLVDADGDVIATLYDENRVNVSLGQISRTMVKAI
FT                   VAIEDYRFYEHGALDLKGTLRALITNQASNGVVQGGSSITQQMVKMTLLTQAKTKAERQ
FT                   EATDDTYARKLRELRYAIAFEQKYSKDWILERYLNIAYFGDGTYGIQSAARHYFNVNAK
FT                   NLDLRQSAMLAGLVKNPTGYDPTNSPDRALERRNVVLDRMAELNVISRQKADRTKDLKL
FT                   GLHVVPAKNGCLYSRAPFFCDYATNWLLHDPELGETVAERKQLLKTGGLTIRTTVDMRD
FT                   QQAADTAVRDHVDKGDQAVGALAMVEPGTGDVKALAQSRPMGRSEAAGETFLNYTVPTR
FT                   YGDSAGFQAGSTFKPFVLAAAVNQGVPLSTTFNAPQEMTLPQDEFANCEGQPGFVGEWK
FT                   VASSTTSGSMDVYRGTRESVNTFYAMLERVTGVCEPFQIAKALGVELTDPKGDEHGYGA
FT                   ERVPTFTLGIANASPLEMAEAYATFGGRGVHCDSRPVTAIEDSNGTVIQEYPSHCTQAL
FT                   PQATADAINDVLRGVQEPGGFGYDIGGTGLSVPSAGKTGTTQDGKSVWFVGYTPQISTA
FT                   AMIAGATKQGQRPMALAGQVIGGNYIYSVSGSGFAGPMWAQAMHVVDDKLDYEDFVAPS
FT                   ATQVQGVMTTVPTTSGMSVDQAISTLKAAGFNAIEGGTAASGNPAGTVAYTAPAEGSSA
FT                   PEGSVVTVYESTGVAPPPPPGQGGGGGGGGGPGNGGGNGHGGGNGHGNGGGRGR"
FT   sig_peptide     complement(351107..351250)
FT                   /locus_tag="Noca_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.956) with cleavage site probability 0.843 at
FT                   residue 48"
FT   gene            351448..351759
FT                   /locus_tag="Noca_0327"
FT   CDS_pept        351448..351759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0327"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: sco:SCO3579
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79871"
FT                   /db_xref="GOA:A1SDI6"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI6"
FT                   /protein_id="ABL79871.1"
FT                   /translation="MWVEDWAPMAACRESQPDQLFVRGAEQNKAKQLCAGCPVRTECLA
FT                   EALDNQIEWGVWGGMTERERRALLRRRPNASWRAVLEAAREQGTPAIGSKPVARPVGV"
FT   gene            complement(351885..353093)
FT                   /locus_tag="Noca_0328"
FT   CDS_pept        complement(351885..353093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0328"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: tfu:Tfu_0111
FT                   putative ion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79872"
FT                   /db_xref="GOA:A1SDI7"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI7"
FT                   /protein_id="ABL79872.1"
FT                   /translation="MSTARKTRTRTRVGPLATAPTAAPALDVDALLDDRGTGIIVCCGS
FT                   GGVGKTTASAALALRAAERGRRVVVLTIDPARRLAQSMGIEQLDNTPRPVTGLRTNAKG
FT                   NRKGGGLDAMMLDMKRTFDEVVESQANPEKARLILDNPFYIALSSSFAGTQEYMAMEKL
FT                   GQLHADARRDGTYDLIVVDTPPSRSALDFLDAPERLSSFLDGRFIRLLLTPARGPARMM
FT                   TAGLGLITNALNRILGTQVLRDMQTFVAAFDTLFGGFRVRAQKTFELLQADGTAFLVVA
FT                   APEPDALREAAYFVERLSEDDMPLAGLIVNRATPVPPGSLSADEAMAASERLRKQDPDS
FT                   LTAGLLCLHADQTRIVEREALLRDRFAAAHPQVPTAVVPALAGDVHDLDGLRRVGELLA
FT                   RSG"
FT   sig_peptide     complement(353001..353093)
FT                   /locus_tag="Noca_0328"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.630) with cleavage site probability 0.410 at
FT                   residue 31"
FT   gene            complement(353090..354118)
FT                   /locus_tag="Noca_0329"
FT   CDS_pept        complement(353090..354118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0329"
FT                   /product="arsenite efflux ATP-binding protein ArsA"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG: sco:SCO3577
FT                   ion-transporting ATPase; TC 3.A.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79873"
FT                   /db_xref="GOA:A1SDI8"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI8"
FT                   /protein_id="ABL79873.1"
FT                   /translation="MAPPTTTPTTTPDWSRVRLHVVTGKGGTGKSTVAAALALGLASQG
FT                   QQVLLCEVEGRQGIARMFDVDPLPYEERRIATGLHHDGRPPGVVHALHIDAESALLEYL
FT                   AMYYKLGRAGRALDRFGVIEFATTIAPGVRDVLLTGKVFEAVQRNSRNRNATRYDAVVL
FT                   DAPPTGRITQFLNVNEELAGLAKVGPIKGQADTVMTLFRSPRTLVHLVTVLEEMPVQET
FT                   ADGISELRAARLPVGAVIVNQVRPRDITPADLEAAVAGRLDTARIEADLDQAGVTGGTA
FT                   LVEGLIAEVRDHAERRALEDAQRAVVDSFGLPTYELPRLTSGVDLGGLYELAADLKNQG
FT                   LA"
FT   gene            354203..354976
FT                   /locus_tag="Noca_0330"
FT   CDS_pept        354203..354976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0330"
FT                   /product="3-oxoacid CoA-transferase, A subunit"
FT                   /EC_number="2.8.3.5"
FT                   /note="KEGG: fal:FRAAL3148 succinyl-CoA:3-ketoacid-coenzyme
FT                   A transferase subunit A (succinyl CoA:3-oxoacid
FT                   CoA-transferase) (OXCT A); TIGRFAM: 3-oxoacid
FT                   CoA-transferase, A subunit; PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79874"
FT                   /db_xref="GOA:A1SDI9"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDI9"
FT                   /protein_id="ABL79874.1"
FT                   /translation="MDKVVASATAAVADIPDGVTLSVGGFGLCGIPSVLIQAVLDRGTQ
FT                   DLEVVSNNAGVDGWGLGLLLGAGRLRRVVASYVGENKEFARQYLSGELEVELTPQGTLA
FT                   ERMRAGGSGIPAFFTATGVGTQVAEGGLPWRYDAEGAVVKSSPAKQTQVFETAEGPKEF
FT                   VLEHAIVADFGLVRAWKGDRHGNLVFRDSARNFNPLAAMCGRVTIAEVEHLVEPGELDP
FT                   NQVHTPGVFVQRVVELTPEQAADKRIEKKTVRARG"
FT   gene            354973..355617
FT                   /locus_tag="Noca_0331"
FT   CDS_pept        354973..355617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0331"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /note="KEGG: fra:Francci3_2503 3-oxoacid CoA-transferase,
FT                   subunit B; TIGRFAM: 3-oxoacid CoA-transferase, B subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79875"
FT                   /db_xref="GOA:A1SDJ0"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ0"
FT                   /protein_id="ABL79875.1"
FT                   /translation="MSWSREEMAARAASELSDGSYVNLGIGLPTMVPNYVGDDVELVLQ
FT                   SENGILGVGAYPFDGEEDPDLINAGKETVTLRRGASFFDSATSFGMIRGGKIDAAILGA
FT                   MQVSKAGDIANWMIPGKMVKGMGGAMDLVHGAKRVIVLMEHVAKDGSYKIVEECSLPYT
FT                   GKGVVQRIITDLAVIDVTREGLELVELAPGVSLDEVREKTEPELVAANVES"
FT   gene            complement(355713..356549)
FT                   /locus_tag="Noca_0332"
FT   CDS_pept        complement(355713..356549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0332"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: lxx:Lxx06230 RNA
FT                   polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79876"
FT                   /db_xref="GOA:A1SDJ1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ1"
FT                   /protein_id="ABL79876.1"
FT                   /translation="MTIAERDQLAVQHVPLVAHLVRETMARVPSYMDRNDLHSAGLLAL
FT                   VQAARAFDPERGVPFAGYASTRIRGALVDELRSVDWASRSVRRRAREIEAARARLAATL
FT                   GQFPDDAAVAEALGITPEEIGKADSEVARAVVLPLDAGPNAGFVESLAGRDPGPEEEAL
FT                   HAERAQYLAAAIEELPERLRHVVRGYFVAQRPMAELAAELGVSESRISQLRAEALVLLR
FT                   DALAEAFEPHLAAPHPNPDGVAARRRLAYTSAVAARYAARRTMPAARVREGLSSIA"
FT   gene            356811..357617
FT                   /locus_tag="Noca_0333"
FT   CDS_pept        356811..357617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0333"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   lxx:Lxx06230 RNA polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79877"
FT                   /db_xref="GOA:A1SDJ2"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ2"
FT                   /protein_id="ABL79877.1"
FT                   /translation="MPERARLCLTCRVTINAPGPAPTVDPARLAAHHLPLVAHLVYDTL
FT                   RRVPAAVDRHDLLAVGVDALLAAAREPTVERPFAEHASVRIRAALVEELRAIDWAARAE
FT                   HPRHAASARARLLAALADLPDAGAAARVLDVDHDPAEAEEGSPAVVGGTTRPAHPDRRD
FT                   ERREYVEAALDELPERLRLVVRGYFVEQRPMAAVAAQVGASEARAVQLLVEGLGLLRDA
FT                   LALAFGPSADAGPVTSTRAASYARTVAARYAARPVRAPREEQRTSA"
FT   gene            357823..358725
FT                   /locus_tag="Noca_0334"
FT   CDS_pept        357823..358725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0334"
FT                   /product="RNA polymerase, sigma 28 subunit, SigD/FliA/WhiG"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, FliA/WhiG
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70, region 4 type 2; KEGG: lxx:Lxx06230 RNA
FT                   polymerase, sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79878"
FT                   /db_xref="GOA:A1SDJ3"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ3"
FT                   /protein_id="ABL79878.1"
FT                   /translation="MTDPEVNEPDTPTAATSGPGPRPGSAEADRLAVEHVPLVTHVVYE
FT                   TLARVPSYVDRNDLRSAGLLALVAAARSFDPERGVPFARYAMPRIRGAMVDELRSVDWA
FT                   SRSVRRRAREIEEARARLAATLGEFPDDEAVAAALGMTLDEVNRVDSEAARGTVLPLDA
FT                   GAQQGLAEILPVREAGPEERAVHLERVRYLADAVEELPERMRLVVRGYFLEERPMAELA
FT                   AELGVTESRVSQVRAEALALLRDALGEAFDPHLPKPHPNPAGVAARRRLAYTSAVAARY
FT                   AARRTMPARRPHRGLESTA"
FT   gene            358835..358990
FT                   /locus_tag="Noca_0335"
FT   CDS_pept        358835..358990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79879"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ4"
FT                   /protein_id="ABL79879.1"
FT                   /translation="MTKWEYLTAPILTHAAKQILDNFGADGWELVQVAPGPNPENLVGF
FT                   FKRPLA"
FT   gene            358987..359451
FT                   /locus_tag="Noca_0336"
FT   CDS_pept        358987..359451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0336"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sco:SCO3575
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79880"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ5"
FT                   /protein_id="ABL79880.1"
FT                   /translation="MTSPEERLAELGLAVPDVAKPVAVYVPAVVSGDLVFTSGQLPMRD
FT                   GELMVTGKVGGEVSPEEAALCAQQCALNAIAAVKSMVGDLDRVAQVVKVVAFVASTPDF
FT                   TGQPQVANGASELFGKVFGDRGAHARSAVGVPVLPLDAPVEVEIVVRVAS"
FT   gene            359462..360334
FT                   /locus_tag="Noca_0337"
FT   CDS_pept        359462..360334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0337"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sma:SAV4589
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79881"
FT                   /db_xref="GOA:A1SDJ6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ6"
FT                   /protein_id="ABL79881.1"
FT                   /translation="MRIPIPPIPLPEQIVELAREYDDGRRDPAEPRDAATVILVRPSDH
FT                   GPAVYYLRRHTTMEFAGGMCVYPGGGVDPRDFDTTVAWAGPAPAEWAERLGCDEEMARA
FT                   LVCAAVRETFEESGVLLAGPSADEVVADTTGEDWEADRHALESRELAMTAFLSARGLVL
FT                   RTDLLGVWGGWLTPAFEPKRYRTWFFVALLPEGQRTRDVSTESESVTWLPAADAVAQAE
FT                   RGEMLMMPPTYLTSLEVAQLATPDEVIVAAHGRVVEMHTPVVEPLDGEGWTLSVPAHHR
FT                   SILAAHRGA"
FT   gene            360390..361157
FT                   /locus_tag="Noca_0338"
FT   CDS_pept        360390..361157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0338"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sco:SCO3572 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79882"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ7"
FT                   /protein_id="ABL79882.1"
FT                   /translation="MLAANPGPMTLDGTNTWVLREPGARRSVVVDPGPALPAHLDAIAA
FT                   EAGEVGVVLLTHHHADHAEAARAFAERVGCGVRALDPAYRLGAEGLGDGDVVAVDGLEI
FT                   RVVGTPGHTADSLSFLLPAEGAVLTGDTVLGRGTTVVAHPDGQLGAYLGSLDRLHALAE
FT                   AHEVASIWPGHGPVIVNALGALDHYLAHRQERLEQVRAAVETLQAAHRPEGIAAEELPR
FT                   RVVEIVYADVDPVLWGAAELSVRAQLAYLAEPR"
FT   gene            complement(361275..361952)
FT                   /locus_tag="Noca_0339"
FT   CDS_pept        complement(361275..361952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0339"
FT                   /product="transcriptional regulator"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: tfu:Tfu_0117 cyclic nucleotide-binding:bacterial
FT                   regulatory protein, Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79883"
FT                   /db_xref="GOA:A1SDJ8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ8"
FT                   /protein_id="ABL79883.1"
FT                   /translation="MDNDVLRQAPLFSALDDEAATALRASMTESKLRRGDVLFHEGDSG
FT                   DKLYIVLDGKVKLGRTSSDGRENLLAILGPGQMFGELSLFDPGPRSATVTAVTDATFAS
FT                   LSHEDLLRWLEGRPVVARGLLTQLAGRLRKANDVVADLVFSDVPGRVAKALLDLADRFG
FT                   RSADDGVHVHHDLTQEELAQLVGASRETVNKALADFASRGWLRLEPRSVVIMDVERLGR
FT                   RAR"
FT   gene            362084..362815
FT                   /locus_tag="Noca_0340"
FT   CDS_pept        362084..362815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0340"
FT                   /product="endonuclease III / DNA-(apurinic or apyrimidinic
FT                   site) lyase"
FT                   /EC_number="3.2.2.-"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sma:SAV4593 putative endonuclease III;
FT                   TIGRFAM: endonuclease III; PFAM: helix-hairpin-helix motif;
FT                   HhH-GPD family protein; SMART: iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79884"
FT                   /db_xref="GOA:A1SDJ9"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDJ9"
FT                   /protein_id="ABL79884.1"
FT                   /translation="MPRRTLGPVPAVPESRTGLVRRARKIDRLLAETYPDARCELDFDN
FT                   PFELLVVTVLSAQTTDKRVNAVRPTLFAAYPDARTMAGADRATLEGIVGPLGFFRAKTE
FT                   SLLKLSAALVERHGGEVPPRLDDLVQLPGVGRKTANVVLGNAFGIPGITVDTHFGRLSR
FT                   RFAWTEETDPVKVEHAVGALFEKRDWTMLSHHLIWHGRRICHARNPACGACPVARWCPA
FT                   YGEGPTDPAAAAKLVKTEGRA"
FT   gene            362812..363423
FT                   /locus_tag="Noca_0341"
FT   CDS_pept        362812..363423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0341"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pac:PPA0224
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79885"
FT                   /db_xref="GOA:A1SDK0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK0"
FT                   /protein_id="ABL79885.1"
FT                   /translation="MRRLLPAVLAAAVLVLGACGSADLPKPPGQAKVDVDTPELRAIRA
FT                   DAGIEPCRQAAGAAVDGGLPDVTLPCLGGGPDVDLAGLRGPVVVNLWASWCGPCRKELP
FT                   IYQQFHERYGDRVGVVGIDYNDVQPKAALELARDTGVTYPLLADPGSTLEGTESFPTIP
FT                   GLPWVVLVDADGKVVHKQAIEITSVDQLVGLVDEHLGTDL"
FT   sig_peptide     362812..362907
FT                   /locus_tag="Noca_0341"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 32"
FT   gene            363420..364139
FT                   /locus_tag="Noca_0342"
FT   CDS_pept        363420..364139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0342"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sma:SAV4594
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79886"
FT                   /db_xref="GOA:A1SDK1"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK1"
FT                   /protein_id="ABL79886.1"
FT                   /translation="MIPDWLVPVRDGAAAISADQLTRFTPPAGGDARRGAVLMLFGAGE
FT                   QGGELLLTERAHDMRSHPGQVSFPGGALDPGETPVEAALREAEEEVGVDPASVEVFGRL
FT                   PELWLPPSNFAVTPVLGWWREPGDVSIVSQAEVHAIHHVPISELLDPEHRITVRHPRGG
FT                   YQSPGFLIGPDHDVVLWGFTGGIIARLFDFLGWTRPWDESRLRDLPSYMLQADPRRGRL
FT                   LDIEDDQDDDQDEEEDG"
FT   gene            364136..365311
FT                   /locus_tag="Noca_0343"
FT   CDS_pept        364136..365311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0343"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap; Colicin
FT                   V production protein; KEGG: fra:Francci3_4292 colicin V
FT                   production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79887"
FT                   /db_xref="GOA:A1SDK2"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK2"
FT                   /protein_id="ABL79887.1"
FT                   /translation="MNLLDWLLVVLVLAYALSGYWQGFITGAFATGGLLLGGLFGVWLA
FT                   PVALGDANPSLMVSLGALFIVILSASLGQAVLQFAGARIRERITWQPARALDAVGGAML
FT                   SAVAVLVVAWALGVAISGSRIGGVTPLVRGSTVLSHVDEVMPASADGALQAFNDVVGTS
FT                   FFPRYLEPFAPERIVEVGPGPKRLLNDPDVERAGSSVLKIRGTNECGRGVEGSGFLYAG
FT                   NRLMTNAHVVAGIDDPEVIVGDESVPADVVYYNPDIDVAVLSFDSGDLPALRFDRDAGA
FT                   PDGVAILGYPQDGPYHVEPARIRSEQRLRSPNIYGDGAVIREVYSLRGRILPGNSGGPI
FT                   VSSAGDVVGVVFAASVTDHETGYALTAGQVSAAAAAGLTSSSQVSTGGCAG"
FT   gene            complement(365473..365892)
FT                   /locus_tag="Noca_0344"
FT   CDS_pept        complement(365473..365892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0344"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   cdi:DIP0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79888"
FT                   /db_xref="GOA:A1SDK3"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK3"
FT                   /protein_id="ABL79888.1"
FT                   /translation="MASNQVQAAPPDEGDPTIGRLVHDASRDISTLIQKEIQLAKSELK
FT                   VSVQAGGIGIGLFAAAGFIAVLAVIMLSVAIAYFINWNGDGLALHWAFLIVFGFYLLLA
FT                   GLMVFVGIRKVKQVRAPERAIEQGREIPKALKGRS"
FT   gene            complement(365914..367218)
FT                   /locus_tag="Noca_0345"
FT   CDS_pept        complement(365914..367218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0345"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; sodium/hydrogen
FT                   exchanger; KEGG: fra:Francci3_2583 Na+/H+ antiporter NhaA;
FT                   TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79889"
FT                   /db_xref="GOA:A1SDK4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDK4"
FT                   /protein_id="ABL79889.1"
FT                   /translation="MTGRRPTRPRLFSRGSFLESSRVADILRAETTGGLLLIAAATVAI
FT                   VWANTPWSASYADLRDLRVGPQAWHLDLTLGAWAADGLLAIFFFVAGLELKREFVAGDL
FT                   RDPRRAALPVVAAMGGMAVPALVYVLWNLGGDGALQGWAIPTATDIAFAVAILAVISTH
FT                   LPTGLRTFLLTLAVVDDLLAITIIALFYTDELHLGYLAAAAVPLLVFALLVQRRIHRGW
FT                   LLIPLAATAWVLVHESGVHATVAGVLLGFAVPVLRSDGQEGPGLAEHLEHLVRPLSAGL
FT                   AVPVFAFFAAGVTVGGFDGLVDALSDPVALGVVTGLVVGKTVGIAGSTWLLATFTRADL
FT                   DDQLSWVDVVGLAMLAGIGFTVSLLIGELAFGSGTPRDDHVKVGVLVGSLAATALATGV
FT                   LRMRNRAYRRLVEIEEQDADADGVPDVYQRDADEG"
FT   sig_peptide     complement(367072..367218)
FT                   /locus_tag="Noca_0345"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.933) with cleavage site probability 0.689 at
FT                   residue 49"
FT   gene            complement(367344..369338)
FT                   /locus_tag="Noca_0346"
FT   CDS_pept        complement(367344..369338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0346"
FT                   /product="acetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.1"
FT                   /note="TIGRFAM: acetate--CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: sco:SCO3563 acetyl-coenzyme A
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79890"
FT                   /db_xref="GOA:A1SDK5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK5"
FT                   /protein_id="ABL79890.1"
FT                   /translation="MSDETLSNLLKEERRFEPPAEIAAKANLQADAYDRAAADPQAFWA
FT                   EQAERLDWDQRWDRVLDWDDPPFAKWFVGGRLNAAYNCVDRHVAAGRGDKVALHWVGEP
FT                   LDDTRDITYAELQDEVCRAANALTDLGVRTGDRVAIYLPMIPEAVVAMLACARIGAPHT
FT                   VVFGGFSADALASRLEDCQAKVVVTSDGGYRRGSASALKPAVDEARAKTAARGHTVEKV
FT                   LVVRRTGQDVAWDDAVDLWWHDAVGGASSEHTPEFFDAEHPLYVMYTSGTTGKPKGILH
FT                   TTGGYLVGSAYTHWAVFDLKPDTDVYWCSADIGWVTGHSYLVYGPLANGATQVMYEGTP
FT                   DSPERGRWWKIIQDYQVSIFYTAPTAIRSFMKQGREIPDGFDMSSLRILGSVGEPINPE
FT                   AYIWYRHVIGDDRTPVVDTWWQTETGAIMISPLPGVTAGKPGSAMTPIPGVSAEVVNDE
FT                   GDPVPNGSGGYLVLTAPWPAMLRTIWGDDQRYRDTYWSRFAKQGYYFAGDGAKKDDDGD
FT                   IWVLGRVDDVMNVSGHRLSTTEIESALVSHPKVAEAAVVGAKDEDTGQAVCAFVILRES
FT                   ASDPGASDGGDDIVAELRQHVRKEIGPIATPRQIMIVPELPKTRSGKIMRRLLRDVAEH
FT                   REVGDVTTLADSSVMDLIAQGLGSGKSEE"
FT   gene            complement(369471..371075)
FT                   /locus_tag="Noca_0347"
FT   CDS_pept        complement(369471..371075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0347"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: sco:SCO1822 putative
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79891"
FT                   /db_xref="GOA:A1SDK6"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK6"
FT                   /protein_id="ABL79891.1"
FT                   /translation="MSSDTLTAILFIGVVLITIAITFWASRQNKGTADFYAAGRSFSGF
FT                   QNGMAISGDYMSAASFLGISGAIALYGYDGFLYSIGFLVAWLVALLLVAELLRNSGRYT
FT                   MADQLAYRMRQRPVRTAASTSTVVVSIFYLLAQMVGAGALVALLLGADSEAAKNATIIG
FT                   VGVLMIFYVTVGGMKGTTWVQIVKAVLLMGGTILITILVLAKFNFNISDLLGAAAANTG
FT                   KGDAFLQPGLKYGIDTTAKIDFLSLGLALVLGTAGLPHILIRFYTVPSAKAARTSVLWA
FT                   IGLIGAFYLMTLALGFGAAALLDTGAGSKVAASGGNLASPLLAEAVGGGDGTTGGAVLL
FT                   ALISAVAFATILAVVAGLTLTSASSVAHDLYATVFKKGAATERDEVRVARLSAFVIGGI
FT                   AIALAIPAQKLNIAFLVALAFAVAASANLPSLIYNLFWRRFNTRGATWAIYGGLIASVG
FT                   LVFFSPVVSGSETALFTGQDWSYFPLSNPGIISIPLGFFFGWLGTVTSQEPESAARFTE
FT                   LEVRAFTGAGAEQAVRH"
FT   gene            complement(371072..371434)
FT                   /locus_tag="Noca_0348"
FT   CDS_pept        complement(371072..371434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0348"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   sma:SAV6453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79892"
FT                   /db_xref="GOA:A1SDK7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK7"
FT                   /protein_id="ABL79892.1"
FT                   /translation="MSDLDQTAGQAHRHDPVYDELHASPEFNRLRSLYRGFAFPATIAF
FT                   LAWYLLYVVMSNWATGFMDTKLSGNINLALVFGLLQFLTTFAIAWLYARYMNRNVDPIA
FT                   RALEKKYNDRPGGGAR"
FT   gene            371696..373204
FT                   /locus_tag="Noca_0349"
FT   CDS_pept        371696..373204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0349"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bja:blr2806 nitrite extrusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79893"
FT                   /db_xref="GOA:A1SDK8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK8"
FT                   /protein_id="ABL79893.1"
FT                   /translation="MALTSLHTDAAEASPIRRRTGRWIDDWRPEDPDFWANGGQQVARR
FT                   NLVWSVFAEHLGFSVWLIWSVSSAFLLAQGFTFTPQQLFLLVAIPNLVGSLLRVPYTLA
FT                   VPRFGGRNWTMVSAGLLLVPTLGFAYAVTDPSTPYWVFCLIAASAGFGGGNFASSMANI
FT                   NFFYPTAKKGAALGLNAAGGNLGVSLIQFFLPLIVGGAAIFGLAKASPGGIHLERAAWV
FT                   YAGLAIVATAAAYFFMDNLGTARSSAREQLGVLKHKQTWVMSFLYIGTFGSFIGYSAAM
FT                   PLLIKLNFWVPEPAPLGTGIYFAYFAFLGALVGSITRPLGGWLADRYGGARVTLGAFTG
FT                   IILSTLGVLWTLLQLTPNPAADPAIAADNKSWFPYFLGFFLLVFAATGIGNGSTYKMIP
FT                   AIFRTEAERATAVGTEERTAALLAATKRASAAIGIIGAVGAIGGFLIPITFSSPWVSDP
FT                   MEATKTAFVIFTVFYLACAATTWVVYLRRPAEHKAHLSYAGAGI"
FT   gene            373204..375246
FT                   /locus_tag="Noca_0350"
FT   CDS_pept        373204..375246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0350"
FT                   /product="assimilatory nitrate reductase (NADH) alpha
FT                   subunit apoprotein"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: fra:Francci3_0863 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79894"
FT                   /db_xref="GOA:A1SDK9"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDK9"
FT                   /protein_id="ABL79894.1"
FT                   /translation="MTQTHCPYCSLQCGMRLEGGRRLEVRPWPEFPVNEGALCRKGWTA
FT                   AGLRGHRERLTTPLIRDRATGELRAAGWDEALDLVASRLCGLRDEHGPDSVAVFGGGGL
FT                   TNEKAYQLGKLARVALGTSQVDYNGRWCMSSAASAGNRALGIDRGLPFPLADVEHTDVL
FT                   VLVGSNLAETMPPAARHLDRLRENGGRVVVVDPRRTPTAERADLFLQPVPGTDLPLALG
FT                   LLHLLDAAGAVAEEYVAARTTGWEEVRRSLAGWWPERVERVAGVQASQLRECADLLAGA
FT                   ERVMVLTARGAEQHAQGTDTVLAWIDLALALGMPGKQYAGYGCLTGQGNGQGGREHGQK
FT                   ADQLPGYRMIDDPLARDHVAEVWGVSTDSLPGPGRSAYELLDSLGTGGGPRALLVVGSN
FT                   IVVSAPNATHVASRLAALDLLVVADLVLSETAAQADVVLPVAQWAEETGTMTNLEGRVI
FT                   LRERAVAPPEGVRTDLEVIAGLAERLGSPVPFAVDPEEVFAELGRASSGGRADYSGIGY
FT                   DRIRDEHGVFWPCPSPDHPGTPRLFAESFPTADGRARFVAVEHRGPAEPTDPSYPIHLT
FT                   TGRVLAQYQSGAQTRRVRELPDEGPFVEMHPMLAARIGAHDGQQVVVTTRRGELRVPAR
FT                   VTATIRPDTVFVPFHWVGANRLTHDALDPASRMPEFKVCAAAVRA"
FT   gene            375404..376786
FT                   /locus_tag="Noca_0351"
FT   CDS_pept        375404..376786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0351"
FT                   /product="assimilatory nitrate reductase (NADH) beta
FT                   subunit"
FT                   /EC_number="1.7.1.1"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: mmc:Mmcs_3231 nitrite reductase (NAD(P)H)
FT                   large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79895"
FT                   /db_xref="GOA:A1SDL0"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL0"
FT                   /protein_id="ABL79895.1"
FT                   /translation="MRVVVVGAGMAAARLADGLHDHDVTLLGDEPHPPYNRILLSAVLE
FT                   GTHDPTAIAMPLRGDVDLRLGTRVVEIHREDRDVELADRSRVPYDRLVLATGSIPTLPP
FT                   IRGLVRMDGRLDERVHAFRSLEDCRRLDVAVPAAHRAVVVGGGLLGLQVARALAVRGVA
FT                   TEVVEGGDHLLRSQVGPRAGAILARDLGRLGTRVYTGARAVRLTDEGLRLDNGYTLATD
FT                   LVVLTAGGRPSTALARRAGLEVRRGIVVDERLRTSDHRIHAIGDCAQHGTQVTGFVPPA
FT                   WEQAGLLARQLRGEDVTYAGSRSVARLRATGLEVAVLGEPERAEGQVVEVANPVTGTHR
FT                   KLVVRDGVIVAATLVGDLSRIGLITQHYDRGTVLGASEPGDLLIGDRPAAQVDLPDDAE
FT                   VCACAGVSAGAIRACASLADARETTRATTGCGGCAAAVRQLLAARLSPGPSLGTTLEGT
FT                   PR"
FT   gene            376783..379299
FT                   /locus_tag="Noca_0352"
FT   CDS_pept        376783..379299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0352"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: fal:FRAAL1355
FT                   nitrite reductase, large subunit, nucleotide-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79896"
FT                   /db_xref="GOA:A1SDL1"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL1"
FT                   /protein_id="ABL79896.1"
FT                   /translation="MSPKHRRTLLVAGHGMVGHRFVQAAIERGLTETHDIVVVGEERRP
FT                   AYDRVALTSFFEVGADELSFLPSGEYDDPRVRLLLGTSVDGFDPATRTVVLSDGQEIAY
FT                   DELVLATGAMPFVPPVPGHDLEGCFVYRTIEDLEAIRAAAATAEVGAVVGGGLLGLEAA
FT                   NALAQLGLVTHVVEMAPRLMAVQVDEAGGATLARHIERLGLTVHTGATTQRILGADRVE
FT                   GLALAGEEPIPADLVVFSAGIRPRDQLARDAGLDVAERGGVLVDERCRTSDPHVWAIGE
FT                   CAAPGGRMYGLVAPGYAMAEVVVDALLGGSGAFTGADLSTKLKLLGVDVASFGDAFAAT
FT                   EGALELVYADAVTGVYKKLVLSADGRQLLGGILVGDASAYGVLRPMVASGIALPDNPED
FT                   LILPTGRGVLEIGLPDEAQVCSCNDVTKGDILAAAAAGTSTRAGATCGSCKAQTKRIIE
FT                   DYYASQGKVVDRSLCEHFALTRQELFDVVAVHGYTRFDDIVAGHGRGRGCDICKPAIAS
FT                   ILASQLNGHVLDGPNRTLQDTNDAYLANIQRNGTYSVVPRIPGGEITPEKLIVIGEVAQ
FT                   EFGLYTKITGGQRIDLFGARMEQLPAIWRRLVDSGFESGHAYGKSLRTVKSCVGSTWCR
FT                   YGVQDSVQLAIDLELRYRGLRSPHKLKGGVSGCARECAEARAKDFGVIATEKGWNLYVG
FT                   GNGGATPAHARLLAGDLDRETLVRYLDRFLMYYVRTADRLQRTASWIDSIDGGLDRVRE
FT                   IVVDDALGLGSELEAAMARHVAGYFDEWRATLDDPAKLARFVSFVNAPGTPDPHITFRS
FT                   ERDQAVPEESSGPVDLGATIPVGAPR"
FT   gene            379296..379673
FT                   /locus_tag="Noca_0353"
FT   CDS_pept        379296..379673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0353"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) small
FT                   subunit"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   fra:Francci3_0795 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79897"
FT                   /db_xref="GOA:A1SDL2"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL2"
FT                   /protein_id="ABL79897.1"
FT                   /translation="MSTSTGPAAGATYTTVCGLDQIEVEGGVVALVDGVAVAIFRTHDG
FT                   NVYAISNYDPVSRASVLARGIVGTRGDVPVVASPMHKQAYDLRTGQCLDDAAVRVPTYD
FT                   VRVIDGTVHVGGPRPEHQDST"
FT   gene            379670..380788
FT                   /locus_tag="Noca_0354"
FT   CDS_pept        379670..380788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0354"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Uroporphyrinogen III synthase HEM4; KEGG: sco:SCO2958
FT                   uroporphyrinogen-III synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79898"
FT                   /db_xref="GOA:A1SDL3"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL3"
FT                   /protein_id="ABL79898.1"
FT                   /translation="MTDSLPLAGFRIGVTAARKVDEQVTLLERRGATVEWAPALSLDPN
FT                   RVDDAALRAATEEVLAAPVDMILATTGIGMRTWFDAAERWGLLPRLLRALGSAEILARG
FT                   PKSVGALRARGLRELWAPESECFEDVLEHLRGRSLAGLRIVVQEHGQSLSMVAHALRRQ
FT                   GAEVTTVTVYRVVSAEDPGPMFALVDLVADRSLDAVTFTSAPAVAALMDAAGSTGRRDE
FT                   LVSAFQADVVAACVGPVTAAAFEMWGVPTIFPERSRLGAMVKQLETELPVRRSGLAIGL
FT                   VGGHRLLLHGEDVLLDGAEVRLSPAPAAVLQALVANPGNVVPRRALLAMLPSGTAGSEH
FT                   AVEMAVARLRAALGTRTVQTVVKRGYRLAVAS"
FT   gene            complement(380814..382331)
FT                   /locus_tag="Noca_0355"
FT   CDS_pept        complement(380814..382331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0355"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: sma:SAV7117
FT                   transmembrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79899"
FT                   /db_xref="GOA:A1SDL4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL4"
FT                   /protein_id="ABL79899.1"
FT                   /translation="MSTGLDAAPGIVAVAVVTIATLVIGTWGLRFSRTTSDFFVASRTV
FT                   RPRLNASAIGGEYLSAASFLGVAGLVLTFGADMLWYPVGWTAGYLVLLVLVAAPLRRSG
FT                   AYTLPDFAEARLGSRSVRAVCSLLVVAVGWLYLLPQFQGAGITLRSTLGAPTWVGPVIV
FT                   GLVVLANVTSGGMRSITFVQAFQYWLKLTALLVPGAVLLVVWAGDSAPLRAGSDGWSVP
FT                   LAAGGNQGLYVTYSLIIATFLGTMGLPHVVVRFYTNPDGRAARRTTLVVLALLGVFYLL
FT                   PPLYGALGRVYAPSLAESGRSDALVLELPRIMLDGPAGEVLTGLVTAGAFAAFLSTSSG
FT                   LSIAVSGVLSQDVTGRPWAGRRLGGVAAFRVGAVVAVTVPCVVALAAPNLGVARAVGLA
FT                   FAMAASTFCPLLLLGIWWRRLTPAGALAGLLAGGVGSGVAIAWTLATSRPSGWADALMG
FT                   QPAAWTFPLALTTMVVVSLATAHRIPTHAGRFLVRLHTPETLGLDRS"
FT   gene            complement(382328..382705)
FT                   /locus_tag="Noca_0356"
FT   CDS_pept        complement(382328..382705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05042 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79900"
FT                   /db_xref="GOA:A1SDL5"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL5"
FT                   /protein_id="ABL79900.1"
FT                   /translation="MSEPGAAPERVRVTGPPRRRTPAARTADIDDETLLGGMYMGSLLR
FT                   EQLRLAVGVLTVLGLTLGLLPLAFHLFPRLGEVEVLGAPLAWVLLGVLAYPTLLLLGWV
FT                   YVRRAERNERDFAELVSEVEG"
FT   gene            complement(382702..383451)
FT                   /locus_tag="Noca_0357"
FT   CDS_pept        complement(382702..383451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0357"
FT                   /product="response regulator receiver"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: sma:SAV7115 regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79901"
FT                   /db_xref="GOA:A1SDL6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL6"
FT                   /protein_id="ABL79901.1"
FT                   /translation="MSAPAAPVPRLRALVVDDERPALDELRYLLERDDRVREVLTTDSA
FT                   TEGLRILRDLDVDVVFLDIQMPGLTGLELAQVLSRFRTPPGIVFVTAHEAHAVEAFDVH
FT                   AVDYVLKPVRADRLAEAVRRVVAGTDRAANGDDMRVAVERGGVTRFLNRSDITHVEAHG
FT                   DYARLHTGDGSHLVRTPLAALEEEWAGAGFVRIHRSLLVSLAHVREVRMDAGRCAVVVG
FT                   EPPVELGVSRRHTRELRELLLQYRTGP"
FT   gene            complement(383448..384572)
FT                   /locus_tag="Noca_0358"
FT   CDS_pept        complement(383448..384572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0358"
FT                   /product="histidine kinase internal region"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase internal region; KEGG:
FT                   sma:SAV7118 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79902"
FT                   /db_xref="GOA:A1SDL7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL7"
FT                   /protein_id="ABL79902.1"
FT                   /translation="MSAMTRPWRRRHLGTEADRATFRTLHTASLASPALREGLTRTSAE
FT                   RSIRHLHDLLGGPALALTDTATTLAWHGTGQHHEEQCPGLAVATVERGRTRMFDREELP
FT                   CDVSGCPVRSAIVSPLVVEERVIGTLQVFPAYATAGLARAADEVAQWVSSQLELAELDA
FT                   SRNRLMEAEVRALRAQISPHFIYNSLGAIASFVRTDPDRARDLLLEFADFTRYSFRRHG
FT                   EYTTLAEELRSVERYLLLEQARFGDRLQVTLRIAPEVLPVAVPFLCIQPLVENAVRHGL
FT                   ETAERGGHIRIVARDQGQECVIEVEDDGTGEDPDVVRRALAGDAALDSTGLGNVDGRLR
FT                   NAFGDDFGLAVETAPGAGTKVVVRVPKFAPGVHA"
FT   gene            complement(384577..385362)
FT                   /locus_tag="Noca_0359"
FT   CDS_pept        complement(384577..385362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0359"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: mag:amb0581 carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79903"
FT                   /db_xref="GOA:A1SDL8"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL8"
FT                   /protein_id="ABL79903.1"
FT                   /translation="MNAARPNRRVRLLVVLCVALAAGSCSGDGDGTRTEPGDHGSEAGR
FT                   AEHWSYDDVEAWEEACATGREQSPVDLAGATSRDLPDLGFAYRPAPATVVDNGHTVQAS
FT                   VEGAGSLELDCETFELRQLHFHSPSEHLVAGASYAAEVHLVHEGTDGRLAVVAVLVQEG
FT                   SANPVVAALLDQVPAAGAEPVAADAPVDPVRVLPADRRAFRYDGSLTTPPCTEGVAWSV
FT                   LAEPITWSAGQLAEFAERHPDSHRPPQPRDGRVLLHDER"
FT   sig_peptide     complement(385258..385362)
FT                   /locus_tag="Noca_0359"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.286 at
FT                   residue 35"
FT   gene            complement(385393..386220)
