(data stored in ACNUC29543 zone)

EMBL: CP000510

ID   CP000510; SV 1; circular; genomic DNA; STD; PRO; 4559598 BP.
XX
AC   CP000510; AAQS01000000-AAQS01000034;
XX
PR   Project:PRJNA16187;
XX
DT   23-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 8)
XX
DE   Psychromonas ingrahamii 37, complete genome.
XX
KW   .
XX
OS   Psychromonas ingrahamii 37
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Psychromonadaceae; Psychromonas.
XX
RN   [1]
RP   1-4559598
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Thompson L.S., Brettin T., Bruce D., Han C., Tapia R., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Staley J.,
RA   Richardson P.;
RT   "Complete sequence of Psychromonas ingrahamii 37";
RL   Unpublished.
XX
RN   [2]
RP   1-4559598
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Thompson L.S., Brettin T., Bruce D., Han C., Tapia R., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Staley J.,
RA   Richardson P.;
RT   ;
RL   Submitted (13-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-4559598
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Thompson L.S., Brettin T., Bruce D., Han C., Tapia R., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Staley J.,
RA   Richardson P.;
RT   ;
RL   Submitted (22-JAN-2007) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; b2f7018fd1e922c81136a4da9a7ff248.
DR   BioSample; SAMN02598361.
DR   EnsemblGenomes-Gn; EBG00001443775.
DR   EnsemblGenomes-Gn; EBG00001443776.
DR   EnsemblGenomes-Gn; EBG00001443777.
DR   EnsemblGenomes-Gn; EBG00001443778.
DR   EnsemblGenomes-Gn; EBG00001443779.
DR   EnsemblGenomes-Gn; EBG00001443780.
DR   EnsemblGenomes-Gn; EBG00001443781.
DR   EnsemblGenomes-Gn; EBG00001443782.
DR   EnsemblGenomes-Gn; EBG00001443783.
DR   EnsemblGenomes-Gn; EBG00001443784.
DR   EnsemblGenomes-Gn; EBG00001443785.
DR   EnsemblGenomes-Gn; EBG00001443786.
DR   EnsemblGenomes-Gn; EBG00001443787.
DR   EnsemblGenomes-Gn; EBG00001443788.
DR   EnsemblGenomes-Gn; EBG00001443789.
DR   EnsemblGenomes-Gn; EBG00001443790.
DR   EnsemblGenomes-Gn; EBG00001443791.
DR   EnsemblGenomes-Gn; EBG00001443792.
DR   EnsemblGenomes-Gn; EBG00001443793.
DR   EnsemblGenomes-Gn; EBG00001443794.
DR   EnsemblGenomes-Gn; EBG00001443795.
DR   EnsemblGenomes-Gn; EBG00001443796.
DR   EnsemblGenomes-Gn; EBG00001443797.
DR   EnsemblGenomes-Gn; EBG00001443798.
DR   EnsemblGenomes-Gn; EBG00001443799.
DR   EnsemblGenomes-Gn; EBG00001443800.
DR   EnsemblGenomes-Gn; EBG00001443801.
DR   EnsemblGenomes-Gn; EBG00001443802.
DR   EnsemblGenomes-Gn; EBG00001443803.
DR   EnsemblGenomes-Gn; EBG00001443804.
DR   EnsemblGenomes-Gn; EBG00001443805.
DR   EnsemblGenomes-Gn; EBG00001443806.
DR   EnsemblGenomes-Gn; EBG00001443807.
DR   EnsemblGenomes-Gn; EBG00001443808.
DR   EnsemblGenomes-Gn; EBG00001443809.
DR   EnsemblGenomes-Gn; EBG00001443810.
DR   EnsemblGenomes-Gn; EBG00001443811.
DR   EnsemblGenomes-Gn; EBG00001443812.
DR   EnsemblGenomes-Gn; EBG00001443813.
DR   EnsemblGenomes-Gn; EBG00001443814.
DR   EnsemblGenomes-Gn; EBG00001443815.
DR   EnsemblGenomes-Gn; EBG00001443816.
DR   EnsemblGenomes-Gn; EBG00001443817.
DR   EnsemblGenomes-Gn; EBG00001443818.
DR   EnsemblGenomes-Gn; EBG00001443819.
DR   EnsemblGenomes-Gn; EBG00001443820.
DR   EnsemblGenomes-Gn; EBG00001443821.
DR   EnsemblGenomes-Gn; EBG00001443822.
DR   EnsemblGenomes-Gn; EBG00001443823.
DR   EnsemblGenomes-Gn; EBG00001443824.
DR   EnsemblGenomes-Gn; EBG00001443825.
DR   EnsemblGenomes-Gn; EBG00001443826.
DR   EnsemblGenomes-Gn; EBG00001443827.
DR   EnsemblGenomes-Gn; EBG00001443828.
DR   EnsemblGenomes-Gn; EBG00001443829.
DR   EnsemblGenomes-Gn; EBG00001443830.
DR   EnsemblGenomes-Gn; EBG00001443831.
DR   EnsemblGenomes-Gn; EBG00001443832.
DR   EnsemblGenomes-Gn; EBG00001443833.
DR   EnsemblGenomes-Gn; EBG00001443834.
DR   EnsemblGenomes-Gn; EBG00001443835.
DR   EnsemblGenomes-Gn; EBG00001443836.