FT                   /locus_tag="Noca_0360"
FT   CDS_pept        complement(385393..386220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0360"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mpa:MAP3459 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79904"
FT                   /db_xref="GOA:A1SDL9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDL9"
FT                   /protein_id="ABL79904.1"
FT                   /translation="MSDQPATSPALSFGDVAAAYDRGRPTYPRAAAAWAVGDQPTTVLE
FT                   LGAGTGKLTEVLVSLGHDVHATDPDEQMLAVLRERLPEVRTSVAAAEDIPAPDASYDVV
FT                   VAAQAFHWFDHERALPEIARVLKPGGRLAVVWNARDERIPWVRRLGRIIGSQEQSRSEG
FT                   PLENSTLFEALETESFRHWQLVDRDSIRDLVLSRSNVATLDETARADKLAEVVAFYDDY
FT                   GRGMDGMQLPYVARCFRSALVAGAVTEDPGAGPAAEAPVTDGSDTEMLLIDFR"
FT   gene            386256..386918
FT                   /pseudo
FT                   /locus_tag="Noca_0361"
FT   gene            complement(387475..388344)
FT                   /locus_tag="Noca_0362"
FT   CDS_pept        complement(387475..388344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0362"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; KEGG: sco:SCO3558 morphological
FT                   differentiation-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79905"
FT                   /db_xref="GOA:A1SDM0"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM0"
FT                   /protein_id="ABL79905.1"
FT                   /translation="MWTRRFDTVPVDGEWTAPAYDGAMATRSTAAFFDLDKTIIAKSST
FT                   LAFSKPFQAGGLISRRAVLRSAYAQFVYLVGGADHDQMEKMRQFMSQLCAGWDVATVRE
FT                   IVADTLHNIVDPLVYDEAVSLIEEHRLAGRDVVVVSASGAEVVEPIAAMLGADRVIATR
FT                   MEIAEGRYTGGIEYYAYADEKARAIEDLAAAEGYDLASSYGYSDSVTDVPMLEAVGHAH
FT                   AVNPDKELRRIAAERGWPVLVFTKPVALRTRVPLPPAKPTLAALAVGGVVAVGGVLWAN
FT                   SRKRRPSA"
FT   gene            388395..389441
FT                   /locus_tag="Noca_0363"
FT   CDS_pept        388395..389441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0363"
FT                   /product="septum site determining protein"
FT                   /note="KEGG: sco:SCO3557 septum site determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79906"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM1"
FT                   /protein_id="ABL79906.1"
FT                   /translation="MTAPLLITRDQSLLDELLRLAAAAGVTPDVASDGGAALRGWARAP
FT                   VVLLGADMAEDLARISPPRRPRVYVVSWAAVPDEMFRVAVAVGAESVAQVARSEGWLTE
FT                   LLTDLGEAAPAEGLVVGVVGGSGGAGATTFACALGQVGARRGRAVVIDADPLGPGIDRV
FT                   LGLEDRHGVRWDGLCQTTGRLSARALREALPRREQLGVLTWHAGEPAALQAFAVREVLS
FT                   AARRGHDLVVVDLPRTAGPLVDEVVARCDRLLVVVVPTVAGVASAVRTCARHPDPTGVR
FT                   LVLRGAGIDPRAVSRATGISVLTTMPDQRGLGEALDLGLGPVRSRRAALGRAATEVLDQ
FT                   LVLLRAAA"
FT   gene            389438..390601
FT                   /locus_tag="Noca_0364"
FT   CDS_pept        389438..390601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0364"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   sco:SCO3556 putative secretory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79907"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM2"
FT                   /protein_id="ABL79907.1"
FT                   /translation="MSEVAAVPLADLEAVRDRLARSPGDLTPHRVAQALRESGRPVGDA
FT                   AVLATYEALRRDVVGAGPLEPLLRTPYVTDVLVNGADHVYLDRGSGLELTDVRFPDEEA
FT                   VRRLAQRLAALGGRRLDDATPYVDLRLPDGTRLHAVLAPLARPGTLVSLRVPRPRTFTL
FT                   DELVGLGTLTAGTARLLRAIVEARLAFLVSGGTGSGKTALLAALLSRVEPEERIVLVED
FT                   ASELRPDHPHVVALEGRPANLEGAGAVEVRTLVRQALRMRPDRLVVGEVRGGEVVDLLA
FT                   ALNTGHEGGCGTLHANSAVDVPARVEALALAAGLGREAAHSQLASAVHVVLHLARGPDG
FT                   VRRLRQIAVPRRGPDGLVSMVPALEVGDDGIVRPGPGADELAARIGR"
FT   gene            390598..391374
FT                   /locus_tag="Noca_0365"
FT   CDS_pept        390598..391374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0365"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   sco:SCO3555 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79908"
FT                   /db_xref="GOA:A1SDM3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM3"
FT                   /protein_id="ABL79908.1"
FT                   /translation="MTAVAVGAAALAMLLLVRPPARPAASGAAVVERRWVPVAVLVAGV
FT                   VAALAMPRLGGLALVLSGTATGAAGLWRRRRRRRAAERVAAQVLDTCELLAGELTAGRP
FT                   PGEALQRAAASWPPLARVAEAFRVGADVPSALRVLAADLEGARDLRVVAAAWQVAHRTG
FT                   QGLASAVERVAESLRAGAATRRMVTGELGSARATARLVAGLPVLALAMGSGAGGDPWGF
FT                   LLGHPAGLLCLAGGLAFGLAGLWWIEAIAAAAEESW"
FT   sig_peptide     390598..390684
FT                   /locus_tag="Noca_0365"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.397 at
FT                   residue 29"
FT   gene            391371..392093
FT                   /locus_tag="Noca_0366"
FT   CDS_pept        391371..392093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0366"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   tfu:Tfu_0126 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79909"
FT                   /db_xref="GOA:A1SDM4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM4"
FT                   /protein_id="ABL79909.1"
FT                   /translation="MSALPALLPVLAAAMAAALLLPPRPTLPGARSPSDHAPSPGWLHR
FT                   HRLLWSGLAGTGALVLVGGPAGPPAALVAAVAAWTVIGRAEPPDVRRRREAVRRDLPHV
FT                   VDLFAATLRGGAAPADGIALVCTALPGPAADRLAGVAARLALGLDPGQVWSALADDPHL
FT                   GRLGRTLARAHSSGAPVVAAVERLADDLARSARAETEERARAVGVKAALPLGLCLLPAF
FT                   VLIGIVPLVVALLASLDI"
FT   sig_peptide     391371..391463
FT                   /locus_tag="Noca_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.532 at
FT                   residue 31"
FT   gene            392651..393028
FT                   /locus_tag="Noca_0367"
FT   CDS_pept        392651..393028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79910"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM5"
FT                   /protein_id="ABL79910.1"
FT                   /translation="MTGRGSGRRRERGAATAELAMALPLLVAITLGLVWLLAVGAAQVR
FT                   AVDAARETARAVARGDSVTAAVARGQRVAPPGSRVSVHDDGGQVTAVVVGRVDGPGGLF
FT                   GRLPGVAVSAQAVAAAEESSP"
FT   sig_peptide     392651..392791
FT                   /locus_tag="Noca_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.672 at
FT                   residue 47"
FT   gene            393025..393390
FT                   /locus_tag="Noca_0368"
FT   CDS_pept        393025..393390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0368"
FT                   /product="conserved hypothetical protein; putative TonB Box
FT                   domain"
FT                   /note="KEGG: fal:FRAAL6570 hypothetical protein; putative
FT                   TonB Box domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79911"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM6"
FT                   /protein_id="ABL79911.1"
FT                   /translation="MKATAAAHRTRDARGSASLFAVSCLAVLLLLGSALGVVAAMVRAH
FT                   RMAQSAADLAALSAATALGRGNDPCRAGAAVAVANGARLVACTVAGDDALVRVEVTGPR
FT                   WLGQTADLAAEARAGPG"
FT   sig_peptide     393025..393147
FT                   /locus_tag="Noca_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.577 at
FT                   residue 41"
FT   gene            complement(393420..393731)
FT                   /locus_tag="Noca_0369"
FT   CDS_pept        complement(393420..393731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79912"
FT                   /db_xref="GOA:A1SDM7"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM7"
FT                   /protein_id="ABL79912.1"
FT                   /translation="MVILGILLIALGAVAIVAALGTAEGSGVELLGADIGAVTLFFVGL
FT                   AAGVAILWGFGLTKWGTKRSIRHRRESKRLNELSEKLDEREAERREDERERDRPGDDR"
FT   sig_peptide     complement(393654..393731)
FT                   /locus_tag="Noca_0369"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.869 at
FT                   residue 26"
FT   gene            complement(393742..396078)
FT                   /locus_tag="Noca_0370"
FT   CDS_pept        complement(393742..396078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0370"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sco:SCO3550 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79913"
FT                   /db_xref="GOA:A1SDM8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM8"
FT                   /protein_id="ABL79913.1"
FT                   /translation="MRAVLGSQARTAGDLRDVVERLVAAPGREDRLCHLEVLPARAARH
FT                   ADWPAWADPDVVAAFAARGVARPWQHQVVAAEAAHAGQHVVLATGTASGKSLAYQLPAL
FT                   STLRGSRGPRGQRGATVLYLAPTKALAQDQLAGLSGLGLDLRVTTHDGDSSREQRDWAR
FT                   DHGEYVLTNPDMLHRSLLPGHSRWAGFLGALQYVVVDECHHYRGVFGAHVAHVLRRLRR
FT                   VCATYGASPTFVLASATVAEPEAAARRLTGLDVQAVTADHSPRGRVSLLLWEPPFTSFT
FT                   GENGAPVRRAASSETADLLADLVAEDVRTLAFIRSRRGAEQVAMTAAELLTDVDPVLAG
FT                   RVASYRGGYLPEERRAIEDSLRRGEITGLAATNALELGIDISGLDAVVMAGFPGTRAAL
FT                   WQQVGRAGRGAQDALAVLVARDDPLDTYLVTHPEALLGRPVEATVFDPSNPYVLGPHLC
FT                   AAAHEAPLTEADLPLFGPTAREVVDALTEGGLLRRRPRGWFWTDRRRASDLADIRSTGG
FT                   APVQLVEAETGRVIGTVDASSAHGTAHPGAVYVHRGETWLVCSLDLEDRVAVIQRAQPD
FT                   YSTTAREVTEISVVREREHTAWGDCRLSFGEVDVTHQVVSFLKRRQPGGDVLGEEPLDL
FT                   PERSLRTAAVWWTVPDHAVTEAGLSGRDLPGAAHAAEHCSIGLLPLFATCDRWDIGGVS
FT                   TAVHPDTGRLTVFVYDGHPGGAGFAERGFRAAREWLTATRDTIRSCTCEDGCPSCIQSP
FT                   KCGNQNNPLDKAGAAALLDVLLGEA"
FT   gene            396317..396655
FT                   /locus_tag="Noca_0371"
FT   CDS_pept        396317..396655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0371"
FT                   /product="anti-anti-sigma factor"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   fal:FRAAL6574 anti-sigma-B factor antagonist
FT                   (anti-anti-sigma-B factor)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79914"
FT                   /db_xref="GOA:A1SDM9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDM9"
FT                   /protein_id="ABL79914.1"
FT                   /translation="MDLTLTTRDAGGKTIVAVGGEIDVYTAPKLRDKITELVAAGVYDI
FT                   VVDMEEVEFLDSTGLGVLVGGLKKVRAHDGSLQLVCTQDRLLKIFRITGLAKVFVIHDS
FT                   ADAALAGS"
FT   gene            396899..399277
FT                   /locus_tag="Noca_0372"
FT   CDS_pept        396899..399277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0372"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: sma:SAV4616 putative inorganic proton
FT                   pyrophosphatase; TIGRFAM: V-type H(+)-translocating
FT                   pyrophosphatase; PFAM: Inorganic H+ pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79915"
FT                   /db_xref="GOA:A1SDN0"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN0"
FT                   /protein_id="ABL79915.1"
FT                   /translation="MTGIVPAVVEVSGGNLVLVIVVALIALGALAMAAMFRQEVLAAGE
FT                   GTDNMKNIAQAVQEGANAYLQRQFRTLAIFAVVAFFLLLALPADDAMVRIFRSVFFLVG
FT                   AGFSATVGYLGMSLAVKANLRVAAAAQTQGRDPAMNIGFRTGATVGMLTVGLGLLGASV
FT                   VVILFQEDAPHVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVENNIPEDDPRN
FT                   AATIADNVGDNVGDCAGMAADLFESYAVTLVAALILGSQAFGDKGLVFPLLIPAIGALT
FT                   AVVGVYLCKPRAGENGLTTINRAFYISAAIGAVASIILALVYLPGDFADLTNSTVDADA
FT                   SPRVVAALAVLIGIVLAAAILGLTGYFTGTDHRPVKDVGKTSLTGAATVILSGLSVGFE
FT                   SAVYTTLVIGAAVFGAFLVGAGSIPVALFAVALAGCGLLTTVGVIVAMDTFGPVSDNAQ
FT                   GIAEMSGDVDEHGAQILTELDAVGNTTKAITKGIAIATAVLAASALFGSYTNALQDAID
FT                   EVTLTEEPGALTSLAFSFNASYPNILVGMLLGAAVVFLFSGLAINAVGRAAGAVVYEVR
FT                   RQFREIPGIMEGTGRPEYGRVVDIVTRDSLRELATPGLLAILAPIAVGFGLGVGPLAGF
FT                   LAGAIATGTLMAVFLANSGGAWDNAKKLVEDGNHGGKGSDAHAATVIGDTVGDPFKDTA
FT                   GPAINPLLKVMNLVSLLIVAAIVKLSIGEDANTPLRIVIALAAFAGIVAAVYVSKRRPV
FT                   HIEGDDDGTTAPPPPPPPVEAVPPTEPAPTQQFEAPQQH"
FT   sig_peptide     396899..397027
FT                   /locus_tag="Noca_0372"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.347 at
FT                   residue 43"
FT   gene            complement(399342..400832)
FT                   /locus_tag="Noca_0373"
FT   CDS_pept        complement(399342..400832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cch:Cag_1235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79916"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN1"
FT                   /protein_id="ABL79916.1"
FT                   /translation="MHRITRALGASVVAALVMSGPSVAVAAPSQGGEPPSSSSAQRAGE
FT                   PTLSGSGVAGQPLTVLIDGLTTLLPVQWLRDGSPIAGATGASYVPDVTDIGHQISALVD
FT                   VPLLGGIPTPSITILAPDGGLPDLLTPPELTGTPVVGELLTVLAPVFSVPGVETTYQWL
FT                   RDGVPIPGETGGTYAPSLEDVGHEISVGVTSTLAGLPVLSTVTNILPISAIGEESLSAT
FT                   AAPTVSGTARIGKVLSVSGTQWNQDGVTTTYQWLRDGVPINGATATSYKLVPDDLDSAI
FT                   SAKATGTKDGFTNGVVTSDSKTALIGDPITWTRQPAVSGTAKVGRLLTADPGAWGTGDT
FT                   PLFGYQWKRNGVAIAGAVAQTYQIDTADFGRSLTVTITAARAGYQPGTFTTSKVAVAKR
FT                   AAVLRATLATKTIAKSQRGVLALVLKVAGVTSPTGRVKVLDGRKVVSKLKFVSGKKGKA
FT                   TVRLPRLKPGVHKLKAVYAGTATISGARSKVVKLTVKK"
FT   sig_peptide     complement(400752..400832)
FT                   /locus_tag="Noca_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 27"
FT   gene            401017..402477
FT                   /locus_tag="Noca_0374"
FT   CDS_pept        401017..402477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0374"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 12; KEGG: sma:SAV4618 rRNA or tRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79917"
FT                   /db_xref="GOA:A1SDN2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN2"
FT                   /protein_id="ABL79917.1"
FT                   /translation="MTASSVSELPSRLRAALVMAGFTYDAVAEALGPEAHAALGRNETT
FT                   PGLRRTGGGWPLETLIRLFLLQAPVELAAAQRALPGLLDRLVAEGLLEQTVGEVAARLD
FT                   VRPYATDDEHLWVVSDLTPGLDGGSSRVGPQHVLGISAASTSLAQLTLREPVGRALDLG
FT                   TGCGVQALHLARHCSEVVATDVNQRALRIARFNLDLNAVTTPVDVRAGSFFEPVADDTF
FT                   DLIVTNPPFVISPATGERLVYRDSGLPGDRVVEDIVRQAAAHLNEGGWCQVLGNWVVPD
FT                   GGAWEQRIEGWVPEGCDAFVVQRELVDPAAYVELWLKDAGLHGSADYLVRYDTWLSWFE
FT                   EQGIEAIGFGWINLRRSGGGARELLTWPYDVEQPIAPAIRDWARASDAVVDLGSHLRLR
FT                   TDVVQETSGPPGAADPETVVLRQQRGLRRARQVDTVEAALAGACDGELSVGQILDAIAR
FT                   LLDLDPAQTIETYLPAARSLVAEGFLLA"
FT   gene            complement(402495..403265)
FT                   /locus_tag="Noca_0375"
FT   CDS_pept        complement(402495..403265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79918"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN3"
FT                   /protein_id="ABL79918.1"
FT                   /translation="MYPYDDDDRWSYAPPAAPDRVTHLVFVDGRLVDTWREPAIGTEWE
FT                   PVALRHDREALPPQPPPPAPHERVAQWLAGVCGGRAAVDGLTDEPLGDDRIDLPTEYPD
FT                   RTDRERVEATADLLDAVAERCFDAETSYAFRHALLALWAEDPDVVTRAASAAHVAGGIC
FT                   WAVGKANGLFSPAGGMRVGVVQEALALRSPASGYGGTVRTALLGFRNQPVGHWSRPAGV
FT                   PDLLVLGRCDLLLGVTRSRLLRIRDRARAAAAAA"
FT   gene            complement(403358..404068)
FT                   /locus_tag="Noca_0376"
FT   CDS_pept        complement(403358..404068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79919"
FT                   /db_xref="GOA:A1SDN4"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN4"
FT                   /protein_id="ABL79919.1"
FT                   /translation="MTEQQIKEGYARLGDALAPPLDVTARVQRRVGVRRRRRRVGVVAG
FT                   SLVAVMAAGGGVVAATSGDDGPGDTVAVDQPQGPVSTLVMTRPDGSTYAFSDVAVTCDP
FT                   PQSAGGDTIGATGRIWMYSPMEITGSEEGNDAMVRRPFVYFEGVLAKLRQDRTFEMPVW
FT                   GPGDSDSYPITLFVADTEGGPDGNEAASSSGGSGTVRVLEASCDPTPVLRLEVDATLAS
FT                   EEGKQDLQIAGEVR"
FT   sig_peptide     complement(403889..404068)
FT                   /locus_tag="Noca_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.626) with cleavage site probability 0.495 at
FT                   residue 60"
FT   gene            complement(404073..404597)
FT                   /locus_tag="Noca_0377"
FT   CDS_pept        complement(404073..404597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0377"
FT                   /product="Sigma-70, region 4 type 2"
FT                   /note="PFAM: regulatory protein, LuxR; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; Sigma-70,
FT                   region 4 type 2; KEGG: sma:SAV6340 RNA polymerase
FT                   ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79920"
FT                   /db_xref="GOA:A1SDN5"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN5"
FT                   /protein_id="ABL79920.1"
FT                   /translation="MEATTDAPSHPDFADFAAVQSGPLLGLAHALTANPHDAWDLTQET
FT                   LARIGERWGRTRIEEPAAYARTVMVRLNIDRIRRLRRELPLLGTPREEAPVEVVGQTDA
FT                   WLVEALATLSPRQRTALALRYVEDLDVRGIAQRMGCSEGTVKSQLSRGTERLREHAREH
FT                   GPLRAAATRED"
FT   gene            404767..407484
FT                   /locus_tag="Noca_0378"
FT   CDS_pept        404767..407484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0378"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: sma:SAV4621 putative DNA topoisomerase I;
FT                   TIGRFAM: DNA topoisomerase I; PFAM: TOPRIM domain protein;
FT                   DNA topoisomerase, type IA, central domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79921"
FT                   /db_xref="GOA:A1SDN6"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN6"
FT                   /protein_id="ABL79921.1"
FT                   /translation="MAHKLVIVESPAKARTIGGYLGQGYVVESSIGHIRDLPQSAADTP
FT                   AKIKDKPWGRLAVDVDNGFEPYYVVPRDKKSHIAKLKTLLKEADELYLATDEDREGEAI
FT                   AWHLLDELKPKDIPVKRMVFHEITKPAIIAAAEHPRELDMDLVEAQEARRILDRLYGYE
FT                   VSPVLWKKVMSGLSAGRVQSVATRLVVDRERERMAFRVASYWDLEGTFDAGATKEPRMF
FT                   PAKVHSVDGSRVAGGSDFGPDGLLKAKKGERVHLDRAAAEALVAALAETTYDVRSVEAK
FT                   PYRRSPYAPFRTTTLQQEASRKLGMSASVTMSVAQRLYENGFITYMRTDSTTLSGGAVE
FT                   AARAQVRELYGAEYLPDTPRTYTSKVKNAQEAHEAIRPAGDSFRTPAQTGLTGDQFRLY
FT                   ELIWMRTVASQMKDATGQSVSVRIGGVAADGRDVVFAASGRVITFHGFLKAYVEGTEGG
FT                   KRSDDDQVPLPDLHEGDAVSAASLAANGHETKPPARYTEATLIKELEDREIGRPSTYAS
FT                   IIGTILNRGYVYKKGTALVPAWLAFSVTRLLEEHFPRQVSYEFTAGMEDVLDEIAGGRK
FT                   DLKSELSEFYYGSDSVVGLKPLVDGLGEIDARELATFPIGGADAGINLRVGRYGPYLEG
FT                   PDDDGTAYARRANVPDDLPPDELTLDKAKELLANPAGEEIRLGVHPDTGLEVVAKNGRF
FT                   GPYVTEVLPEDAAQGRKKGAAKPRTGSLFKSMSLDTVTLADAVKLLSLPRVVGVAEDGE
FT                   EVTAQNGRYGPYLKKGTDSRSLASEDQLLTITLDEALRIYAQPKQRGRAAAAAPLKELG
FT                   NDPVSGQPVVVKAGRFGEYVTDGEYNATLRKEDSVESITIERAAELLAERRAKGPAKKA
FT                   AKRGAKKAPAKKAAAKKTATKKAATKKATAKKAT"
FT   gene            407542..408570
FT                   /locus_tag="Noca_0379"
FT   CDS_pept        407542..408570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0379"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sco:SCO6349
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79922"
FT                   /db_xref="GOA:A1SDN7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN7"
FT                   /protein_id="ABL79922.1"
FT                   /translation="MPAHRDKRHPTMADVAARAGVSHQTVSRVINNAPSVRPETAARVV
FT                   QAISDLGYRPNRSARLLASRHSRLIGVATWGTSHHGPQQVLLALDAAARRADYRTAVST
FT                   LHALTEQDTRDGVEELLQLGVEAVVLIIPHESMLRFATEADLGVPTVVVEGDLSRMPLT
FT                   VGVDNVQGGSLATRHLLELGHRTVVHVAGPPGWAEAAARVDGWRLELETWGRVVPPLRW
FT                   GGDWSARSGYDAGVSLARDPEVTAVFAANDQMAMGVIAALREAGRRVPDDISVVGFDDL
FT                   PESAYLDPPLTSVHQDFGELGRRAMGLLERVLAGEKKPTADLVPTSLVVRASTSSPRVP
FT                   AN"
FT   gene            408864..410567
FT                   /locus_tag="Noca_0380"
FT   CDS_pept        408864..410567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0380"
FT                   /product="L-ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /note="TIGRFAM: L-ribulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pac:PPA2319 ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79923"
FT                   /db_xref="GOA:A1SDN8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN8"
FT                   /protein_id="ABL79923.1"
FT                   /translation="MVAGVVAGAVAAGSRPELVVGVDFGTLSGRAVVVRVEDGAELGSA
FT                   THEYPHGVLDRELPDGTPLGPDWALQVPADYVDVLRVAVPAALAAAGADAAQVIAIGTD
FT                   FTACTMVPTTADGTPLNEVEGFASEPHAYVKLWKHHAAQPQADRINALAAKRGEAWLPR
FT                   YGGLISSEWEFAKGLQLLEESPETYRATAHWVEAADWIVWQLCGEYVRNACTAGYKGIF
FT                   QDGTYPTREFLAELHPDFEGFVEDLLQPVTGQLGRPAGRLTEEAAAWTGLPAGIVVAVG
FT                   NVDAHVTAPAAQSTESGQMLAIMGTSTCHIMNGAVLREVPGMCGVVDGGITQGLWGYEA
FT                   GQSGVGDIFNWFVTNAVPAAYAEEAAARGVDVHELLTEKAAAQAVGEHGLVALDWHSGN
FT                   RSVLVDHELSGLVLGLTLTTRPEDVYRALIEATAFGTRTIVETFGASGVPVTEFVAAGG
FT                   LLKNQFLMQVYADVLGMPISVITSEQGPALGSAIHAAVAAGAYPDVHAASAAMGGVERG
FT                   AYQPDPVRAAAYDALYAEYRALHDHFGRGGTEVMRRLRSIRRATHTGAQA"
FT   gene            410564..411280
FT                   /locus_tag="Noca_0381"
FT   CDS_pept        410564..411280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0381"
FT                   /product="L-ribulose 5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: blo:BL0273 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79924"
FT                   /db_xref="GOA:A1SDN9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDN9"
FT                   /protein_id="ABL79924.1"
FT                   /translation="MNAVVSAESREAVRRLQAEVAALHAELTRNRLVVWTAGNVSARVP
FT                   GTDLFVIKPSGVSYDELDADTMVVCDLDGTLVEGARQPSSDTAAHAYVYRHLPEVGGVV
FT                   HTHSTYATAWAARGEPIPCVLTMAADEFGGEIPIGPFALIGDDSIGRGIVETLRESRSR
FT                   AVLMQNHGPFTVGPDARSAVKAAVMVEDVARTVHVARQLGAPLPIAQEHVDALYDRYQN
FT                   VYGQTQQTQQQTGGVA"
FT   gene            411277..412785
FT                   /locus_tag="Noca_0382"
FT   CDS_pept        411277..412785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0382"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: aba:Acid345_0326
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79925"
FT                   /db_xref="GOA:A1SDP0"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDP0"
FT                   /protein_id="ABL79925.1"
FT                   /translation="MTHHPDELEIWFLTGSQHLYGPEVIDQVAEHAARIVAALDASPHL
FT                   PVRVVSKPVLTETDSIRRALLDATATDSCVGVIAWMHTFSPAKMWITGLDALRKPLLHL
FT                   HTQANQALPWAEIDMDFMNLNQAAHGDREFASVQTRMGVARKTVTGHVEDPEVARRIGL
FT                   WARAALGRHALAGMRLARFGDNMRNVAVTEGDKVEAERRFGVSVNTWGVNDLVAVVDEV
FT                   ADADVDKLCEEYADSYDVAAELLPSGERHESLRYGARIELGLRSFLTEGGFTAFTSNFE
FT                   DLGGLRQLPGLAVQRLMADGYGFGGEGDWKTSVLLRTLKVVADGLPGGTSFMEDYTYHL
FT                   VPGEERILGAHMLEVCPSIAEGRPSLEIHPLSIGGREDPVRLVFDAAPGPAVLLGLADL
FT                   GERFRFVGNEVEVVAPTEPLPNLPVARAVWRPAPDLRTSTEAWLMAGGPHHTVLSTALG
FT                   AEHLDDLAEMTGTELVLVDADTTIRGLAKELRWSAAYHRLAQGL"
FT   gene            412854..413939
FT                   /locus_tag="Noca_0383"
FT   CDS_pept        412854..413939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0383"
FT                   /product="multiple monosaccharide-binding protein"
FT                   /note="KEGG: ret:RHE_CH03165 xylose ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79926"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP1"
FT                   /protein_id="ABL79926.1"
FT                   /translation="MRKLLTTIVAGSLALTLAACGGDDDSKGEEGSGGGGTIGVAMPTK
FT                   SSERWIADGNNIKKQLEDAGYSVDLQYAEDDIPTQVSQVENMVTKGVDMLVIAAIDGTA
FT                   LGEVLDTAASQDIDIISYDRLIRDSEAVSYYTTFDNFQVGVIQAQSLVDGLAAKGDGPY
FT                   NVELFAGSPDDNNATFFWNGAMSILQPMLDSGEIVVPSGQTDFDQAAILRWDPATAQKR
FT                   MEDILTKTYASKTVDGVLSPYDGLSLGIIAALQGNGYGGGGKELPVVTGQDAEVQSVKS
FT                   IMAGEQYSTVFKDTRDLAEVTVDMIKALSAGDEPEVNDTETYDNGVKVVPSYLLDPVLV
FT                   TKDNVQTALVDTGYYTADELK"
FT   sig_peptide     412854..412940
FT                   /locus_tag="Noca_0383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.847 at
FT                   residue 29"
FT   gene            414015..415544
FT                   /locus_tag="Noca_0384"
FT   CDS_pept        414015..415544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0384"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: lxx:Lxx00320 multiple sugar (arabinose, xylose,
FT                   galactose, glucose, fucose) putative porter; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79927"
FT                   /db_xref="GOA:A1SDP2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP2"
FT                   /protein_id="ABL79927.1"
FT                   /translation="MAQPILEMRSITKRFPGVLALSDVNLAVERGEIHAICGENGAGKS
FT                   TLMKVLSGVHPHGTYEGEIVYEGQPVEFSNIRQSEAAGIVIIHQELALIPELSIAENIF
FT                   LGNETATRGVINWDEANSRAIELMARVGLRENPLTAVKNLGIGKQQLVEIAKALSKEVR
FT                   LLILDEPTAALNDEDSNHLLDLLKGLQGKGITSIMISHKLNEIARISDSITILRDGKTI
FT                   ETLNVGAGGVDEDRIIRGMVGRSLEHRFPDHTPQIGGVLLEVRDWTVMHPLDHSRVVID
FT                   KASLSVRRGEIVGIAGLMGAGRTELARSLFGRSYGSKHHGTVHLDGKELRLKTVHDAIR
FT                   AGIAYVSEDRKGLGLNLLDDVKTSISSAGLDQLRKGLTVDEREEVLVAERYRRSFGIKA
FT                   PSVTTGVRQLSGGNQQKVVLGKWLYTEPQLLILDEPTRGIDVGAKFEIYGIIQTLAREG
FT                   KGVLVISSELPELLGLCDRIYTLAEGVITHEFVRGGATQESLMRYMTADAR"
FT   gene            415548..416837
FT                   /locus_tag="Noca_0385"
FT   CDS_pept        415548..416837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0385"
FT                   /product="multiple monosaccharide ABC transporter membrane
FT                   protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG: sco:SCO2406
FT                   putative sugar transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79928"
FT                   /db_xref="GOA:A1SDP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP3"
FT                   /protein_id="ABL79928.1"
FT                   /translation="MSTLTTTLRGNIRQYGMIIALAAIVILFQFTTDGVLLKPLNVSNL
FT                   VVQNAHILILAIGMVIVIVARHIDLSVGSVAAFVGAVGAILMTKYDVPWLLAVILCLAL
FT                   GALIGAWHGFWVAYVGIPAFIVTLASMLLFRGLTLVVLEGATVGGLPEGFKKIGNGFLP
FT                   EIGPDTDLHNLTLLLGLLVVALLVFFDFRKRTAAKRYNFEVLPIPLFALKQIVLGAVIM
FT                   EFSYLLADARGLPIVGLILFTLIGVYTFIMSRTIFGRHVYAIGGNVDAATMSGVNTKRV
FT                   DFLVMTNMGLLAGLAGLVTTARLTAANPKAGVNFELDAIAASFIGGAAVTGGVGTVIGA
FT                   IIGGLVMGVLNNGMSLNGVSIDWQQAIKGLVLLGAVAFDVWNKKRTAGSGGAGAEAEAT
FT                   PPPPDELVEEIRNLEADAGPPGHGSGAGVR"
FT   gene            417242..417910
FT                   /locus_tag="Noca_0386"
FT   CDS_pept        417242..417910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0386"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="PFAM: thymidylate kinase; KEGG: pac:PPA0243 putative
FT                   thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79929"
FT                   /db_xref="GOA:A1SDP4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP4"
FT                   /protein_id="ABL79929.1"
FT                   /translation="MSTGPAAARPGVYADTGVFVCLEGGEGSGKSTQSGLLRDWLETQG
FT                   FEVLLTFEPGDTEVGRKLRAIVLSPETGAISDRTEALLYAADKAEHVDTVVQPALDRGA
FT                   VVITDRYVASMLAYQGAGRALDVGEVEQVARWATHDLRPHLTVVLDLEPEHGLGRFEER
FT                   DRIEGESVEFHRRVREGFLGMAAADPDHYLVLDARGDREEIAGRVRDRVAPLLDRAARR
FT                   "
FT   gene            417907..419064
FT                   /locus_tag="Noca_0387"
FT   CDS_pept        417907..419064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0387"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: pac:PPA0244 DNA polymerase III delta' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79930"
FT                   /db_xref="GOA:A1SDP5"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP5"
FT                   /protein_id="ABL79930.1"
FT                   /translation="MTVWDGLVGQHRPSEALRAAAHGQGMSHAFLFTGPPGSGRSNAAV
FT                   AFAAALQCERPEDRGCGECHECHTVLTGSHADVAVIRTEKLSIGVDEMRDLVRRSALAP
FT                   VGRRWQIMIVEDADRLTERAWNALLKAIEEPADRTVWMLCAPTVEDVLPTVRSRCRLVT
FT                   LTTPTTDDVASFLVRADGVDAAVASYAARASQGHIGRARALARDEATRNRRREVVALPA
FT                   RLVSLRACMEAATSLAEVAKQEAELVTGELDAREKADLDAAYGVVERGRRPREYAPALR
FT                   DLEKDQKTRAKRRYLDVVDRGLMDLVSVYRDAIAVATGAAGLLVNEEIRGDVELLARVS
FT                   TPEVNLRRIAAIFEAREQMLEFNVQPMLALESMMVALVAPEVRTG"
FT   gene            419061..420626
FT                   /locus_tag="Noca_0388"
FT   CDS_pept        419061..420626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0388"
FT                   /product="tripeptidyl-peptidase B, Serine peptidase, MEROPS
FT                   family S33"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: sco:SCO3540 proteinase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79931"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP6"
FT                   /protein_id="ABL79931.1"
FT                   /translation="MRRLLVVLVVVALVVGVGGVAVLVALGPGDPSDPGSAPRTDVPTT
FT                   VPEPAATQPPSPGLTPFYSQALAWSVCPDDDALCATLTVPLDYRRPRGKTIELALLKVP
FT                   AEDPGRRIGSLVVNPGGPGAPGTDYAASANTVFRQPLLDVYDIVGFDPRGTGDSAPIDC
FT                   LTDDQLDDYIATDPDPDTPAEVASYEGWVQAFGEGCAERSGRLAAHVTTIEAARDMDVL
FT                   RAALGESTMTYFGASYGTKLGATYADLFPDKVGRLVLDGAVDLSIGSRELSLEQAAGFE
FT                   TALRAYVANCVEQTDGCFLGDTVDAGLQRIRDFIDAVDAHPLRGSGDRLLDVGNAFYGI
FT                   VLPLYSREYWTILSQALRLGFQGDGSALLQLADLYNSRGPDGYRDNASEAIYAINCLDD
FT                   PYAIPPEQVPANLPDFEAASPTFGSVFAWGLTTCGGIQVHSTEKPRTVRAAGAAPIVVI
FT                   GTTRDPATPYDWAVHLAQQLDSGVLVSRDGDGHTGYNSGNDCVDEAVEAYLIDGTVPED
FT                   GLSC"
FT   sig_peptide     419061..419213
FT                   /locus_tag="Noca_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.284 at
FT                   residue 51"
FT   gene            complement(420751..422100)
FT                   /locus_tag="Noca_0389"
FT   CDS_pept        complement(420751..422100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0389"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: nfa:nfa30780 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79932"
FT                   /db_xref="GOA:A1SDP7"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP7"
FT                   /protein_id="ABL79932.1"
FT                   /translation="MSDVVVVGAGLSGLAAARRLQAAGRSVVVVEARDRVGGRTEAGAL
FT                   SDGQWIELGGQWVGPTQDRMYELIAELGLATIPTYNDGDIVFSLCGRHGRLAGRKGAVP
FT                   RLNPFAIADLAQGTLRFARLARRVDLDRPWDTERAAALDGQTFRTWVQRNLRTPQGRAY
FT                   FELYCEAVFSADLSDLSLLHALFYTHSGTDMDTLMAVDRGAQQDRIDGGSWRISQRLAE
FT                   GLDVRLGQPVRSVVQDAAGVRVVTRDGTSYDADRVIITLPPALAGRLEYDPPLPSWRDQ
FT                   LTQKVPAGSVFKVYAVYPTPFWREDGLNGQAGSDLGPVKVTFDNTPPGYDRGILMGFIE
FT                   AADGREWARRTPEERRAAVVDCFVRYFGPRAAEPLEYVERDWMAEEFTRGCYGAHFAPG
FT                   VWTGFGHALREPVGRLHWAGAECSPVWNGYMEGAVRSGEATADEVHALLG"
FT   gene            complement(422097..423287)
FT                   /locus_tag="Noca_0390"
FT   CDS_pept        complement(422097..423287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0390"
FT                   /product="peptidase U34, dipeptidase"
FT                   /note="PFAM: peptidase U34, dipeptidase; KEGG: pae:PA4677
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79933"
FT                   /db_xref="GOA:A1SDP8"
FT                   /db_xref="InterPro:IPR005322"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP8"
FT                   /protein_id="ABL79933.1"
FT                   /translation="MCDTIVFRTDSGMVLAKNSDRDPNEAQLWEWTPAATHEAGARSRT
FT                   TYVDLPQVACTHATVVSRPWWMWGAEMGANEHGVAIGNEAVFTKQRTSLEPGLLGMDLL
FT                   RLALERAASAREAVEVIVALLEEHGQGGACSAEHRRFTYHNSFLVADRDGAIVLETAGR
FT                   HWASEDVTGARSISNGLTIAGFAERYADRLRGRVAGCAGRRSLTERRAGGAEGVLDAIS
FT                   ILRDNGTDGGPRWSLLNGSMVGPNMHAGGLLASSQTVSSWVSDLGSGLHWATGTADPAL
FT                   SLFVPLRVDQPLAETAYPTAGVDNRRDDRSLWWRHERLHRTALCDWTGVEARLAAERDE
FT                   TQRRWVAHPVPTATALAEAEVLREKWTAAAEAGTGDTRPAWVRRRWAGFELKAVGR"
FT   gene            complement(423351..423755)
FT                   /locus_tag="Noca_0391"
FT   CDS_pept        complement(423351..423755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0391"
FT                   /product="Limonene-1,2-epoxide hydrolase"
FT                   /note="PFAM: Limonene-1,2-epoxide hydrolase; KEGG:
FT                   nfa:nfa48080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79934"
FT                   /db_xref="GOA:A1SDP9"
FT                   /db_xref="InterPro:IPR013100"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDP9"
FT                   /protein_id="ABL79934.1"
FT                   /translation="MTPEQTVRAFLEHLSRAESEAALALLDADVEWRNTAMPTFRGERV
FT                   RQMIGDMERRGVGFEVRWHHVAATGEPDNGTVLTDRTDVLRYSGWETSFRVRGTFTVQD
FT                   GRITLWDDAFSWLELLGSGVAGLGKMLTSR"
FT   gene            complement(423752..424702)
FT                   /locus_tag="Noca_0392"
FT   CDS_pept        complement(423752..424702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0392"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: csa:Csal_1417 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79935"
FT                   /db_xref="GOA:A1SDQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ0"
FT                   /protein_id="ABL79935.1"
FT                   /translation="MLSLHQLTCFLATYEHGSLTAAAEELGYAQPSVSEQIRALEKTLG
FT                   VQLFRRVGRGVVPTTVADTLRPHAEKVLATVDEAAQAVQSVKSLETGTIRFGMFGIARL
FT                   YAGAGLIGDVLSRYPGVRVELVGQNSTEVAEDLRRGRLEAAMLAVSGIQSEGMTVTPVA
FT                   REELVYISADPTRLATPVTPHRLSQASLVMSETTYRAVDSTRATLRQMLHETGHNPATR
FT                   IEVEDIETAVELVGMGYADSVVPKGAALQLLPRLAPEAGWVALRPRQYDTFAVVHRTGA
FT                   ILSPAARLMIDLATARIQAIAEPVTARAARATVGA"
FT   gene            424809..424991
FT                   /locus_tag="Noca_0393"
FT   CDS_pept        424809..424991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79936"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ1"
FT                   /protein_id="ABL79936.1"
FT                   /translation="MFDHHCTACDQRKLIFPSQVTGLANTDHGIVVTFTCWCGAEQTML
FT                   TGRRAARAPKATLAA"
FT   gene            425150..425225
FT                   /locus_tag="Noca_R0011"
FT                   /note="tRNA-Thr1"
FT   tRNA            425150..425225
FT                   /locus_tag="Noca_R0011"
FT                   /product="tRNA-Thr"
FT   gene            425549..426130
FT                   /locus_tag="Noca_0394"
FT   CDS_pept        425549..426130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79937"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ2"
FT                   /protein_id="ABL79937.1"
FT                   /translation="MEKQSFGLISASGGKGGREGKAARSGAKSGRSTTTVDKSAQFRLR
FT                   SATKGERRVSSSALRRDTRPTLDLLQDTDAVAVTHYNEVEGYLVAPDRYLGLVARVEEA
FT                   DERESELASTMTVLLAAARTGVAVPSEMLERVMPRVDVAERWREIAEFAATFPTRITAG
FT                   EHGEPITRAHLSHVGGPIEEFGSDDDLNLG"
FT   gene            426148..426810
FT                   /locus_tag="Noca_0395"
FT   CDS_pept        426148..426810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79938"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ3"
FT                   /protein_id="ABL79938.1"
FT                   /translation="MAEETQGSASDAWYPAPAGYWVPAEEADRPDVWPHRFGDLFRAPP
FT                   SDANGTPLTTSDGRPWDAVMVYSPSCEVISKAKQSDSVEVVRVVRLDTQDPKAAAAIIG
FT                   GWQERQGRIGVAYAHTVFLAAVAGHPTHDYPMFAHLKSTVRVALGDLRAAGRIAALTHD
FT                   ARIAVIRRDLYYRYRWLVPIEEVKAAEIDRISNDPHFTPPRPGWAPDASEENAETHG"
FT   gene            427097..427459
FT                   /locus_tag="Noca_0396"
FT   CDS_pept        427097..427459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0396"
FT                   /product="DGPFAETKE family protein"
FT                   /note="PFAM: DGPFAETKE family protein; KEGG: sma:SAV1196
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79939"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ4"
FT                   /protein_id="ABL79939.1"
FT                   /translation="MTHYLLSVHGPAERNEFGNYDSREEMEEAFAATGAFNDKLHAEGY
FT                   WVFAGGLEAASTATVVDGQGETPLITDGPYLETKELIGGFWIIDAPDLDVALDLAAQGS
FT                   KACRGKVEVRPFEGLA"
FT   gene            427653..428579
FT                   /locus_tag="Noca_0397"
FT   CDS_pept        427653..428579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79940"
FT                   /db_xref="GOA:A1SDQ5"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ5"
FT                   /protein_id="ABL79940.1"
FT                   /translation="MRKILPALLIVVGTFFLVVAIVALTWVPGQVERTPLDTDNVTDLS
FT                   GTAGVFSGGDALDEGPVKAWSTNAVDSEASDDDNVVFNTSLCLVHDEGGIDGCVDADDP
FT                   QGRLISAETTLFVTDRHTAMTVDNDGYLPETAPQLEGLQNKWPFDAQKKAYPVWDDIIA
FT                   GTVEAEYLGEDEIDGLKVYKYEYHATADSVVVAGDITGTYDATYTFYIEPRTGSIIKQV
FT                   VHQERVADNGTPLLELDLAFTDEQVQKNVDDANEAISTLRLLEDIVPIVGLAAGIPLIL
FT                   LGLALLLLARRRRTAAPADQPKATAGA"
FT   sig_peptide     427653..427730
FT                   /locus_tag="Noca_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.549 at
FT                   residue 26"
FT   gene            complement(428636..429280)
FT                   /locus_tag="Noca_0398"
FT   CDS_pept        complement(428636..429280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0398"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: cpf:CPF_1051 L-fuculose phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79941"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ6"
FT                   /protein_id="ABL79941.1"
FT                   /translation="MHVSEADARAAVCEVGRRLWQRGMVAANDGNISVRVDPDSFLCTP
FT                   TGVSKGTLRPEDLPVVDGTGQLLGGGDVRPSSEIRMHLRVYAVDPQVHAVVHAHPMYST
FT                   VWAIKGEGLYGPMMPETVVAMPEVPLASYATPSTDAVPDSIEPFVLSHRACLLEHHGAL
FT                   TWGTDLEQAYLAMERLEYTAQVTFLLRQIGGARYLPAAEVARLNTIFNTGR"
FT   gene            complement(429287..430168)
FT                   /locus_tag="Noca_0399"
FT   CDS_pept        complement(429287..430168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0399"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   cch:Cag_1641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79942"
FT                   /db_xref="GOA:A1SDQ7"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ7"
FT                   /protein_id="ABL79942.1"
FT                   /translation="MADLEGNLAAKDFGLDRPQQVEGFHIKGASQLDFGMRHRLSRIFG
FT                   ADGRTVMLAFDHGYFQGPTSGLERVDLNIVPLAPYADALMATRGIIRSVIPASCDNALV
FT                   VRASGGPSILNDLSDERIAMDITDAVRMDAAAVAVQVFIGSDHETQSIHNLTQLVDAGL
FT                   GAGVPVLGVTAVGRDMVRDARYLGLATRIIAELGAQLVKTYYCEDFAQVTAACPVPIIM
FT                   AGGKKLPVLDALNMARKAVDEGAAGVDMGRNIFQRRDPHAMLQAVRSVVHDEWSPEKAA
FT                   ELYRDLSHGAED"
FT   gene            complement(430197..430586)
FT                   /locus_tag="Noca_0400"
FT   CDS_pept        complement(430197..430586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0400"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: btk:BT9727_2719 conserved hypothetical protein,
FT                   possible polyketide synthesis domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79943"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ8"
FT                   /protein_id="ABL79943.1"
FT                   /translation="MKSGSTNDLEYRFGDHGPAYVIRDPSSEIGVLRLRPGDDMTNHIH
FT                   HFCDESFIVLEGSATLWVGCERRYLLGVGDVYRCSPGEMHYFVNETDAPFRMVFVKSPA
FT                   SPGDTVNLPWTPGQPAPHVPETPAL"
FT   gene            complement(430624..432582)
FT                   /locus_tag="Noca_0401"
FT   CDS_pept        complement(430624..432582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0401"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: syn:slr1208
FT                   short-chain alcohol dehydrogenase family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79944"
FT                   /db_xref="GOA:A1SDQ9"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDQ9"
FT                   /protein_id="ABL79944.1"
FT                   /translation="MPFAMSPAASAALTDLVRVSRLLGADPALVLHGGGNTSLKATTTD
FT                   LTGSTVDTLFVKASGHDLASIDAAGFAPLRLARLREILPPVVVPDDLLINELRCALLDA
FT                   AAPDPSVETLLHALLPRPAVIHSHADALLAVANTPDGRERLADLFGDRVILVDYAMPGP
FT                   DLVAACAAAWSREGGNHTQGVVVLGHGLFTVGSTPDEAYQHHVDLVTDVAGLLRASSTR
FT                   GQSQPAAPLPPADPLAVARLRQSLSRAAGHPMVVTSHRDNEVASFVGDDRLLAAAQRGP
FT                   LTPDHVIWTKHSPMIGTDLDAFVRAEDDYFTRHATRRGRTLLRLDGAPRVVLDRTLGML
FT                   TAGRTAGEAARTADIYRHTLGAIELAEALGGYRPVEEEHVFDLEYWSLQQAKLSRKDSH
FT                   RPLSGQVAVVTGAASGIGHACAVSLLESGASVVGWDVSPSVRDAISSPEWLGLAVDVTD
FT                   SAAVTEAIQRGVEAFGGVDILVVAAGIFPTSANLGEMSMQAWRRAMAVNVDAVADLYGQ
FT                   IHPFLAAGTPYGRVVLIASKNVAAPGPGAAAYSASKAAVTQLTRVAALEWAPHGIRVNM
FT                   IHPDAVFDTGLWTPELLEARAEHYGMTVEQYKRRNLLSTEVTSKAVGDLAVTLAGPAFA
FT                   ATTGAQIPIDGGNERVI"
FT   gene            complement(432727..433446)
FT                   /locus_tag="Noca_0402"
FT   CDS_pept        complement(432727..433446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0402"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   tte:TTE0461 Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79945"
FT                   /db_xref="GOA:A1SDR0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR0"
FT                   /protein_id="ABL79945.1"
FT                   /translation="MRTRNTLASRIAEDLRGDLSAGTYGPGSRLPTEAQLSENFGVSRP
FT                   TVRAALRELEALGLVQTQHGVGTFVVEQPAVRAGLEGMDSITDSIRATGKVPGMVYATR
FT                   LLRPVLPEEAAFMGVSGDTEVLELRRKLLADGEVVAYSYDLLPATLLPDGFDIQTLEGS
FT                   LFAFLRGVLRIEPDHGVAEVHAVHSDHVGWGDEAKAHDLFVLLNQLHYAGDDRLILYSR
FT                   TYFIEGRYSFTIFRNHR"
FT   gene            433600..434634
FT                   /locus_tag="Noca_0403"
FT   CDS_pept        433600..434634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0403"
FT                   /product="translation initiation factor 2B subunit I family
FT                   (IF-2BI)"
FT                   /note="KEGG: fal:FRAAL1411 methylthioribose-1-phosphate
FT                   isomerase (MTR-1-P isomerase); TIGRFAM: eIF-2B
FT                   alpha/beta/delta-related uncharacterized proteins; PFAM:
FT                   initiation factor 2B related"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79946"
FT                   /db_xref="GOA:A1SDR1"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR1"
FT                   /protein_id="ABL79946.1"
FT                   /translation="MVLALQWQEDAQTIRLLDQTLLPVEERYLDVDTVDALVAAIQSLA
FT                   VRGAPALGAVGALGVVVAMRQAEREGWDDERLQVEVDRIRLARPTAVNLAWGVDQVRAA
FT                   MPSGPETVLKMAKAVVEEDEAANRTLSRLGADWILGRTGRERVRVVTHCNTGALATSAW
FT                   GTAYGIIHELHDRGALEVVYVDETRPLLQGARLTSWELTRDEIPHLLEVDGAASSTIVR
FT                   GLVDVAIIGADRITANGDTANKVGSLALALACQRAGIPFVVAAPSSTVDLATAHGDDIA
FT                   IEERDAAEVLSLGGHPTALPSTRVYNPAFDVTPHDLISAIVTDRGVVEPAARPAPNLLA
FT                   SVAS"
FT   gene            434682..435788
FT                   /locus_tag="Noca_0404"
FT   CDS_pept        434682..435788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0404"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: ret:RHE_PB00122 probable sugar ABC
FT                   transporter, substrate-binding protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79947"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR2"
FT                   /protein_id="ABL79947.1"
FT                   /translation="MRMNKLIVAGVAAVSALSLAACSQGSGATTAEPKAQDSASVQAAS
FT                   GDAPAPFDQAGVRVAIVQNSGQGDYFQQYLNGTKQQAAALGIDLSVYDAQGDNATQATQ
FT                   LDQAISSGVQGIIVRHGFPDTLCPGVNKAIDQGIKVVIYDVEIQKCAPQAVQTQQSDNK
FT                   MASLVLDKMAEDIGTGKPVGYVNVAGIAPLDRRDLVWQDYLATNDWTQKFKTGKFTNST
FT                   ATDTAPMVDSVLKSNPDVVAVYAPYDELTKATLSALKQNPSLQGKVKVYGADISTADIE
FT                   LMTNPDSPWVATGATDPNAIGAAVVRTLALHMAGELDGLNVEFPPILVTQDFLRSEGIK
FT                   NMDDLRAAEPALNIADVSSADWIPAVTF"
FT   sig_peptide     434682..434774
FT                   /locus_tag="Noca_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.335 at
FT                   residue 31"
FT   gene            435846..437378
FT                   /locus_tag="Noca_0405"
FT   CDS_pept        435846..437378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0405"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: psp:PSPPH_2279 ABC transporter protein, ATP binding
FT                   component; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79948"
FT                   /db_xref="GOA:A1SDR3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR3"
FT                   /protein_id="ABL79948.1"
FT                   /translation="MLSNPSPDEPLPALRLHDIAMSFGTNAVLKGVTMALYPGTVTALL
FT                   GANGAGKSTLIKILAGVYSGNGGTIEVAGEPVVLDSPLAAAQHGIQTVHQHIGASIIPG
FT                   LSVAENLVFEEIVQGQIPAVRSHAKLLPRAREIAATLDLGWSDATLRSDVFELGIADGQ
FT                   LLLLARALVHRPKVLILDEPTSTLSQAEADRLFDVIKRLCREGVAILYVSHHLDEIRSL
FT                   ADQLVVLRDGRIHDVQRQPFDMAQAIRSMLGKQVALDAETLVERRGTAAALELRGVQLL
FT                   RRSRQFDLDIRYGEVTGVVGLIGAGKSELARGIFGADKFRAGTVRFDAKAYRPRQPADA
FT                   VGQGIYLVPEDRASEAILPGWSIAWTTTLPFVARLSRAGILNLPRERSSARSVIDAFGV
FT                   VSTGADQPVDALSGGNQQKVVVGRWLNQSPRVILLDEPFRGVDIGARRDICRKAREASE
FT                   GGSCVVVFSSDVDEIREVADRIIVLVEGDVRLDSYTSEVDSEAIVKSMSEVA"
FT   gene            437378..438463
FT                   /locus_tag="Noca_0406"
FT   CDS_pept        437378..438463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0406"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG: mlo:mlr7287
FT                   ABC transporter, permease protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79949"
FT                   /db_xref="GOA:A1SDR4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR4"
FT                   /protein_id="ABL79949.1"
FT                   /translation="MPQIESSVLPTEATGSSRVMRPEDDVLSTGTRVRDAVVKYGFIAV
FT                   TVGLFAYFALSEPSFRTSGALFSMLKFASVTAILGLGMTFVMAVGGMDLSIGSTAGLSV
FT                   QMAAMTMVFYNLNGGAAVVVVLLAGVAVGLLNAVLIVLCKIPDLLATLGVMFVIQGSKL
FT                   IPVDGQSVASGMVLPDGTPAPGKFTESFLRIDGGTLGPVPYPVIMMLVLTTVSWFILAR
FT                   TKWGRIFYAIGANPEASRLAGVRVGLYRGLAYVLCSVFASIGGLILVSRIGQGDVNAGA
FT                   SSLLEAVAVALVGTSVLGMGKPNAWGTLLGALLIGIVLTGLTMKGFQYYYQDTAKGLVL
FT                   IVALLFSFTISRRKVRYTPAT"
FT   gene            438509..439738
FT                   /locus_tag="Noca_0407"
FT   CDS_pept        438509..439738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0407"
FT                   /product="5'-methylthioribose kinase"
FT                   /EC_number="2.7.1.100"
FT                   /note="TIGRFAM: 5-methylthioribose kinase; KEGG:
FT                   yps:YPTB0878 5-methylthioribose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79950"
FT                   /db_xref="GOA:A1SDR5"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR009212"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR5"
FT                   /protein_id="ABL79950.1"
FT                   /translation="MMSDYEFLTVDTVASYIESRPVLASRVDTVALASVEEIGDGNLNL
FT                   VFLVKDRHGRGLCLKQALPYVRMTGEAWPMTPDRARHEVESLRAHHALIPDHVVEVFDY
FT                   HPERYIIAMEDLSDHRVWRGALNEGLRHDGAAEAMGAYVGAVAFGTSAFGLERHALADA
FT                   VSASVNPALCTITEDLVFTEPLVDAGRNSVLPANEKDAAELAADDAMVRAMGRAKWLFM
FT                   TQAEALIHGDLHTGSVMVRAVDGSSRCDSVKAFDSEFAFYGPVAFDLGALWGNYAIAAA
FT                   RALALGQDERAAWALGLVQQTWDGFEGEFRRRWPSRLDARVWRDDTLQDLLREWENEAW
FT                   LFAAAKMSRRIVGAAKTADIETLPEELREGAARGVLRAARTLVRHSTSENGPRVVAGRV
FT                   GEVLAEHCTR"
FT   gene            complement(439817..442225)
FT                   /locus_tag="Noca_0408"
FT   CDS_pept        complement(439817..442225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0408"
FT                   /product="Thrombospondin type 3 repeat"
FT                   /note="PFAM: Thrombospondin type 3 repeat; KEGG:
FT                   ade:Adeh_3645 outer membrane protein, OmpA/MotB family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79951"
FT                   /db_xref="GOA:A1SDR6"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR6"
FT                   /protein_id="ABL79951.1"
FT                   /translation="MDRKSSLVLLLLLALALVGMGAPAASSPSSEFVRPSWGDGQLPAG
FT                   CVVDRDPLNPDNLCYHMKVGLNALDSPKVDVDVLVPVSPAAERDMRVAEQAVMMWEGGL
FT                   HHLADQMDLPWLKDGFDMNVRTHQVVVDPTGALQQPLALVDPEIVVIVSNPAGGVGIGI
FT                   DPVSFAGELGIIDGEGAPCAAVPSPLDFGTWTDKPGFEQHGREKGGVYVEDCGGVGGNV
FT                   CFAVNGAVDPVPGASDFFGLFDLVAHEFGHCLTLGHVGDGADGPWGPTPTNDIMAYSTD
FT                   PPGVAKCVSTLDVEGFALRMSRYLDVNGDGAVDRHDHLAPNDVRGDGFNSFQVQHPDDH
FT                   LYASSTGDPADCPQPELGPVPLSYGSWSPKPVATTRPVLRTSSLQVTNGHVHVRGDATN
FT                   EPLGKTPTQRSARATDATSDSPTPVTDLTGVQVSVTRRTVDATMSVTQVWPVAQGGSAT
FT                   AYSLLVSGRRFDSFICTGDTSGTPQVMDNGTGYYLPGGSATWNYDDNTVTFHIRRDYLA
FT                   DQQIEAPYTVNAITGLHARGNDWIATTDAAPDGAGLRLAAPPMGAETRDAPVARTVRTA
FT                   RVELTPEGGASVLPTDSTLGVGLVSAVDSRDYFDLPIAKQATAEVTLSWTGSTIFGLSV
FT                   NGGSGQQVAEQDGRITVTVPWARRDLSITVDPQEVVEPTTYTLTARLTTVRADHDRDRV
FT                   PDVADRCPTRPGPSASSGCPDTDADGILDRDDRCPTEASASASGCPTDGDERVVLIVDG
FT                   RRLAAQTVVTAHGSAAFTLDGVVGRGTHRVVLAWIRDGKVVARISRRAG"
FT   sig_peptide     complement(442145..442225)
FT                   /locus_tag="Noca_0408"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.401 at
FT                   residue 27"
FT   gene            complement(442294..443040)
FT                   /locus_tag="Noca_0409"
FT   CDS_pept        complement(442294..443040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0409"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   rxy:Rxyl_0706 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79952"
FT                   /db_xref="GOA:A1SDR7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR7"
FT                   /protein_id="ABL79952.1"
FT                   /translation="MTERLVAFVTGASSGLGRATARALARAGYDVALAGRDAEALSEVA
FT                   TAVRGAGAQALELAVDLAEGDAVEDAARRAVDQLGGVDVLVNAAATDSPGPASTLSREA
FT                   WDRVLAVNLTAPFLLARSLMGSMASRGGGLVVNVSSVAGRRGWAGASAYCSTKFALTGL
FT                   TQSLAAEGREHGVRVCCLYPGAMATSWGVFDPAARRTAEQPAPASVRESLAPDTVADLI
FT                   VWMATHPGAPVLNEVTVTPLLEQGWP"
FT   sig_peptide     complement(442963..443040)
FT                   /locus_tag="Noca_0409"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.592 at
FT                   residue 26"
FT   gene            complement(443037..443549)
FT                   /locus_tag="Noca_0410"
FT   CDS_pept        complement(443037..443549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_4078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79953"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR8"
FT                   /protein_id="ABL79953.1"
FT                   /translation="MKTPPPPAALATAAALAQRLLGGPRPARPARTAAAGLVGAASAGL
FT                   LVAAVEQFRRTGTTVNPLEPGTATDLVTTGANAVSRNPMYVGMAGVLVAHALLRGRWAA
FT                   LLPAAAFVVAIDRGQIAAEEAALRERFPGDYSTYAARVPRWVGLPGSRRTSDAGPHRRG
FT                   CRATVDS"
FT   sig_peptide     complement(443427..443549)
FT                   /locus_tag="Noca_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.487 at
FT                   residue 41"
FT   gene            complement(443569..444246)
FT                   /locus_tag="Noca_0411"
FT   CDS_pept        complement(443569..444246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0411"
FT                   /product="Vitamin K epoxide reductase"
FT                   /note="PFAM: Vitamin K epoxide reductase; KEGG: blo:BL0088
FT                   narrowly conserved hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79954"
FT                   /db_xref="GOA:A1SDR9"
FT                   /db_xref="InterPro:IPR012932"
FT                   /db_xref="InterPro:IPR038354"
FT                   /db_xref="InterPro:IPR041714"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDR9"
FT                   /protein_id="ABL79954.1"
FT                   /translation="MTHAPGTDKRSTGGLGTDEELAEGSRLHRLRHSRATVWVTMLVAS
FT                   VASLVASFVLSIDALRLAEDPNADLGCNINAVISCGTVANSWQSSLLGFPNAFLGLVTE
FT                   PVVITLAVASLAGIRFPRWFMLAAQAVYTVGLAFAYWLFYEAMFDIGALCPWCLLVTLA
FT                   TTLVFFEMTYVNIRDANLYLPRRVQAGLVAMVRSNLDLVLVVAWILVLVLAVVLKYGDA
FT                   LFA"
FT   gene            complement(444243..445073)
FT                   /locus_tag="Noca_0412"
FT   CDS_pept        complement(444243..445073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0412"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: nfa:nfa52230
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79955"
FT                   /db_xref="GOA:A1SDS0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS0"
FT                   /protein_id="ABL79955.1"
FT                   /translation="MSTAGHDHRPGLPKNDHRKSRMSKQGRIRTQQMREQQRIVEEQQA
FT                   RRRRLVTAVGAVVILGLVAAIVFAVVRTVTGDDDSAPAASGPLVAPANIEPSGSFAVGQ
FT                   DDAPVTVEIYYDYMCPACGAFEAANSGELDRLVADGTARIELRPISFLDEQSRGTRYST
FT                   RAANAFATVVHGAPDRAWAFHSALYENQPAEGTEGLSNDQIAAIARDAGVPDDVVEQFG
FT                   EGTYEPWTASVTQKAFDSGIQGTPTVVIDGEQFQGDVYTVGPLTEAIESAAGSQ"
FT   gene            complement(445255..445623)
FT                   /locus_tag="Noca_0413"
FT   CDS_pept        complement(445255..445623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79956"
FT                   /db_xref="GOA:A1SDS1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS1"
FT                   /protein_id="ABL79956.1"
FT                   /translation="MTEQTPADRAPSGDRTEPTAPDRAADPSGADRAVPDRASRWRTLV
FT                   RRPGPEGYLAAGLSALVVLVGLGGFLVGRASVDEQQGPTEVGQQWRRGPLPGDLPDPPF
FT                   GGDRDGGYGPGIVPGAPS"
FT   gene            445679..447970
FT                   /locus_tag="Noca_0414"
FT   CDS_pept        445679..447970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0414"
FT                   /product="peptidase S15"
FT                   /note="PFAM: peptidase S15; X-Pro dipeptidyl-peptidase
FT                   C-terminal domain protein; KEGG: nfa:nfa43000 putative
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79957"
FT                   /db_xref="GOA:A1SDS2"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS2"
FT                   /protein_id="ABL79957.1"
FT                   /translation="MCFLCWSCGCAGSGVRASGRTLRWQHHAMRRARRAATASLVLAAV
FT                   LAGARLGTTGASAAGPGDPAGFTLRPSVNQLYVLSATPGEQLELVGADGATVAAGTVDA
FT                   AGSLAWRELAAGGYAVRPAADPGAQSDPVTVGDFDDPAPPQSFYDAQTLAPGFGYVTTR
FT                   DGTTLSANVVLPPGPGPFPTVVEYSGYDPSNPANTTMAQLFNTLGYAYVGVNMRGTGCS
FT                   GGSFLHFEPIQSLDGYDVIEAVAAQPWAKFHRVGMVGISYPGISQLYVARTRPPHLSAI
FT                   TPLSVIDDTYRGTLYPGGILNTGFAVPWATERASQAAPYGQGWERPRVDAGDSVCEANQ
FT                   ALRLQNPDPLQLIEDNPYYSAKVGDPISPSLFVHRIDVPVFIAGAWQDEQTGGHFPALL
FT                   DDFASAPHVYASMANGSHTESLSLGVFGRYADFLDLYVARRVPTAAKTFVAPILAQSLT
FT                   GVAGLSLPPGPDYTGLTYRQALRSYQSADPVRILFEEGAAAGQPSGAPLPRFVRTFPSW
FT                   PIPSAAPTAWYLTSTGRLRATPSSTRPAAATPRSYRADPTALPETTYSGSSSGIWAAHP
FT                   DYDWRQIPDGTGLGWLSAPLRTDVVAIGTGSVDLWVRTPALDTDLEVTLSEVRPNGREV
FT                   YVQSGWLRASHRALDTARSTPVSPVHTDLEADVRPLPAGRYTKLRIELFPFAQAFRAGS
FT                   RLRLTVDAPGGARPLWAFDTIADGERVSVAADAVRRSRLVLSVVPGVRVPATAPACASL
FT                   RSQPCRSFPG"
FT   sig_peptide     445679..445855
FT                   /locus_tag="Noca_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.963 at
FT                   residue 59"
FT   gene            448056..448667
FT                   /locus_tag="Noca_0415"
FT   CDS_pept        448056..448667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0415"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   eca:ECA3669 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79958"
FT                   /db_xref="GOA:A1SDS3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS3"
FT                   /protein_id="ABL79958.1"
FT                   /translation="MSSVLVPPPHTRLEDLLSLVTGVYVVSLGLSFLQASGAVTGGTAG
FT                   LALLLSYATPIGFGVLFVLINLPAFAVAAWKKGWPFTVKSLACVVGVSFATRLQAEVLD
FT                   LPDLDKLYGVVAGNLLAGVGLLILFRHGASLGGFNIIALLMQEKLGLRAGYVQMVLDVM
FT                   VVLGSAFVVDPGIVVLSALGAVVLNIVLAFNHRPGRYMGL"
FT   gene            448743..449033
FT                   /pseudo
FT                   /locus_tag="Noca_0416"
FT   gene            complement(449692..450126)
FT                   /locus_tag="Noca_0417"
FT   CDS_pept        complement(449692..450126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV6755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS4"
FT                   /protein_id="ABL79959.1"
FT                   /translation="MGTEPLPTDLLGTWTLTRVVDDHLTGERRDVVGVTTLAVESPDRV
FT                   RWSEEGTMTWAGRSVPVSRTLYVERAGETWEVTFSDGRPFHPWSVGHRVGHPCGADHYD
FT                   GLIEVGPEGWSVEWRATGPEKDYVMTTVHSDRRAARRSSD"
FT   gene            450212..450643
FT                   /locus_tag="Noca_0418"
FT   CDS_pept        450212..450643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0418"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease H; KEGG: eli:ELI_01550
FT                   ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79960"
FT                   /db_xref="GOA:A1SDS5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS5"
FT                   /protein_id="ABL79960.1"
FT                   /translation="MPVPEGAREVFTDGACSGNPGPGGWAWALDTAVYASGREAPSTNQ
FT                   RMEIRAALEAVRSLDGPLLVVSDSTYVVHCFRDLWWQGWLDRDWVSSARKPVANRDLWE
FT                   PLVGLVQDRGDVAFAWVKGHSGHVMNDFVDRLAVAATRA"
FT   gene            450723..451823
FT                   /locus_tag="Noca_0419"
FT   CDS_pept        450723..451823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0419"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79961"
FT                   /db_xref="GOA:A1SDS6"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS6"
FT                   /protein_id="ABL79961.1"
FT                   /translation="MVRRVRLGRRDASRRARRWAGPPPLLLVATLIGFLVAPLVGHQPE
FT                   PPPAARIAAHVTAPGARDSVLTASPTHPRAVADRPPRQRVLSAAPSRAGHAAGAGLRPV
FT                   RLKRVHIGVASMNMYRKLSPAQAAHDARRLTRRPGLDVVGWQEADRFGRVLHSLPGWDT
FT                   KTFPFGRRNSEIAVSWRRSEFALVSARQRQVAQGVSWRDGRYPFGNRMVGVVTLRHRDT
FT                   GRLLTVVDAHLPQAIEDLSRPGRWTPTINAYRARNQLARIATTWRSAPGRWVVGTGDYN
FT                   FDARADARHRPRGGPRRALADTAVSSYQALGADVAPTFPSNGRRIDYVYVDRAAYRAEQ
FT                   MRFTGQWVVGGFASDHNALVTRLVLS"
FT   sig_peptide     450723..450884
FT                   /locus_tag="Noca_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 54"
FT   gene            complement(451816..452163)
FT                   /locus_tag="Noca_0420"
FT   CDS_pept        complement(451816..452163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0420"
FT                   /product="helix-turn-helix, HxlR type"
FT                   /note="PFAM: helix-turn-helix, HxlR type; KEGG: sma:SAV4875
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79962"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS7"
FT                   /protein_id="ABL79962.1"
FT                   /translation="MPFVRDLQLDTDCPDTRLLVEHVTSKWGVLVLLTLDDRTLRWSEL
FT                   KREIAGVSEKMLIQTLQVLEADGLVRRTALPVVPPHVEYSLTDDGRAAAAHLAPLVRWA
FT                   QARVGPRVAVS"
FT   gene            452287..453144
FT                   /locus_tag="Noca_0421"
FT   CDS_pept        452287..453144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0421"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; KEGG: lxx:Lxx16700
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79963"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS8"
FT                   /protein_id="ABL79963.1"
FT                   /translation="MSIVITGATGHLGRLVVEALLARGAEGIVATGRSVERLADLADRG
FT                   VRVERLDFDDVPESVDWLGAGDVLLLVSGSEVGQRLPQHRAVVDLAVRAGVRRIAYTSA
FT                   PAADDTTLAVAPEHAATEAMIRESGLPFTFLRNGWYTENYLPTFAQARESGLVIGSAGE
FT                   GRVASAPRSDFAEAAAVVLTTDGHEGAVYELFGDAAWTYGELAATFADVLGREVTYRSL
FT                   TPEAHREALLAAGLDEGTAGFVVALDQDIAAGLLGLSTGHLAKLLGRPTVPLRDTVSTW
FT                   AAQD"
FT   gene            complement(453119..454018)
FT                   /locus_tag="Noca_0422"
FT   CDS_pept        complement(453119..454018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0422"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: fra:Francci3_0236
FT                   modification methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79964"
FT                   /db_xref="GOA:A1SDS9"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022446"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDS9"
FT                   /protein_id="ABL79964.1"
FT                   /translation="MLTLGMAASSTMAGPAPDDALVATLRAAGCVFAEDEAALLAREAG
FT                   DEAALAAMVARRVAGEPLEQVLGFAEFLGLRVAVEPGVFVPRLRTTLLARRAIRALEPG
FT                   DLAVDLCCGTGAIGVALLAAVPGAEVHAADIDPAAVRCARRNLPPDRVHEGDLYDALPG
FT                   ELRGRVAVVVANAPYVPTGAIATMPPEARDHEHRVALDGGADGLEVARRVIAGARPWLA
FT                   PGGRVLVETSAAQRDLAAAHVVAAGLDVTVASAADVDGNVVIGRLHPERLSPERLSPEQ
FT                   LSPGQLSPGQLSPGRPRC"
FT   gene            454035..454358
FT                   /locus_tag="Noca_0423"
FT   CDS_pept        454035..454358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0423"
FT                   /product="conserved hypothetical protein; putative membrane
FT                   protein"
FT                   /note="KEGG: fal:FRAAL1608 hypothetical protein; putative
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79965"
FT                   /db_xref="GOA:A1SDT0"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT0"
FT                   /protein_id="ABL79965.1"
FT                   /translation="MVGYAALVAVLAVVAARRGERPGWLDQMAWMLEVLLLVRALAGLG
FT                   PLLGDDRPDSTSTYVGYLFASVCVLPIAMRSVAGDRAAWSSAVVAVAAVAVGVVAVRLQ
FT                   MTA"
FT   gene            454355..454762
FT                   /locus_tag="Noca_0424"
FT   CDS_pept        454355..454762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0424"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: tfu:Tfu_0355 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79966"
FT                   /db_xref="GOA:A1SDT1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT1"
FT                   /protein_id="ABL79966.1"
FT                   /translation="MSGDRRSGPHQVLLALYALFTLAAGARSIVQLTTQYDEAPVAYWL
FT                   SLGAAVTYALGWFAIRQASAGHTGFASVMLRVELGGVVGVGTLSLAVRDWFPDASVWSD
FT                   YGIGYGFVPAALPVAGLLWLRRQKRPALAAD"
FT   gene            454784..455962
FT                   /locus_tag="Noca_0425"
FT   CDS_pept        454784..455962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0425"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   rha:RHA1_ro03045 probable NADH-dependent flavin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79967"
FT                   /db_xref="GOA:A1SDT2"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT2"
FT                   /protein_id="ABL79967.1"
FT                   /translation="MTADVFAPTTLGPVRLRNRTVKAATFEGRAPHGQVTDELIDYHLA
FT                   VTHGGVGLTTVAYLAVAPEGRTHREQIVVGEPTLAGLTRLADAIHESGAAIAGQVGHAG
FT                   PVANGRSNGVKAISASRMPSPLSMQLIRSATEADLTRVTKAYVAASRLLVRAGFDVLEL
FT                   HMAHSYLISSFLAPGLNRRKDGWGGSLANRARLGRQVARAVRDEIGSDAAITAKVSVGD
FT                   GFRGGVTTDEGIEYAQLLEADGTLDALQLSGGSSLMNPMYLFRGEAPVREFAATMPLVV
FT                   RLGMKTPVGQSFLKAYPFEEAYFREKALRFREAVSMPLMLLGGINRLATMEQAMAEGFD
FT                   FVAMGRALLREPDLVDRLQSGRATAGVCIHCNRCMPTIYSGTRCPVIAPEPA"
FT   gene            456145..457266
FT                   /locus_tag="Noca_0426"
FT   CDS_pept        456145..457266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0426"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   rha:RHA1_ro02530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79968"
FT                   /db_xref="GOA:A1SDT3"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT3"
FT                   /protein_id="ABL79968.1"
FT                   /translation="MVSTGSATERTPPRPPLRVVVWSTGTVGRHAIAGIDAHPDLELVG
FT                   VWVSNPDKAGKDAGELAGLGRELGVCATTDKQQLLALRPDAIVHTAMTDDRVFEAIDDL
FT                   VDFLEAGVNVTSSGPVLLQWPEQILPPELMERITKAGERTGASLHVNGIDPGFANDVLP
FT                   LTLTSLSQRIDEVRVMEICDYSTYYQPVVMNDLFGFGKPMDQPGFLFAPGVLSMAWGSV
FT                   VRQLAAGLGITLDEPLTEDVDRRPAEVDTTSVSGDVAAGTMGAVRFQVIGKVDGVPRVV
FT                   LDHITRTAPDQVPEWPTPPDGDGCYRVVVTGEPFLQLDLTHHGENGDHNVSGMIVTAQR
FT                   IVNAVPAVVASPGGLVTALDLPLVTGTGLVSRA"
FT   gene            457322..458134
FT                   /locus_tag="Noca_0427"
FT   CDS_pept        457322..458134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0427"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_4362 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79969"
FT                   /db_xref="GOA:A1SDT4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT4"
FT                   /protein_id="ABL79969.1"
FT                   /translation="MILDRFSTEGQVAIVTGAGRGLGAATAVALAEAGSDVLISARTER
FT                   QLDQVAERIRATGRRALVVAADLSDLDAVAGLAQTAYDELGRLDTVVNNVGGTFPNAFL
FT                   DTSNEFLNEAFAFNVTTAHALTRAAVPLMLRDAGSVADAQKSVVTISSMMGRTADRGFI
FT                   AYGTAKAALAHWTRMAAQDLAPRIRVNGIYVGSIMTSALEYVAGRPELMSQLETKTPLG
FT                   RVGEPEDIAAGVVYLASRAGQYVTGKLLEIDGGIQQPTLDLGFPDVGS"
FT   gene            458144..459244
FT                   /locus_tag="Noca_0428"
FT   CDS_pept        458144..459244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0428"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rha:RHA1_ro04761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79970"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT5"
FT                   /protein_id="ABL79970.1"
FT                   /translation="MTPSTSPASTPTAFAVSPDSGEHWSKAGAWQVADGIHRIPLPLPM
FT                   DGLKAINVYVIESADGLTLIDGGWAIDVARDLLERCLRQVGYGFGDIRRFLVTHVHRDH
FT                   FTLATVLGHEYGADVALGLGEKPALDLLNDRLLDESPFLDVLRTAGANAIADLWAAGGE
FT                   RPDPAMWLLPDTWLEGDHEIEVGVRTLDAVHTPGHTPGHYVFAEQAAGLLFAGDHVLPT
FT                   ITPSIGFTVPPTPDPLGDFMASLTKVRALPDLKVLPAHGPVAPSSHARADELLSFHDRR
FT                   LEQSLAAIAEEPGTGFTVAHQLAWTRHEKAYDELDLFSQGMAAMEIKAHLELLVARGQA
FT                   TRADTPEGVLFSAVPAGAPGEDTLSG"
FT   gene            complement(459234..459677)
FT                   /locus_tag="Noca_0429"
FT   CDS_pept        complement(459234..459677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0429"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   rha:RHA1_ro06613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79971"
FT                   /db_xref="GOA:A1SDT6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT6"
FT                   /protein_id="ABL79971.1"
FT                   /translation="MITITAGPFTALDAPTAYAVWRLRQDVFVVEQECPYPDLDGRDDE
FT                   PDTRHVLLRDDDTLLGYARVLDEERDGQAVWRIGRVVLDRAVRGQGLADPLVQTALQVC
FT                   KDRDVVLDAQSPLAPWYATFGFEVSGPEFLEDGIPHTPMRLSR"
FT   gene            complement(459674..460591)
FT                   /locus_tag="Noca_0430"
FT   CDS_pept        complement(459674..460591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0430"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: eli:ELI_09720 esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79972"
FT                   /db_xref="GOA:A1SDT7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT7"
FT                   /protein_id="ABL79972.1"
FT                   /translation="MSPSRRHEALAWVVPRLRRSRDLGTPEAERARIERWHARLARRLP
FT                   TRVTPGFAKRFSVVTEVLTGRSGEFASYVVTPRGTDPRRTVVYLHGGGYVAPIDPFHVR
FT                   YLCRLATDLHARIVLPDYPLAPEHTWRDSHAAIADLTGRWVGDSDQLVLAGDSAGGGYA
FT                   LAIAQTLRDRGGPQPARLLLHSPWVDLTTATPETESFTVRDPWLFLGKLQAYAAWWAGS
FT                   TEDLGRPEVSPALAELGGLPPALMFCGTRDTLTPGCRLLARRAEQADWDLTYVEVHDLI
FT                   HVYPLLPFIPEAREARRRTMEFLR"
FT   gene            460688..461275
FT                   /locus_tag="Noca_0431"
FT   CDS_pept        460688..461275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0431"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   sma:SAV1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79973"