DR   EnsemblGenomes-Gn; EBG00001443837.
DR   EnsemblGenomes-Gn; EBG00001443838.
DR   EnsemblGenomes-Gn; EBG00001443839.
DR   EnsemblGenomes-Gn; EBG00001443840.
DR   EnsemblGenomes-Gn; EBG00001443841.
DR   EnsemblGenomes-Gn; EBG00001443842.
DR   EnsemblGenomes-Gn; EBG00001443843.
DR   EnsemblGenomes-Gn; EBG00001443844.
DR   EnsemblGenomes-Gn; EBG00001443845.
DR   EnsemblGenomes-Gn; EBG00001443846.
DR   EnsemblGenomes-Gn; EBG00001443847.
DR   EnsemblGenomes-Gn; EBG00001443848.
DR   EnsemblGenomes-Gn; EBG00001443849.
DR   EnsemblGenomes-Gn; EBG00001443850.
DR   EnsemblGenomes-Gn; EBG00001443851.
DR   EnsemblGenomes-Gn; EBG00001443852.
DR   EnsemblGenomes-Gn; EBG00001443853.
DR   EnsemblGenomes-Gn; EBG00001443854.
DR   EnsemblGenomes-Gn; EBG00001443855.
DR   EnsemblGenomes-Gn; EBG00001443856.
DR   EnsemblGenomes-Gn; EBG00001443857.
DR   EnsemblGenomes-Gn; EBG00001443858.
DR   EnsemblGenomes-Gn; EBG00001443859.
DR   EnsemblGenomes-Gn; EBG00001443860.
DR   EnsemblGenomes-Gn; EBG00001443861.
DR   EnsemblGenomes-Gn; EBG00001443862.
DR   EnsemblGenomes-Gn; EBG00001443863.
DR   EnsemblGenomes-Gn; EBG00001443864.
DR   EnsemblGenomes-Gn; EBG00001443865.
DR   EnsemblGenomes-Gn; EBG00001443866.
DR   EnsemblGenomes-Gn; EBG00001443867.
DR   EnsemblGenomes-Gn; EBG00001443868.
DR   EnsemblGenomes-Gn; EBG00001443869.
DR   EnsemblGenomes-Gn; EBG00001443870.
DR   EnsemblGenomes-Gn; EBG00001443871.
DR   EnsemblGenomes-Gn; EBG00001443872.
DR   EnsemblGenomes-Gn; EBG00001443873.
DR   EnsemblGenomes-Gn; EBG00001443874.
DR   EnsemblGenomes-Gn; EBG00001443875.
DR   EnsemblGenomes-Gn; EBG00001443876.
DR   EnsemblGenomes-Gn; EBG00001443877.
DR   EnsemblGenomes-Gn; EBG00001443878.
DR   EnsemblGenomes-Gn; EBG00001443879.
DR   EnsemblGenomes-Gn; EBG00001443880.
DR   EnsemblGenomes-Gn; EBG00001443881.
DR   EnsemblGenomes-Gn; EBG00001443882.
DR   EnsemblGenomes-Gn; EBG00001443883.
DR   EnsemblGenomes-Gn; EBG00001443884.
DR   EnsemblGenomes-Gn; EBG00001443885.
DR   EnsemblGenomes-Gn; EBG00001443886.
DR   EnsemblGenomes-Gn; EBG00001443887.
DR   EnsemblGenomes-Gn; EBG00001443888.
DR   EnsemblGenomes-Gn; EBG00001443889.
DR   EnsemblGenomes-Gn; EBG00001443890.
DR   EnsemblGenomes-Gn; EBG00001443891.
DR   EnsemblGenomes-Gn; EBG00001443892.
DR   EnsemblGenomes-Gn; EBG00001443893.
DR   EnsemblGenomes-Gn; EBG00001443894.
DR   EnsemblGenomes-Gn; EBG00001443895.
DR   EnsemblGenomes-Gn; EBG00001443896.
DR   EnsemblGenomes-Gn; EBG00001443897.
DR   EnsemblGenomes-Gn; EBG00001443898.
DR   EnsemblGenomes-Gn; EBG00001443899.
DR   EnsemblGenomes-Gn; EBG00001443900.
DR   EnsemblGenomes-Gn; EBG00001443901.
DR   EnsemblGenomes-Gn; EBG00001443902.
DR   EnsemblGenomes-Gn; EBG00001443903.
DR   EnsemblGenomes-Gn; EBG00001443904.
DR   EnsemblGenomes-Gn; EBG00001443905.
DR   EnsemblGenomes-Gn; EBG00001443906.
DR   EnsemblGenomes-Gn; EBG00001443907.
DR   EnsemblGenomes-Gn; EBG00001443908.
DR   EnsemblGenomes-Gn; EBG00001443909.
DR   EnsemblGenomes-Gn; EBG00001443910.
DR   EnsemblGenomes-Gn; EBG00001443911.
DR   EnsemblGenomes-Gn; EBG00001443912.
DR   EnsemblGenomes-Gn; EBG00001443913.
DR   EnsemblGenomes-Gn; EBG00001443914.
DR   EnsemblGenomes-Gn; EBG00001443915.
DR   EnsemblGenomes-Gn; EBG00001443916.
DR   EnsemblGenomes-Gn; EBG00001443917.
DR   EnsemblGenomes-Gn; EBG00001443918.
DR   EnsemblGenomes-Gn; EBG00001443919.