FT                   /db_xref="GOA:A1SDT8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT8"
FT                   /protein_id="ABL79973.1"
FT                   /translation="MPSTFRIPKATITGLYGKVVSAYARRTFGEIPDGLYVYFHHKPLM
FT                   RAVVGFEGKVAKWGALDPTLKSYAELASAGTIGCSWCLDFGYFKAHDEGVDLAKVSEVP
FT                   RWRESDVFTPLEREVLEYAEAMTATPPTVTDAMVARLVEQLGTPAVVELTQIVALENMR
FT                   SRFNSAAGLQSQGYSDVCELPLAVPSGDVRPA"
FT   gene            461272..462150
FT                   /locus_tag="Noca_0432"
FT   CDS_pept        461272..462150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0432"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: DNA gyrase C-terminal repeat, beta-propeller;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; Sigma-70, region 4 type 2; KEGG: sco:SCO2742
FT                   putative sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79974"
FT                   /db_xref="GOA:A1SDT9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDT9"
FT                   /protein_id="ABL79974.1"
FT                   /translation="MNATDSTDVFVDHRNLLFTVAYEMLGSAADAEDVLQETWLRWVEV
FT                   DREEVREARAYLVRIATRLALNRMRTNARRRESYVGPWLPEPLLTTPDVAEDVELADSV
FT                   SLAMLTLLETLGPTERAVFVLREVFDFGYDEIAAAVDKTPAAVRQIAHRARGHVAERRP
FT                   RAEATRSEREHVMATFLAAVATGDIQSLMDVLAPDVVLVTDGGGVKKAALRPILGRDKV
FT                   VRFLGAVSEGLDAVADVVVVNGAPALRIVLDGELDTVASMVVEDGLVTGLYVVRNPAKL
FT                   ARLDAVVTLTR"
FT   misc_binding    462310..462422
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 75.38"
FT   gene            462413..463492
FT                   /locus_tag="Noca_0433"
FT   CDS_pept        462413..463492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0433"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: sco:SCO5646 putative solute
FT                   binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79975"
FT                   /db_xref="GOA:A1SDU0"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU0"
FT                   /protein_id="ABL79975.1"
FT                   /translation="MRPIHALAPLAPLVALALAATGCSTIGNGSSGDESTASPGGEPGR
FT                   VVLVTHESFSLPKPLIKQFEQQSGYDLVVRASGDAGILTNKLVLTKGDPLGDVAFGIDN
FT                   TFASRALDEGVFAPYDAPLPDGADQYRLPGDDEHDLTPIDNASVCVNVDDTWFADHHLA
FT                   PPKTLDDLAAPEYQGLFVTPGAATSSPGLAFLLSTIAAYGEDGWQDYWARLMENGTKLT
FT                   AGWSDAYEVDFTQGGGQGDRPIVLSYDSSPAFTVADGESSTSALLDTCFRQVEYAGVLD
FT                   GAANPAGAEQLVDFLLSPEVQAALPESMYVFPVDSSVQLPKEWARFAKQPSDPFSVDPA
FT                   SIDEHRDEWLREWTDVTSR"
FT   sig_peptide     462413..462511
FT                   /locus_tag="Noca_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 33"
FT   gene            463526..465160
FT                   /locus_tag="Noca_0434"
FT   CDS_pept        463526..465160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0434"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sco:SCO5647 ABC transporter
FT                   integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79976"
FT                   /db_xref="GOA:A1SDU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU1"
FT                   /protein_id="ABL79976.1"
FT                   /translation="MRRSLELVGLAALPLAVLGVFFLLPVSGMVSEGFVTDGRFDPGGV
FT                   LEVLGRPRVHRVLWFTVWSSTVATLLAVLLGLPVAHLLHRRRFWGRRALRSLLLVPFVL
FT                   PTVVVGVAFRELIGEAGPLGFLGLDGSAVAIVAGLVFFNVAVVIRAVGAAWESLDPRPA
FT                   EAAAALGAGPAHVFRTVTLPALRPAIVSAASVVFLFCATAFGVVLTLGGLRYSSVETEI
FT                   YLLTTNLLDLQAAAALSILQLLAITALLVVTGRLRAVPDPALARSTRRPPRPAPGDWPG
FT                   LVATGLVLLLVGAPVAALVAGSLRVGDAWSLGNYRALTGEGTQHALLASATDALVTSLR
FT                   TAVDATWMSLSLGVLVTVVVTRRSRTRGERRARGLLDGLFMLPLGVSAVTLGFGFLITL
FT                   DRPPLDLRDSPLLVPIAQALVALPLVVRTLVPVLGGIDDRQRQAAASLGAGPLRTFATV
FT                   DLPAMWRPLTAAAGFAFAVSLGEFGATSFLAREDHPTLPIVIYHLIGHPGAMNYGMALA
FT                   ASVVLATTTALVMLAVDRLRVPSVGAF"
FT   sig_peptide     463526..463612
FT                   /locus_tag="Noca_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.564 at
FT                   residue 29"
FT   gene            465160..466158
FT                   /locus_tag="Noca_0435"
FT   CDS_pept        465160..466158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0435"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sco:SCO5648 ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79977"
FT                   /db_xref="GOA:A1SDU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU2"
FT                   /protein_id="ABL79977.1"
FT                   /translation="MLALDHLSVSYDGVPAVVDATLELADGHVLAVLGPSGSGKSTLLR
FT                   AVAGLEPAVAGRICWDGADLAHVPTHKRGFALMFQDGQLFNHLTVARNIGYALRLRRTP
FT                   RAAERVAELLALVGLEGYAERLPATLSGGERQRVALARSLAVAPRLLLLDEPLSALDAG
FT                   LRERLAVDLREILRAAGTTALMVTHDQEEAFAVADRLAVMRAGRIVQQGEIAEVWRAPA
FT                   DPETALFLGYARVLEGSAAAALLQAAGLPVAPAVAVRRSALVVADGAEAGPLRGAVVSA
FT                   RATPELIRLVVDVDTIGEVDAVARLGTHPGPGDPVRLSVDPSRLAPTPTGR"
FT   gene            466180..467241
FT                   /locus_tag="Noca_0436"
FT   CDS_pept        466180..467241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0436"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79978"
FT                   /db_xref="GOA:A1SDU3"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU3"
FT                   /protein_id="ABL79978.1"
FT                   /translation="MPTLTPVYRRAYALLVGNAVVMGVLAIIVAIVYDKRLIDPEGSFL
FT                   GPSWLRLPLLLFGALLLDLLPRTLWFSKMDPRLMPGIVRERWRTHWNRERLTLVALGIV
FT                   CFYVVYVSYRNLKSFLPFVRDVMYDRELHYLDRALLFGHDPAHVLHGLLGEGFMAWPLS
FT                   YIYLWFLPLVPLAVTAWLVWSRNLSYGYWFVTSQCIAWSLGTASYYALPTLGPGLEYTW
FT                   LYDSLPTTPTSRLMESLAYGRNNVYWGVVQDAVQSVAGFASLHVAITLLVALMIQYTVR
FT                   SRALKWIFWVNFGVTVIATLYFGWHYLADDVAGVMIAFVSFYVGGLASGQKFDKHGLAS
FT                   HPTTTTSAVPVDR"
FT   gene            467338..469311
FT                   /locus_tag="Noca_0437"
FT   CDS_pept        467338..469311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0437"
FT                   /product="acyl-CoA oxidase domain protein"
FT                   /note="PFAM: acyl-CoA oxidase domain protein; acyl-CoA
FT                   dehydrogenase domain protein; KEGG: tfu:Tfu_2239
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79979"
FT                   /db_xref="GOA:A1SDU4"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU4"
FT                   /protein_id="ABL79979.1"
FT                   /translation="MATDTAAPTPTGYVQPEIDVPALTALLDGRYAGVRDLVRTNLAEH
FT                   ASILVDAEEMSIDDFREQVLKVVVEMAATGQTGMGFPEEYGGGCGLGASIAAFETLAYG
FT                   DLSVLVKVGVQFGLFGGAILQLGTERHHEAYLADLITGKLMGCFAMTETGHGSNVQALG
FT                   TVATYDPATEEFVITTTTEDARKDYIGNAAKHAEVAVVFAQLEVGGTTEGVHAFVVPIR
FT                   VDGESAPGVRIEDDGRKMGLNGVDNGRIWFDQVRVPRTALLNRFADVTPEGSYESSIEN
FT                   PNRRFFTMLGTLVQGRVCVGGGGINAAKVALAIATKYAVRRRQFEATSDEQEELLLDYG
FT                   LHQRRLLPLIARTYALHFAQEVVAGQLHDVFSGTHAPGAEDDQARRELESRAAGTKALG
FT                   TWHATRTIQECREACGGAGYLSENRFAALKADTDVFTTFEGDNHVLLQLVAKGLLTDYA
FT                   SEFEDLDQLGMVRFVAGLAVETVIEKTSVHKLLERVRDLLPGGDEWDQEAGLLDPDYQL
FT                   AMLRFREEHMLAGVARRLKRGIDQDMNPGEVFSRVQDHVIAAASAHVERLVLEAFVDKT
FT                   AGLPDGDLKVALNLLCDLFALSTIEADRAWFMEHGRLTVPRSKAISREVGDLCRKIRPL
FT                   AVPLVDAWAIPPEMLRSPGLVG"
FT   gene            complement(469421..469912)
FT                   /locus_tag="Noca_0438"
FT   CDS_pept        complement(469421..469912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0438"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: sma:SAV4661
FT                   putative inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79980"
FT                   /db_xref="GOA:A1SDU5"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU5"
FT                   /protein_id="ABL79980.1"
FT                   /translation="MLEFDVLVEIPKGQRNKYEVDHESGRIRLDRTLFTSTQYPADYGY
FT                   IENTLGLDGDPLDAMVILQEPTFPGCLIRCRAIGMFRMTDEAGGDDKVLCVPATDPRLE
FT                   HLRDISHVSKFDRLEIQHFFEVYKDLEPGKSVEGAEWVGRTEAEAEVHASFARLKEEGH
FT                   "
FT   gene            470027..471409
FT                   /locus_tag="Noca_0439"
FT   CDS_pept        470027..471409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0439"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13, D-Ala-D-Ala carboxypeptidase C; KEGG:
FT                   sma:SAV4662 D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79981"
FT                   /db_xref="GOA:A1SDU6"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU6"
FT                   /protein_id="ABL79981.1"
FT                   /translation="MGGRDRDHPTRGARLAAWLPVALVLAVLAAAGLVLWLDPPASPPE
FT                   EEPAAVPPPAGLTVQPLVAPDPVAEPASGVPDPGKVRRALAPLLRDADLGPHVLATVAG
FT                   LDGTLLYSSGTGSATPASTLKLLTAAAALETLGPDHTFATTVVDAGPRRVVLVGGGDPL
FT                   LDRKDVTRLARDTATALAATGRTRVRVDYDTGLFRGPEVSPHWPAGYLPDGVVAPITPL
FT                   WIDEGRPEDGFGRVADPAAVAAAAYAKALARAGVTVLGPQREAAAPADVAELARTDSLP
FT                   LDRIVEHTLATSDNEAAEVLARHVGLATSGDGSFAGGARALLRVLDGLGVPTQGTTTYD
FT                   GSGLSREDRLDPDTLTAVLELAASPEQPDLRAVLTGLPVAGFTGSLTERFAGPDDQGRG
FT                   LVRAKTGTLSGVSSLAGIVTDREGRPMVFALLADRIDLVDTLDARAALDGATGALAGCR
FT                   CG"
FT   sig_peptide     470027..470176
FT                   /locus_tag="Noca_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.931) with cleavage site probability 0.433 at
FT                   residue 50"
FT   gene            471452..472498
FT                   /locus_tag="Noca_0440"
FT   CDS_pept        471452..472498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV4663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79982"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU7"
FT                   /protein_id="ABL79982.1"
FT                   /translation="MSKHSGPELVDWDLAVALGSRIAGDGPVVDRRTADAVVAELRADA
FT                   DRSTGLVRAHTGLLAAERTAPVLVVDRPGWVIANADGFATILAPVVDKLSSRKGEPTGL
FT                   TKAIGSRVTGAEVGALLGFLAGKVLGQFDPFHAPSGRLLLVAPNIVHVERELGVVPRDF
FT                   RLWVCLHEETHRVQFTATPWLADHLLGEMHALAESLEPSGLLDDGLTRIAGAVRSAREG
FT                   GGSLLDLIGTPEQKEIVDRVTGVMSLLEGHADVVMDDVGPGVIPTVADIRKRFNRRRQG
FT                   VGVLDRLLRRVLGLDAKMAQYRDGAKFVRAVVDKAGMTEFNAVWERPENLPSKAEIADP
FT                   RAWISRVL"
FT   gene            472519..473484
FT                   /locus_tag="Noca_0441"
FT   CDS_pept        472519..473484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0441"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: tfu:Tfu_2897
FT                   helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79983"
FT                   /db_xref="GOA:A1SDU8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU8"
FT                   /protein_id="ABL79983.1"
FT                   /translation="MSLHPAIAAVRLAVRRALAHVDPGRTVVVACSGGADSLALLAATV
FT                   FEGRRAGWRVVGATVDHGLQPGSADHAAHVVRQMAALGADETVAATVHVEAAGQGPEAA
FT                   ARQARYAVLDQLAERFDADAVLLGHTRDDQAETVLLGLARGSGGRSLAGMRRSFDRFVR
FT                   PLLDLSRADTATACQVAGIEFWSDPHNEDPAFTRVRVRRSVLPVLEDQLGPGVAEALAR
FT                   TADQLRADMDLLDDAAEAAYQRLRDLPVDGLLAEPGPIRRRVLRLAALAAGAPASELFH
FT                   EHVLAMDALLTHWHGQKWVDLPGKVRCRRADGRLRLGPAG"
FT   gene            473580..474293
FT                   /locus_tag="Noca_0442"
FT   CDS_pept        473580..474293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79984"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR032109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDU9"
FT                   /protein_id="ABL79984.1"
FT                   /translation="MSHRRTFAAAVALLAAAVIAPQALPASASPAGRAVTAQRAGQALI
FT                   QGVVVDQAGRYVDDVEVQATKADGTPAASAITYASDREDGPQHGYFFLEVTRGTYTLTF
FT                   SRDGYRTLVLDDLQIERARQKLSLGEVEIQKKLAESKTEASLVRRTITTKQNGEVVVTV
FT                   SARGVKPTGDVEIREGRTVVGEDGLRARDNGQVTIELDRLPRGTHELKAYYLGSPDLKV
FT                   SASTSFTLTVTRGRH"
FT   sig_peptide     473580..473666
FT                   /locus_tag="Noca_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 29"
FT   gene            474309..474860
FT                   /locus_tag="Noca_0443"
FT   CDS_pept        474309..474860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0443"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: sco:SCO3405 putative hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79985"
FT                   /db_xref="GOA:A1SDV0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV0"
FT                   /protein_id="ABL79985.1"
FT                   /translation="MHASDVENDLVNVLFTEEQIQQRLAELAKDIEADYEGKDLLIVGI
FT                   LRGAVMVMADLARSFTRHLEMDWMAVSSYGSGTKSSGVVRILKDLDTDISGRHVVIVDE
FT                   IIDTGLTLSWLTSNLSSRSPASVEICTLLRKPDALTMPVEVKYVGWDIPNEFVVGYGLD
FT                   YRERYRNLRDIGTLAPHVYS"
FT   gene            475120..477165
FT                   /locus_tag="Noca_0444"
FT   CDS_pept        475120..477165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0444"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: sma:SAV4666 putative cell division protein
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79986"
FT                   /db_xref="GOA:A1SDV1"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV1"
FT                   /protein_id="ABL79986.1"
FT                   /translation="MKRIFKGPWLWIVLAVVGVLLALQYLAPNRGGEEVDASKMQDLIS
FT                   SGEIKELTFVDGGEQQIKATLDNGDKVTAFWLDGTQAELDSQVQDQVDAGKIDSYTVEV
FT                   PKPSLLGSILATLLPFALIILLFLFLMNQVQGGGGRGVMQFAKSRAKLISKDMPKTTFG
FT                   DVAGCEEAIEELGEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAVAGEAGV
FT                   PFYSISGSDFVEMFVGVGASRVRDLFEQAKENAPAIVFIDEIDAVGRHRGAGMGGGHDE
FT                   REQTLNQLLVEMDGFDVRGGVILIAATNRPDVLDPALLRPGRFDRQIQVDAPDLNGRHM
FT                   ILKVHSRGKPMSQDIDLLSVARRTPGFTGADLANVLNEAALLTARSNQKLITNANLDEA
FT                   IDRVIAGPQRRTRLMSEKEKLITAYHEGGHALVAAALPGTDPVHKITILPRGRALGYTM
FT                   VLPDEDKYSQTRSQMLDSLAYMLGGRAAEEMVFHDPTTGAGNDIEKATNLARAMVTQYG
FT                   MTERLGAIKLGESNSEPFLGRDLGHARNYSEDVAAIVDEETKKLLANAHQEAFEILEEN
FT                   RDVLDALVLELVEKETLDKQQVAEVFAPLRRRSERPAWTGSPERNPSAIPPVEIPQWIR
FT                   DRAAANGHSKEEGEAGPVLTPPGSGGDVHGDPGVGGAETPPGLPPH"
FT   sig_peptide     475120..475218
FT                   /locus_tag="Noca_0444"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.726 at
FT                   residue 33"
FT   gene            477305..477922
FT                   /locus_tag="Noca_0445"
FT   CDS_pept        477305..477922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0445"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: sma:SAV4667
FT                   putative GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79987"
FT                   /db_xref="GOA:A1SDV2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV2"
FT                   /protein_id="ABL79987.1"
FT                   /translation="MVVAMSDSTLPGGRPAPAFDLARAEAAVRELLIAIGEDPEREGLQ
FT                   ETPARVARAYAELTAGLRMEPEDVLTTTFDIGHDEMVLVRDIELWSMCEHHLVPFTGVA
FT                   HVGYIPATSGKITGLSKLARLVDVYAKRPQVQERLTTQVADALTRLLEARGVIVVIEAE
FT                   HLCMTMRGVKKAGARTITSAVRGTMRTNPTTRAEAMALIHRR"
FT   gene            477930..478790
FT                   /locus_tag="Noca_0446"
FT   CDS_pept        477930..478790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0446"
FT                   /product="Dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: sma:SAV4672 putative dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase, DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79988"
FT                   /db_xref="GOA:A1SDV3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV3"
FT                   /protein_id="ABL79988.1"
FT                   /translation="MAALADLLAPRARPRLMGVVNVTPDSFSDGGRWLEPRDAIAHGRD
FT                   LLADGADILDIGGESTRPGATRPLVEEELGRVVPVITALAAEGAVVSVDTMRAEVAEAA
FT                   LAAGATVVNDVSGGLADPRILEVVAASGAAYVAMHWRAHADHMRDFAVYDGPGGVVGAV
FT                   CDELTARVRAMTAAGIAREQVILDPGLGFAKRAEHNWELLRRIDELAALGYPLLVGASR
FT                   KSFLGRLLVDRGGVPRAVDQREHANAAITLHLARHAVWGVRVHDVRASRDALRVAEQLS
FT                   EEGST"
FT   gene            478787..479173
FT                   /locus_tag="Noca_0447"
FT   CDS_pept        478787..479173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0447"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   tfu:Tfu_2891 dihydroneopterin aldolase
FT                   family:dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79989"
FT                   /db_xref="GOA:A1SDV4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV4"
FT                   /protein_id="ABL79989.1"
FT                   /translation="MTERPTDELSVTGIACYGHHGVFDFERREGQTFVVDLVLGVDTAP
FT                   AAASDDLQDTVDYGSLVASVQAAVEKDPVDLIETLAQRIAGVCLLDGRVEWARVTVHKP
FT                   DAPIEATFADVTLTITRRREGTRD"
FT   gene            479166..479735
FT                   /locus_tag="Noca_0448"
FT   CDS_pept        479166..479735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0448"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: sco:SCO3401 putative
FT                   hydroxymethyldihydropteridine pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79990"
FT                   /db_xref="GOA:A1SDV5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV5"
FT                   /protein_id="ABL79990.1"
FT                   /translation="MTETPNPNIIDADTLTGEMRPIRRAVLALGSNLGERMGNLQGALN
FT                   ALADTPDVWITAVSPVYETDPVDCPPEAKTFLNAVVLIDTTLAASRLMDRALAIEDAFE
FT                   RERGEQRNAPRTLDVDLIVVGDRRSNEEFLRLPHPRAAERAFVLRPWFDVDPAAEVPDR
FT                   GPVADLLDGTDQSGLKLRDDLVLEIQ"
FT   gene            479743..480234
FT                   /locus_tag="Noca_0449"
FT   CDS_pept        479743..480234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0449"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3402 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79991"
FT                   /db_xref="GOA:A1SDV6"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV6"
FT                   /protein_id="ABL79991.1"
FT                   /translation="MSAGPSGEEPQPTGRLRPTSGGALTAWAVAGLVGGWLLHPAAERV
FT                   RDTAPIVTWAQPLALVLVAAILGATAYLTWRTVHVQQQRLEPQRAVNRLVLARSCALVG
FT                   ALVAGGYLGYAVSWIGVDTELATQRAWRSAVAAAAGVGIVVTSVLLERACRVRSDDEDT
FT                   "
FT   gene            480244..480849
FT                   /locus_tag="Noca_0450"
FT   CDS_pept        480244..480849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0450"
FT                   /product="putative multidomain membrane protein"
FT                   /note="KEGG: sco:SCP2.27c putative multidomain membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79992"
FT                   /db_xref="GOA:A1SDV7"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV7"
FT                   /protein_id="ABL79992.1"
FT                   /translation="MASSPAPASRRRQRSTRLTVAVVLLVLAALVVAAAAATGSTVLIT
FT                   LAAVLGVALGAAATRITHSELALTRREAARDRAEQARAYRTLTAERTAENAAFAESMRT
FT                   RMARQQDALRELEEALTAAQGRAAEATRKLNAEARRADAAERDSRQLEEGLAGAEQRAA
FT                   EAIVRVAELEQELDVVRAELDVVTQAWHAAEAGQRKHA"
FT   sig_peptide     480244..480354
FT                   /locus_tag="Noca_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.578 at
FT                   residue 37"
FT   gene            480965..482113
FT                   /locus_tag="Noca_0451"
FT   CDS_pept        480965..482113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0451"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79993"
FT                   /db_xref="GOA:A1SDV8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV8"
FT                   /protein_id="ABL79993.1"
FT                   /translation="MIPHENRFESDPDAVLGDLPGLPSGWTIGTPDPSDRFDVARLTHL
FT                   LRAHERHARGWAGSGVDDVMVEVSEHGLRMRENVVIRDEDGDIHAWGSVHDRSVGRMLF
FT                   VHIVQRDLPDDPDGSIADSCSDLLVEWAEAQARCVGSARGLAVQQIDTGAFAGDERQAR
FT                   WLAGSGFEKVRTWWQMSRPVTPDEEGLVATPDHWTDRGVVFRLVRRTGDGMPDEGDLHE
FT                   VHEVLEGAFVDHFNSSEETFEEFVHRLREDPGHRWDHWWLAELVEDGEDGEDGEDGEDG
FT                   EDGEDGVRRPVGALIGTASEDATGPDGSYVSYLGVLEAARGRGVATGLLRTIIADAAAR
FT                   GRNRVGLEVDADSPTGATGLYTSMGWVTKYVTESWHRDIPVA"
FT   gene            complement(482221..483255)
FT                   /locus_tag="Noca_0452"
FT   CDS_pept        complement(482221..483255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0452"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sma:SAV7409 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79994"
FT                   /db_xref="GOA:A1SDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDV9"
FT                   /protein_id="ABL79994.1"
FT                   /translation="MDATGSAAAGPTSTEPMIRLSGVGKTYDDGTVAVHALDLEVERGE
FT                   LVCLVGPSGCGKSTTLKMINRLIEPTTGTIEIDGRDVTGQDPVRLRRGIGYVIQEVGLF
FT                   PHQKIIANVMTVPLLYGESRATARERARELLELVGLDPATYAERYPTQLSGGQQQRVGV
FT                   ARALAAKPPVLLMDEPFGAVDPLVRLRLQDEFLRLQRELGVTVVFVTHDIDEAVRLGDR
FT                   VAVFATGGRLAQYDTPARLLGRPADDFVAEFVGSTSGLRRLDVTPLDPAHLEPMDGVTA
FT                   GDLGAAIDVDSTLGHALAVLLRGDAGMVGVREGARFVGVLTPNGIHRALRAALAEMAEV
FT                   ASAG"
FT   gene            483259..483966
FT                   /locus_tag="Noca_0453"
FT   CDS_pept        483259..483966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0453"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sma:SAV7406 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79995"
FT                   /db_xref="GOA:A1SDW0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW0"
FT                   /protein_id="ABL79995.1"
FT                   /translation="MTLLGAVPAADDPSCYSRLTNEWFCGQYLGDYRHELVDATTQHLV
FT                   ITVVSVIAGVVIAFPLALLARRLPALETSVLGVTTAVYTIPSLALFPLLVPFTGLSATT
FT                   VVIGLALYALTILVRSMLEGLRSVPEEVRESAVGLGYGATRLLVLVELPLALPVIMAGL
FT                   RVATVSTVALTTVGSLVAYGGLGNLIKDGVTTNFRAELMTASLLCVLLAVVLDALIVGA
FT                   QWLLTPWSRGARG"
FT   gene            483963..484736
FT                   /locus_tag="Noca_0454"
FT   CDS_pept        483963..484736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0454"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6728 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79996"
FT                   /db_xref="GOA:A1SDW1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW1"
FT                   /protein_id="ABL79996.1"
FT                   /translation="MTSMTVLADAWDYLTTAGSWTGDGGMVELLLQQLLLSFTSLALAA
FT                   AVGLPVALWLGHLGRGGFLAINVTNIGRAVPTFALLALLVTADWPGTGTLGPYGRAGLA
FT                   TIIALTLFALPPIITSSYVGVREVSPAVKQAADGMGMTGRQRFFRVELPLAAPLVLLGL
FT                   RLALVQVWATATIAALVAGPGLGRVITDGFYRTNYGKGVAGAVVVAVVALLLELLAALG
FT                   QRVLDPTARASSPKRHQGMSVDAPRVTEAADAVGR"
FT   gene            484783..485739
FT                   /locus_tag="Noca_0455"
FT   CDS_pept        484783..485739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0455"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: fal:FRAAL6729 putative
FT                   amino acid ABC transporter amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79997"
FT                   /db_xref="GOA:A1SDW2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW2"
FT                   /protein_id="ABL79997.1"
FT                   /translation="MHMQVRRSLAAALAVGSLFLATACADDDLDSKQADDATPSATTDQ
FT                   GPVRIAGQSFTEAAIVAAMYDELLTAAGYDTDVKLVDTRDAYMATFPDSVDVVPEYVGG
FT                   IVNFLNARENGAKAEPFTAGDGAELVDQGKSLLDAAGIALLDQSAATDTNAFFVTKDFS
FT                   ESEGVTKLSDLEGRSVKLAAAPDCEGRLDCEGGLVDQYGIDVTEVLPLGYASNDTYQSV
FT                   ISGESELGETSTTDGTLESQGLVVLEDDKQIQPAQNLVPAVSSAFLEQHPDIADVLNGL
FT                   MAALTTEKLTELNGAVAVDRDKPEDVAHQFLVDEGLI"
FT   sig_peptide     484783..484860
FT                   /locus_tag="Noca_0455"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.784 at
FT                   residue 26"
FT   gene            complement(485732..486844)
FT                   /locus_tag="Noca_0456"
FT   CDS_pept        complement(485732..486844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0456"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sco:SCO2590 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79998"
FT                   /db_xref="GOA:A1SDW3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW3"
FT                   /protein_id="ABL79998.1"
FT                   /translation="MKFGRRRPLVSVVVPVYDVAAYLPEALDSVLAQSHRNLEVVVVDD
FT                   GSPDASGVIADEYAGRDPRIRVVHTANRGLGAARNEGIRHATGDLLAFADSDDVVPRDA
FT                   YAVLVRHLERTGSEFVTGSVARWEAGVLTELPWMRRLHRDRGAFTLEEHPELLGDVFAW
FT                   NKLFRRSFWDRAELAWPEGIRYEDQPTTTRAFVAAERFGVVPEVVYHWRIRHDGTSITQ
FT                   QRASLADLRDRWETKRMALASVASLGSEQVDAVFHDRVLAGDLHRYFAEIPGCSDQWWD
FT                   LLVAGVREFWGDRSLVHSGLPPVHRLTGWLVEQGRREEAELVMRYVAALGGPVPQVDAP
FT                   HGPRIDVPGLDPTGVDPAALALRDFEVRAR"
FT   gene            486894..487982
FT                   /locus_tag="Noca_0457"
FT   CDS_pept        486894..487982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL79999"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW4"
FT                   /protein_id="ABL79999.1"
FT                   /translation="MPADPSDVDPADYPRKVLFVAGAGRSGTSTMAGLMQIMGLHVPQP
FT                   EVVADETNPKGFGEPAWVVEHHDRLLKEAGVQVSDARPEAWFETGRVSTREPERIRTAE
FT                   WLDGHFAVNPELVVKDPRLSWFLSLWRVAAVRTGATPVFATMLRPPAEVVGSKQNYYQN
FT                   RLGSAHLAASWLNMLLHTERATRESVVDGGRVFVRYADLLDDWTRVVMHAGERLGLEHV
FT                   MHAKSEAIRNGHRFVDPSLRRMNQTLEDLALPPRLHELTAETWEELNKLAEPDGDTPAV
FT                   HEALDQLREGYVELYEEAAAISRSSVVAAEQRVRKQLKGGGGSRPAPAAPADPADRIPH
FT                   GVRAAIPAPVRRGLRKAMGRSR"
FT   gene            487979..488893
FT                   /locus_tag="Noca_0458"
FT   CDS_pept        487979..488893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rxy:Rxyl_3098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80000"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW5"
FT                   /protein_id="ABL80000.1"
FT                   /translation="MTAHLGATGLANLEGHTDFDITWPWLRPGGLRPGSTAVLRVKNEA
FT                   PSLPFVLPPLLRACEFVLLVDNGSDDGTPDVARETAERAGRADRLTVTSYPFAVARAGA
FT                   EHLAQHELSVHSLAYFYNWCFSQVTTRYSWKWDGDMVLTTEGEVSIADLGWQVGDVQSI
FT                   IRVPRHGLYLESEAKGYLDLGWRNAEEWGFPIGPDFVYTKAFEWEIRTTPVGVRSIGLP
FT                   HGLCVELKYLDGEEFAHWTDPESFATSWRNRRKRREWEVFHALKEGRVPPGVHEITAPA
FT                   GVHIVDHVTHDWLPHAPRPLQVG"
FT   gene            489233..490051
FT                   /locus_tag="Noca_0459"
FT   CDS_pept        489233..490051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80001"
FT                   /db_xref="GOA:A1SDW6"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW6"
FT                   /protein_id="ABL80001.1"
FT                   /translation="MVAAAGESDASRARIADLLPGTRTAKPTDVARSCDLLLLTVPDDM
FT                   LGNVVTVLSDSGAIRPGQYVVHTSGRHGLAVLEPAARAGAHPVAMHPAMTFTGTALDLD
FT                   RLPGCVYGLTAEPSERVFTEGLVADLRGRPTWVPEEMRTLYHGGLAHGANHLVTLVSQA
FT                   MELLAAAGCDHPAGTLRPLLTAALDNALEQGDSALTGPIVRGDVNTVRAHLADIATNAP
FT                   HTLPSYVALARDTLDRVVTDGRVLPIRAAAIKRALEQAEQAAPRTTAPRR"
FT   gene            490048..491052
FT                   /locus_tag="Noca_0460"
FT   CDS_pept        490048..491052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0460"
FT                   /product="pantothenate synthetase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: nfa:nfa4060 putative pantothenate synthetase;
FT                   TIGRFAM: pantoate--beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80002"
FT                   /db_xref="GOA:A1SDW7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDW7"
FT                   /protein_id="ABL80002.1"
FT                   /translation="MSSAPVLAHTREELATLLAAARARGEQVGLVPTMGALHEGHASLV
FT                   RAARERVTDDGRMGPVVVSVFVNPLQFGANEDLDRYPRTLEADLEVCAREGADIVFAPS
FT                   VDEVYPGGPPQVTVRPGPLGKILEGKVRPGHFRGVLTVVAKLFGLVRPDVAVFGQKDYQ
FT                   QLALIRRMVLDLALGVEIVAAETVREDDGLALSSRNRYLEPEQREQAVALSRALLAAQE
FT                   NAGYGAEVALDEARAELRAAPGVDLDYLVITDPDLDELPAVVPPGTPARILVAARVGGT
FT                   RLIDNLPLMLGTRGPAGEASPPNRERSEPGSAEQNKSPGEARTTPSGTSEASE"
FT   gene            491064..491471
FT                   /locus_tag="Noca_0461"
FT   CDS_pept        491064..491471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0461"
FT                   /product="L-aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: nfa:nfa4070 putative aspartate
FT                   1-decarboxylase; TIGRFAM: aspartate 1-decarboxylase; PFAM:
FT                   aspartate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80003"
FT                   /db_xref="GOA:A1SDW8"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDW8"
FT                   /protein_id="ABL80003.1"
FT                   /translation="MMKSKIHRATVTQADLHYVGSVTVDEDLLDAADLLPGELVHIVDI
FT                   DNGARLETYTIAGERGSGVIGINGAAARLVHPGDLVILIAYGQMEDVEAKGFEPHVVFV
FT                   DADNRVVSTGSDPADAPAGSGLLRGDRPAGR"
FT   gene            491481..493208
FT                   /locus_tag="Noca_0462"
FT   CDS_pept        491481..493208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0462"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: sco:SCO3382 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80004"
FT                   /db_xref="GOA:A1SDW9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDW9"
FT                   /protein_id="ABL80004.1"
FT                   /translation="MQHQGVPDHAVPDEGVPDVPAEIDAPVRRVPGRLVAPEPGWTTTT
FT                   DVVVVGSGIAGLTAALRLREEVGTVLVVTKDVLAAGSTQWAQGGIAAALGPGDTPAEHE
FT                   LDTLVAGAGACDRDAVHALVTEGPEAVRELIALGTNFDHDPNGELSLTREGGHHRDRIA
FT                   HAGGDATGAEIQRALIAAIEQAPEIEVIQHALAVDLLLAEDGGVAGLTLHVMGEGQRDG
FT                   VGAVHCRAVVLASGGLGQVFSQTTNPAVSTGDGMAVALRAGAVLRDLEFVQFHPTVMYL
FT                   GPDSLGQQPLISEAVRGEGAFLVDFEGNRFMQGVHELADLAPRDVVAKAITRRMNETGR
FT                   PHMWLDARHLGADLWERRFPTILATTRSHGVDPVTELIPVAPACHYASGGVRTDLWGRS
FT                   SVPGLYATGEVACSGVHGANRLASNSLLEGLVFSRRIAQVLPGELRPLVCPAEDTRTAG
FT                   LVPGGARRELQDVMTGRVGVLRSAEGLADATGLLDKLAGERADVIDQASWETTNLLTIA
FT                   VALADAAALREETRGSHWREDFPDRDDAGYAGHFDVVMADGASTLQLVPAPPTDRDDR"
FT   gene            493205..494107
FT                   /locus_tag="Noca_0463"
FT   CDS_pept        493205..494107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0463"
FT                   /product="nicotinate-nucleotide pyrophosphorylase
FT                   (carboxylating)"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: fra:Francci3_4378 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80005"
FT                   /db_xref="GOA:A1SDX0"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX0"
FT                   /protein_id="ABL80005.1"
FT                   /translation="MTPATPYDEELRAAGLDPEAIRAQVARALAEDLPGGLARGDVTSV
FT                   ATIAADARGTGVFAAREAGVVAGLGVAALVFHEVLGDAVEVTDRVPDGTRVAPGDVVMR
FT                   VAGPTRGLLTAERTALNYASHLSGVATATAHWVDALAGTRARVLDTRKTLPTFRALQKY
FT                   AVRCGGGVNHRFSLGDRAMVKDNHVVAAGGVVPAYDAVRRAYPDLRVEVEVTGLDELRE
FT                   LLDAGCTEILLDNMDTATMAEAVRLTAGRATLEASGGLTIERAREVAETGVDFISVGAL
FT                   THSVQVFDLGLDLSSGSEG"
FT   gene            494111..494884
FT                   /locus_tag="Noca_0464"
FT   CDS_pept        494111..494884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0464"
FT                   /product="pantothenate kinase"
FT                   /EC_number="2.7.1.33"
FT                   /note="TIGRFAM: putative transcriptional activator, Baf
FT                   family; PFAM: Bordetella pertussis Bvg accessory factor;
FT                   KEGG: sma:SAV4690 putative Bordetella pertussis Bvg
FT                   accessory factor family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80006"
FT                   /db_xref="GOA:A1SDX1"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SDX1"
FT                   /protein_id="ABL80006.1"
FT                   /translation="MPLLCADIGNSHTVLGLVSGGSVLADWRVATDERNTADDWSVLLR
FT                   GLLGAALEEIDGIAVCATVPAVLHEWREMLTRHFPAVRHVVVEPGVRTGVPVLMDNPRE
FT                   VGTDRIINALAAVHEYGGPAIVVDFGGTATTFDVVSAQGQYVGGSISPGIELSLESLGR
FT                   RGAQLRKVELLRPRSVIAKNTVEALQSGMVFGVAAQVEGIVDRMIGELGVGATDVQVIA
FT                   TGYLAPVVLDECRCFTHHAPWLTLRGLELVFERNA"
FT   gene            495060..495386
FT                   /locus_tag="Noca_0465"
FT   CDS_pept        495060..495386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80007"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX2"
FT                   /protein_id="ABL80007.1"
FT                   /translation="MAQKVNIVLVDDIDGSEATETVTFGLDGTTYEIDLNDKNAAALRD
FT                   VFSGYVGHARKVGAAPRRARRAAAASSGPSAKEIRDWARSNGHDVPDRGRVSAEVREAY
FT                   DRAH"
FT   gene            495691..498276
FT                   /locus_tag="Noca_0466"
FT   CDS_pept        495691..498276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0466"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase, central domain
FT                   protein; Clp N terminal domain protein; ATPase associated
FT                   with various cellular activities, AAA_5; ATPase AAA-2
FT                   domain protein; SMART: AAA ATPase; KEGG: sma:SAV4697
FT                   putative ATP-dependent Clp protease"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80008"
FT                   /db_xref="GOA:A1SDX3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX3"
FT                   /protein_id="ABL80008.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLSHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLDISLEAVRAQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHSYIG
FT                   TEHILLGLIREGEGVAAQVLQKLGADLNRVRQQVIQLLSGFQGKESAGSAAATGASGGD
FT                   APSSSLVLDQFGRNLTQDAREGKLDPVIGREQEIERVMQILSRRTKNNPVLIGEPGVGK
FT                   TTIVEGLAQDIVKGNVPETLKDKQIYTLDLGALVAGSRYRGDFEERLKKVLKEIRTRGD
FT                   IVLFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYLEKDAALER
FT                   RFQPIQVAEPSIAHTIEMLKGLRDRYEAHHRVTITDEALVSAATLADRYISDRFLPDKA
FT                   IDLIDEAGSRLRIRRMTAPADLREYDDKIGEVRQRKEAAIDGQDFEAAARLRDEEKQLI
FT                   LKKSEREKQWRAGDMDEVAEVDEELIAEVLAVATGIPIVKLSEEESTRLLKMEDELHKR
FT                   VIGQEEAVKALSRAIRRTRAGLKDPKRPGGSFIFAGPSGVGKTWLSKTLAEFLFGDEDA
FT                   LIQLDMSEFGEKHTVSRLFGSPPGYVGYEEGGQLTEKVRRKPFSVVLFDEVEKAHPDIF
FT                   NSLLQILEEGRLTDSQGRVVDFKNTVIIMTTNLGTRDIAKGINLGFQQSGDAAGSYERM
FT                   KSKVSEELKQHFRPEFLNRVDEVIVFPPLSQEQIVHMVDNMIASVELRMKDRDMRIELT
FT                   QNAKNLLAERGFDPVLGARPLRRTIQREIEDVLAEKMLYGEVGPGQIVLVDVEGEGPTA
FT                   TFTFSGQKVGDLPDLPPFETAEVTSSEATPPTEGPDDSDSGTDVPKSTD"
FT   gene            complement(498338..499204)
FT                   /locus_tag="Noca_0467"
FT   CDS_pept        complement(498338..499204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0467"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; KEGG: sco:SCO3355 putative adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80009"
FT                   /db_xref="GOA:A1SDX4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX4"
FT                   /protein_id="ABL80009.1"
FT                   /translation="MNELHAPVLQWYDEHARDLPWRRAEAGPWSVLVSEFMLQQTPVAR
FT                   VLPVHEQWLARWPQPADLAAESAGEAVRAWGRLGYPRRALRLHAAATAILERHDGAVPS
FT                   SYDDLIALPGVGDYTAAAIAVFAYGRRHVVLDTNVRRVLTRTLQGVEFPAPSVTRAERE
FT                   LALAVLPADEPTAATWSVAVMELGALVCTAANPRCADCPVARLCAWRTAGYPAYDGPKR
FT                   LVQTWAGTDRQCRGRLLAVLREDDGPVHRSRLDAVWSEEAQRVRCLASLAADGLVVHVG
FT                   PDAYALP"
FT   gene            499269..500069
FT                   /locus_tag="Noca_0468"
FT   CDS_pept        499269..500069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0468"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2874 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX5"
FT                   /protein_id="ABL80010.1"
FT                   /translation="MPALTRGPLPARVYWVRRLLVLGTATLLVVAIARLLGGGSDAASE
FT                   PDAGAQLVADGSPTAAATLDGEPTTTTSARKPGKRASKSQEPVLAQPDGPCADEDVAIT
FT                   PKVENAVAGRPVQIVLQLRTLESDACTWRVSAGTVTVNITSGPDDIWTSRQCRRAIPAR
FT                   DVVVRKAVTSNVSITWSSRRSDDGCTRLTDWAYPGWYHVTAAALAGEPSDAQFELRTPT
FT                   AATITKTVTPTQKPSQKPSQSASGRPVTPGQGQSASPSGAVEPN"
FT   sig_peptide     499269..499397
FT                   /locus_tag="Noca_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.866 at
FT                   residue 43"
FT   gene            complement(500207..501289)
FT                   /locus_tag="Noca_0469"
FT   CDS_pept        complement(500207..501289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0469"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: fal:FRAAL6529 nucleic-acid-binding
FT                   protein protein, containing HHH domain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80011"
FT                   /db_xref="GOA:A1SDX6"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX6"
FT                   /protein_id="ABL80011.1"
FT                   /translation="MATDRSDDILRLRATLATIAPGTPLRDGLERILRGRTGALIVLGH
FT                   DKVVESISTGGFTLDVPFTATGLRELAKMDGAIIVDRDVTRIQRAAVHLMPDHTIPSEE
FT                   TGTRHRTADRVARQTGFPVISVSQSMQIIAAYVGETRHVLEDSGQILSRANQALATLER
FT                   YKLRLDEVSSTLSALEIEDLVTVRDVAVVAQRLEMVTRIASEIEDYVLELGTDGRLLSL
FT                   QLEELITGVDTERELVIRDYLPAGRRSKSPEALLNRLESLSSTELVDPAAAARALGLGN
FT                   GEHLDGAVAPRGFRLLAKVPRLPATVVDRLVDHFGTLQKLLSAGVDDLQAVEGVGELRA
FT                   RSVREGLSRLAESTILERYV"
FT   gene            complement(501369..502787)
FT                   /locus_tag="Noca_0470"
FT   CDS_pept        complement(501369..502787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0470"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: sma:SAV4710 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80012"
FT                   /db_xref="GOA:A1SDX7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX7"
FT                   /protein_id="ABL80012.1"
FT                   /translation="MAKSPHPAFRCSECGWETAKWVGRCGECQAWGSVAEAAAVPVGRT
FT                   PATPVSRPAVPIAQVSVEDSRFRTSGVPELDRVLGGGLVPGAAILLAGEPGVGKSTLLL
FT                   EVAAQTARYQRRTLYVTGEESASQVRLRADRTGGVHDELYLAAETDLGAVLTHIEEVRP
FT                   TLLVVDSIQTIGAAGVDGVPGGVTQVKEVAAALVRVAKTRNITTVIVGHVTKDGSIAGP
FT                   RVLEHVVDVVLHFEGDRESRFRMVRAMKNRFGPVDEVGCFDLGPEGITAVTDPTGVFVE
FT                   SHHSRVPGTCVAVTMEGRRPLLAEVQALVTHTSAERPRRTTSGLDSSRVAMVMAVLQQH
FT                   CGVHLHTRDVFASTVGGARITEPASDLAAAVALTSASRGLAAPRGVVAIGEIGLSGELR
FT                   RVRDLPLRLAEAARLGFQLAVVPTEPGRPAVRSPESWTVDGMQVLDVTDVGGALRLLRL
FT                   LDTEHEKPRSIEGR"
FT   gene            503013..504032
FT                   /locus_tag="Noca_0471"
FT   CDS_pept        503013..504032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0471"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: sth:STH770
FT                   LacI family transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80013"
FT                   /db_xref="GOA:A1SDX8"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX8"
FT                   /protein_id="ABL80013.1"
FT                   /translation="MARVSTTPPTLADVAERAGVSRQTVSNAVNNPDLLRADTLARVLH
FT                   AIDELGYSPNRAARNLRTRASHLVGMRIGPVYEGTANATMDRFVHSLVEASREAGYHVL
FT                   LFAGDPEDPVAGYDDLLRSTTVDAFVVTDTYLGNPQATWLEERRAPFVAFGRPWDNPAA
FT                   EHPWVDVDGAAGTDLATSYLLGRGHERIAWIGWRKDSWIGEDRRSGWSRALHARGLPTT
FT                   GLASRVEDTVSSGREASAVLLDEARPTAFVCASDTLAMGVLGTLADRGLTPGRDVSVIG
FT                   FDDSQVAQVVSPGLTSVRQPLEEVAVEIVKALEGLLGHPPTVGPGVMLVPSLALRGTS"
FT   gene            complement(504157..504912)
FT                   /locus_tag="Noca_0472"
FT   CDS_pept        complement(504157..504912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0472"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rha:RHA1_ro06583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80014"
FT                   /db_xref="GOA:A1SDX9"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDX9"
FT                   /protein_id="ABL80014.1"
FT                   /translation="MDDPRSHAIARPVRQLSRGRVRATEGARPSPNIWQHPATYEIENR
FT                   AVDPDGLLAAAMLAVDRWADRTVLDVGCGTGFHLPWFAETAASVIGVEPHADLVALARR
FT                   RSRRLANVTVHQGVAQSLPLPDASVDVVHARWAYFFGPGCEPGLAELDRVVRRGGTAYV
FT                   IDNDPTRSTFGGWFRRGYPEVDPVAVERFWSARGWTRVPLDLRWSFSSRADLEAVVRIE
FT                   FTPQVADQVLPEHAGTEVDYAVNLWWKRF"
FT   gene            complement(504920..505558)
FT                   /locus_tag="Noca_0473"
FT   CDS_pept        complement(504920..505558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pac:PPA0314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80015"
FT                   /db_xref="InterPro:IPR025870"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY0"
FT                   /protein_id="ABL80015.1"
FT                   /translation="MRLDHLSFAAGPDGLASTAQRIGRLLGRDFVDGGVHPRFGTRNMI
FT                   LPLAGNTYLEVVEVLDHPASDKAPFGQAVRARSALGGGWLGWVVAVDDITVVERRLGRE
FT                   AVVGSRHRPDGTELRWKQIGVNGLIADPQLPFFIEWEIPAELHPSAGADEAFSLACLEI
FT                   AGDPHRVSEWLGETVEAPLEDVKVEWAAPNGTPGIGAAQFQTPSGLVRL"
FT   gene            complement(505707..506477)
FT                   /locus_tag="Noca_0474"
FT   CDS_pept        complement(505707..506477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO3349 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY1"
FT                   /protein_id="ABL80016.1"
FT                   /translation="MPEVDLVFPRAYVEFVNPADETEVLRCDLTWLTSSYTCIFGRGCP
FT                   GIYADAPDVGCCTLGAHFADKDDEKRVAEYVGMLDEELWQHKPQRPDGKVRKRDWIELD
FT                   DEGERKTRTIEVDGQQACIFQNRPDFKNGAGCALHALAYVLDKLPLETKPDVCWQLPIR
FT                   RTFRDVTRQDGSTYTEVSIGEYDRRGWGPGGHDLDWYCSGNTEAHVGVEPVYVANAAEL
FT                   TALMGEAAYAELVRHCEAHVRSRSALALHPADPH"
FT   gene            506536..507471
FT                   /locus_tag="Noca_0475"
FT   CDS_pept        506536..507471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0475"
FT                   /product="Ppx/GppA phosphatase"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: sco:SCO3348
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80017"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY2"
FT                   /protein_id="ABL80017.1"
FT                   /translation="MRLGVLDIGSNTGHLLVVDAHGGAAPLPAYSYKQPLRLAEHLDDE
FT                   GAVTRLGVDSLTAFTAQALVVAEDKGCQDMLAFATSAVRDAVNTDAVLDHVHAATGVRI
FT                   EVLPGEDEARLTFLAVRRWFGWSAGRLAVFDIGGGSLEIAGGADESPDVAWSLPIGAGR
FT                   LARQFFSGGPPDDEAIRGLRKQLRAEIARDAGHLLRAGTPDHAAATSKTFRSLARICGA
FT                   APSADGPLVPRVLEREVLREWIPKLVTMAPEALAHLPGVSPSRAHQIVTGALVAEAAMD
FT                   IFGLELLEVCPWALREGVILERLDQISVLG"
FT   gene            507474..508262
FT                   /locus_tag="Noca_0476"
FT   CDS_pept        507474..508262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0476"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sco:SCO3347 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80018"
FT                   /db_xref="GOA:A1SDY3"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY3"
FT                   /protein_id="ABL80018.1"
FT                   /translation="MAPRVGLSTVSVYPESSAHAFAYASALGYDTIEVMVGIDALSQQT
FT                   SAIQQLSAHHGVPVSAVHAPCLLFTQRVWGTEPWGKLERSAEMAAALGAEVVVVHPPFR
FT                   WQKSYARDFVDGIAALEESTGIAFAVENMYPWRASSRGMEMYLPGWDPSSEPYANTTID
FT                   LSHAAIARSDPVGMAERLGDRLRHIHLTDGTGSAKDEHLVPGRGSIGAAAFLRHLAAAG
FT                   FGGEIVVEINTRKCRDAAAREVDLRESLEFAREHSVVGTP"
FT   gene            508259..508867
FT                   /locus_tag="Noca_0477"
FT   CDS_pept        508259..508867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0477"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   rha:RHA1_ro00946 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80019"
FT                   /db_xref="GOA:A1SDY4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY4"
FT                   /protein_id="ABL80019.1"
FT                   /translation="MTDPATRAAPRRGRRPGTPDTRAAILAAARELFAAQGYAGTSVRA
FT                   IGAAAGVDASLVHHYFGTKDDLFVAALELRVDPRVVVPPVFEGGLESAGERLMRLFVSV
FT                   WDDEEKRLPLLALIRGALDSGGQQLVRDGFMRMVLEPLAAGLGVADQRRMPLVASQLLG
FT                   LVLLRYLLVVEPLASMPADELVALYGPTLQRYLSGPLPD"
FT   gene            508897..509646
FT                   /locus_tag="Noca_0478"
FT   CDS_pept        508897..509646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0478"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: nfa:nfa19890 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80020"
FT                   /db_xref="GOA:A1SDY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY5"
FT                   /protein_id="ABL80020.1"
FT                   /translation="MPGGASVRIIQRMVKNAVEIRDLHVVRGPHTVLEHLDLTIGGGVT
FT                   GLLGPSGCGKSTLMRCLVGVQRIRGGTVEVFGLPAGSRPLRDRVGYVTQAVSVYHDLTV
FT                   AENLHFFARVLGAGRAEVDRAITAVDLADHRDDVVGRLSGGQQSRASLAVALLDEPDLL
FT                   VLDEPTVGLDPVLREDLWNLFHRLADAGVAVFVSSHVMDEAERCDRLLLMRQGRILADG
FT                   TPAEIKAAAGVDDVEAAFLALVRRDAA"
FT   gene            509714..510451
FT                   /locus_tag="Noca_0479"
FT   CDS_pept        509714..510451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0479"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rha:RHA1_ro00945
FT                   ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80021"
FT                   /db_xref="GOA:A1SDY6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY6"
FT                   /protein_id="ABL80021.1"
FT                   /translation="MNARITLAVAGRVLIQLRRDHRTLAMLLVLPCLLISLMWWMYDEA
FT                   NPLLFDRIGPALLAMFPVIVMFLVTSVTTLRERSSGTLERLLAMPMGKLDFLVGYAIAF
FT                   GLVAAVQSVLAVAVSIGLLDLDLEGPVWLLTVVAVVDAVLGSALGLFVSAFAQTEFQAV
FT                   QFMPAIVIPQLLLCGLLVPRELLPDVLRQLSDVLPLSYAVDAMQHLTTSSATGQVWRDV
FT                   AIVGAFAVAGLAFGAATLRRRTP"
FT   gene            510531..511481
FT                   /locus_tag="Noca_0480"
FT   CDS_pept        510531..511481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0480"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: tfu:Tfu_0434
FT                   proline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80022"
FT                   /db_xref="GOA:A1SDY7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY7"
FT                   /protein_id="ABL80022.1"
FT                   /translation="MSLLRQPLLLLARSSLVKKVVSGMPVSAGIVRSYVPGETTESAVG
FT                   ATAELVDGGLRVTLDYLGEDTTDAEQADATVAAYLDVLQELSARGLTRNAEVSVKLSAI
FT                   GQFLPDAVGFGGGEKIALENARTICRAARNAGTAVTLDMEDHTTTDSTLSILRELRKDF
FT                   PETGAVLQAALHRTESDCRALAYEGSRVRLCKGAYLEPESVAFQDRLEISKSYVRCLKV
FT                   LLAGEGYPMIATHDPRMIEIASSLASRYGRAAGTYEYQMLYGIRPEEQRRLVASGETMR
FT                   VYVPYGTEWYGYLMRRLAERPQNLSFFVKSLVSKK"
FT   gene            511592..512395
FT                   /locus_tag="Noca_0481"
FT   CDS_pept        511592..512395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0481"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: sma:SAV4724 putative pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80023"
FT                   /db_xref="GOA:A1SDY8"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY8"
FT                   /protein_id="ABL80023.1"
FT                   /translation="MSQTAILGAGVMGETLLSGLVRAGRRVDHLLVGEKRPERAQELEE
FT                   RYGVAVVGNAEAARKADTLALVVKPQDMGDLLEEIAGELRPGQLVVSLAAGITTAFIEA
FT                   RVPEGVAVVRVMPNTPALVDEGMAAVSPGSHCSEEHLAEAESLMASVGRVLRIPERQQD
FT                   AVTAISGSGPAYIFFVVESMIEAGVHLGLPRATATDLVVQTVVGSAKMLRETGTHPAVL
FT                   REQVTSPAGTTAAALRELEIHKVRAAFLAAMEAARDRSRALAEGS"
FT   gene            complement(512432..513400)
FT                   /locus_tag="Noca_0482"
FT   CDS_pept        complement(512432..513400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0482"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: sma:SAV4725 putative tryptophanyl-tRNA
FT                   synthetase; TIGRFAM: tryptophanyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80024"
FT                   /db_xref="GOA:A1SDY9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDY9"
FT                   /protein_id="ABL80024.1"
FT                   /translation="MHRQLSLLTPSGHLTLGNLLGALRPMAAAQRDASTPAACFYGIAD
FT                   LHAMTTPHEPARLRSLTHETATLLLAAGLEESTLFVQSRVPAHAQLAYLLECTASTGEL
FT                   NRMIQFKEKGRDQPTTRASLFTYPALMAADILLYRPRQVPVGADQRQHVELTRDLATRF
FT                   NSTYGPVFTIPEITVPAAGARVMRLDDPTVKMGKSAAETPGVVRLLDPPDVVRRKVARA
FT                   VTDSDTGPDAVRADPNKPGVTNLLEILTACGGSAEGISTYGALKKAVADAVIAELEPLQ
FT                   KRYADLAADPAHVTSVYEAGAARCREVTAPVLAAAQAAMGL"
FT   gene            513595..514779
FT                   /locus_tag="Noca_0483"
FT   CDS_pept        513595..514779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0483"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   tfu:Tfu_2707 putative acetoin utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80025"
FT                   /db_xref="GOA:A1SDZ0"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003085"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ0"
FT                   /protein_id="ABL80025.1"
FT                   /translation="MPACQGPATVVFDPSLTAYDFGPTHPMSPLRVDLTIRLAEELGVL
FT                   AGLRRVDAPVATDEVIATVHRPALIEAVRRAGTMPGILDEAHGLGTDDNPTFPDMHHAA
FT                   AHIVGATVEAARQVWSGESLHAVNISGGLHHAMPERASGFCIYNDVAVGIQHLLDSGAK
FT                   RVAYVDVDVHHGDGVEKVFWDDPRVLTISLHETGQMLFPGTGFPTDAGGPAARGTAVNV
FT                   ALPPGTGDGGWLRAYHAVVPPLVREFAPDVLVTQHGCDSHIEDPLAHLMLSVDGQRAAY
FT                   LALHELAHEVCGGRWVATGGGGYALVEVVPRAWTHLLAIVAGRPLDPATETPEGWRRHV
FT                   QTTLDQVAPHRMTDGRTPAYRDWIDGYDPEIWLDRAIHSTRMEVFPLHGLDPFP"
FT   gene            514976..515179
FT                   /locus_tag="Noca_0484"
FT   CDS_pept        514976..515179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0484"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: Prophage CP4-57 regulatory; KEGG: cef:CE0431
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80026"
FT                   /db_xref="GOA:A1SDZ1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ1"
FT                   /protein_id="ABL80026.1"
FT                   /translation="MATNPGDSSSSKFLTVAEVAAMMRVSKMTVYRLVHNGELPAVRVG
FT                   RSFRVQEKDVDEYLRKSFYSAG"
FT   gene            515312..515413
FT                   /locus_tag="Noca_0485"
FT   CDS_pept        515312..515413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0485"
FT                   /product="Protein of unknown function DUF1713"
FT                   /note="PFAM: Protein of unknown function DUF1713; KEGG:
FT                   pac:PPA0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80027"
FT                   /db_xref="InterPro:IPR013177"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ2"
FT                   /protein_id="ABL80027.1"
FT                   /translation="MGSVIKKRRKRMAKKKHRKLLKKTRVQRRKLGK"
FT   gene            515440..516519
FT                   /locus_tag="Noca_0486"
FT   CDS_pept        515440..516519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0486"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG:
FT                   fra:Francci3_0479 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80028"
FT                   /db_xref="GOA:A1SDZ3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ3"
FT                   /protein_id="ABL80028.1"
FT                   /translation="MGSAGRVVLVTGVSRDLGRRFARALAADPSVDRVVGVDAVPPRGD
FT                   IGEVSFVRADIRNPVIAKVIVKEDVDTVVHMSVISTPGSAGGRNTMKELNVIGTMQLLA
FT                   ACQKAPGLRTLVVKSSTTVYGASNRDPAMFTEDMEPRRVPRSGYAKDVAEVEGYVRGFA
FT                   RRRPDVSVTILRAANVIGPQVTSPLTSYFRLPVIPTVLGFDPRLQFLHEQDLLDVLRHA
FT                   IAAEVAGTFNVAGAGILMLSQAVRRLQRPSVPLPPFAVGRVGSTLRSARVADFSPEQLG
FT                   LLTYGRGVDTTRMRTELGFEPALTTAGAFADFAAPLPPTGGYADRLLARVAQGLPEPAP
FT                   VPAPLPASAPAYPRGADRG"
FT   gene            516512..517639
FT                   /locus_tag="Noca_0487"
FT   CDS_pept        516512..517639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0487"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   fal:FRAAL0978 putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80029"
FT                   /db_xref="GOA:A1SDZ4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ4"
FT                   /protein_id="ABL80029.1"
FT                   /translation="MGDAEIIPIGTRGRPGRGTGKHPSSAARGLATGARPPAAKAGRRT
FT                   AGPASGSAPEPPARSDTRAERPATTTQDRAPLAGIPASDWLAAVQHGAREVFGEQWEPQ
FT                   LARFLAFLRRRITGDYVVDEYGFDQEITERFLMATLRPIAQKWFRIEVRGIENIPTEGG
FT                   ALVVSNHSGTIPVDGLMTLVSIYDHTGRFLRPLGADLVFRLPFVSSLARKSGATLACNE
FT                   DAERMLHGGQLVGVWPEGFKGIGKAYSDRYKLQRFGRGGFVSAALRTGVPIIPLAVVGA
FT                   EEIYPLVGNLPSLARALGLPYLPVTPFFPALGPLGLVPLPSKWLLEFGEPIRTDELDVG
FT                   AADDPMLVFNVTDQVRETIQQTLYSLLMQRESVFK"
FT   gene            complement(517793..518947)
FT                   /locus_tag="Noca_0488"
FT   CDS_pept        complement(517793..518947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV4734 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80030"
FT                   /db_xref="GOA:A1SDZ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ5"
FT                   /protein_id="ABL80030.1"
FT                   /translation="MTWGFTAQRRAEEFDARVEGASTYDVADPRDAELLALVGALRAVP
FT                   EAQPRPEFVATLRERLMAEAATALVPDDVSRLTLPARRPTRERRLAAVVGGIVIVGAST
FT                   SLAVASQSALPGDSLYPVKRAIEQAHTGLSVGEGSKGTTILANASDRLDEVDALTRQNH
FT                   FGDEIRIADTLNTFTDQATQATDLLLADYAHTGEASSIAHLRDFAASSLTRLADLEPLV
FT                   PAEARDELIRAAGVVTTIDTEAALRCGDCGGAGITSIPATLGAAAEVINVPKPPADAVT
FT                   KGDRTRNGGKHGTKGAQGTGLPDVDPGEVGPGSILNPDGSGLQPGTTTSGGSDPIGDLA
FT                   NGLTGGDSPSDAPSVPVVTDVVDGVGGILQDVVDGVTGGLPKTP"
FT   gene            complement(519078..519878)
FT                   /locus_tag="Noca_0489"
FT   CDS_pept        complement(519078..519878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0489"
FT                   /product="sigma-70 region 2 domain protein"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   sma:SAV4735 RNA polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80031"
FT                   /db_xref="GOA:A1SDZ6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ6"
FT                   /protein_id="ABL80031.1"
FT                   /translation="MSWEDTDVARGLDALRRLVAHVLVLEQPQLAGTPGMLATEAVASG
FT                   RAEMRAKTRPKSGPGTGDGGPDGYGDAELATSSEEDEAERSRLIALVELARKGDADAFG
FT                   LLYDHYQPSVYRFLFYRTRSGTLAEDLTSETFFRALRSMNNFRWQGKDFGAWLMTIARN
FT                   LATDHFKAGRTRLELTTEDMGLHDDATEGPESMVLAGLTNELLLHALTELPPEQRDCLV
FT                   MRFLQGMSIAETAAVLGRSDGAVKQLQLRGVRNLAKLMPEGIRD"
FT   gene            complement(520088..520981)
FT                   /locus_tag="Noca_0490"
FT   CDS_pept        complement(520088..520981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0490"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IB
FT                   (PSPase-like); HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sma:SAV4736 3-phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80032"
FT                   /db_xref="GOA:A1SDZ7"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ7"
FT                   /protein_id="ABL80032.1"
FT                   /translation="MTPAHDRRARPRNLQLRSVLAGEAAAAAAEVESALTPPLDPVAAA
FT                   FFDVDNTVMQGASIFHLARGLHRRKFFTTREILGAAWKQAYFRVVGVEDPAHVADARAS
FT                   ALGFIAGHTVTELQDLGEEIFEEAMADRIWPGTRALAQLHLDEGQRVWLVTAAPIEIAQ
FT                   IIARRLGLTGALGTVAEHIDGVYTGRLVGDLLHGPAKGEAVRALAAREGLDLHRCSAYS
FT                   DSFNDLPMLTMVGDPCAINPDARLRAHAREQGWRIHDYRTGRKALRAGLVAGGIAGAAS
FT                   GTVAAGLALRGRRFPR"
FT   gene            521035..522582
FT                   /locus_tag="Noca_0491"
FT   CDS_pept        521035..522582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0491"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   tth:TTC1065 long-chain-fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80033"
FT                   /db_xref="GOA:A1SDZ8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ8"
FT                   /protein_id="ABL80033.1"
FT                   /translation="MSGMRDIAELVSVAAAEHPDRLAVVEAGGRSLTWAGLEDEVGRIA
FT                   TGLGAAGILGGTRVLLAVGNRLEFVTTYLGVLRAQAVAVPVNPRSTVSELSRMVADSGA
FT                   RMVVGEPDTVEALREAVAGLDPAPLLVVIEAEPLPGERAHDELRALPARPVPPLQDPEK
FT                   LAVLLYTSGTSGLPRAAMLTHRALLANLDQVAQVEPPMIHGDDVVLGVLPLFHVYGLNA
FT                   VLGGILRHRAKLVLVERFDPHETLSLIDDEACSVVPVAPPVFAYWLGEEHLAEHLGPVR
FT                   LVLSGSAPLAAELIDKFTARAGVPVHQGYGLTEAAPVVTSTLCSVTPQVGSVGAALPGV
FT                   ELRLVDESGRSPDGDDPGEIQIRGANLFSGYWPDGEGGPDDDGWWSTGDVGFLDPSGDL
FT                   FLVDRIKDLVIVSGFNVYPVEVEEVLTEVDGVVEAAVIGVDDPVTGEAVVAYVRAPDAD
FT                   PAAIEEAVRVHCEQRLARFKRPSRIEVVDALPKTGTGKVQKGRLRGIERRRTLGLLE"
FT   gene            522579..522824
FT                   /locus_tag="Noca_0492"
FT   CDS_pept        522579..522824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0492"
FT                   /product="glutaredoxin 2"
FT                   /note="PFAM: glutaredoxin; glutaredoxin 2; KEGG:
FT                   sma:SAV4737 redoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80034"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SDZ9"
FT                   /protein_id="ABL80034.1"
FT                   /translation="MSAPRVTLYTRPGCHLCDVAREVVERVCAELGEAYAEVHIDDDPE
FT                   LRERFTDEVPVTFVDGRQHDFWRVDEARLRAALATS"
FT   gene            523011..523688
FT                   /locus_tag="Noca_0493"
FT   CDS_pept        523011..523688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0493"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; Rex DNA-binding
FT                   domain protein; KEGG: sma:SAV4738 putative AT-rich
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80035"
FT                   /db_xref="GOA:A1SE00"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE00"
FT                   /protein_id="ABL80035.1"
FT                   /translation="METRSVSARTSPESARDIPEATVARLPVYLRALVTLSEQGTATCS
FT                   SEELAVAAGVNSAKLRKDLSYLGSYGTRGVGYDVDYLRYQIAREIGVTQDWPVVIVGIG
FT                   NLGQALANYSGFRSRGFRVVALLDADPARHDQVVAGIEVRPFDHLERIVRDHAVAIGVI
FT                   ATPAVAAQDVADRMVAYGITSILNFAPTVLTVPAEVDVRKVDLSIELQILAYHEQRKGA
FT                   VTA"
FT   gene            523685..524977
FT                   /locus_tag="Noca_0494"
FT   CDS_pept        523685..524977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0494"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /note="PFAM: glutamyl-tRNA reductase; Shikimate/quinate
FT                   5-dehydrogenase; KEGG: rha:RHA1_ro02053 glutamyl-tRNA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80036"
FT                   /db_xref="GOA:A1SE01"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE01"
FT                   /protein_id="ABL80036.1"
FT                   /translation="MSVLVVGISHKSAPVALLEQLALDGPGLHKLIDDVAASEHVTEAT
FT                   VIATCNRLEIYAEVDRFHGSVEEVSRLVVDRAGERTEAMLPHLYVHYDDGAVSHLFQVV
FT                   AGLDSMAVGEGQILGQTRAALNAGQEIGTVGPALNVLFQQALRVGKRARAETGIDRAAP
FT                   SLVSAALDRSRATVGELSGKRVLVVGAGSMAGLATSTVAARGTASVTVVNRTSGNADRL
FT                   AEEYGARSATLAELAAELAVADVVISCTGATGTLITRDMVAAATVDGRELSILDLALPH
FT                   DVDPTVADLPGVSLVGLTDLADELRDSDAGQEVEAVRQIVTQEVAAFLSARRQASVTPT
FT                   VVALRSMATSVVEAEMERLTSRVPGLDDDIRAEVLHTVRRVADKLLHQPTVRVRELANE
FT                   TGAVSYAAALAELFALDQEAVDAVTRPEGLT"
FT   gene            524974..525918
FT                   /locus_tag="Noca_0495"
FT   CDS_pept        524974..525918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0495"
FT                   /product="hydroxymethylbilane synthase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: rha:RHA1_ro02052 hydroxymethylbilane synthase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80037"
FT                   /db_xref="GOA:A1SE02"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE02"
FT                   /protein_id="ABL80037.1"
FT                   /translation="MSAPLRVGTRASVLATTQSGLVADQLREALGREVELVTVSTEGDR
FT                   TQAAGIPLQGGSATGVFVAALRDALLRGEVDVAVHSLKDLPTYPTEGITLAAVPVREDP
FT                   RDVVVARDGLTLGELPVGSRVGTGSPRRVAQLHALGLGLEVVGIRGNVDTRIGKVRSGE
FT                   CDAVILARAGLARIGRLEAVTEVLDPLQMLPAPGQGALAVECRTDDPLAAQVAAALDDP
FT                   RVRAAVTAERAVLATLEGGCSAPIGALAEIVEGEDGDELWVRSVALSPDGALSVRRSAS
FT                   GSPSDAAGVGTRLGEQMLADGADRLGDPAEVQQ"
FT   gene            526010..527668
FT                   /locus_tag="Noca_0496"
FT   CDS_pept        526010..527668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0496"
FT                   /product="uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; Uroporphyrinogen III
FT                   synthase HEM4; KEGG: sco:SCO3317 putative uroporphyrin-III
FT                   C-methyltransferase/uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80038"
FT                   /db_xref="GOA:A1SE03"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE03"
FT                   /protein_id="ABL80038.1"
FT                   /translation="MTRGKTTTATGSGSTRGWVSFVGSGPGDPGLLTVRAVDLLRQADV
FT                   VVTEVPDHAALVRTVLGLPLDAAGAEPAGPEIVDGGFGEDGQPLTHAARAKVVVRQAKR
FT                   GLRVVRLMAGDPFLYASGPEEAQACVKAGLGFEIVPGVSSVSAVPAYAGIPLTTKDCRE
FT                   VAVVTCGERVDWSRYVDARTLVLLSAVGQIADISKALVAAGRSPETPVAMTRVGTTTEQ
FT                   ATVTSTLERIGADARAARMTPPAITVVGDVVDLRETLSWFETKPLFGWRVLVPRTKEQA
FT                   GSLSARLRGYGAVPDEVPTISVEPPRNPLQMDKAVRGLVEGRYEWIAFTSVNAVRAVRE
FT                   KFEEYGLDARAFSGLKIAAVGDKTAQAIAGWGLRADLVPSGEQSAAGLLADWPEYDELL
FT                   DPINRVFLPRADIATENLVAGLVDLGWECDDVTAYRTVRAAPPPAPTRDAIKTGKFDAV
FT                   VFTSSSTVRNLVGIAGKPHPSTIIAVIGPATAKTAEEHGLRVDVLAAKPDVDTLVDALA
FT                   DFGASRRIAMVEAGQPVTKPSDRKPSGRRKTTSAR"
FT   gene            527693..528694
FT                   /locus_tag="Noca_0497"
FT   CDS_pept        527693..528694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0497"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   sma:SAV4742 putative 5-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80039"
FT                   /db_xref="GOA:A1SE04"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE04"
FT                   /protein_id="ABL80039.1"
FT                   /translation="MSEVPVPPVVGPTVRPRRLRTTAALRRMVSETSLEARQLVLPVFV
FT                   CEGLDEPRPISSMPGVVQHTRSSLLAAVTEAAELGLGGVMLFGIPERKDAVGSGAVDPA
FT                   GILNLAITDVVGEVGDALTVMSDLCLDEFTDHGHCGVLTPDGKVDNDRTLSRYAEMALA
FT                   QAHAGVDMVGPSGMMDGQVAVVRRALDAAGHTDVSILAYSAKYASAFFGPFREAVDSSL
FT                   EGDRRTYQQDPANAREGVREAMLDVEEGADLVMVKPALAYLDVLHRVRDAVDVPVAAYN
FT                   VSGEYAMLEAAAAKGWIDREPAILEALTSIRRAGADVVLTYWAAEVARILAR"
FT   gene            complement(528934..530103)
FT                   /locus_tag="Noca_0498"
FT   CDS_pept        complement(528934..530103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0498"
FT                   /product="secreted protein"
FT                   /note="KEGG: sma:SAV6229 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80040"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE05"
FT                   /protein_id="ABL80040.1"
FT                   /translation="MPTRSTRFGRGQKVMALVPLALLSAAWTASIAGVGASTATASAES
FT                   ESTALPDGSTVPTEAIKAPASVSTSGGLAPGVRGDGAGIVSTASTSGIPSAALAAYQRA
FT                   ETVINAADKSCHLSWQLIAAIGRVESDHGRTNGNTLDAQGVARPGIYGIALDGSHGTTR
FT                   ITDTDAGQYDADARFDRAIGPMQFIPSTWSVVGVDADGDGQRNPQDVDDAALATAVYLC
FT                   SGSDDLSTPAGQRAAVYRYNHSSSYVDLVLSIAAAYLDGDFTSVPNGTTSAGYLVPAPA
FT                   KPGQQGPKKHHGQPHATQTQGPGGGSQQPAPEPSPEPTAPAAPNPTGGGGGGDLPVPSV
FT                   PPLPSTSIPPVDELLTVAQAIVQCTLDGYVDNILKDDDAFDQCVYDYTH"
FT   sig_peptide     complement(529972..530103)
FT                   /locus_tag="Noca_0498"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.679 at
FT                   residue 44"
FT   gene            530333..531670
FT                   /locus_tag="Noca_0499"
FT   CDS_pept        530333..531670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0499"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: sma:SAV4795
FT                   putative glutamate-1-semialdehyde 2,1-aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80041"
FT                   /db_xref="GOA:A1SE06"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE06"
FT                   /protein_id="ABL80041.1"
FT                   /translation="MTAGATLPTAASAALFERARAVTPGGVNSPVRAFNAVGGTPRFIR
FT                   SARGAWLTDADGNEYVDLICSWGPMLLGHAHPEVQAAVSAAVARGTSYGAPTEPEVELA
FT                   EEIAARAPVERVRFVSSGTEATMSAIRLARGFTGRDVVVKFAGCYHGHVDSLLASAGSG
FT                   LATFAVPGTPGVPESSTALTLVLPYNDRAAVEKAFAEHGDRIACLITEAAPGNMGVVPP
FT                   DADGSGGGFNGFLAETCARHGALFVSDEVMTGFRASRQGQWGLDGAVEGWRPDLMTFGK
FT                   VMGGGFPAAAFGGRADVMSRLAPEGPVYQAGTLSGNPIATTAGLATLRLATDDVYAHIG
FT                   AAADTIKTAASDALSRAGVEHVVQAAGTMFSVFLTAGPVRDFADASRTDVAAYAAFFHA
FT                   MLDQGVYLPPSAYEAWFLSSAHDDRAVQTVLDALPTAARAAAAAQT"
FT   gene            531683..532363
FT                   /locus_tag="Noca_0500"
FT   CDS_pept        531683..532363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0500"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: sma:SAV4796
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80042"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE07"
FT                   /protein_id="ABL80042.1"
FT                   /translation="MNQTPDTIVHLLRHGEVHNPEGVLYGRRDGFHLSDLGVQMAEKVA
FT                   EAIKDRDIVHLRSSPLERAQETGAPLARARGLDIVTDERVIESTNKFEGRRFAGGANAL
FT                   RDPRTWALLWNPFRPSWGEPYKQVVARMMAAVDDAREVARGHEAVVVSHQLPIWITRLA
FT                   AEKRSFLHDPRRRQCTLCSLTSFHFVGDRLTQVSYSEPAGDLIPVQDKSAPFSAGGAPE
FT                   QRRP"
FT   gene            532363..532965
FT                   /locus_tag="Noca_0501"
FT   CDS_pept        532363..532965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0501"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pac:PPA0325
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80043"
FT                   /db_xref="GOA:A1SE08"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE08"
FT                   /protein_id="ABL80043.1"
FT                   /translation="MTRLRRSLGAGAVGLLLLTGCSSLEGTGDKGYISGDQRVRVVDPA
FT                   DRGSAVELTGTSLTGDPVDVADSRGRVLVVNTWWSGCAPCRSEMPMLTAAAKELGERAD
FT                   FLGINIRDASASQGQAFIRSVGAEYPSIYDPTGKAVLAFAGKTTLSAIPTTIVLDAEGR
FT                   VAAVITGEIPSKQTLVDVVDEVAANAAAESGGETADG"
FT   sig_peptide     532363..532449
FT                   /locus_tag="Noca_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.375 at
FT                   residue 29"
FT   gene            532958..533719
FT                   /locus_tag="Noca_0502"
FT   CDS_pept        532958..533719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0502"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: sco:SCO4473 putative cytochrome biogenesis
FT                   related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80044"
FT                   /db_xref="GOA:A1SE09"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE09"
FT                   /protein_id="ABL80044.1"
FT                   /translation="MGDWFQQTAFSGSLVLAVPVALIAGLVSFFSPCVIPLLPGYLSYA
FT                   TGLSGADLATGAAGTRRGRMLLGSVLFVLGFSVVFVALGTLSGALGSWLVTWRDQMTFV
FT                   LGLLTIVLGLAFAGWLPFFRRDWRVHSVPAVGLAAAPLLGFLFGLGWTPCIGPTLSAIT
FT                   TLSFTESTAGRGAVLSAVYALGLGLPFVLAGLAYEKALATVGWVRRHQAWVMRAGGLML
FT                   VAVGLMLVTGWWDQAVTWIQLHLVSSSETAL"
FT   gene            533802..535400
FT                   /locus_tag="Noca_0503"
FT   CDS_pept        533802..535400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0503"
FT                   /product="ResB family protein"
FT                   /note="PFAM: ResB family protein; KEGG: sco:SCO4474
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80045"
FT                   /db_xref="GOA:A1SE10"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE10"
FT                   /protein_id="ABL80045.1"
FT                   /translation="MSTPTRTSLSTRPPEDDRRPGELTLRELLRWTWRQLTSMRTALVL
FT                   LLLLALAAVPGSIIPQEGVDSLKTSNWRSDHPKLTPVYERLGLFSVYDSPWFSAIYLLL