DR   EnsemblGenomes-Gn; EBG00001443920.
DR   EnsemblGenomes-Gn; EBG00001443921.
DR   EnsemblGenomes-Gn; Ping_R0001.
DR   EnsemblGenomes-Gn; Ping_R0002.
DR   EnsemblGenomes-Gn; Ping_R0003.
DR   EnsemblGenomes-Gn; Ping_R0004.
DR   EnsemblGenomes-Gn; Ping_R0005.
DR   EnsemblGenomes-Gn; Ping_R0006.
DR   EnsemblGenomes-Gn; Ping_R0007.
DR   EnsemblGenomes-Gn; Ping_R0008.
DR   EnsemblGenomes-Gn; Ping_R0009.
DR   EnsemblGenomes-Gn; Ping_R0010.
DR   EnsemblGenomes-Gn; Ping_R0011.
DR   EnsemblGenomes-Gn; Ping_R0012.
DR   EnsemblGenomes-Gn; Ping_R0013.
DR   EnsemblGenomes-Gn; Ping_R0014.
DR   EnsemblGenomes-Gn; Ping_R0015.
DR   EnsemblGenomes-Gn; Ping_R0016.
DR   EnsemblGenomes-Gn; Ping_R0017.
DR   EnsemblGenomes-Gn; Ping_R0018.
DR   EnsemblGenomes-Gn; Ping_R0019.
DR   EnsemblGenomes-Gn; Ping_R0020.
DR   EnsemblGenomes-Gn; Ping_R0021.
DR   EnsemblGenomes-Gn; Ping_R0022.
DR   EnsemblGenomes-Gn; Ping_R0023.
DR   EnsemblGenomes-Gn; Ping_R0024.
DR   EnsemblGenomes-Gn; Ping_R0025.
DR   EnsemblGenomes-Gn; Ping_R0026.
DR   EnsemblGenomes-Gn; Ping_R0027.
DR   EnsemblGenomes-Gn; Ping_R0028.
DR   EnsemblGenomes-Gn; Ping_R0029.
DR   EnsemblGenomes-Gn; Ping_R0030.
DR   EnsemblGenomes-Gn; Ping_R0031.
DR   EnsemblGenomes-Gn; Ping_R0032.
DR   EnsemblGenomes-Gn; Ping_R0033.
DR   EnsemblGenomes-Gn; Ping_R0034.
DR   EnsemblGenomes-Gn; Ping_R0035.
DR   EnsemblGenomes-Gn; Ping_R0036.
DR   EnsemblGenomes-Gn; Ping_R0037.
DR   EnsemblGenomes-Gn; Ping_R0038.
DR   EnsemblGenomes-Gn; Ping_R0039.
DR   EnsemblGenomes-Gn; Ping_R0040.
DR   EnsemblGenomes-Gn; Ping_R0042.
DR   EnsemblGenomes-Gn; Ping_R0043.
DR   EnsemblGenomes-Gn; Ping_R0044.
DR   EnsemblGenomes-Gn; Ping_R0045.
DR   EnsemblGenomes-Gn; Ping_R0046.
DR   EnsemblGenomes-Gn; Ping_R0047.
DR   EnsemblGenomes-Gn; Ping_R0048.
DR   EnsemblGenomes-Gn; Ping_R0049.
DR   EnsemblGenomes-Gn; Ping_R0050.
DR   EnsemblGenomes-Gn; Ping_R0051.
DR   EnsemblGenomes-Gn; Ping_R0052.
DR   EnsemblGenomes-Gn; Ping_R0053.
DR   EnsemblGenomes-Gn; Ping_R0054.
DR   EnsemblGenomes-Gn; Ping_R0055.
DR   EnsemblGenomes-Gn; Ping_R0056.
DR   EnsemblGenomes-Gn; Ping_R0057.
DR   EnsemblGenomes-Gn; Ping_R0058.
DR   EnsemblGenomes-Gn; Ping_R0059.
DR   EnsemblGenomes-Gn; Ping_R0060.
DR   EnsemblGenomes-Gn; Ping_R0061.
DR   EnsemblGenomes-Gn; Ping_R0062.
DR   EnsemblGenomes-Gn; Ping_R0063.
DR   EnsemblGenomes-Gn; Ping_R0064.
DR   EnsemblGenomes-Gn; Ping_R0065.
DR   EnsemblGenomes-Gn; Ping_R0066.
DR   EnsemblGenomes-Gn; Ping_R0067.
DR   EnsemblGenomes-Gn; Ping_R0068.
DR   EnsemblGenomes-Gn; Ping_R0069.
DR   EnsemblGenomes-Gn; Ping_R0070.
DR   EnsemblGenomes-Gn; Ping_R0071.
DR   EnsemblGenomes-Gn; Ping_R0072.
DR   EnsemblGenomes-Gn; Ping_R0073.
DR   EnsemblGenomes-Gn; Ping_R0074.
DR   EnsemblGenomes-Gn; Ping_R0075.
DR   EnsemblGenomes-Gn; Ping_R0076.
DR   EnsemblGenomes-Gn; Ping_R0077.
DR   EnsemblGenomes-Gn; Ping_R0078.
DR   EnsemblGenomes-Gn; Ping_R0079.
DR   EnsemblGenomes-Gn; Ping_R0080.
DR   EnsemblGenomes-Gn; Ping_R0081.