FT                   MVSLVGCIIPRAILYWRGMWAQPPAAPRNLTRLPDHATYQTAVAPDAVLERARATLRRR
FT                   RYRLSPEAGDAVAAERGYLREAGNLLFHLAVVVVLVGFALGGLFGYKGGVILLVGDGYG
FT                   FSNNLTQYDDFDPGSLFRDSDMEPFSFSIDDFSVEWLTSGPRAGMARGFESHLTYRESP
FT                   DAPDRTYDLKVNHPLSIGNTDVFLIGHGYAPVLTIRDGDGEEVYSGPTIFLPTDQSFQS
FT                   IGVVKAPDAEPTQIGLEGEFYPTVAFSKQTGSYFSLFGRPLDPLVSMLVYTGDLGMDDG
FT                   QPQSVYSLDKSRTTMLTKANGAPYRIDLRPGEQVTLPDGLGTVSFDGLERWNKIQISQT
FT                   PGKWIALIGVVLALLGLLGSLFIRPRRVWVRARRDGDGTLVEVAALDRSGGGDVAVVVA
FT                   QLVTDLQQPDREDNS"
FT   gene            535397..536422
FT                   /locus_tag="Noca_0504"
FT   CDS_pept        535397..536422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0504"
FT                   /product="cytochrome c assembly protein"
FT                   /note="PFAM: cytochrome c assembly protein; KEGG:
FT                   pac:PPA0328 putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80046"
FT                   /db_xref="GOA:A1SE11"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE11"
FT                   /protein_id="ABL80046.1"
FT                   /translation="MTDVQWESLSNWAVAASGVVYFLALLVHLAEWASLRKVPVAAGAA
FT                   VTSSVDIPGGIAVATGPGGEGDGQDEGKVRRTEFLGRLGYLLTVLAVAVQLVALVGRGM
FT                   AADPDRVPWGNMYEFTLTGTFVVAALYVALYHKLRLAWMAPIVVAFVLSVLMVAVIWLY
FT                   APVAPLTEALSSYWLVIHVVSAIIATGAFTLGGITSALYLVKARAPERESGYVARLPRP
FT                   EVLDRVSYRLHAFGFPVWTFAVLITGPIWAHQAWSSYWNWDPKEVWAFITWVVYAAYLH
FT                   ARTTAGWKGRNAAILALVGVATLWFNFIGINYFSTTSQHSYAGGAPALVEPAAPQSDAL
FT                   G"
FT   gene            complement(536673..536867)
FT                   /locus_tag="Noca_0505"
FT   CDS_pept        complement(536673..536867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80047"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE12"
FT                   /protein_id="ABL80047.1"
FT                   /translation="MLKFLLVVILIAVAVYLTVRVIQRRGIASPPRRPQAPPRVVGPDD
FT                   DPDFLRDLDRRRKHPEEPE"
FT   sig_peptide     complement(536781..536867)
FT                   /locus_tag="Noca_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.338 at
FT                   residue 29"
FT   gene            536911..537180
FT                   /locus_tag="Noca_0506"
FT   CDS_pept        536911..537180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80048"
FT                   /db_xref="GOA:A1SE13"
FT                   /db_xref="InterPro:IPR025323"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE13"
FT                   /protein_id="ABL80048.1"
FT                   /translation="MKEFWIYTALRFLLFVGSLGIVAGVWFLLADSVPILWAVVIAFVI
FT                   SGAGSYFLLNRPREALARRVQTRAERMTAKIEEMRAKEDVDDEA"
FT   sig_peptide     536911..537003
FT                   /locus_tag="Noca_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.334 at
FT                   residue 31"
FT   gene            complement(537409..538302)
FT                   /locus_tag="Noca_0507"
FT   CDS_pept        complement(537409..538302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0507"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   cef:CE0469 putative 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase MenA"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80049"
FT                   /db_xref="GOA:A1SE14"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE14"
FT                   /protein_id="ABL80049.1"
FT                   /translation="MLESPVVATPDQWLAGARPRTLPAAVSPVLAGTGVAAYADGLVWW
FT                   KALLALVVALALQVAVNYANDYSDGIRGTDADRVGPMRLVGSGAARPAAVKRAAFLAFG
FT                   VAAGAGLVLAATTAWWLVAVGLVSVLAAWFYTGGSKPYGYLGLGEVMVFVFFGLVAVLG
FT                   TAYVQTEAWEWAALYAAVGVGTLACAILVANNLRDIPTDAVAGKRTLAVVLGDRRTRSL
FT                   FLLLVVLAAAAVVAVAATTTWWALAGLGFLVLAGPAARTVLGGAAGPGLIPVLQQTGLA
FT                   ELLWAVLVAAALVAGG"
FT   gene            538338..539339
FT                   /locus_tag="Noca_0508"
FT   CDS_pept        538338..539339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0508"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   tfu:Tfu_1408 putative ortho-succinylbenzoate-CoA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80050"
FT                   /db_xref="GOA:A1SE15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE15"
FT                   /protein_id="ABL80050.1"
FT                   /translation="MDTVVEPVAGWLAADDPEPWVVETSGSTGAPKRVVLPRDAVLASV
FT                   RASARRVGATGQWLLALPPAYVAGLQVVCRSLAAGHPPVLLEDHGSFAAAAAAMAPGER
FT                   FVSLVPTQLHRLLETDAPALATFHTVLLGGGPIDPALRRRAADAGVHVIATYGSAETAG
FT                   GCVYDGVALDGVAVALDADGRVRIAGPTLFAGYAGDPELTARVLVDGWFRTADAGRLDE
FT                   DGRLQVLGRIDDMVVTGGVNVPAPAVAARLREHPDVEAAEVLGVPDEEWGNRVVAFVVG
FT                   PVSLDVARDWVAAAHPRSWAPRQLVALDTIPLLGNGKPDRLALRHAAVEEWA"
FT   gene            539330..540292
FT                   /locus_tag="Noca_0509"
FT   CDS_pept        539330..540292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0509"
FT                   /product="Mandelate racemase/muconate lactonizing enzyme,
FT                   C-terminal domain protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   enzyme, C-terminal domain protein; KEGG: tfu:Tfu_1410
FT                   O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80051"
FT                   /db_xref="GOA:A1SE16"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE16"
FT                   /protein_id="ABL80051.1"
FT                   /translation="MGMIVWSVPMRTRFRGITVREGVLLRGPADAERPGWGEWSPFLEY
FT                   DAAVAEPWLRCAEEAAAGDWPAPLRDRVPVNVTVPAVGPQQAHAIVLAGGCRTAKVKVA
FT                   EPGQTAADDQARLEAVRDALGADGRVRIDVNGLWDLDTAVASIPVLDRAAGGLEYVEQP
FT                   CASVEDLAAVRRRVDVPIAADESIRRAADPYRVRDLEAADVAVLKVQPLGGVRACLRIA
FT                   EDIGLPVVVSSALETSVGIAAGVALAAALPELPYACGLATVQLLTADVVTESLLPVGGE
FT                   LPVRAVQVDESLAPADPDRVAHWEARLAEVRALRQDRPS"
FT   gene            540289..541902
FT                   /locus_tag="Noca_0510"
FT   CDS_pept        540289..541902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0510"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="KEGG: pac:PPA0903 menaquinone biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80052"
FT                   /db_xref="GOA:A1SE17"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE17"
FT                   /protein_id="ABL80052.1"
FT                   /translation="MTAPEPAPESATATARRILAALVEAGVTEIVVAPGSRNAPLSFAA
FT                   YDAAAAGLVRLHTRLDERTAGFLALGLTRSGRRAAVVCTSGTAVANLHPAVLEAAHAGV
FT                   DLVVVSADRPARLRGTGANQTTDQVGIFGPLVPTQDASGPVELLTAGPVHLNVPLEEPL
FT                   VPDDRWLPDVVPGEPAHRVIPASLTVLARGPRTVVVAGDDAGPRVRVLAEQAGWPLLAE
FT                   PSSGSRTGDNAIRTYRLLLDGDLGARVERVVVGGHPTLSRPVSRLLARPDVEVVDLGAW
FT                   GVWSERPFPVHSRILGGVGVDAPVDAADGTADDTDWLEEWRTADRAVSARLDALLAAEP
FT                   GLTPHEVAGAVARALPAGGLLVVGASSPIRDLDLMVPRYDVGARRKVVANRGLAGIDGT
FT                   ISTAVGAALGRPRSTRALTLMGDVTFLHDAGALVIGPGEAVPDLTIVVVNDDGGSIFAM
FT                   LEQGAAEYADQYDRLFGTPHRVDLASLCAATRTPHWRVDSLAELEHALASPAGGIEVVE
FT                   AVVRRDNRRDLDERIRALRP"
FT   gene            541936..543810
FT                   /locus_tag="Noca_0511"
FT   CDS_pept        541936..543810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0511"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: mmc:Mmcs_0521 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80053"
FT                   /db_xref="GOA:A1SE18"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE18"
FT                   /protein_id="ABL80053.1"
FT                   /translation="MADVDTALFLVALAVAVLAGVVVAGRIGVPAPLLLVVAGVAASFL
FT                   PFLPEVHLEPDVVLFGLLPPLLYSAAITSSLVDFNANRRPILLLSVGLVVFTTLGVGVL
FT                   VHELVPGLSWPVAFALGAVVAPPDAVAATSIGRHIGLPRRVVTILEGESLFNDATALVS
FT                   LQTALGATLVGVELWRVGLDFVVAAGGGVLIGVVVFLVVGAMRRRLSDPMLDVAMSFVI
FT                   PFTAFLAAEEVHASGVVAVVTAGLLLGHRAPVLQTAQSRIAERINWRTIAFLLENTVFA
FT                   LIGLQARWLFDDLGESTLSPARIIAVSAATLVAVIVLRLVWVFLSRSLLVRPRVDPATG
FT                   QVPPWSFTLLLGWSGMRGVVTLAAAFLIPPDTRHREVLLVVAFAVVAGTLLVQGLSLPW
FT                   LTRRLHVPAPDPLDDALARATLLQQASKAAVEELERQEYDDQAGVGDLIRQRLDQRNFA
FT                   AWERLGTTADQESPAAVYYRIRMAMIAAERRRILEIRRSGTVASEVIAEVLSMLDVEES
FT                   MLDNAHQERDEAEDYARRRWTLGETCDDLGRYPVVDAEPATYCQACLDEGTRWVALRRC
FT                   LECGNLACCDSSPRQHATAHFRETQHPVMQSAEPGEDWRWCYLHHLTA"
FT   sig_peptide     541936..542064
FT                   /locus_tag="Noca_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.767 at
FT                   residue 43"
FT   gene            complement(543868..545064)
FT                   /locus_tag="Noca_0512"
FT   CDS_pept        complement(543868..545064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0512"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_3241
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80054"
FT                   /db_xref="GOA:A1SE19"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE19"
FT                   /protein_id="ABL80054.1"
FT                   /translation="MTYFDLSDPAFDVTSAQVHAARDQDWYVETNWGWAVLRYAEVSAL
FT                   LRDRRFRQGNARWPAQNGIHSGLFSDWWQETLLSLEGDDHARIRRLLMPAFRNKTIAAM
FT                   RPRFQALANELIDGFADRGSVEFVSEFAEPYAARIICVLLGLPEDHWQQVAHWADDLGA
FT                   SFSIDVGNQVPRIEAALDGLYGYVDEVVADRAAHPREDLVTTLVQATADGDRLSRHELG
FT                   VALVFLAFAGMETTRNQLGLAVQTLLEHPDQWRLLGEHPELGENAVEEVMRVNPTVTWV
FT                   TREALEDVELQGLRIPKGGIVQMLSHSAGTDPAAMPDPSFDITQQRPPHHGFGAGVHHC
FT                   LGHFVARTDMAVALPLLARRMPGAEPDGPGRWLPISGNTGALSFPIRFEHPAPIGSCA"
FT   gene            complement(545122..545628)
FT                   /locus_tag="Noca_0513"
FT   CDS_pept        complement(545122..545628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0513"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   nfa:nfa41970 putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80055"
FT                   /db_xref="GOA:A1SE20"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE20"
FT                   /protein_id="ABL80055.1"
FT                   /translation="MTAPAPDVRLRAAVPADAAACAAMHAACWREAYAPYVDAALLEQR
FT                   VTDLDRWVAAWTKHLVDGPPRVLAEAGGEPVGFAVVGPSRDDDGATPQELYAIYVRAAW
FT                   WGTGLGQALWDAVRPDAACSLWVLEDNARAQAFYRRNGFVPDGAREHYAGLDTCEIRMV
FT                   RPTNP"
FT   gene            complement(545625..546233)
FT                   /locus_tag="Noca_0514"
FT   CDS_pept        complement(545625..546233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0514"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   sma:SAV7466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80056"
FT                   /db_xref="GOA:A1SE21"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE21"
FT                   /protein_id="ABL80056.1"
FT                   /translation="MLEVVLSGLVTGWAIAIPIGAVGAFLVTLSARTSFRVGGAGALGV
FT                   ATVDGGYAALAVVAGSAIAAALEPVSRALSIASGLVLLGVAGLTAAHALRSAGRVREVP
FT                   SLRPRTAYAMFLGITAVNPTTVVYFAAVVLGNQGLVAGPAEGVVFVLAAFLASASWQLL
FT                   LAGGGAALGRIATGHRAHLVTGLVSAVVVAGLAVHTMLA"
FT   sig_peptide     complement(546138..546233)
FT                   /locus_tag="Noca_0514"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.674 at
FT                   residue 32"
FT   gene            546289..546924
FT                   /locus_tag="Noca_0515"
FT   CDS_pept        546289..546924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0515"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   sma:SAV1967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80057"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE22"
FT                   /protein_id="ABL80057.1"
FT                   /translation="MRITKFGHACVRVEHAGTTVVLDPGVFTDPAALDGADAVLITHEH
FT                   ADHYLPDHLLATDAPVFTIEAVAAHVREDVPAVAERLTVVAPGETFDVGVPVRAVGELH
FT                   AVIHPEFPRFFNSGYVLTLGDRKVYHPGDALTEPGEDVDVLLVPVSGPWLKASEAIDFA
FT                   RAVRAPRNLAIHDRVYSEAGLGIIDGHMDKFLPKEGLEYVRRPDGHDL"
FT   gene            complement(547044..548330)
FT                   /locus_tag="Noca_0516"
FT   CDS_pept        complement(547044..548330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0516"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   tfu:Tfu_1413 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80058"
FT                   /db_xref="GOA:A1SE23"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE23"
FT                   /protein_id="ABL80058.1"
FT                   /translation="MSTLGRVTSSPTPGDPPPAPADALVVRTVRLDLDQAASLLDLVPA
FT                   DRPVTWLRRGDGLVGWGVAAQVRTSGATRFADAVKWWSETIARADVHDDVNEPGTGLVS
FT                   FGSFAFADDPGDSILVLPRVVVGRRGDVTWLTTVGEVGPPLGPVERPAAPAAVSFADGA
FT                   LNGEQWMSVVADAVARINAGDLEKVVLARDLVATASDPVDVRWPLGRLGETYPMCWTFH
FT                   VDGMFGATPEMLVRRERGLVTSRVLAGTIRRTGDHERDLALAATLAHSSKDLEEHEYAV
FT                   RSVADALEPHCSSMNVPEAPFVLHLPNVMHLATDVAGVVHDAATVSSLQLAEALHPSAA
FT                   VGGTPTPVATALIADIEGMDRDRYAGPVGWMDASGDGEWGIALRSARLEGRTVRLFAGC
FT                   GIVADSDPAAELAEAQAKFVPVRDALTAS"
FT   gene            548444..549013
FT                   /locus_tag="Noca_0517"
FT   CDS_pept        548444..549013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80059"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE24"
FT                   /protein_id="ABL80059.1"
FT                   /translation="MIALGLLALFAIALPKAVGEDDGAARLVLPDTLPGGYAAADDPAS
FT                   FEGGDYADQADSIAEQEKSNSAYGNRVLPEVLGHAAATRTYVLDGTKAVFVQVFDAEGG
FT                   AFAPNSIPDPEASGGAPANEVTNVGDGVCILSYGQGSTDAGPADPVFSQCQVTRDGRTV
FT                   QIGAPDVDAEDLVATADGLLDDLQGS"
FT   gene            complement(549035..549964)
FT                   /locus_tag="Noca_0518"
FT   CDS_pept        complement(549035..549964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0518"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: sma:SAV3383
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80060"
FT                   /db_xref="GOA:A1SE25"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE25"
FT                   /protein_id="ABL80060.1"
FT                   /translation="MLLARRLLLLVAVAALLCAAAFVAGDALDGGSSARPAASGAGAAS
FT                   TDQPATTDPTAAPSSSDPTATPGSSPTDAPAPTAADEPTRQPTHLPTRQPTLVPGPRLL
FT                   GPGDQGDEVRDLQARLKQIYWFNTDVTGVYGDVTATAVRGFQAKREIPVTGEVDQRTLD
FT                   RLRAMTSTPTGAELHNRGNTPGALDARCRTGRVLCIDKTSSTLRWVVDGTVRQTLDVRF
FT                   GASTTPTREGVFHVYLKDADHVSRLYGSAMPYSMFFSGGQAVHYSSDFAAVGYAGASHG
FT                   CVNVRDYDALGLLYGQVRVGDTVVVYWS"
FT   sig_peptide     complement(549833..549964)
FT                   /locus_tag="Noca_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.750 at
FT                   residue 44"
FT   gene            550120..550809
FT                   /locus_tag="Noca_0519"
FT   CDS_pept        550120..550809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0519"
FT                   /product="demethylmenaquinone methyltransferase /
FT                   2-octaprenyl-6-methoxy-1,4-benzoquinone methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   sma:SAV4831 putative ubiquinone/menaquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80061"
FT                   /db_xref="GOA:A1SE26"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE26"
FT                   /protein_id="ABL80061.1"
FT                   /translation="MVRAELDKQPSDVRRMFDAVARRYDVTNDVLSMGQDRRWRRAVIA
FT                   AVDPQPGERVLDLAAGTGTSSQPFADRGASVVPCDFSLGMLRVGKSALPHLPFTAGDGT
FT                   RLPFADATFDAVTISFGLRNIVDPLSGLRELHRVTRPGGRLVVCEFSHPTFAPFRTVYL
FT                   EYLMRALPSIARAVSSAPDAYVYLAESIRAWPDQEGLAAMVAEAGWRAPAWRNLSGGIV
FT                   ALHRATR"
FT   gene            551159..551518
FT                   /locus_tag="Noca_0520"
FT   CDS_pept        551159..551518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0520"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 3; KEGG: sma:SAV4837 putative NADH dehydrogenase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80062"
FT                   /db_xref="GOA:A1SE27"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE27"
FT                   /protein_id="ABL80062.1"
FT                   /translation="MELYTPVVVLVVLATVFALGGAVMAFAVGPTRYNRVKLDSYECGI
FT                   EPTPQAVGGGRFPIKYYITAMLFIVFDIEIVFLYPWAVQFDELKFFGLVEMVLFIATVF
FT                   VAYAYVWRRGGLDWD"
FT   sig_peptide     551159..551242
FT                   /locus_tag="Noca_0520"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            551532..552086
FT                   /locus_tag="Noca_0521"
FT   CDS_pept        551532..552086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0521"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: tfu:Tfu_2694 NADH dehydrogenase (ubiquinone),
FT                   20 kDa subunit; TIGRFAM: NADH-quinone oxidoreductase, B
FT                   subunit; PFAM: NADH ubiquinone oxidoreductase, 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80063"
FT                   /db_xref="GOA:A1SE28"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE28"
FT                   /protein_id="ABL80063.1"
FT                   /translation="MGIEEKLPSGVLLSTVEGLAGYMRKASFWPASFGLACCAIEMMTS
FT                   GGPKHDLGRFGMEVFRASPRQADVMIVAGRVSQKMAPVLRQIYDQMPEPKWVLAMGVCA
FT                   SSGGMFNNYAVVQGVDHVVPVDMYLPGCPPRPQMLIDAILKLHDKVQHTKMGAHRAAEI
FT                   EELETAALRALPTSEMKGQLR"
FT   gene            552083..552835
FT                   /locus_tag="Noca_0522"
FT   CDS_pept        552083..552835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0522"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH (or F420H2) dehydrogenase, subunit C;
FT                   PFAM: NADH dehydrogenase (ubiquinone), 30 kDa subunit;
FT                   KEGG: rha:RHA1_ro05911 probable NADH dehydrogenase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80064"
FT                   /db_xref="GOA:A1SE29"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE29"
FT                   /protein_id="ABL80064.1"
FT                   /translation="MSDDSSDVKPGPKGPEQPAVEQSPENVPAPTGEVHQVGARHGMFG
FT                   VRGTGDTSGYGGLNQAIVLPGDAQRPYGGWFDEVADGLAAATREAGLEIAAPRVVIHRG
FT                   EITFHLRREDLLPVAQVLRDDERLRFEFCAGVSGVHYPDETGRELHAVYHLLSMTHNRR
FT                   IRLEVAVPDADPHIPSIVPVYPTNDWHERETYDMFGIIFDGHPALTRILMPDDWPGHPQ
FT                   RKDYPLGGVPVEYKGGTVPPPDQRRSYN"
FT   gene            552835..554175
FT                   /locus_tag="Noca_0523"
FT   CDS_pept        552835..554175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0523"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: sco:SCO4565 NADH dehydrogenase I chain D;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80065"
FT                   /db_xref="GOA:A1SE30"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE30"
FT                   /protein_id="ABL80065.1"
FT                   /translation="MADQDLYSGSSETTEGRVFTVTGQDWDSIAEGLAEDEAQERIVVN
FT                   MGPQHPSTHGVLRLILELEGETVTEARAGIGYLHTGIEKNMEYRTWTQGVTFCTRMDYL
FT                   SPFFNEMTYVLGIERLLDIEDRVPEKAQVMRVLLMELNRISSHLVAIATGGMELGALTV
FT                   MTIGFRERELVLDLFELITGLRMNHAFIRPGGVAQDMPPGALDEIRGFVALMKKRLPEY
FT                   ADLCNANPIFKGRLEGIGHLDLAGCLALGLTGPVLRSTGYPWDLRKTQPYCGYETYDFD
FT                   VQTWDTSDSYGRFRIRLNEMWESLRIIEQAADRLAGLDGAPVMIEDKKIGWPSQLAIGS
FT                   DGMGNSLDHIRHIMGESMEALIHHFKLVTEGFRVPPGQAYVPVESPRGELGAHVVSDGG
FT                   TRPFRAHFRDPSFTNLQATSVMAEGGMVADVIVAIASIDPVMGGVDR"
FT   gene            554172..554963
FT                   /locus_tag="Noca_0524"
FT   CDS_pept        554172..554963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0524"
FT                   /product="NADH dehydrogenase subunit E"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, E subunit;
FT                   PFAM: NADH dehydrogenase (ubiquinone), 24 kDa subunit;
FT                   KEGG: pac:PPA1932 NADH dehydrogenase I chain E"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80066"
FT                   /db_xref="GOA:A1SE31"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE31"
FT                   /protein_id="ABL80066.1"
FT                   /translation="MSLTQETYGELQEIAARYPEPRSGLLPMLHLVQSAEGRITPEGIE
FT                   ACADLLGVTAAEVSGVATFYTMYKRRPVGDYHVGVCTNTLCAVMGGDAIFDRLKSDLGV
FT                   GNDETTEDGKITLEHIECNAACDYAPVMMVNWEFMDNMTPDTAARIIDDLRAGNEVHST
FT                   RGPRIVTWREAERVLAGFPDDLADEGPAAGRASLVGLGLARERGWAAPSSEQGPAAHDV
FT                   PEEPAQVEQAAADASPPPSEAATVEKESGTSETAAEKGDAQ"
FT   gene            554960..556282
FT                   /locus_tag="Noca_0525"
FT   CDS_pept        554960..556282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0525"
FT                   /product="NADH dehydrogenase subunit F"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05914 probable NADH dehydrogenase
FT                   subunit F; TIGRFAM: NADH-quinone oxidoreductase, F subunit;
FT                   PFAM: Respiratory-chain NADH dehydrogenase domain, 51 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80067"
FT                   /db_xref="GOA:A1SE32"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE32"
FT                   /protein_id="ABL80067.1"
FT                   /translation="MSDAVTDVLTPVLTDNWDQERSWTLAAYESRGGYRAVDTAFAMEP
FT                   DAVIDAVKESGLRGRGGAGFPTGMKWGFIPQDNPRPKYLVVNADESEPGTCKDIPLMMA
FT                   SPHTLVEGVIISSYAIRANKAFIYIRGEVLHVIRRVQRAVQEAYAAGHLGTNIHGSGFD
FT                   LDVVVHAGAGAYICGEETALLEGLEGRRGQPRLRPPFPAVAGLYASPTVINNVESISSV
FT                   PSIIGRGHAWFASMGTEKSKGVGIFSLSGHVKRPGQYEAPLGITLRTLIDLAGGIREGH
FT                   ELKFWTPGGSSTPLLTAEHLDVPLDFEGVGSAGSMLGTRALQIFDDSVCVVRAVLRWSE
FT                   FYKHESCGKCTPCREGTWWLVQVLTALEKGDGTEEDLDLLLDQCDNILGRSFCALADGA
FT                   TSPIVSSIQFFRDEYVAHLTHGGCPFDPAAATLFATAGAQA"
FT   gene            556279..558714
FT                   /locus_tag="Noca_0526"
FT   CDS_pept        556279..558714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0526"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain G; PFAM:
FT                   ferredoxin; molybdopterin oxidoreductase; KEGG:
FT                   tfu:Tfu_2689 NADH-quinone oxidoreductase, chain G"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80068"
FT                   /db_xref="GOA:A1SE33"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE33"
FT                   /protein_id="ABL80068.1"
FT                   /translation="MTSTPEKAAVDTVSVTIDGIQVDVPKGTLVIRAAEQIGVQIPRFC
FT                   DHPLLAPVGACRQCLVDIPDAGNGRGFPKPQASCTLPVADGMVVNTQATSPVADKAQQG
FT                   IMEFLLVNHPLDCPVCDKGGECPLQNQAMSNGRGESRFTGVKRTYPKPINISAQVLLDR
FT                   ERCILCARCTRFSEQIAGDPFIALIERGALQQVGIYEREPFESYFSGNTIQICPVGALT
FT                   SADYRFRSRPFDLVSTPSVAEHDACGSAIRVDHRRGRVMRRLAGNDPEVNEEWITDKDR
FT                   FGFHYATEPDRLTYPQVRDRVEDGGDGGLRPASWTEAFAVAARGLQAAGATAVLTGGRV
FT                   TAEDAYAYSKFARVSLGTNDIDFRSRPLSAEEASFLAAEVVLRGPGNGGVTYGDLEAAK
FT                   TVVLAGLEPEDEAGMIFLRLRKASKPGRPGGGTRVVAIAPYATRSLTKMRGQLLRTAPG
FT                   DEAAALESLSSHAEFGVDSTAVILVGERLATVPGALSAAAALAARTGARLAWVPRRAGD
FT                   RGAVETGCLPNLLPGGRPVADAGARVDAATTWGVDSLPDAPGRDADAIVAALRAGEVRG
FT                   LVVGGVDPDDTSDPAATRAAVEAASFVVALELRETELTRAADVVFPVAPVADRAGTFVS
FT                   WEGRPRPFPAVFSRPTSLPDLRILAGIAEELSALGAGRELGFRTVEEARAQMEEMGPWD
FT                   GQRAALDTVSAPTAPVGEGLALATWKLLIDNGVMQDGDKAYRATGRKPVARLGRATYDA
FT                   VGPTVTLTGDRGSVTLPAEPADLDDGVVWVPANSFGNGVLADLASPGSRVTVAKGADA"
FT   gene            558711..560060
FT                   /locus_tag="Noca_0527"
FT   CDS_pept        558711..560060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0527"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase, subunit
FT                   1; KEGG: rha:RHA1_ro05916 probable NADH dehydrogenase
FT                   subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80069"
FT                   /db_xref="GOA:A1SE34"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE34"
FT                   /protein_id="ABL80069.1"
FT                   /translation="MNTLTAPLPMATDALSQFGHDAWWVIGLKAVLILVVLLLLTLFNI
FT                   WFERRVVGRMQHRPGPNVNGPFGLLQSLADALKLIFKEGIIPKAADKAVYLIAPVIAVI
FT                   PSFITFSVIPFGPEVTIPFTDTRTPLQLTDMPVAVLFVMAIASIGIYGIVLGGWSSGST
FT                   YSLLGGLRSSAQMISYEVAMGLALVAVFLYAGSMSTSEIVAAQDNLWYGLILVPSFVIY
FT                   LIAMVGETNRAPFDLPEAEGELVGGFHTEYSSMTFALFFLAEYINMATVSAVATTLFLG
FT                   GWHAPFWLDHAWAGANEGYWPLLWFLGKVLFFVFIFIWLRGTLPRLRYDQFMAFGWKRL
FT                   IPVALVWIVAVATIRSISLDGGVDRRYLLIGIGALAVVFLVLFFIGGAAEEQPTTVPEA
FT                   APAGGYPVPPMPAGGPVRGAAVPLTFDRSSPIASSMPQPSAATRSAGEEI"
FT   gene            560060..560650
FT                   /locus_tag="Noca_0528"
FT   CDS_pept        560060..560650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0528"
FT                   /product="NADH dehydrogenase subunit I"
FT                   /EC_number="1.6.5.3"
FT                   /note="TIGRFAM: NADH-quinone oxidoreductase, chain I; PFAM:
FT                   4Fe-4S ferredoxin, iron-sulfur binding domain protein;
FT                   KEGG: fra:Francci3_0546 NADH-quinone oxidoreductase, chain
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80070"
FT                   /db_xref="GOA:A1SE35"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE35"
FT                   /protein_id="ABL80070.1"
FT                   /translation="MAGSPEPKSMREQFWDPIAGFGVTFRTMFKKVVTEQYPFDKYPTA
FT                   PRFHGRHQLNRWPDGLEKCVGCELCAWACPADAIYVEGASNSDDPDGGERFSPGERYGR
FT                   VYQINYLRCILCGLCIEACPTRALTMTNEYELADDNRADLIYEKSDLLAPLLPGMEQPP
FT                   HPMRLGDDEGAYYRGEFAAPAPTAPGSSTEAGA"
FT   gene            560647..561474
FT                   /locus_tag="Noca_0529"
FT   CDS_pept        560647..561474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0529"
FT                   /product="NADH dehydrogenase subunit J"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone/plastoquinone oxidoreductase,
FT                   chain 6; KEGG: mmc:Mmcs_1571 NADH-ubiquinone/plastoquinone
FT                   oxidoreductase, chain 6"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80071"
FT                   /db_xref="GOA:A1SE36"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE36"
FT                   /protein_id="ABL80071.1"
FT                   /translation="MIAFWILAPVMVIAALGLLFVRKAVHAALLLAVVMMSLAVLYAAL
FT                   EAPFLFAVQIIVYTGAILMLFLFVLMLVGVDASDSVVETIRGQRVLAAIAGLGLGLVMV
FT                   LGLSQISLGTAVGLEDANSGGNIQALANILFSRYVFAFEVTSALLITAAVGAMVLAHRE
FT                   RLTPKPTQMSLAAQRMKDYAERGTHPGPLPPPGVYARHNAVDTPALLPDGTAAESSVSR
FT                   VLAARGTVRSGPAMAEDIDEIQGTLSGATHAGRDAVAPATTTEVTPATGEDAE"
FT   sig_peptide     560647..560730
FT                   /locus_tag="Noca_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.703 at
FT                   residue 28"
FT   gene            561471..561770
FT                   /locus_tag="Noca_0530"
FT   CDS_pept        561471..561770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0530"
FT                   /product="NADH dehydrogenase subunit K"
FT                   /EC_number="1.6.5.3"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: rha:RHA1_ro05919 probable NADH dehydrogenase subunit
FT                   K"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80072"
FT                   /db_xref="GOA:A1SE37"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE37"
FT                   /protein_id="ABL80072.1"
FT                   /translation="MNVTAYVVLSGILFTIGCVGVLIRRNAIVVFMCVELMLNASNLAL
FT                   VAFARQHGNLDGQIAAFFVMVVAAAEVVVGLAIIMTIFRTRRSASVDDASLLKY"
FT   gene            561784..563715
FT                   /locus_tag="Noca_0531"
FT   CDS_pept        561784..563715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0531"
FT                   /product="NADH dehydrogenase subunit L"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: nfa:nfa26570 putative NADH dehydrogenase I
FT                   chain L; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain L; PFAM: NADH-Ubiquinone
FT                   oxidoreductase (complex I), chain 5/L domain protein;
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80073"
FT                   /db_xref="GOA:A1SE38"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE38"
FT                   /protein_id="ABL80073.1"
FT                   /translation="MYALNEGAIPVVHAASADGVYSLLWLVVALPLAGAAILLVGGRYT
FT                   DKWGHLLGTLLPVVSFILSLVLFFDLLGRDEGDRQFNQHVFTWFQTGHLDVGMDLLYDP
FT                   LSALFLLLITGVGSLIHVYSIGYMAHDPRRRRFFGYLNLFVAAMLLLVLSENYLGLFLG
FT                   WEGVGLASYLLIGFWQHRPSAAAAGKKAFVINRVGDMGMSTAIMMFYVTFGSTSFTVIS
FT                   ANAPGASDTQLTILGLLLLLGACAKSAQFPLQAWLLDAMEGPTPVSALIHAATMVTAGV
FT                   YLIVRSNFIFEAAPHAQTAVVVVALISILWGAAIGCAKDDIKKGLAGSTMSQIGYMMLG
FT                   AGLGAAGYAFAIFHLLTHGFFKANMFLGAGSVMHGMNDDVDMRHYGALRKMMPVTFLTF
FT                   AMGYLAIIGFPGFSGFWSKDKIIETALADNWLVGLCAIIGAGVTGFYMTRMMLMTFFGD
FT                   DRRWEKDVHPHESPSVMTVPLVVLAALSVLGGLMLAGDWIQDFLAPVVGVGAHDDPPVP
FT                   ALLVTAIIVVVVGAGVALAWMLFGRREIPRTAPQDVSFVTRAAREELYGNQINDGLVVN
FT                   PGRHLVGGLLTIDKHVIDGTFTGGPVALGSFAGVARRVQNGFVRTYALSLLGGALIVVL
FT                   ALLAVNLA"
FT   gene            563712..565241
FT                   /locus_tag="Noca_0532"
FT   CDS_pept        563712..565241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0532"
FT                   /product="NADH dehydrogenase subunit M"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05921 probable NADH dehydrogenase
FT                   subunit M; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain M; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80074"
FT                   /db_xref="GOA:A1SE39"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE39"
FT                   /protein_id="ABL80074.1"
FT                   /translation="MNDLPWLTALWVLPLVGALVTAFVPRATGSALPKQVGLLFALLTL
FT                   AVGIAIAVQYDTGDGMQLTETHTWIEAFGVNYALGVDGLGLLLILMTVALVPLVLVATW
FT                   NDADDRSSAAFVAWALALESFSLAVFAATDVFLFYMVFEATLIPAYFLIGRFGQAGRGR
FT                   AALKFLMYQLGGGLVLLASVIGLYVVSADAGNPSYLLSDLQQLDLSTNTERWLFVGFMI
FT                   AFAVKAPLFPLHTWLADTTEKATPGTSVLLVCILDKIGTFGMLRFGLGLFPEASQWATP
FT                   VVVALALVSIVYGALVAIGQDDILRLIGLTSLSHFGFITLGIFAFSSQGGSGAILYMVN
FT                   HGVGTAALFLIAGYLIRRKGTQLISQIAGVETKAPLLAGLFLVAGLSTLGLPGLSQFVS
FT                   EILVLISAFDYHWWVGAIAVTGIVLAAIYVLWLYQRTMTGPATPGDEAMTDLNRRELVA
FT                   VVPLIAALVFFGFFPMPLLDVSNPTVDSLLQHVGVSDEAPTVADHAEEGAH"
FT   sig_peptide     563712..563801
FT                   /locus_tag="Noca_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.880 at
FT                   residue 30"
FT   gene            565241..566842
FT                   /locus_tag="Noca_0533"
FT   CDS_pept        565241..566842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0533"
FT                   /product="NADH dehydrogenase subunit N"
FT                   /EC_number="1.6.5.3"
FT                   /note="KEGG: rha:RHA1_ro05922 probable NADH dehydrogenase
FT                   subunit N; TIGRFAM: proton-translocating NADH-quinone
FT                   oxidoreductase, chain N; PFAM:
FT                   NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80075"
FT                   /db_xref="GOA:A1SE40"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE40"
FT                   /protein_id="ABL80075.1"
FT                   /translation="MDFIKPTIEYGDVWPLLVVFGVAAVGVLVEGFVPRAQRYLVQAAL
FT                   AIAGVVVALVGTILVARDLDVLGDGAARGAIDVEGTIAVDGPALFIWGMLLVFALGGAL
FT                   LFAERRLEGGVSAFAGQAAALPGTEAERQASTRGLEHTEVYPLMMFALGGMMLFAAAND
FT                   LLTLFVALEVLSLPLYLLSGLARRRRLLSQEAALKYFMLGAFSSGFFLYGAALVYGFSG
FT                   SMGFAEINEAVRDDVGNQTLLLIGIGMLSVGLLFKVGAVPFHSWTPDVYQGAPTAVTAF
FT                   MAAGTKIAAFGAMLRLFYVAFGSDRWSWQPMLWIIAILTMLVGALIAIVQTDMKRMLAY
FT                   SSVAHTGFLLTGVLGVQQASELADGEVTSLQAVLFYLVTYGFAVVGAFAVVTLVRDAGG
FT                   EAGQFVRWRGIGRRSPLVAGVFAFFLLSMAGIPLTAGFVGKWAVFTVALAAGAWPVVIA
FT                   AVLCSIIAVFFYVRVILLMFFEDDDVSAQGEVASVTKPSVLTSATIFVGVAATLVLGVV
FT                   PGPVLDLAANAGQFVR"
FT   gene            566839..567843
FT                   /locus_tag="Noca_0534"
FT   CDS_pept        566839..567843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0534"
FT                   /product="Trans-hexaprenyltranstransferase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: sco:SCO4583
FT                   putative polyprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80076"
FT                   /db_xref="GOA:A1SE41"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE41"
FT                   /protein_id="ABL80076.1"
FT                   /translation="MTPASSGLALPVTDEALASRLRDRMAAVEVALAGHVVSRAGFVSE
FT                   TASHLMAAGGKRFRPLLVLLAAETGEHPDADEVITAACVVELTHLASLYHDDVMDEAEL
FT                   RRGAVSANARWDNHVAILTGDFLFSKSSELTAELGPDAVRVQARTFTRLVEGQILETVQ
FT                   PGPGEDPLAHYLDVVAGKTGSLIATSAHYGARFGGASREVEEALTAYGEIVGSAFQLSD
FT                   DILDIASDSGESGKTPGTDLREGVPTLPVLMARASTDPADARLLELLGGDLTDDDRHAE
FT                   ALRLLRAHPALGQARDYVIARAHEAKAHLAVVPPGPVRDALEAFADLVAVRSS"
FT   gene            complement(567946..569427)
FT                   /locus_tag="Noca_0535"
FT   CDS_pept        complement(567946..569427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0535"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane;
FT                   KEGG: sma:SAV4873 RarD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80077"
FT                   /db_xref="GOA:A1SE42"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE42"
FT                   /protein_id="ABL80077.1"
FT                   /translation="MPEVSGARRVGLVDVRPGLGVPAVGPDVTPPVPVAVLGREHADLP
FT                   ALLRPVRGHPLEHLPLARGRRALLLLHDDRAVPGIDPALEVELAVPLHDRVVQVAGRLL
FT                   GPPTDRRTRNRPGGGVGRSARRLGGSRGRGQAAHAQGERGGQGRQGLTHPWGLPPRVAG
FT                   APDRPRARNLPLGPQGQTPATPSYAVRVPEPRRGLAFGFAAYAMWGAFPLYWPLLEPAG
FT                   ATEILAHRVLWSALTMGLLLLVLARTPQLRAVLRDRRVRLLLTIAAAVISVNWVTYIWG
FT                   VNNDRVVETSLGYFINPLVTVLMGVVVLHERLRPLQWMAMGLASGAVVVLAVDYGRLPW
FT                   VALILAFSFGSYGLCKKTANVGATESLAFETAVIAPFAAGYLAWLGWTGGSNFASHGAG