DR   EnsemblGenomes-Gn; Ping_R0082.
DR   EnsemblGenomes-Gn; Ping_R0083.
DR   EnsemblGenomes-Gn; Ping_R0084.
DR   EnsemblGenomes-Gn; Ping_R0085.
DR   EnsemblGenomes-Gn; Ping_R0086.
DR   EnsemblGenomes-Gn; Ping_R0087.
DR   EnsemblGenomes-Gn; Ping_R0088.
DR   EnsemblGenomes-Gn; Ping_R0089.
DR   EnsemblGenomes-Gn; Ping_R0090.
DR   EnsemblGenomes-Gn; Ping_R0091.
DR   EnsemblGenomes-Gn; Ping_R0092.
DR   EnsemblGenomes-Gn; Ping_R0093.
DR   EnsemblGenomes-Gn; Ping_R0094.
DR   EnsemblGenomes-Gn; Ping_R0095.
DR   EnsemblGenomes-Gn; Ping_R0096.
DR   EnsemblGenomes-Gn; Ping_R0097.
DR   EnsemblGenomes-Gn; Ping_R0098.
DR   EnsemblGenomes-Gn; Ping_R0099.
DR   EnsemblGenomes-Gn; Ping_R0100.
DR   EnsemblGenomes-Gn; Ping_R0101.
DR   EnsemblGenomes-Gn; Ping_R0102.
DR   EnsemblGenomes-Gn; Ping_R0103.
DR   EnsemblGenomes-Gn; Ping_R0104.
DR   EnsemblGenomes-Gn; Ping_R0105.
DR   EnsemblGenomes-Gn; Ping_R0106.
DR   EnsemblGenomes-Gn; Ping_R0107.
DR   EnsemblGenomes-Gn; Ping_R0108.
DR   EnsemblGenomes-Gn; Ping_R0109.
DR   EnsemblGenomes-Gn; Ping_R0110.
DR   EnsemblGenomes-Gn; Ping_R0111.
DR   EnsemblGenomes-Gn; Ping_R0112.
DR   EnsemblGenomes-Gn; Ping_R0113.
DR   EnsemblGenomes-Gn; Ping_R0114.
DR   EnsemblGenomes-Gn; Ping_R0115.
DR   EnsemblGenomes-Gn; Ping_R0116.
DR   EnsemblGenomes-Gn; Ping_R0117.
DR   EnsemblGenomes-Gn; Ping_R0118.
DR   EnsemblGenomes-Gn; Ping_R0119.
DR   EnsemblGenomes-Gn; Ping_R0120.
DR   EnsemblGenomes-Tr; EBT00001821391.
DR   EnsemblGenomes-Tr; EBT00001821393.
DR   EnsemblGenomes-Tr; EBT00001821395.
DR   EnsemblGenomes-Tr; EBT00001821397.
DR   EnsemblGenomes-Tr; EBT00001821400.
DR   EnsemblGenomes-Tr; EBT00001821402.
DR   EnsemblGenomes-Tr; EBT00001821404.
DR   EnsemblGenomes-Tr; EBT00001821406.
DR   EnsemblGenomes-Tr; EBT00001821408.
DR   EnsemblGenomes-Tr; EBT00001821409.
DR   EnsemblGenomes-Tr; EBT00001821411.
DR   EnsemblGenomes-Tr; EBT00001821412.
DR   EnsemblGenomes-Tr; EBT00001821415.
DR   EnsemblGenomes-Tr; EBT00001821416.
DR   EnsemblGenomes-Tr; EBT00001821418.
DR   EnsemblGenomes-Tr; EBT00001821420.
DR   EnsemblGenomes-Tr; EBT00001821423.
DR   EnsemblGenomes-Tr; EBT00001821425.
DR   EnsemblGenomes-Tr; EBT00001821427.
DR   EnsemblGenomes-Tr; EBT00001821430.
DR   EnsemblGenomes-Tr; EBT00001821432.
DR   EnsemblGenomes-Tr; EBT00001821434.
DR   EnsemblGenomes-Tr; EBT00001821436.
DR   EnsemblGenomes-Tr; EBT00001821438.
DR   EnsemblGenomes-Tr; EBT00001821440.
DR   EnsemblGenomes-Tr; EBT00001821441.
DR   EnsemblGenomes-Tr; EBT00001821443.
DR   EnsemblGenomes-Tr; EBT00001821445.
DR   EnsemblGenomes-Tr; EBT00001821448.
DR   EnsemblGenomes-Tr; EBT00001821452.
DR   EnsemblGenomes-Tr; EBT00001821453.
DR   EnsemblGenomes-Tr; EBT00001821455.
DR   EnsemblGenomes-Tr; EBT00001821458.
DR   EnsemblGenomes-Tr; EBT00001821460.
DR   EnsemblGenomes-Tr; EBT00001821461.
DR   EnsemblGenomes-Tr; EBT00001821463.
DR   EnsemblGenomes-Tr; EBT00001821466.
DR   EnsemblGenomes-Tr; EBT00001821468.
DR   EnsemblGenomes-Tr; EBT00001821470.
DR   EnsemblGenomes-Tr; EBT00001821472.
DR   EnsemblGenomes-Tr; EBT00001821474.
DR   EnsemblGenomes-Tr; EBT00001821476.
DR   EnsemblGenomes-Tr; EBT00001821478.
DR   EnsemblGenomes-Tr; EBT00001821480.
DR   EnsemblGenomes-Tr; EBT00001821483.
DR   EnsemblGenomes-Tr; EBT00001821484.
DR   EnsemblGenomes-Tr; EBT00001821486.
DR   EnsemblGenomes-Tr; EBT00001821488.
DR   EnsemblGenomes-Tr; EBT00001821491.
DR   EnsemblGenomes-Tr; EBT00001821494.
DR   EnsemblGenomes-Tr; EBT00001821496.
DR   EnsemblGenomes-Tr; EBT00001821497.
DR   EnsemblGenomes-Tr; EBT00001821499.
DR   EnsemblGenomes-Tr; EBT00001821500.
DR   EnsemblGenomes-Tr; EBT00001821502.
DR   EnsemblGenomes-Tr; EBT00001821504.
DR   EnsemblGenomes-Tr; EBT00001821505.
DR   EnsemblGenomes-Tr; EBT00001821506.
DR   EnsemblGenomes-Tr; EBT00001821507.
DR   EnsemblGenomes-Tr; EBT00001821508.
DR   EnsemblGenomes-Tr; EBT00001821509.
DR   EnsemblGenomes-Tr; EBT00001821510.
DR   EnsemblGenomes-Tr; EBT00001821511.
DR   EnsemblGenomes-Tr; EBT00001821512.
DR   EnsemblGenomes-Tr; EBT00001821513.
DR   EnsemblGenomes-Tr; EBT00001821514.
DR   EnsemblGenomes-Tr; EBT00001821515.
DR   EnsemblGenomes-Tr; EBT00001821516.
DR   EnsemblGenomes-Tr; EBT00001821517.
DR   EnsemblGenomes-Tr; EBT00001821518.
DR   EnsemblGenomes-Tr; EBT00001821519.
DR   EnsemblGenomes-Tr; EBT00001821520.
DR   EnsemblGenomes-Tr; EBT00001821521.
DR   EnsemblGenomes-Tr; EBT00001821522.
DR   EnsemblGenomes-Tr; EBT00001821523.
DR   EnsemblGenomes-Tr; EBT00001821524.
DR   EnsemblGenomes-Tr; EBT00001821525.
DR   EnsemblGenomes-Tr; EBT00001821526.
DR   EnsemblGenomes-Tr; EBT00001821527.
DR   EnsemblGenomes-Tr; EBT00001821528.
DR   EnsemblGenomes-Tr; EBT00001821529.
DR   EnsemblGenomes-Tr; EBT00001821530.
DR   EnsemblGenomes-Tr; EBT00001821531.
DR   EnsemblGenomes-Tr; EBT00001821532.
DR   EnsemblGenomes-Tr; EBT00001821533.
DR   EnsemblGenomes-Tr; EBT00001821534.
DR   EnsemblGenomes-Tr; EBT00001821535.
DR   EnsemblGenomes-Tr; EBT00001821536.
DR   EnsemblGenomes-Tr; EBT00001821537.
DR   EnsemblGenomes-Tr; EBT00001821538.
DR   EnsemblGenomes-Tr; EBT00001821539.
DR   EnsemblGenomes-Tr; EBT00001821540.
DR   EnsemblGenomes-Tr; EBT00001821541.
DR   EnsemblGenomes-Tr; EBT00001821542.
DR   EnsemblGenomes-Tr; EBT00001821543.
DR   EnsemblGenomes-Tr; EBT00001821544.
DR   EnsemblGenomes-Tr; EBT00001821545.
DR   EnsemblGenomes-Tr; EBT00001821546.
DR   EnsemblGenomes-Tr; EBT00001821547.
DR   EnsemblGenomes-Tr; EBT00001821548.
DR   EnsemblGenomes-Tr; EBT00001821549.
DR   EnsemblGenomes-Tr; EBT00001821550.
DR   EnsemblGenomes-Tr; EBT00001821551.
DR   EnsemblGenomes-Tr; EBT00001821552.
DR   EnsemblGenomes-Tr; EBT00001821553.
DR   EnsemblGenomes-Tr; EBT00001821554.
DR   EnsemblGenomes-Tr; EBT00001821555.
DR   EnsemblGenomes-Tr; EBT00001821556.
DR   EnsemblGenomes-Tr; EBT00001821557.
DR   EnsemblGenomes-Tr; EBT00001821558.
DR   EnsemblGenomes-Tr; EBT00001821559.
DR   EnsemblGenomes-Tr; EBT00001821560.
DR   EnsemblGenomes-Tr; EBT00001821561.
DR   EnsemblGenomes-Tr; EBT00001821562.
DR   EnsemblGenomes-Tr; EBT00001821563.
DR   EnsemblGenomes-Tr; EBT00001821564.
DR   EnsemblGenomes-Tr; EBT00001821565.
DR   EnsemblGenomes-Tr; EBT00001821566.
DR   EnsemblGenomes-Tr; EBT00001821567.
DR   EnsemblGenomes-Tr; EBT00001821568.
DR   EnsemblGenomes-Tr; EBT00001821569.
DR   EnsemblGenomes-Tr; EBT00001821570.
DR   EnsemblGenomes-Tr; EBT00001821571.
DR   EnsemblGenomes-Tr; EBT00001821572.
DR   EnsemblGenomes-Tr; EBT00001821573.