FT                   HALLFATTGVVTAVPLICFGAAATRVSMVTLGLLQYLAPIIQFALGVLWFHEDMPAGRW
FT                   VGFVLVWIALVVFTVEAVNHRRRQLRLTVEATTAS"
FT   gene            complement(569507..570622)
FT                   /locus_tag="Noca_0536"
FT   CDS_pept        complement(569507..570622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0536"
FT                   /product="thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding protein"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; KEGG: sma:SAV4876 2-oxoglutarate ferredoxin
FT                   oxidoreductase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80078"
FT                   /db_xref="GOA:A1SE43"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE43"
FT                   /protein_id="ABL80078.1"
FT                   /translation="MTTDLNFPGLRSGVELVPTTDQSQTGKDYTSDQEVRWCPGCGDYA
FT                   VLKAVQGFLPDLGLRRENIVFISGIGCSSRFPYYLDTYGMHSIHGRAPSIATGIATARE
FT                   DLSVWVVTGDGDALSIGGNHLIHALRRNVNMTILLFNNRIYGLTKGQYSPTSEAGKITK
FT                   STPMGSLDHPFNPVSLALGAEGSFVARTIDSDRKHLTSVLSAAAAHRGTSFVEIYQNCP
FT                   IFNDGAFDALKSPDTKADAIIPLVHGEPIRFGAPDSNGLGTKGLIRDVGPGGTGGVKIV
FT                   DLADLGDAAEDKVLVHDAYNPDPSTAFAISRLTDSGYLHQSPIGIFRQVERPTYDDQAR
FT                   AQVSEAKAAHPGDRSERLAALIGGGDTWTVV"
FT   gene            complement(570619..572601)
FT                   /locus_tag="Noca_0537"
FT   CDS_pept        complement(570619..572601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0537"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: tfu:Tfu_2674 2-oxoglutarate
FT                   ferredoxin oxidoreductase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80079"
FT                   /db_xref="GOA:A1SE44"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE44"
FT                   /protein_id="ABL80079.1"
FT                   /translation="MSVQQGKQVKQLDRVIIRFAGDSGDGMQLTGDRFTQESAVFGNDL
FT                   VTLPNFPAEIRAPQGTLPGVSSFQVHFADHDILTAGDAPDVLVAMNPAALKANLGDLPK
FT                   GAAIIVDTHDFTSRNLAKAGYATNPLDVLGDVNDPLGAFAVHAVDLTGMTIEAVKEFGL
FT                   SRKDAARAKNMFALGLLSWMYGRPTEPTITFLEKRFAKVADIRDANIAAFKAGWNFGET
FT                   TETFVVQYEIKPAPMAPGTYRNITGNLALAYGLVAGGVQSGLPVFLGSYPITPASDILH
FT                   ELSKHKAFGVTTFQAEDEIAGVGSAIGASFAGSLAVTTTSGPGIALKSEAIGLAVMTEL
FT                   PLVVVDVQRGGPSTGLPTKTEQADLLQAMFGRNGEAPVPIVAPRSPGDCFDAALEACRI
FT                   AVTYRTPVMLLSDGYLANGSEPWRIPELADLPTIDPAFASPAAEGDTFQPYSRDPETLA
FT                   RPWAPPGTAGLEHRIGGLEKADITGNISYDPANHDFMVRTRQAKVDRIAESLPPLEVDD
FT                   PSAEDGQGAKVVVLGWGSTYGPIGAGVRRVRKAGYRVAQVHLRHLNPFPKDLGEILARY
FT                   DKVLVPEMNLGQLSLLIRAKYLVDAVGYNQVRGLPLKAAEVAQAIGELISQAEGIQVDL
FT                   TDTTTADTTAGSTASTAVSTEEALS"
FT   gene            572921..573958
FT                   /locus_tag="Noca_0538"
FT   CDS_pept        572921..573958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0538"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: mmc:Mmcs_3482 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80080"
FT                   /db_xref="GOA:A1SE45"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE45"
FT                   /protein_id="ABL80080.1"
FT                   /translation="MKTSIKVAAAAFAGVLALTGCSASADGDADETVNVNAFSVMEAAN
FT                   EPVFADFAATEEGKGVRFETSYGASGDQSRAVVAGAAADVVHYSLETDVTRLVDEGLVA
FT                   EDWKDDATNGIATSSVVVFVVRKGNPENIQTWDDLVKPGVEIITPNPGSSGSARWNILA
FT                   AWAHVTGNGGSAEDAKSFLTRLLDNTIALPGSGREATTAFTDGSGDVLLSYENEAILAK
FT                   QSGADVDYVLPPDTLLIENPAAVTVDADETAQAFLEFMTSPEAQADYAQSGFRPVVDGV
FT                   DIGAVEGANDPSDPFPAPDRLFTIDGDFGGWGEAADKYFGDGEEGHPLGIITELQQQTG
FT                   KVGEE"
FT   sig_peptide     572921..572998
FT                   /locus_tag="Noca_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 26"
FT   gene            573958..574839
FT                   /locus_tag="Noca_0539"
FT   CDS_pept        573958..574839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0539"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; sulfate ABC transporter, inner membrane subunit
FT                   CysT; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mbo:Mb2421c probable
FT                   sulfate-transport integral membrane protein ABC transporter
FT                   CysT"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80081"
FT                   /db_xref="GOA:A1SE46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE46"
FT                   /protein_id="ABL80081.1"
FT                   /translation="MPTALLEGPRDSAEPASHGGRRRRRARRTARRNTLTPGAGLGLGI
FT                   SMIWFSLLVLIPLAAVVAAASAGGWDGYLRVLQNDQTWAAIKLTVTQSLAVTLVNVVMG
FT                   TVIAWVLVRDRFWGRSVLDVIIDVPFAMPTVVAGLLLLSLYGPSSPIGVHWANTERAVS
FT                   LALAFVTLPFVVRTVQPVLEELDADVEEAAASLGAGRATVVRRIVLPSLAPAIAAGAAL
FT                   SFARAISEYGSLVLLSGNRPFQTEVVSVRVLTFIENGSNTSAAAVASVMLAVALVVIVS
FT                   LDLVQRRVARRG"
FT   sig_peptide     573958..574152
FT                   /locus_tag="Noca_0539"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.911) with cleavage site probability 0.857 at
FT                   residue 65"
FT   gene            574832..575653
FT                   /locus_tag="Noca_0540"
FT   CDS_pept        574832..575653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0540"
FT                   /product="sulfate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: sulfate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mtc:MT2469 sulfate ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80082"
FT                   /db_xref="GOA:A1SE47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE47"
FT                   /protein_id="ABL80082.1"
FT                   /translation="MVEVSTPTRWLLRALATGYVFFLVAWPVGLLGRRTFDGGPGNLTD
FT                   MLADDRAVAALQLTAVVAFWAVVINLVFGVTVSILLVRYEFPGKRVLSALIDLPLSVSP
FT                   VVVGLALVLVYNGRDGWFGTTLEDNGLQVIFNSPGMIMATCFVALPLVIREVVPVLTEI
FT                   GDDQEQAARSLGAGARQTFLRITLPSIRWALVYGVVLALARSIGEFGAVKIVSGNITGR
FT                   TQTATLAVEAKYQNFQQPEAYAIAFLLALVCIACLVVVAVLRPRRAHRPRP"
FT   gene            575669..576688
FT                   /locus_tag="Noca_0541"
FT   CDS_pept        575669..576688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0541"
FT                   /product="sulfate ABC transporter, ATPase subunit"
FT                   /note="KEGG: mpa:MAP2210c sulfate transport system
FT                   ATP-binding protein; TIGRFAM: sulfate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80083"
FT                   /db_xref="GOA:A1SE48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR014769"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR024765"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE48"
FT                   /protein_id="ABL80083.1"
FT                   /translation="MSIEVSGVTKRFGDFVALDDVSVSLPTGQLTALLGPSGGGKSTLL
FT                   RIIAGLDTADEGTVSIEGVDATRLPPQKRNVGFVFQHYAVFKHLTVAKNVAFGLEIRTH
FT                   GGLRPPWAPRRRTDRDRIQAKVDELLRLVHLTQFAHRLPAQLSGGQRQRMALARALAVE
FT                   PSVLLLDEPFGALDAKVRKELRGWLRRLHDEVHVTTVFVTHDQEEAMEVADEIVVINEG
FT                   RVEQVGTPDQLYDEPANDFVMGFLGDITTLNGVRLRPHDVHISRSPQFSGAAEGTVSRL
FT                   LRVGFEVRATVLTDDGDEVTVVLTRAHARQLGLEAGSPVWVTPASGAAVIPAMLPTPA"
FT   gene            complement(576702..577691)
FT                   /locus_tag="Noca_0542"
FT   CDS_pept        complement(576702..577691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0542"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: ccr:CC1928 inosine-uridine preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80084"
FT                   /db_xref="GOA:A1SE49"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE49"
FT                   /protein_id="ABL80084.1"
FT                   /translation="MPVPFILDTDTAQDDCVAIIAGILDPEADLRALTMVAGNVSFDQQ
FT                   VRNAQLTLNALGRLGEVPIHLGCRQPMVLPWVSAENVHSDGSGGLDMDFAGTTTEDEHA
FT                   VDALIRMTAEAPGEISVVAIGPLTNIAMAAVKDPAFVRNVRHLVIMGGSNNGRGNITPA
FT                   AEFNLYVDPHAAKVVFEAGFDITVVPWAPLTLNDAVFSREQLAGIESLGTTLSQFFLQV
FT                   CGPTLAFDESVGIPGTTHPDSLSVAVLLHPDLVLDAAEYHVAVEADSELTRGYSSMSWG
FT                   VHGLAPNARVIEHIDAVAFHRYLTGLLATPTEPTVPLRFGAPFTARQG"
FT   gene            complement(577710..578474)
FT                   /locus_tag="Noca_0543"
FT   CDS_pept        complement(577710..578474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0543"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rxy:Rxyl_1898 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80085"
FT                   /db_xref="GOA:A1SE50"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE50"
FT                   /protein_id="ABL80085.1"
FT                   /translation="MAEDFAEGLPAGLHSAAPGTLHSRISAWLRERIATGAWPPHYRLK
FT                   PEPELAAALGVSRGTLRRALATLIAEGALVQVRGKGTFVTSTLVEPAIAQKLTSLAEDF
FT                   ADQGSPLSTEVLECRLLTPPAPVAALLDTPVGRPILHLVRLRSTPEGPVALLDNYVRTD
FT                   LAPGLEETDFTEATLFGALASRHGLHIATGRRTFTATLADQKQAALLDLAPGSPLQHLE
FT                   QVTYLGDGSPIEYSDVWIRSDRLRVTSLLTRH"
FT   gene            complement(578474..579169)
FT                   /locus_tag="Noca_0544"
FT   CDS_pept        complement(578474..579169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0544"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: syn:sll1776 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80086"
FT                   /db_xref="GOA:A1SE51"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE51"
FT                   /protein_id="ABL80086.1"
FT                   /translation="MTEYASLTPAELAPYIQHTLIAVGTTREQTIAHAQQCVEHGFDAA
FT                   MVAGSWVGLTAEVLAGTGITVASALDFPTVGVMTSAGKAAEAAELVRLGARELDIGVQV
FT                   GWLRSGDHDAFREDIAGVVRAAGVPVKVMLELPLLTPSERDAAVDLACEAGAAYLKNAS
FT                   SGAIEVASPASIRYLVDRAPAGVLVKASGGIKSRDQIVALLEAGAAKVGTSAGVEVVTD
FT                   SADEDTESY"
FT   gene            complement(579216..580130)
FT                   /locus_tag="Noca_0545"
FT   CDS_pept        complement(579216..580130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0545"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: rxy:Rxyl_1888 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80087"
FT                   /db_xref="GOA:A1SE52"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE52"
FT                   /protein_id="ABL80087.1"
FT                   /translation="MRIAVVGSYGVGMTMRMPRLPVAGETLLGGEYRSGHGGKGSNQAV
FT                   AASRLGAEVTLLTAVGGDAIGRAARDMWAAEGVDATATITAPAATMVGMILVEPSGENR
FT                   IVIATGALDHLTPRHVQDFAPQLAAADIAVVSLEIPMATAVAALRAAHEAGTRTLLNPA
FT                   PAQPIPDEAWSNVDLLTPNRTEAAILLGLPPDAAGPAEELARQLHERGGATIVLTLGAE
FT                   GALICDAGGLTPVAAVPPAEVVDTTGAGDAFTAALAVELAGGGSVPGAVAFAARVGAFA
FT                   VAHHEVFPGLPRRTDLDTEPDLT"
FT   gene            580692..581231
FT                   /locus_tag="Noca_0546"
FT   CDS_pept        580692..581231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80088"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE53"
FT                   /protein_id="ABL80088.1"
FT                   /translation="MNESSRSLSTTTCPDWCIDNDHSQEVNEQLGDGPLHQGPAFGGRL
FT                   RAWGLDDADGRTLSIDFEDRSDFGTPEQLRALAQAAEEAARWLEEQGMSHQPPAGSADR
FT                   APAPRLLDALALREAEGFLTIDEAAERYGIDRGVLAAEAAAGRVGTVSLRFDDTIEATF
FT                   LPTHDEAVAAWLEAHR"
FT   gene            581228..581422
FT                   /locus_tag="Noca_0547"
FT   CDS_pept        581228..581422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80089"
FT                   /db_xref="GOA:A1SE54"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE54"
FT                   /protein_id="ABL80089.1"
FT                   /translation="MSADRLAARRVPKEALRDRTGVVIRQARKAQRLTLRDLAAICEVD
FT                   YTTIKAITEAIGKHMAGAA"
FT   gene            581823..582059
FT                   /locus_tag="Noca_0548"
FT   CDS_pept        581823..582059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80090"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE55"
FT                   /protein_id="ABL80090.1"
FT                   /translation="MTTTPKKQLTPFISVQGAPIRLFLTRQQAAVACGVSPATISRVKN
FT                   TGALKAKKTAPRGGRELYRIEDLQAWFDGLDDA"
FT   gene            complement(582212..582445)
FT                   /locus_tag="Noca_0549"
FT   CDS_pept        complement(582212..582445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80091"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE56"
FT                   /protein_id="ABL80091.1"
FT                   /translation="MPYPQNHPLREVLAEYRNTITNILFEDEMTGDIELDPAEAFAILL
FT                   KSTYFYAFAIEDLMDQADFDPAKVVPRTVDEI"
FT   gene            complement(582461..585370)
FT                   /locus_tag="Noca_0550"
FT   CDS_pept        complement(582461..585370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0550"
FT                   /product="phage tail tape measure protein, TP901 family"
FT                   /note="TIGRFAM: phage tail tape measure protein, TP901
FT                   family; KEGG: nfa:nfa15380 putative phage tail"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80092"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE57"
FT                   /protein_id="ABL80092.1"
FT                   /translation="MARADITRTSGTVSRLGRTASRTGRLLGAAFAVGSIARAAVAVGK
FT                   VGAGYVDSLNKIQALTGSTDASLSRIARRLESQASVYAKFGQTTGDAAAGMVELTKSGL
FT                   SARKALGAIRGTMILAKAGELEVADASELVANTLNTFSLKASKASKIANGLANAANISS
FT                   ANVTDLAESFKYAAPLAAKAGLPLDQVNAILAELSNSGIKASQAGTSLRGILLALQAPS
FT                   TAGATALEDLGVRVYDARGRMRDFGDLLEDLRKGLGRLSDEGRNSALKSIFGRNAITGA
FT                   QVLLKGGRQALDEYTAGVRRAGAAQALAESSSRGLAGTINQIKAAATSTAQALYRIYSP
FT                   VIDRALRTALEFATKHKKVLIPALAGAAAAAAGAAAALGAIALVTSPTALAVSAVVGLG
FT                   AAVSVAYKRSETFRNAVAATADALRSFGGYLQGTVLPAVTRTAREIAQRLQPVLAQAGQ
FT                   TFRSDIAPALAQVAAQFREWQPTIRRVAETAGRLTAQVLIFQAKLSGKVIPVLIRLGGI
FT                   MARTNIPVALRLADALVKLTAANMRTGAAMLAAGQKAARFAAAVRSKFNDAIAFMTTVP
FT                   GRIKGALGDLSNILYAAGRSVISGLISGIVDKAQDLWNTLAGITSKIPLHKGPPARDRK
FT                   LLRGTGRLIMAGLIRGIDDGSEGIKRALERITQLIQKRLDGKKQADRRKSLLKSLKDEG
FT                   AALRANGKLQDAVARALEKATSRYKDLIRTSREYAASVKAGFQSYGSVVGLGTTGGGTA
FT                   VTLPALLSQLAARASVADQFTAIIEKLKSRLNKTSLKQLLDQAAQGDLEGALATAQAIA
FT                   SGGPAAVAQINALTAQIGKAGGKLGDSAAASLFAAGIRAAEGFAKGLKRQERRLDQTAD
FT                   RMADRLVDRIRTQLGIGKTSAPRTPAPRFSASDTYAGRTPAYDAYMRQAARPSSGGDVH
FT                   ITLNVQAPVGSSSQDIGRTLTKHLDAYFGAGGRRHTRWA"
FT   sig_peptide     complement(585251..585370)
FT                   /locus_tag="Noca_0550"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.527 at
FT                   residue 40"
FT   gene            complement(585456..585692)
FT                   /locus_tag="Noca_0551"
FT   CDS_pept        complement(585456..585692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80093"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE58"
FT                   /protein_id="ABL80093.1"
FT                   /translation="MAVTEDMTRVRQIFDEAMAETFDALFKAPDAVAVVAAVAQGDLAI
FT                   VITGSTLHVVSVTPLSPAPAAAADDDYRPGMYL"
FT   gene            complement(585699..586034)
FT                   /locus_tag="Noca_0552"
FT   CDS_pept        complement(585699..586034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80094"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE59"
FT                   /protein_id="ABL80094.1"
FT                   /translation="MSFEEDRARDRVREAANAGYLSNWAAARERFEQATREWEAAAREY
FT                   RDAYHRIADRNPLLDEFGLTTGEVAPLGARDQAVLDAAEHLEAQAWARRQAAATAFERA
FT                   DDFSHPW"
FT   gene            complement(586031..586432)
FT                   /locus_tag="Noca_0553"
FT   CDS_pept        complement(586031..586432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0553"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80095"
FT                   /db_xref="GOA:A1SE60"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE60"
FT                   /protein_id="ABL80095.1"
FT                   /translation="MIVVLDDDPTTVAQLTAALTGYVRQLRRNGGYPAPDLLLLMRSVQ
FT                   ARSGQERPKLAPGARPSHSDSEPADGAGAGPEVIGLTYGQTAQRLGISERTVRRRVTSG
FT                   ELPVIRLGARVARIPASAVDALAEQGKVS"
FT   gene            complement(586429..587172)
FT                   /locus_tag="Noca_0554"
FT   CDS_pept        complement(586429..587172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80096"
FT                   /db_xref="GOA:A1SE61"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE61"
FT                   /protein_id="ABL80096.1"
FT                   /translation="MSTNPPPHQPCPAASPTDQVVDERALALAFHESGHAVAAVCLGNA
FT                   VEAVTIAGGRTHAGLTLWWSETTDEARALLKSGGRDADRDLFLRARGRLEQDVMITLAG
FT                   DVAEALGRLEARWLATTRRGELRKSHAGTVQRAPVLERHVEALAGRDEDRVHARERAAS
FT                   EADDHQEAGLDPGSDEAAAWAGILALNPDHDPRTLGAHLAYLRAATRTLLEREWEAVEA
FT                   LAGALVEHETLSGLAATLIIGAHRS"
FT   gene            complement(587200..588729)
FT                   /locus_tag="Noca_0555"
FT   CDS_pept        complement(587200..588729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lxx:Lxx24020 phage-related terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80097"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE62"
FT                   /protein_id="ABL80097.1"
FT                   /translation="MRLLDDPDALVQPSFYHCPDYVVTIGPEVADLVQLFGRTANPEQR
FT                   LLLDGSFGMDRRGRLAAFEVFVEAARQNLKTGFFEFRALGKALLLHRPMQIWTAHKESA
FT                   TDQALLDLKQMIEESAELSKRVKRITEGKGGKSIEFTNRCTIVFRPRTGKAGQSMSADD
FT                   VDLDEYFAVEAKHEGSLLPTMSTRPNAQVGAASSAPHLGSHMQRALMARGRMAALGLRI
FT                   EPRLLYAEWSPIRVIGEKPDGSPRFGPPPCAQPKCTHRLGVEGCIADDREVIKLANPSA
FT                   GRSSKPAISWEFIADERRKLCSPEAPEESLDEYFKERLSIGVEEVGLEASIFPTWPGLK
FT                   QAPPAPLEVLALGVACDNDQTVLSLGAACKGHAHTHLAVVDRRAATERKGFAENVARIQ
FT                   RERSCAVLIRGKNFMIDDLIEAGVTLRLVDADERAQSHADLATAIETNALEHGDYPELN
FT                   AAVEVAQWQVLDNRRSLDSRRGEISALESVALALRGATKPNPTVEPFAIWG"
FT   gene            complement(588726..589163)
FT                   /locus_tag="Noca_0556"
FT   CDS_pept        complement(588726..589163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lxx:Lxx24010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80098"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE63"
FT                   /protein_id="ABL80098.1"
FT                   /translation="MSVDRTCEECGTPFVAKTKRGRFCGAACRVRANRRPTKTGRAVTA
FT                   AAQSGERPAPRVGAADGGLEAQIRSSLESAGAMQTVAGTAALLLARQIGSGQDSGSAVA
FT                   TMTRELSRLMGEARAEAAPKQRDGADDVMARVAAKIQELVR"
FT   gene            complement(589544..589915)
FT                   /locus_tag="Noca_0557"
FT   CDS_pept        complement(589544..589915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE64"
FT                   /protein_id="ABL80099.1"
FT                   /translation="MTVPAPPDLAAWFRHRDGCAGPAVFVIEHADGHPGLVCRGCGRSV
FT                   TFRGGTFADAARRVLRRYAHEVAHAAEDAQAKALAECMDCGAPLPVHRMDRPGVPLCAA
FT                   DRVRREQLKLARRGSKGSR"
FT   gene            complement(590431..591093)
FT                   /locus_tag="Noca_0558"
FT   CDS_pept        complement(590431..591093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80100"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE65"
FT                   /protein_id="ABL80100.1"
FT                   /translation="MGAGNVKAVLTDWSAHVRDPAFRVLVAIALTTKDDDDPPVFWGGL
FT                   ELLAAALGRRAPLTDADLRAVGRAMGQLRKAGAIVRVQHSAPGKAPRHELRIKPSTPDA
FT                   ARLVNQGSTPDARRPVNNGEHRTRGGYSQDAPRPNTGRPASDRGVLGTTEEGASHPPSV
FT                   STGGRSREVVDVTIVDAALHRFEPVSHRPSRCSICDRAAADPRHATPSIELHEAVNT"
FT   gene            complement(591094..591324)
FT                   /locus_tag="Noca_0559"
FT   CDS_pept        complement(591094..591324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80101"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE66"
FT                   /protein_id="ABL80101.1"
FT                   /translation="MSEPRRQGSGPADDVRAQIDRLGRLMQDEGDPFVAAVGAEISEVA
FT                   TMRPRTDGTEFARLAYLALVWALGEIEGRED"
FT   gene            complement(591317..591718)
FT                   /locus_tag="Noca_0560"
FT   CDS_pept        complement(591317..591718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80102"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE67"
FT                   /protein_id="ABL80102.1"
FT                   /translation="MAHSAGDIRPAATAVPSAHRSPGLERVADSWPAADVSAAAFHMHA
FT                   LGMSESVSALALRTLAARGVRNVRAYVAPWTADDASRWTQRANEVQCDAERAACHLKIG
FT                   HHQDPLIRGLRRRVARWPWRTSTGGDRGV"
FT   gene            complement(591718..591897)
FT                   /locus_tag="Noca_0561"
FT   CDS_pept        complement(591718..591897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0561"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: mmc:Mmcs_4829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80103"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE68"
FT                   /protein_id="ABL80103.1"
FT                   /translation="MPDYLTTAEVADILRTPVETVRFWRHAHKGPKSFKVGRRVLYARE
FT                   DVERFIAEARGTTG"
FT   gene            591983..592798
FT                   /locus_tag="Noca_0562"
FT   CDS_pept        591983..592798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80104"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE69"
FT                   /protein_id="ABL80104.1"
FT                   /translation="MTPSTQEEIWFRAGRIIRPKDPVVRDGNVIWAEEYDGKAPRAPGP
FT                   DDLLDRYCRLAIATHEEIAEFVALNGLPEVGGFVMLGEEKAPDWRQRFPDEPGRVPADR
FT                   IREHARGVAAARRVGAALAGRRPGDQADWLDMHRFLNPGKRRLASRPGWLGQELGDWSL
FT                   ERDRFAGLVSDFLASTGVYTGVNWSDYKRLAIVPVSSTFLGAIALLLSREIGAEGRYAC
FT                   SSCGSPVDRRRPPRAGESVYCDRPECKREQQRRNQAAWRAKKAAERGGS"
FT   gene            592798..593883
FT                   /locus_tag="Noca_0563"
FT   CDS_pept        592798..593883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0563"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mmc:Mmcs_4828 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80105"
FT                   /db_xref="GOA:A1SE70"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE70"
FT                   /protein_id="ABL80105.1"
FT                   /translation="MASIKKRDNGKWRARYRDEGGKEHARHFARKTDAQDWLDEETAGL
FT                   VRGDWIDPRHGKITFAQWFADWSARQVWADGTLEAAEQAAASVTFGNIAMRKILRSHVE
FT                   AWVKSMSTTLAASTTRMRYNYVHMAFRAAVRDKVIREAPSDGVALPKIPRAEVTMLIPT
FT                   PEQVAAARVSCPDSAFVGFIAVCAYAGLRLGEAAGLQVGDVDFLRREIRVRRQVQGQTV
FT                   ATAKVVPPKAGSARTVYVDDSLVKLLSTHVRDYGTWGDEGWLFGMGTLLNRNSAGHLWR
FT                   QTRQGVGLDAFTLHDLRHFYASGLIAAGCDVVTVQHALGHSSPTITLNTYSHLWPKAED
FT                   RTRDAAASLWRPATRQGKAAQ"
FT   gene            complement(594467..594958)
FT                   /locus_tag="Noca_0564"
FT   CDS_pept        complement(594467..594958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0564"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520; KEGG:
FT                   mpa:MAP4063c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80106"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SE71"
FT                   /protein_id="ABL80106.1"
FT                   /translation="MADSSFDIVSKIDRQEVDNALGQTAREIATRFDFKGTGASIEWQG
FT                   EHAIEISASADDRASAVLDVFKTKLVKRDVSLKVLDASEPRQSGQQSKIAIALKEGISS
FT                   EDAKKISKLIRDEGPKGVKAQIQGDELRVSSKKRDDLQAVIALVKQQDYDFAVQFTNYR
FT                   "
FT   gene            595077..595158
FT                   /locus_tag="Noca_R0012"
FT                   /note="tRNA-Tyr1"
FT   tRNA            595077..595158
FT                   /locus_tag="Noca_R0012"
FT                   /product="tRNA-Tyr"
FT   gene            complement(595341..596720)
FT                   /locus_tag="Noca_0565"
FT   CDS_pept        complement(595341..596720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0565"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sco:SCO5349 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80107"
FT                   /db_xref="GOA:A1SE72"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE72"
FT                   /protein_id="ABL80107.1"
FT                   /translation="METSFDVRIYAVLPYRGARGTTYAVRWQVQGRRFRRTFTTRKLAD
FT                   AFRAQLKVAAQAGQSFVVDNGLPLSMQEQAPERTWMQHAMAYVDVKWAHASARHRRGIA
FT                   EALTDVTIATMPEAGGRPPVARMRRVLFRWAFNTAARSTSLDDEHAAALAWLTRHSPPL
FT                   VAFSSSATLRQALDRIALRQDGRPAAASTVTRKRATLHNVLEYAVEVEAFPSNPLHRVR
FT                   WRPPRTTEVVDRRVVVNPTQARALLDAVQTASPALTAYFASLYYAGLRPGEAIELRRED
FT                   LQLPMSGWGQILLSRSHQRAGAAWTDTATAGEVRGLKHRGREDTRPVPAHPDLVATLTR
FT                   HLETFPTGAQGHLFAARTGRAGTPLSPPYHSLVSAKTIYRVWAAARRNALTRQQADSVL
FT                   ARRPYDLRHACLSTWLNAGVPPARVAEWAGHSVDVLLRIYANCVEGDDKIALTRISEEL
FT                   Q"
FT   gene            complement(596887..597114)
FT                   /locus_tag="Noca_0566"
FT   CDS_pept        complement(596887..597114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO5348 excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80108"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE73"
FT                   /protein_id="ABL80108.1"
FT                   /translation="MDLPTNSDTVPSPAATEHLLTVPEICARLGVSRSTFYDWRQAHKA
FT                   PPCLVLPNAQLRVREADFDRWVDERMETAL"
FT   gene            complement(597415..598725)
FT                   /locus_tag="Noca_0567"
FT   CDS_pept        complement(597415..598725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE74"
FT                   /protein_id="ABL80109.1"
FT                   /translation="MYGENGAQMRTELAALLRQHRVMHRLAADSPTERAEVGQQILRYR
FT                   RTLLTWCVQAIRVAQPLTFPNIPLKPADPFRATSDHGAAVSELVRALELARDQAATTAA
FT                   SSTALATPSLNDVVEHWRLAARAAALAEHDTAPDVSVQLTGAQARTIAGDVAAISQALV
FT                   VLDRRYRNTPDWESLAGCDRLGWAALATALDVSLGQPDYSVDQTGWRPRTKPIRGPAKP
FT                   GVLGVLQAEHNLLVRLKSLPNAINLRLIVDSQRLLTSQLIPYAERVDPPLAEQWRARTA
FT                   TYSRIQRELRNVGGRLGNGAGATAEAANAVSRMKALPSGTVIEPRMLGGFQTLFRRIDE
FT                   RISDVLEAGVERGAFVQRVTVPRLASGEGRLVHPVRERFVPVAHPSDLEVVRTIREHLR
FT                   PRPEPAAVSPGASRVDLHAALIHRPPAKGTQFDVPGL"
FT   gene            complement(598725..599024)
FT                   /locus_tag="Noca_0568"
FT   CDS_pept        complement(598725..599024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80110"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE75"
FT                   /protein_id="ABL80110.1"
FT                   /translation="MLLPHAQTLAQARSYVAALADQALTIEASSAYERVLLELDRVHGD
FT                   DCPALDTDDLTDDRDILLTVASSAVEELENYGVDALSVELILAMIVDAHDLDIG"
FT   gene            complement(599141..599677)
FT                   /locus_tag="Noca_0569"
FT   CDS_pept        complement(599141..599677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80111"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE76"
FT                   /protein_id="ABL80111.1"
FT                   /translation="MSPYPDEPDDPDGYRSVTELLERPPVPINWNLLDAEQAEIEWHDL
FT                   DEWVKWLKSTFGLPPNIVPPYWHRHDELVWELSALHCHWLSCYHESASPSAPISWMREF
FT                   AEARGRLRDWVSICGTRLDRDRPTRQTTWPGELPADSGGEIEIRDRKKDFADFVREDVL
FT                   RRRRIEAIANQQLIG"
FT   gene            complement(599689..600102)
FT                   /locus_tag="Noca_0570"
FT   CDS_pept        complement(599689..600102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0570"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80112"
FT                   /db_xref="GOA:A1SE77"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE77"
FT                   /protein_id="ABL80112.1"
FT                   /translation="MSMPTQMSLVGFIASAPELHFTKAGAECCRMRVGIEQWRKEVDGS
FT                   FTKLDPTFHDMVAFESTARETYARFRKGDSFVASGYVHEYEVDGREGSVIKEEFVARKI
FT                   GHNVSKTDYVVQRGRHAADRSLTSVPQPPAVGL"
FT   gene            600243..600554
FT                   /locus_tag="Noca_0571"
FT   CDS_pept        600243..600554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0571"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   cef:CE2618 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80113"
FT                   /db_xref="GOA:A1SE78"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE78"
FT                   /protein_id="ABL80113.1"
FT                   /translation="MPKKIDPAVKERCVRQVLEHLPEYPSLTAAAESVARREGLGKETV
FT                   RRWVVQAQIDGGQRQGATSEELAEIKELKAKVRRLEEDNEILRRASIFFAGELDPRNR"
FT   gene            600770..603022
FT                   /pseudo
FT                   /locus_tag="Noca_0572"
FT   gene            601264..602703
FT                   /locus_tag="Noca_0573"
FT   CDS_pept        601264..602703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0573"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_5505 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80114"
FT                   /db_xref="GOA:A1SCS8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:A1SCS8"
FT                   /protein_id="ABL80114.1"
FT                   /translation="MATKDWSKKTSDAPEGLRRQWRADRALRPAMRSPGRPDPSRVVQR
FT                   QFWRQIATGVTTVEASMAVGVSWPVGARWFRHAGGMPPISLAEPTGRHLTFEEREEIAI
FT                   LRAKDKGVREIARAIGRDPGTVSRELRRNAATRGGKQEYRAGVAQWKAQQAAKRPKTAK
FT                   LVTNERLREYVQDRLAGNVRRPDGTIVPGPTPPPWKGLNKPHRRDRRWSTAWSPEQIAQ
FT                   RLKVEFPDDESMRISHEAIYQSLFIEGRGALKRELVTCLRTGRALREPRARSRNKAQGH
FT                   VTADVVLSERPAEADDRAVPGHWEGDLIIGTGRSAIGTLVERSSRSTLLVHLPRLEGWG
FT                   EKPYVKNGPSLGGYGAVAMNTALTASMTKLPEQLRKTLTWDRGKELSGHALFAVATGTK
FT                   VFFADPHSPWQRPSNENTNGLLRQYFPKGTDLSRWSAEDLEAVAYALNNRPRKVLGWKT
FT                   PAEVFEEQLRSLQQPGVASTS"
FT   gene            603183..604172
FT                   /locus_tag="Noca_0574"
FT   CDS_pept        603183..604172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0574"
FT                   /product="GTP cyclohydrolase subunit MoaA"
FT                   /note="KEGG: tfu:Tfu_1348 elongator protein 3/MiaB/NifB;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   Radical SAM domain protein; molybdenum cofactor synthesis
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80115"
FT                   /db_xref="GOA:A1SE80"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE80"
FT                   /protein_id="ABL80115.1"
FT                   /translation="MTAPLADRFGRVAADLRVSLTDRCNLRCNYCMPAEGLDWLPTEQT
FT                   LTDDEIVRLITIGVEMLGIREVRFTGGEPLLRRGLVDIVARTHALGVETSLTTNALGLA
FT                   RTAQALADARLDRINASIDTVRPDTFATITRRDRLHDVVAGLEAAKSAGLGPIKLNAVL
FT                   LRGTNDDQAPELLRWSIEHGYELRFIEQMPLDAQHDWSRAEMVTADEIFDALSTEFSLT
FT                   PHGEPRGSAPAELFDVGGGPATVGIIASVTRPFCGDCDRVRLTADGQVRNCLFAREESD
FT                   LRTALRSGATDQEIAERWVIAMLGKRAGHGIDDMTFLQPDRPMSAIGG"
FT   gene            complement(604897..605787)
FT                   /locus_tag="Noca_0575"
FT   CDS_pept        complement(604897..605787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0575"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: oxidoreductase domain protein; NADP
FT                   oxidoreductase, coenzyme F420-dependent; 6-phosphogluconate
FT                   dehydrogenase, NAD-binding; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD-binding; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein; KEGG:
FT                   mxa:MXAN_2154 NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80116"
FT                   /db_xref="GOA:A1SE81"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE81"
FT                   /protein_id="ABL80116.1"
FT                   /translation="MRPTHRSRVAVLGLGQMGTEIARVLAEAGHDTTVWNRTSARTEAF
FT                   KSSASVASSADEACRGADLVLSVLSNYTVTDELLKAPGMDDALSGKTLVQMSTGTPDEA
FT                   RSTASWAVRTGVAYLEAKIVAYPNSIGTDHSSILYSGDPETFGRWQHTLAPLAGVNVLV
FT                   GKNVTDAATLDLAWLGFWYGASAAFHQSLALCRAEQLPVETLSSQLRWMVDFIELTARD
FT                   SATRVENDDFSGTDCTLEVHRSALEHVVRASRDAGIDDRVPRSVVELFSRAIALGHGGD
FT                   ELPALDRAVTRTSSR"
FT   gene            606498..607802
FT                   /locus_tag="Noca_0576"
FT   CDS_pept        606498..607802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0576"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; NmrA
FT                   family protein; protein of unknown function DUF1486; KEGG:
FT                   nfa:nfa29880 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80117"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE82"
FT                   /protein_id="ABL80117.1"
FT                   /translation="MSQILVIGARGKTGRHVASGLVSRGVSVKAASRNPEEVSGGHGVP
FT                   TRFDWHDSSTWRSALAGIDAVYLVKPESEDVVEIVTEFLHAMGDAGVRRLVLLSECATH
FT                   TRSEDATERRVELAVEATDLEWTILRPSWFMQDIIAEDFFGPMIRDGGIIVMTTGGSAT
FT                   AWIDVRDIAEVAVELLIGGGSIGQAVDLTGPEALTLNELAERITAAAGTPVLGVEETVA
FT                   EAESRMRRDGFDEDTIAYLTRIVESIIEGHTANVTGDVERITGHPPRHFDSFLVDHARD
FT                   LRRTGDLDADNTRPDAAADNEALFRRLVAAWASSDFDTLLDCFADDMVYTDMPFPDAPV
FT                   QGKTAFKRHVTDYNALFARGQVDTELVTVVATDTHVVGELSCRASYVGPGAPAEGVPVH
FT                   WYATLVDTIDDGKVVSEHAYFDPTAFDKAIQRVST"
FT   gene            607952..610116
FT                   /pseudo
FT                   /locus_tag="Noca_0577"
FT   gene            610474..610818
FT                   /locus_tag="Noca_0578"
FT   CDS_pept        610474..610818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0578"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   mlo:msr9402 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80118"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE83"
FT                   /protein_id="ABL80118.1"
FT                   /translation="MLDSGGHLIVAERSDASPIGRFEIARGKAYGALALGMNSRAIMER
FT                   SEVQPQFVASATAALDGRVIPVPGGVLLDDRNGRLVGAVGVSGDTSDNDESVAMEAIAA
FT                   VGFIPRGAGT"
FT   gene            complement(611044..613143)
FT                   /locus_tag="Noca_0579"
FT   CDS_pept        complement(611044..613143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0579"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; glucose-inhibited division protein A; KEGG:
FT                   sme:SMa0257 probable methylamine"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80119"
FT                   /db_xref="GOA:A1SE84"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037348"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE84"
FT                   /protein_id="ABL80119.1"
FT                   /translation="MNRVPPAAHHRVLFEPISIGSKTLRNRFFNVAHGTAYGVLRPSTW
FT                   ASYRAVRAEGGWAAVSTEFSSVGPSSDESPLHSSDIWDGEDGRRHKAMVDAVHEHGALA
FT                   SIELHHGGAHAMRRLSREPALSPSGLAGELPPPAGPLGTPKVMTLEDIERVEQSFVDAA
FT                   VRARDVGYDIVDVLAGYGYLFAQFLSAFHNHRTDKYGGSLENRARFWIETLGRVRDAVG
FT                   ADCAVASRMSIQTQGPWGHTLDESVELVRMADPLVDLWDLNVGSVLDWGSDISPSRVIP
FT                   EGHNVELFTRVRSATQKPIVGVSRWTSPDLMAEVVRSGVIDLIGSARQSIADPFFPQKV
FT                   YEGRIEDIRECMGINHCISSLDRGNMACAQNATAGEEYRRGWHPERFEPLERPDVSVLV
FT                   VGAGPAGLEAAIGLARRGADMVHLVDSADQVGGHLRQVVDLPGLREWGRFIDHRKIQID
FT                   KLPNLQLIASTTLSAAEILEYGASHVVVATGARWLDTGLAPGTHTPLPGVDGLEWVFTP
FT                   DQLLARGDRPVSGCRVTVYDAEGSYMGSGLSQLLADEGYKVSVVTPHAQVTAEGDLTLD
FT                   GPAVRRSLHTSGVAMYRNVSLTEVGDGLLRGADEFEEPFLLETDALVLVTMRAPVDDVY
FT                   RQLVSERNTLHESEIEAVLCIGDAQSPRPLAEAMFDGHRLAREFESTDPSVPLPYRRES
FT                   LQFVK"
FT   gene            complement(613528..613905)
FT                   /pseudo
FT                   /locus_tag="Noca_0580"
FT   gene            614126..615679
FT                   /locus_tag="Noca_0581"
FT   CDS_pept        614126..615679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0581"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   rha:RHA1_ro06977 possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80120"
FT                   /db_xref="GOA:A1SE85"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE85"
FT                   /protein_id="ABL80120.1"
FT                   /translation="MKSAEEIMKILDAYDLTGSLRDAGELAGCSHHTVKRYVVRRAGAG
FT                   ELDKAAVRPQLIDEYLPKVEEWVERSKGKVRADKAHEKLVALGYTGSERTTRRAVAKVK
FT                   AAYRAGHVRVHRPWVTEPGMWLQYDYGDGPVVDGVKTVLFVAWLAWSRFRVVIALRDKT
FT                   MPSVFAALDQTFRRLGGVPTYVLTDNEKTVTVEHIAGIPVRNSQLVGFAEHYSVVVHTC
FT                   VPADPASKGGTESSVKISKADLVPKDTNLREEYGSFAELEAACEEFCHKVNTRDHRITK
FT                   RPPIEMLAEERTRLHPVAMTPHTVAFGTTRVVPANTPMVMFESGQYSVPHALLGATVWV
FT                   RVHGRGGDEQVVIVHVGQDGPVEVARHHRATPGTPRINDDHFPPQPAGPLDRRPRAKNP
FT                   AESEFLDLGEGARLWLIEAAAAGTGRMRVKMSEALALAKLFDPVEVDWALGHAAVHGRF
FT                   AEADLASILDHHARRPAGGEHRASEDSSLTQGTSAWSRLGQQVGQQVGQQVEADSEVTR
FT                   "
FT   gene            615676..616455
FT                   /locus_tag="Noca_0582"
FT   CDS_pept        615676..616455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0582"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: rha:RHA1_ro06982 possible
FT                   insertion sequence ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80121"
FT                   /db_xref="GOA:A1SE86"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE86"
FT                   /protein_id="ABL80121.1"
FT                   /translation="MTARTAQAPPLPADLEELLRRLRLPHIRRHAPEVVATAKAQRWEP
FT                   AEVLKALFAEEVAGRERSALATRRAAAGFPTGKTFDAWQPEASSIPAPTQQALRTLEWV
FT                   HRRENLVVCGPSGTGKTFLLEALGQHAVEQGLKVAWFTLEDLGVLLRRHRADDTVTKAI
FT                   ARVLRADVVVVDDIGLLPVAADAAEGLYRLVDAAYEKRSVAISSNLHPSGFDELMPKTL
FT                   ATATVDRLLHHAHVCQTSGDSVRLTQALAGQGVSPLS"
FT   gene            complement(616926..617201)
FT                   /pseudo
FT                   /locus_tag="Noca_0583"
FT   gene            complement(617378..618160)
FT                   /pseudo
FT                   /locus_tag="Noca_0584"
FT   gene            complement(618228..618641)
FT                   /locus_tag="Noca_0585"
FT   CDS_pept        complement(618228..618641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0585"
FT                   /product="Monoamine oxidase-like protein"
FT                   /note="KEGG: mxa:MXAN_4930 amine oxidase,
FT                   flavin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80122"
FT                   /db_xref="GOA:A1SE87"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE87"
FT                   /protein_id="ABL80122.1"
FT                   /translation="MTPPSSGTVAVLGAGLAGLAAASSLVAEGFDVTVFEARDRVGGRV
FT                   WLQSLEAAFGPIVIERGAEFVLHGYSETRGLLQQYGLGLVETGMSYYVREVGDLTDVST
FT                   EDLIAAGRDALRFVRDHAHEGALSAEDGLRGGG"
FT   sig_peptide     complement(618552..618641)
FT                   /locus_tag="Noca_0585"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.701 at
FT                   residue 30"
FT   gene            618937..620220
FT                   /locus_tag="Noca_0586"
FT   CDS_pept        618937..620220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0586"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: aor:AO090020000701 monoamine oxidase Pfam:
FT                   FAD_binding_3 HI0933_like FAD_binding_2 GIDA DAO
FT                   Amino_oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80123"
FT                   /db_xref="GOA:A1SE88"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE88"
FT                   /protein_id="ABL80123.1"
FT                   /translation="MVDSVEVAVVGAGFAGLRAARDLSTEGRSVVLLEAAGRVGGRAYS
FT                   RESATDPGTTVEVGGAYFHRHHHARLAAEVDRYNIETQPAAPFKVFRNRLASGDHNAAF
FT                   PIPPEELLEAERVLFCLIRDARRIDCHAGLENQNLKDLDISAHDYLNALNPPPVTSQLL
FT                   RSWIWNMMGQRVEDASALWVLQLIASHDYSVLGVLLSLDEVMTSGTGTLTSAIASEVPD
FT                   LRLGEAVHAIHQQADWVDLAYGAERALRAEHVVVAAPLNCMRELRFEPPLSGPRAEVVA
FT                   EGHGGRGLKLLIHVQGVPEGISCTGDGVFPTLYDYLPATDGGRILVGFTDRDSFDPADN
FT                   DAIEAAVHHYLPEAIIVGTDYHDWCADPYVRAPWVSPRIGQATRAHKSLGEPHGRVHFA
FT                   GSDVSLLFPGYIEGALETADRVRAEING"
FT   gene            620470..620763
FT                   /locus_tag="Noca_0587"
FT   CDS_pept        620470..620763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80124"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE89"
FT                   /protein_id="ABL80124.1"
FT                   /translation="MVKTALKRAGNAVVVWKSADRCEIHPVQIHTSPRRRRSRKGSLID
FT                   WGEAIGEVEVIEVNVPDLAVFKALHDGIIDVMTERPDCQGKTQVSDCGPGRE"
FT   gene            621282..622454
FT                   /locus_tag="Noca_0588"
FT   CDS_pept        621282..622454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0588"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: fal:FRAAL2528 hypothetical protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80125"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE90"
FT                   /protein_id="ABL80125.1"
FT                   /translation="MHKTLGTRVRRLAGAVLVLAVMGVISSCSTESGGQAASASSDDNV
FT                   AQAANEAIDKLYGNGTFTEPASTGPKAQSGYKVALVSSGVQSPTGTAMANGARAAAKLL
FT                   GWDFTVYDGKYEPAEYQEGIRQAISQNADAIWLYSIDCPLVRTALEEAKKAGIPVFSQE
FT                   AADCSDVDPSQPSYYERSLEFVEGDFITWGEGLGAAEATWLLSKLGSEANIIEVSNTEL
FT                   VITKAVHDGFQKAMKEQCPECEVATLNIRLADFGPALEEKISTALLRNPEANGMALSYD
FT                   DLVTSGGAAAVMASGRNDSIEVVSGSGYAANIDLVRQNKGQDAGWTYDGSYEAWSAADM
FT                   INRYFAGEERVPSGVGISMFDHDHDLPPEGEAWSTSIDYEPVFKKVWGVS"
FT   sig_peptide     621282..621401
FT                   /locus_tag="Noca_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.632 at
FT                   residue 40"
FT   gene            622577..623803
FT                   /locus_tag="Noca_0589"
FT   CDS_pept        622577..623803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80126"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE91"
FT                   /protein_id="ABL80126.1"
FT                   /translation="MSIEHDLRAVADELILKIPAISEEVRERCRSGAPNYYRRNDPMLL
FT                   ETELPSITGALTSIIHGLRHARQLPDGASEGALEEARVAAQAGVELTDLLLTRRIGQVV
FT                   LWNWILETAVRIVPAGPRQMAVLKQAAEYHFAWNDRITHDVVATYEQEKSAYFFHSRDR
FT                   QRRAVVTDLLNGVPTDTEQLGYNLKVDHLAAVVWGSAPRVALKSLATLFEASLLVVEGT
FT                   GGTSLAWLGSSRLCESFEQRYETFQPPAATFVAVGGPLNGVDGFRRAHRQAWQACRVGR
FT                   LRSEPVTRYRDIALESVVLRDAPAARDFMMSELGPIGDDDARTQLLRETLKAYFDTGQN
FT                   AAATAGRIRVHERTVAYRLKSIEERLGFPISDRRDELAVALRLAGVLHEASDRQLSILG
FT                   ENSQGETGI"
FT   gene            623979..624278
FT                   /locus_tag="Noca_0590"
FT   CDS_pept        623979..624278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0590"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmp:MMP0887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80127"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE92"
FT                   /protein_id="ABL80127.1"
FT                   /translation="MIRHVFSWRVAEGHSNDEIIEILNTLPGALPVIKYWEVGSHQGDP
FT                   GDNGDPFDGVLITDFDSWDDLDAYSNDPFHLSVVERLLPRFSARAVVDFERKDA"
FT   gene            624278..625204
FT                   /locus_tag="Noca_0591"
FT   CDS_pept        624278..625204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0591"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: pfl:PFL_4035
FT                   hypothetical polyketide cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80128"
FT                   /db_xref="GOA:A1SE93"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE93"
FT                   /protein_id="ABL80128.1"
FT                   /translation="MDRAGIKVAASPWGPDDQLGALNHLSREGSAAILARVDGTRSYDL
FT                   SIDYFVGMPSFQAAGDPSYQLFMSHTPAGTVVDNMNGVGEAGNRHVCYSGDVVFMYTHT
FT                   GTHIDSLSHFGVDGHIYNGFSVEDNLGSRGWTKGGAEVIPPIITRGVLIDVAKSHQVDC
FT                   LPDSYAITVEDCQKVLNDAGITLQPGDVALIRTGRMGFWPDGSKVLGNPPGLSLEAAKW
FT                   LTRQGISAIAADQECVEVGPSQHEDNWLPGHCHFLAEAGVPMIELVNLEELSRDGVDEF
FT                   CLIAAPIRLRGASGAPLRPIALPLRDN"
FT   gene            625236..626420
FT                   /locus_tag="Noca_0592"
FT   CDS_pept        625236..626420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0592"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG:
FT                   bur:Bcep18194_A4962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80129"
FT                   /db_xref="GOA:A1SE94"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE94"
FT                   /protein_id="ABL80129.1"
FT                   /translation="MSMPKVGVVGGSIAGLTAANLLRDAGCEVDVYERSDTLLSGFGTG
FT                   IVVQPELVRYLLERTSTALEDISVPSNEMRYFDAASGRSAGQVKAGWRFTAYNAVYQKL
FT                   LDAFGTERYHLGKELVLVTPGAETATATFADGAQVTADLLVCADGGGSVARSQLLGRKP
FT                   DYAGYVTWRGMVDQSDVSTETWDFFQDAFTYGLLPDGHIIAYPISQVSSEGEVTGDTRL
FT                   NFQWYWNVEAGEALDELMTANDGNRRPVSVHFPALPASSLEEFRSRATSQLAPNFRELI
FT                   TGAPQPFVTIVADADVPRMAFDRLALIGDAAFTPRPHAAAGAAKAAADAWALADRLVEA
FT                   SGDVQEALAAWEPERLAVGEAYLAKVRAMAAALQHGGEFPPGAAEFRFGLPRPA"
FT   gene            626505..627239
FT                   /locus_tag="Noca_0593"
FT   CDS_pept        626505..627239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0593"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mmc:Mmcs_4601 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80130"
FT                   /db_xref="GOA:A1SE95"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE95"
FT                   /protein_id="ABL80130.1"
FT                   /translation="MQLLNEFEVALPPENTWTLLTDLEKVAPCLPGASITSVEGDDFHG
FT                   RAKIKVGPITAEYKGVAQFTELDEKAHTAVLLARGKDARGQGDATANVRATLHPKGAGT
FT                   RVVVETELALTGKVAQFGRGVLADVSGALMTMFAQRLQEMVAAEGAPDTPTSAAAATDD
FT                   RDAQHQAAEAPAHPAASASSSRVGGRVSDRDDEVLDILALAGGMSWAKAIPTGGALVSV
FT                   VAALISVFAAGYASGRARSANR"
FT   gene            627274..628125
FT                   /locus_tag="Noca_0594"
FT   CDS_pept        627274..628125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0594"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   rpb:RPB_3113 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80131"
FT                   /db_xref="GOA:A1SE96"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE96"
FT                   /protein_id="ABL80131.1"
FT                   /translation="MKPPKFRYVAPRSLDDAVEHLASDPDAKVLAGGQSLMPLLAMRLA
FT                   APSILVDLQHVSGLDDIEDQGTSLLIGARVTHREIERSAMVAERLPILSSAVVHIAHPQ
FT                   IRSRGTFGGSTAHADPSGEWPTILLSLGATMRTVSPRGRRTIEADDFFVGPFTSTLAED
FT                   EILTHVSVPTTRTAWSFQEAAVKKGDYGLALVAATGTARDGVLLDPRVTVGAAVGSVRR
FT                   VAEVERLLTETPLTEGLADEAAVTAAASIDPISDIHGNSEYRRKLVASLVRRAVIELMN
FT                   GA"
FT   gene            628127..628633
FT                   /locus_tag="Noca_0595"
FT   CDS_pept        628127..628633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0595"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: rxy:Rxyl_1873 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80132"
FT                   /db_xref="GOA:A1SE97"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE97"
FT                   /protein_id="ABL80132.1"
FT                   /translation="MSTTPEERLDVSMTINGSRYRATVEARRTLADFIREDAQLPGTKL
FT                   GCEHGVCGACTVLLDDLPARSCLTLAVQAEGRQIRTVESLADGQELNHLQRAFREQHGL
FT                   QCGFCTAGFLMTATALLEENATPTREEIVETMSGSLCRCTGYQTIISAIEQAAAEGQSD
FT                   TEDDQ"
FT   gene            628630..631035
FT                   /locus_tag="Noca_0596"
FT   CDS_pept        628630..631035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0596"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: rxy:Rxyl_1872
FT                   carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80133"
FT                   /db_xref="GOA:A1SE98"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE98"
FT                   /protein_id="ABL80133.1"
FT                   /translation="MKKLDSHQHMKTPVVAARSVGTRVLRSEDPRLLTGRGEFIADIDL
FT                   PRQLHVAFIRSPVAHARITNLDLSAIRDADGVALAWSGKDVAPFCEGLVGEMAVEGCFP
FT                   TTMPLLAGDEVVYVGEPVAVVVADSRYAAEDACELIDWDFDELPAVTNVDAAAGGGPVA
FT                   NPQLPDNIGLNGGASFGDVSGAFEQAHQVVEGRFYTCRVSAAPMETRGVIADYEWASKA
FT                   LRLWSNTQMPHYLKYMLTAYLGFPEQSVEVITPDTGGGFGLKAHVYPEEMLLPLIAREV
FT                   GRPVKWIEDRRENLIAGAHAHEQYVDIAYALDADGKITGVRTHALGDGGAYHLPPWSMA
FT                   VEPWCAAVMTPTGIYDVPAVEYTYKAAATNKTPVGAYRGVGYMAGTFARECLADDAARA
FT                   LRMSPFDFRRHNVVREFPWTNPQGIVYQEGSWLQTIDALEEMVDYPAFLRRQTELRKEG
FT                   RYIGLGLSCFVESSGESTATSLEHGLGDVYHDTATVRLNPNGTANVTIGLSAQGQGLAT
FT                   TMAQMAADTLGIKVEDVSVQTARSTSHAYGSGTLGSRGAVVAGGAVSRAADVVREKVRQ
FT                   VAAHMLEASTDDIELVDGLASIKGISDASLSIADVATAIYFDLDSWPEDFEPTLEATQA
FT                   YDPSQAMFSNGGHAIMVELDAETGFVRFEKIFSVEDCGTVINPNIVEGQIRGGVIQGIG
FT                   ASVFEELAYDESGQILTTTFLDYGLPTMDVAPPFEINHLETPSSHSASGVKGMGESGLI
FT                   AAPAAVLNAVNDALSPFGVVLRDLPLTPEKVLGAMSGAKVATGLAERS"
FT   gene            631032..631874
FT                   /locus_tag="Noca_0597"
FT   CDS_pept        631032..631874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0597"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: sma:SAV4383 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80134"
FT                   /db_xref="GOA:A1SE99"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SE99"
FT                   /protein_id="ABL80134.1"
FT                   /translation="MTSGDGSRTNRLRVALLQVAYGDDESLSDRVQRVSQWIREVGPAD
FT                   LVVLPELWAHGGFASTTWRATAELMNGPTIAQMASVAREVGVWLHAGSIIERAEDGADR
FT                   GAERRGLWNTSVLISPQGTVHKTYRKIHRFGFGDGEPRVLEAGTDLAVAELVHDTGASR
FT                   VGMATCYDLRFPELFRRLGDLGADVIVLPAAWPMRRVEHWRLLGRARALENQAWVLQCN
FT                   TAGTHSGLDMGGHSQVVAPTGEVVAELGSDEDVLLTDIDLNLVASVRADFPVLADRRI"
FT   gene            632540..633765
FT                   /pseudo
FT                   /locus_tag="Noca_0598"
FT   gene            complement(633778..634297)
FT                   /pseudo
FT                   /locus_tag="Noca_0599"
FT   gene            complement(634392..635381)
FT                   /locus_tag="Noca_0600"
FT   CDS_pept        complement(634392..635381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0600"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   eba:p2A227 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80135"
FT                   /db_xref="GOA:A1SEA0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA0"
FT                   /protein_id="ABL80135.1"
FT                   /translation="MNALAASLQTYFTTFARSQRDLSNHTIGSYRDTWRMLLKYLTTTL
FT                   GVSVDAVDFDAVTATNITRFLDYLEHERGNSAKTRNVRLTAIRAVLGHALPDHPEHAAT
FT                   ITQVLAIPPKRTTRPVIEFLRPDEVVALLAAPDPTTRTGRRDHALLAMTVQTGLRISEV
FT                   CSLTIDDVHLGTGPHVTCTGKGRRRRITPLTGATVSVMTDYLTERSARPGTALFCGPRG
FT                   LSLSRDALEHRLATHVAAAAAACPSLTGKHVTMHTLRHTAAMNLLAAGVDVAVIALWLG
FT                   HADTHSTDGYLHADMAIKQAALDRTRPPDVQAGTYRPAPDILTWLTAL"
FT   gene            complement(635378..636376)
FT                   /locus_tag="Noca_0601"
FT   CDS_pept        complement(635378..636376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0601"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   sus:Acid_3311 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80136"
FT                   /db_xref="GOA:A1SEA1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA1"
FT                   /protein_id="ABL80136.1"
FT                   /translation="MTAPAKTPAASAPTPTLRDRLDEYLVMRRALGFQLNDVERQVGLF
FT                   CTWLEARGQTQTFTIDEAVTWARLNPDAHPSWWATRLSLVRRFAGYLNANDVDVPVIPR
FT                   GLLPAPKPRAVPFIYSQHDLDALLTACDRVFTDERIAATMRTVIGLLAATGLRIGEALK
FT                   LRVGDVDHVNDLLVIKAAKSVERLVPLHPTTTAALMDYITLPARTATNPDPDGPVFVTA
FT                   NGTGYIYVSFYKMFRAVREEAGLTPRGRARPRLHDLRHTFATAHMTAAYAHDGDPERVL
FT                   SLLATWLGHSDATHTYWYLSATGELMALAAGRLELNPEIGADIDAGTGEPS"
FT   gene            complement(636373..637611)
FT                   /locus_tag="Noca_0602"
FT   CDS_pept        complement(636373..637611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0602"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   eba:p2A229 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80137"
FT                   /db_xref="GOA:A1SEA2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA2"
FT                   /protein_id="ABL80137.1"
FT                   /translation="MTKRSATARPYPVRIQRVPVGPLAPTVLDECRRWFAAKGYSPGSA
FT                   AAAVNLAQRLSAWMELAGAGIDEIDEDLLDRFVTAERSRERPCSSVKPWIGALRRCLTD
FT                   SGYLQADGVDEDRSTPTQVAAAQWCEWMRVQRGLTEKSIVRYRYYAVGLLDQVTTADGS
FT                   VSWDRLNATMINAYVADRGRGYGVAAKAHVVGSVRCLLRWALSTGRLDRDLSAGILKPS
FT                   GTKRSLPRGVTADQVAALLAVCDPTTAIGARDRALVLMLVRLGLRAGEAAHLMLDDIDW
FT                   AGGQVRVTGKGREHVLPLPVDVGQALEAWLRLRPEALDRAVFVRLRAPRQMMTASGTSG
FT                   VIARLSSMAGIEPIHAHRLRHTAAMDVLAAGGTLSEAKELLGHVYTVTTMTYAKVDLAS
FT                   LRELVVPFGQVPR"
FT   gene            637847..638242
FT                   /locus_tag="Noca_0603"
FT   CDS_pept        637847..638242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0603"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mmc:Mmcs_3178 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80138"
FT                   /db_xref="GOA:A1SEA3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA3"
FT                   /protein_id="ABL80138.1"
FT                   /translation="MKSRIAVAALDNAVARRGAEGVDVAGCLLHTDRGSQFRSRKLVHQ
FT                   LNRHQMVGSMGRVGAAGDNAAMESFFSLLQKNVLDRRVWNTREELRIAIVTWIERTYHR
FT                   RRRQAALGRLTPVEYELIMKPAATQAA"
FT   gene            complement(638469..639644)
FT                   /locus_tag="Noca_0604"
FT   CDS_pept        complement(638469..639644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0604"
FT                   /product="monosaccharide ABC transporter substrate-binding
FT                   protein, CUT2 family"
FT                   /note="KEGG: fal:FRAAL2528 hypothetical protein; TC
FT                   3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80139"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA4"
FT                   /protein_id="ABL80139.1"
FT                   /translation="MRSTFNRPARRLAGVSVALAVIAAGAACSTESGEQTIGSGGGDEI
FT                   AQNAAEALDSNFYGQGSYTEPPAEGPEAQRGARIAVVNSGVQSPTGTKQVEAAREVAGL
FT                   LGWDLSVYDGKYEPAEYQEGIRQAISQKADVIWLYSIDCPLAETALAEAKRAGIPVVSQ
FT                   EAADCTDVDPEAESYFADTLAFSQGTFIDWARAMGESQATWLLAQLGEDADVIEVSVPE
FT                   LVVTNAIHEGFTAAMEEQCPACKVTEVKAQIADFGPALQEKIETALLRNPNANGMALSY
FT                   DDLMTTGGSAAVMASGRNDSLAVVAGSGFPANVKLIRDGQGQDAGFAYDMGYETWAAAD
FT                   MINRLLAGEEQGESGVGIAVFDADNGLPPAGKAWSVDIEYKPVYKAMWGVS"
FT   sig_peptide     complement(639543..639644)
FT                   /locus_tag="Noca_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.299 at
FT                   residue 34"
FT   gene            complement(640425..640926)
FT                   /pseudo
FT                   /locus_tag="Noca_0605"
FT   gene            complement(641063..641557)
FT                   /locus_tag="Noca_0606"
FT   CDS_pept        complement(641063..641557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0606"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: gka:GKP18 carbon monoxide dehydrogenase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80140"
FT                   /db_xref="GOA:A1SEA5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA5"
FT                   /protein_id="ABL80140.1"
FT                   /translation="MKTRVTVNGEGYERDVEPRMLLSDFLRHELGLTGTNVGCEHGVCG
FT                   SCTVLLDGEPVRSCTMLAVQCDSRRLTTVEGLACDEKLHGLQDAFSACHGLQCGFCTPG
FT                   MLMTLLPIYNEARRLNDDEIREAISGNLCRCTGYQQIVEAARKALGEAADMADPCVESR
FT                   A"
FT   gene            complement(641554..642441)
FT                   /locus_tag="Noca_0607"
FT   CDS_pept        complement(641554..642441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0607"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   rpb:RPB_3113 molybdopterin dehydrogenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80141"
FT                   /db_xref="GOA:A1SEA6"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA6"
FT                   /protein_id="ABL80141.1"
FT                   /translation="MKPPPFEYVVATSVDHAIELVCSDEDAKFIAGGQSLIPLLSLRFA
FT                   SPTLLVDVSRLTELRDVRRVGEVLRIGALTRHAEIQRLTIFRQDAPLLSTAAGWVAHSQ
FT                   VRNRGTFGGAIAHSDSAAEFPAVLLATGATIVARSRDGERRIPCQDFFGSHFQTALNHG
FT                   ELLTGVEVPAHDASTKWGFSEFARRKGDYAIGGAAVSVRLDEQGRCTRVRAGLIAAGPG
FT                   PTSAKGLDEVLVDRIVDESAVSDAVARAERYLSPESNVHGTKEYRRAVVAESLRRALRQ
FT                   AFDLDRAGTERKSA"
FT   gene            complement(642623..643873)
FT                   /locus_tag="Noca_0608"
FT   CDS_pept        complement(642623..643873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0608"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="KEGG: rha:RHA1_ro03774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80142"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA7"
FT                   /protein_id="ABL80142.1"
FT                   /translation="MTIESDLQVVANAVRARIPELVSAIERTSAQEVPEIYEKDDPVYK
FT                   EAERSSVLSALTSIVEGLAGGRRPPDRPSDAALQEARIAAQAGIDLHSLLRTYRVGQSI
FT                   LWDAILEETLHVVDSDERRMAVLKQASDYQYGWNNKVMESVIAAYQAEHNAYFFRSQDR
FT                   KRRAVVSDILRGIPADVQQLGYSLRAEHLAVVAWGRSPEANIRALAVSLDARHLTVSGT
FT                   SGTYLGWLGSSSLKRVLVERPEAARAMRETHLALGEVAHGIDGFRLSHRQAWQAYRVGK
FT                   LRAAGLVNYADVALEALMLKDRQAVQDFVSRELGPLHDEEDPRGELLKSTLRAYFRSGQ
FT                   NAASTAQAIHVHERTVAYRLRSIESRLGVTIGARRDELAAALRLADLLGQVSSADLRDL
FT                   DAQADAGLGPDPEAAAQ"
FT   gene            complement(643944..644687)
FT                   /locus_tag="Noca_0609"
FT   CDS_pept        complement(643944..644687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0609"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80143"
FT                   /db_xref="GOA:A1SEA8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA8"
FT                   /protein_id="ABL80143.1"
FT                   /translation="MTTGIDHGAEHPGDPFQNPALVNTTDGVITVWSDIGCPWASLALQ
FT                   TLRSRVLQRDVDVAIDHRAFPLELFNKRGTPKGIIDVEVTAIAGLVPALGWQPWTAPDW
FT                   QYVVSTVPAMAAVQAAKALSVGGLRASDELDHALRQAFYIHGRSISVHSEILAAAAGCP
FT                   SLYLPALESALEQGKGYAEVFTHWHTAAALPVQGSPHIFVKDRYAEHNPGVQYHWTARP
FT                   GEGFPRFDRYDESWADLVVDAVVAP"
FT   gene            complement(644690..645766)
FT                   /locus_tag="Noca_0610"
FT   CDS_pept        complement(644690..645766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0610"
FT                   /product="monosaccharide ABC transporter membrane protein,
FT                   CUT2 family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   fal:FRAAL2526 putative ribose transport system permease
FT                   protein; putative membrane protein; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80144"
FT                   /db_xref="GOA:A1SEA9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEA9"
FT                   /protein_id="ABL80144.1"
FT                   /translation="MSHTQDTTDAPVASPDAETLPAPTGVAEAEQKRKAARARTGKARF
FT                   VDFLEAYALLVLLVVIALFFCFWPETSSTFPTVANMRILLASQAVIGVISLGLLLPLLC
FT                   QEFDLSVGNIAGLAAIVVAAYVSSEGNVLAAVVLALTIGLAIGAVNALIVTRLHVNGVI
FT                   ATLGMSTILGGIVLQRTGGLAPASDIPQSLTNFGTGLVAGVPIIFITLLVIAGITYFVL
FT                   NHTSLGRQIYAVGSNMEAAKLVGLRTDGLRAVTFAAGGLLCGLGGLLYVSRAGGASPNV
FT                   GMTFTLPAFAAAFLSAASVRPGRFNVWGTIIAVYFLAVLNNGLSLAGVDPYVNDYVNGG
FT                   ALIAGVALATVLYRRRTT"
FT   gene            complement(645763..647367)
FT                   /locus_tag="Noca_0611"
FT   CDS_pept        complement(645763..647367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0611"
FT                   /product="monosaccharide ABC transporter ATP-binding
FT                   protein, CUT2 family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: fal:FRAAL2527 putative ATP-binding protein of sugar
FT                   ABC transporter; TC 3.A.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80145"
FT                   /db_xref="GOA:A1SEB0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB0"
FT                   /protein_id="ABL80145.1"
FT                   /translation="MNEHTTTEHTQAEQARKVALAVLDVSKTYGATRALDRVSLKVTTG
FT                   AIHGLMGGNGSGKSTLIKMLAGVVTPDEGKLALNGDWIDARSHTPSRAKASGLHFVHQQ
FT                   NSTFPDLSVAENLALGRGFESTAVKSINWRAQKARARQVLDRFEIDVAADAHLVRLSPA
FT                   AQMMVAIARALQDQDDTAERGVLVLDEPTASLPKHEVDVLLTALRKYAADGQTIIYVSH
FT                   RLEEVTAITNEVTVLRNGSVASRLTGAAISHDTLVAGITGSASAQPALRPRRGNDVVAS
FT                   GVPLSQVAGSRETALTLRRRTATGLKKEMLLVRAGEIVGIAGLLGSGRSRMLKQIFGAA
FT                   HRDDFEVAVRSGTVPSSDMRTSMKRGLALVPENRLREAALPELSIAENLSITSLSEHAR
FT                   AGWIRPSRERKAAKRLIQEFGVRAPSTTAPLTSLSGGNQQKVILARWLQRRPDVLLLDE
FT                   PTQGVDIGARNEIHELVRAAASAGTAVLVVSSDFGELAALAQRAVVISGGEIVDSVDGP
FT                   LTEDILNDIVYAQEKAL"
FT   gene            complement(647541..649913)
FT                   /locus_tag="Noca_0612"
FT   CDS_pept        complement(647541..649913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0612"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: rxy:Rxyl_1874
FT                   carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80146"
FT                   /db_xref="GOA:A1SEB1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB1"
FT                   /protein_id="ABL80146.1"
FT                   /translation="MSRPGASGGLGPSAKRYVGQPVRRREDARLLRGDARFVDDVDIHG
FT                   QLYMSVVRSSEAHARIVSVEPSAARRAPGVRLVITADDIDAEVPLEQIGYHEVYPQIDD
FT                   YLHPVFAGDRVRYVGQPVAAVIADTPYLAEDAAGLVEVTYDLLPPVLDPQYALTDEAEP
FT                   LFEGQSNEAVRIVKAYGDVADAFKKAAHVVKGRYVVGRHSGVPMETRGCIAEPDRGRKQ
FT                   LFMWGPVHTHDCQRLIAQVLELPLADLRMKHVDIGGNFGVKGGVFPEYIMVGWAAMRLG
FT                   RPVKWTEDRLEHMVANAHAREQVHEMAAAFDADGVLLALKDEIWHNHGAFIRQAEPLVS
FT                   DITVGMVPGPYRVPAYDGLLHVVVSNKTPLSAYRAPGRYEGTFARERLLDLAAEQIGIS
FT                   QVEIRRRNLLTEADLPFAPGMDICFEPYHFDSGDVVDHLDKALESAGFDDWEREAAELR
FT                   AQGRLVGNGIGMLMDKAGLGLYETSAIDVDASGRIRVRTGASSVGQGIETVLAQIVADE
FT                   LQVDPELIDVVHGDTELVPEGVGSWSSRSTVLAGGAARQAALDTLAKAKRLASEMLEAN
FT                   VDDLILVDGRIVVSGLEQQGLSLAEIAGRWDGWSARLANDEPGLGAQAVYLDEHMNYPY
FT                   GVTLVQIEIDPATGGHTLRRFLTSTEAGRAINPMTTRGQVIGAAAQGIGGALYEEFLYD
FT                   ESGQPLATSFMDYLLPTSLDVPDVDFFMTEDAPTPNNPFGAKGLGEVGLIAVGAAIAGA
FT                   IDDAFGEGVRTIKVPVPPETLWRRSHSIAFSDEPESM"
FT   gene            650063..651214
FT                   /locus_tag="Noca_0613"
FT   CDS_pept        650063..651214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0613"
FT                   /product="protein of unknown function DUF1100, hydrolase
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF1100, hydrolase
FT                   family protein; KEGG: ppu:PP_3195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80147"
FT                   /db_xref="InterPro:IPR010520"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB2"
FT                   /protein_id="ABL80147.1"
FT                   /translation="MPRIRGTCRRPTAAQSGRCCLPTYGEEMTTETPQVPTAEEEMLNW
FT                   GRLLMDGLPFADLLAAQRRDAETSWFDFWMAKADAYEAMGETALKDGNDLTAGYWFWVG
FT                   SMAAQYAQFLWFDERRPKGQLRKAGLYHRAAPLLDPPAERVDLPIDDTVIIGYLRRPKG
FT                   ADGPVPCAVLLGGLESTKEESYMFENLLLERGVATFTFDGPGQGEMFEDVALAGDYHRY
FT                   TSRVVDYLETLGVTIDEDRIGVLGRSLGGHYALRAASMDDRFRACVTWGGFVQMDDWDF
FT                   EYPMTKLSWQYVTKSPDLPTAQERVKEAIDVRPVLAGLKVPTYVMHGAKDETPLTELDL
FT                   LQEYAVNADITIDLEPEGDHCCHNLGPAPRLRMADWLANQLRP"
FT   gene            651308..651658
FT                   /locus_tag="Noca_0614"
FT   CDS_pept        651308..651658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0614"
FT                   /product="protein of unknown function DUF861, cupin_3"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein; KEGG: sma:SAV6269
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80148"
FT                   /db_xref="InterPro:IPR008579"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB3"
FT                   /protein_id="ABL80148.1"
FT                   /translation="MDEIKAVESGTVELETWQPDGVTIHEGDPKGRGFTLFENYESGAR
FT                   ATGVFECEPSKTTYTLEYNEIIYVLEGEVTIELENGSRVDLRAGMQAFLPAGHISTWTF
FT                   HTKFREVWVLAD"
FT   gene            652288..653516
FT                   /pseudo
FT                   /locus_tag="Noca_0615"
FT   gene            654191..654460
FT                   /locus_tag="Noca_0616"
FT   CDS_pept        654191..654460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0616"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80149"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB4"
FT                   /protein_id="ABL80149.1"
FT                   /translation="MTPGIVRGTLRHWLEVYGTGKKTAADGTLTSSPLQSTTTTTTSFG
FT                   TRERDAGAEGRPARGVHDVVAHVASAHRGRSRRHAGRARCRPGS"
FT   gene            complement(654412..654885)
FT                   /pseudo
FT                   /locus_tag="Noca_0617"
FT   gene            complement(654931..657102)
FT                   /locus_tag="Noca_0618"
FT   CDS_pept        complement(654931..657102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0618"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sme:SMa0257 probable methylamine"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80150"
FT                   /db_xref="GOA:A1SEB5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB5"
FT                   /protein_id="ABL80150.1"
FT                   /translation="MTIDPRHAPLFEPIQVGPKMFRNRFYVSPHCSGLGVDYPGAQAYL
FT                   RGMRAEGGWAAVNTEYCAVDAESDDAPWVQARLIDHRDEANLRLMVERVHEFGALAGVQ
FT                   LVYMGPDHTGFVTRLPAGGPSQVTSALSGHSCYEMNKSDIRRIQKAYVDAAIRARNIGF
FT                   DLVQVSARASFSLPLQFLWRHWNHRTDEYGGSIENRTRFWRETIEQVREAVGDDCAIVA
FT                   GFCLDSFTDESDRAFRVNEDGVAVVELLDDMVDLWDMQVGSMTDDASSSRFFEPFWQRE
FT                   YIEQVRPYAKKPIAAVGRFTDPELMARVVRDGVIDIIAAARPAIADPFIPTKIREGRGE
FT                   DIRECIGCNICVSRFNNGGGRIVCTQNATVGEEYRRGWHPEKFNASPRAEEPILIVGAG
FT                   PAGLECARVLGERGFHNVHLVDKDAEVGGHVNWVSQLPGLRTWRRVVEYREAQLSKLNN
FT                   VTVLTNQPMDVEAILDYGAQTVVVATGAEWDATGNNPITHAPIDGAKDHRQMVFTPESI
FT                   MIEQRQGLGDRVVVYDCDGYYMGSSIAERLAAQGKKVTLVCPGDQVGSYLFYTDEGERM
FT                   VHSLLELGVEVVPSHVVTSIRPGLVTGHHSYHSGLTATWPASSIVLVTQRRSRSGLYDE
FT                   LTGQAEVLRENGIEVFRIGDCVEPRVIAEAVFDGHRLAREIDAPDPATPLPFIREQRIL
FT                   GWREEDYDGELVHRLPLAPTSKTSAPATP"
FT   gene            complement(657099..658139)
FT                   /locus_tag="Noca_0619"
FT   CDS_pept        complement(657099..658139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0619"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: nfa:nfa30730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80151"
FT                   /db_xref="GOA:A1SEB6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB6"
FT                   /protein_id="ABL80151.1"
FT                   /translation="MTRAKTRRVSAIAEDPVTPAGVTRVTVGDALRVSHQLALTAATAI
FT                   APMVWGTTYSVTTELLPANRPLFAALMRSLPIGLLAILLTRVLPRRDWWWKAAVLGMLN
FT                   IGSFFPLLFIAAERLPGGVAATLGAAQPLFVTGLAVVMLGERLSLLRLAWGVVGLVGVG
FT                   LVVLGPDVGFDPFGILAGLVGACAMGVGMTLTKRWGRPAGISPISFAAWQLAVGGLALL
FT                   PATLLVEGLPSHVGISSAAGYLWLGAIGGLLAYALWFRGIGRLPVTSAALLGLVSPLVA
FT                   ALMGMLLGERLNSIQVFGFVLALIAVVGGSARVRPIQTDRIQQKATLNLVQPDKVPAEN
FT                   PARFRP"
FT   gene            658209..659132
FT                   /locus_tag="Noca_0620"
FT   CDS_pept        658209..659132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Noca_0620"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sma:SAV4790 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Noca_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABL80152"
FT                   /db_xref="GOA:A1SEB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SEB7"
FT                   /protein_id="ABL80152.1"
FT                   /translation="MRYVLAVADARNFTRAAEQCFVVQSALSQRIANLERELGVALFAR
FT                   TSRRVELTAAGQAFIPPARQCLEAADRAAAEAAAAVGQVRGRLTIGVIPNVAAVDLPDV
FT                   LRRVREKYLAVRIELRVGASDWLAEQVVAGNLDVAFLGLPENQKPVGVSFRALASDRHV
FT                   AVLPVDHHLAGRAEVGLADLSDEAFADFPYGSPGRAQGDYAFASAEIRRDVAYEVVSAD
FT                   LMLDLVRHGLAVALLPSMSVNPMPELAIVSVTDGPGRVEYLAWSDFNPSPATRAFLDIL
FT                   ADEASPGTGHDVHRSALPAIRGSDPT"
FT   gene            659396..659788
FT