DR   EnsemblGenomes-Tr; EBT00001821574.
DR   EnsemblGenomes-Tr; EBT00001821575.
DR   EnsemblGenomes-Tr; EBT00001821576.
DR   EnsemblGenomes-Tr; EBT00001821577.
DR   EnsemblGenomes-Tr; EBT00001821578.
DR   EnsemblGenomes-Tr; EBT00001821579.
DR   EnsemblGenomes-Tr; EBT00001821580.
DR   EnsemblGenomes-Tr; EBT00001821581.
DR   EnsemblGenomes-Tr; EBT00001821582.
DR   EnsemblGenomes-Tr; EBT00001821583.
DR   EnsemblGenomes-Tr; EBT00001821584.
DR   EnsemblGenomes-Tr; EBT00001821585.
DR   EnsemblGenomes-Tr; EBT00001821586.
DR   EnsemblGenomes-Tr; EBT00001821587.
DR   EnsemblGenomes-Tr; EBT00001821588.
DR   EnsemblGenomes-Tr; EBT00001821589.
DR   EnsemblGenomes-Tr; EBT00001821590.
DR   EnsemblGenomes-Tr; EBT00001821591.
DR   EnsemblGenomes-Tr; EBT00001821592.
DR   EnsemblGenomes-Tr; EBT00001821593.
DR   EnsemblGenomes-Tr; EBT00001821594.
DR   EnsemblGenomes-Tr; EBT00001821595.
DR   EnsemblGenomes-Tr; Ping_R0001-1.
DR   EnsemblGenomes-Tr; Ping_R0002-1.
DR   EnsemblGenomes-Tr; Ping_R0003-1.
DR   EnsemblGenomes-Tr; Ping_R0004-1.
DR   EnsemblGenomes-Tr; Ping_R0005-1.
DR   EnsemblGenomes-Tr; Ping_R0006-1.
DR   EnsemblGenomes-Tr; Ping_R0007-1.
DR   EnsemblGenomes-Tr; Ping_R0008-1.
DR   EnsemblGenomes-Tr; Ping_R0009-1.
DR   EnsemblGenomes-Tr; Ping_R0010-1.
DR   EnsemblGenomes-Tr; Ping_R0011-1.
DR   EnsemblGenomes-Tr; Ping_R0012-1.
DR   EnsemblGenomes-Tr; Ping_R0013-1.
DR   EnsemblGenomes-Tr; Ping_R0014-1.
DR   EnsemblGenomes-Tr; Ping_R0015-1.
DR   EnsemblGenomes-Tr; Ping_R0016-1.
DR   EnsemblGenomes-Tr; Ping_R0017-1.
DR   EnsemblGenomes-Tr; Ping_R0018-1.
DR   EnsemblGenomes-Tr; Ping_R0019-1.
DR   EnsemblGenomes-Tr; Ping_R0020-1.
DR   EnsemblGenomes-Tr; Ping_R0021-1.
DR   EnsemblGenomes-Tr; Ping_R0022-1.
DR   EnsemblGenomes-Tr; Ping_R0023-1.
DR   EnsemblGenomes-Tr; Ping_R0024-1.
DR   EnsemblGenomes-Tr; Ping_R0025-1.
DR   EnsemblGenomes-Tr; Ping_R0026-1.
DR   EnsemblGenomes-Tr; Ping_R0027-1.
DR   EnsemblGenomes-Tr; Ping_R0028-1.
DR   EnsemblGenomes-Tr; Ping_R0029-1.
DR   EnsemblGenomes-Tr; Ping_R0030-1.
DR   EnsemblGenomes-Tr; Ping_R0031-1.
DR   EnsemblGenomes-Tr; Ping_R0032-1.
DR   EnsemblGenomes-Tr; Ping_R0033-1.
DR   EnsemblGenomes-Tr; Ping_R0034-1.
DR   EnsemblGenomes-Tr; Ping_R0035-1.
DR   EnsemblGenomes-Tr; Ping_R0036-1.
DR   EnsemblGenomes-Tr; Ping_R0037-1.
DR   EnsemblGenomes-Tr; Ping_R0038-1.
DR   EnsemblGenomes-Tr; Ping_R0039-1.
DR   EnsemblGenomes-Tr; Ping_R0040-1.
DR   EnsemblGenomes-Tr; Ping_R0042-1.
DR   EnsemblGenomes-Tr; Ping_R0043-1.
DR   EnsemblGenomes-Tr; Ping_R0044-1.
DR   EnsemblGenomes-Tr; Ping_R0045-1.
DR   EnsemblGenomes-Tr; Ping_R0046-1.
DR   EnsemblGenomes-Tr; Ping_R0047-1.
DR   EnsemblGenomes-Tr; Ping_R0048-1.
DR   EnsemblGenomes-Tr; Ping_R0049-1.
DR   EnsemblGenomes-Tr; Ping_R0050-1.
DR   EnsemblGenomes-Tr; Ping_R0051-1.
DR   EnsemblGenomes-Tr; Ping_R0052-1.
DR   EnsemblGenomes-Tr; Ping_R0053-1.
DR   EnsemblGenomes-Tr; Ping_R0054-1.
DR   EnsemblGenomes-Tr; Ping_R0055-1.
DR   EnsemblGenomes-Tr; Ping_R0056-1.
DR   EnsemblGenomes-Tr; Ping_R0057-1.
DR   EnsemblGenomes-Tr; Ping_R0058-1.
DR   EnsemblGenomes-Tr; Ping_R0059-1.
DR   EnsemblGenomes-Tr; Ping_R0060-1.
DR   EnsemblGenomes-Tr; Ping_R0061-1.
DR   EnsemblGenomes-Tr; Ping_R0062-1.
DR   EnsemblGenomes-Tr; Ping_R0063-1.
DR   EnsemblGenomes-Tr; Ping_R0064-1.
DR   EnsemblGenomes-Tr; Ping_R0065-1.
DR   EnsemblGenomes-Tr; Ping_R0066-1.
DR   EnsemblGenomes-Tr; Ping_R0067-1.
DR   EnsemblGenomes-Tr; Ping_R0068-1.
DR   EnsemblGenomes-Tr; Ping_R0069-1.
DR   EnsemblGenomes-Tr; Ping_R0070-1.
DR   EnsemblGenomes-Tr; Ping_R0071-1.
DR   EnsemblGenomes-Tr; Ping_R0072-1.
DR   EnsemblGenomes-Tr; Ping_R0073-1.
DR   EnsemblGenomes-Tr; Ping_R0074-1.
DR   EnsemblGenomes-Tr; Ping_R0075-1.
DR   EnsemblGenomes-Tr; Ping_R0076-1.
DR   EnsemblGenomes-Tr; Ping_R0077-1.
DR   EnsemblGenomes-Tr; Ping_R0078-1.
DR   EnsemblGenomes-Tr; Ping_R0079-1.
DR   EnsemblGenomes-Tr; Ping_R0080-1.
DR   EnsemblGenomes-Tr; Ping_R0081-1.
DR   EnsemblGenomes-Tr; Ping_R0082-1.
DR   EnsemblGenomes-Tr; Ping_R0083-1.
DR   EnsemblGenomes-Tr; Ping_R0084-1.
DR   EnsemblGenomes-Tr; Ping_R0085-1.
DR   EnsemblGenomes-Tr; Ping_R0086-1.
DR   EnsemblGenomes-Tr; Ping_R0087-1.
DR   EnsemblGenomes-Tr; Ping_R0088-1.
DR   EnsemblGenomes-Tr; Ping_R0089-1.
DR   EnsemblGenomes-Tr; Ping_R0090-1.
DR   EnsemblGenomes-Tr; Ping_R0091-1.
DR   EnsemblGenomes-Tr; Ping_R0092-1.
DR   EnsemblGenomes-Tr; Ping_R0093-1.
DR   EnsemblGenomes-Tr; Ping_R0094-1.
DR   EnsemblGenomes-Tr; Ping_R0095-1.
DR   EnsemblGenomes-Tr; Ping_R0096-1.
DR   EnsemblGenomes-Tr; Ping_R0097-1.
DR   EnsemblGenomes-Tr; Ping_R0098-1.
DR   EnsemblGenomes-Tr; Ping_R0099-1.
DR   EnsemblGenomes-Tr; Ping_R0100-1.
DR   EnsemblGenomes-Tr; Ping_R0101-1.
DR   EnsemblGenomes-Tr; Ping_R0102-1.
DR   EnsemblGenomes-Tr; Ping_R0103-1.
DR   EnsemblGenomes-Tr; Ping_R0104-1.
DR   EnsemblGenomes-Tr; Ping_R0105-1.
DR   EnsemblGenomes-Tr; Ping_R0106-1.
DR   EnsemblGenomes-Tr; Ping_R0107-1.
DR   EnsemblGenomes-Tr; Ping_R0108-1.
DR   EnsemblGenomes-Tr; Ping_R0109-1.
DR   EnsemblGenomes-Tr; Ping_R0110-1.
DR   EnsemblGenomes-Tr; Ping_R0111-1.
DR   EnsemblGenomes-Tr; Ping_R0112-1.
DR   EnsemblGenomes-Tr; Ping_R0113-1.
DR   EnsemblGenomes-Tr; Ping_R0114-1.
DR   EnsemblGenomes-Tr; Ping_R0115-1.
DR   EnsemblGenomes-Tr; Ping_R0116-1.
DR   EnsemblGenomes-Tr; Ping_R0117-1.
DR   EnsemblGenomes-Tr; Ping_R0118-1.
DR   EnsemblGenomes-Tr; Ping_R0119-1.
DR   EnsemblGenomes-Tr; Ping_R0120-1.
DR   EuropePMC; PMC2405808; 18460197.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01731; TwoAYGGAY.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000510.
DR   SILVA-SSU; CP000510.
DR   StrainInfo; 677503; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000833
CC   Source DNA and bacteria available from James Staley
CC   (jstaley@u.washington.edu)
CC   Contacts: James Staley (jstaley@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4559598
FT                   /organism="Psychromonas ingrahamii 37"
FT                   /strain="37"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:357804"
FT   gene            137..1675
FT                   /locus_tag="Ping_R0001"
FT   rRNA            137..1675
FT                   /locus_tag="Ping_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            1822..1898
FT                   /locus_tag="Ping_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            1822..1898
FT                   /locus_tag="Ping_R0002"
FT                   /product="tRNA-Ile"
FT   gene            1949..2024
FT                   /locus_tag="Ping_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            1949..2024
FT                   /locus_tag="Ping_R0003"
FT                   /product="tRNA-Ala"
FT   gene            2504..5395
FT                   /locus_tag="Ping_R0004"
FT   rRNA            2504..5395
FT                   /locus_tag="Ping_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            5697..5812
FT                   /locus_tag="Ping_R0005"
FT   rRNA            5697..5812
FT                   /locus_tag="Ping_R0005"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(6451..7047)
FT                   /locus_tag="Ping_0001"
FT   CDS_pept        complement(6451..7047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0001"
FT                   /product="putative transposase"
FT                   /note="KEGG: ppr:PBPRB1782 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01876"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW1"
FT                   /protein_id="ABM01876.1"
FT                   /translation="MKRKRILKKFQFKTIFKIPGHIALDRVDIWLQDEARFGQQNTTTK
FT                   LWAEKGSRPRAVKQQQFEYAYLFGSVCITNGASEALVVPYVNKDIMMTHLQQISDRTPI
FT                   DRHAVIIMGGAGWHSDDIDADFKNLTIIKLPPYSPELNPIEQVWSWLRQHHLANRCFSG
FT                   YDSIVETVCDAWNDFVSDSKRVIKMCTRDWMSLIS"
FT   gene            complement(6998..7483)
FT                   /locus_tag="Ping_0002"
FT   CDS_pept        complement(6998..7483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0002"
FT                   /product="transposase-like protein"
FT                   /note="KEGG: vvy:VV3211 transposase and inactivated
FT                   derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01877"
FT                   /db_xref="GOA:A1SQW2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW2"
FT                   /protein_id="ABM01877.1"
FT                   /translation="MTTKKHDFTALAKTHQSVRMRLRFLALAHFQEGNSRTAIAKFLKV
FT                   SRTSINKWISQYHQFGMDGLIDKKTTGRPFRLSNEQHKQLIHYVTESSKSELGGRLNGS
FT                   DIQLYIEENFAVHYHLSSVYKLLHKLGFSWITSRSKHPKQSIEAQEDFKKIPIQNDL"
FT   gene            complement(7861..9195)
FT                   /locus_tag="Ping_0003"
FT   CDS_pept        complement(7861..9195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0003"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: ppr:PBPRA0253 putative ATP-dependent protease
FT                   HslVU, ATPase subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01878"
FT                   /db_xref="GOA:A1SQW3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SQW3"
FT                   /protein_id="ABM01878.1"
FT                   /translation="MSNMTPKEIKHELDRHIIGQDNAKRAVAIALRNRWRRMQLDKEMR
FT                   QEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVESIVRDLV
FT                   DVAIKLTREEEMAKVAHKAEDLAEDRILDILIPPAKTGNDWETVKTEDSATRQSFRKKL
FT                   REGKLDDKEVEIDLPAPQIGVEIMAPPGMEEMTNQLQGMFQSMSGKDKTKKRKMKIKEA
FT                   LKVLIESEAAKLVNEEDIKEKALFSAENNGIIFIDEIDKICKRGDSAGPDVSREGVQRD
FT                   LLPLIEGSTVSTKHGMVKTDHMLFIASGAFQVAKPSDLIPELQGRLPIRVELEALTEED
FT                   LAKILTEPKASLSEQYKALLATEGITLQFSKDGIDKIAKSAWHVNETTENIGARRLHTL
FT                   MERILDELSYEASERKGESITIDENYVANTLDDLLENEDLSRYIL"
FT   gene            complement(9207..9761)
FT                   /locus_tag="Ping_0004"
FT   CDS_pept        complement(9207..9761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0004"
FT                   /product="HslV component of HslUV peptidase, Threonine
FT                   peptidase, MEROPS family T01B"
FT                   /note="PFAM: 20S proteasome, A and B subunits; KEGG:
FT                   pat:Patl_4191 20S proteasome, A and B subunits"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01879"
FT                   /db_xref="GOA:A1SQW4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SQW4"
FT                   /protein_id="ABM01879.1"
FT                   /translation="MTTIVSVRRGNQVVVGGDGQVSLGNTVMKGNARKVHRLYNNQVIA
FT                   GFAGGTADAFTLLERFEAKLQAHQGNLERAAVELAKDWRTDRSLRRLEALLAVADKNSS
FT                   YIITGNGDVVRPENDLMAIGSGGYFAQSAAIALLENTDLDAKTIVEKALAIAGNICVFT
FT                   NETHTIECIDFSDEITTESKK"
FT   gene            complement(10064..10597)
FT                   /gene="ftsN"
FT                   /locus_tag="Ping_0005"
FT   CDS_pept        complement(10064..10597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsN"
FT                   /locus_tag="Ping_0005"
FT                   /product="cell division protein FtsN"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   pat:Patl_4190 sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01880"
FT                   /db_xref="GOA:A1SQW5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW5"
FT                   /protein_id="ABM01880.1"
FT                   /translation="MATENRRKPATPKKAVVRKRTAVKKTASKKGIPYLAISAVVLIIG
FT                   FIGFFMFGVEKPSAPQRVNKPVQKKEDVLPEKPQPIWEYEKTLKTKKITVDIPEKEAQT
FT                   RPYQMQCASFRARGDAESLKAKIAFQGLNSEVLKTGDWYRVILGPYERKRLAEKHRHKL
FT                   QRAKINGCQIWFWR"
FT   gene            complement(10601..12349)
FT                   /locus_tag="Ping_0006"
FT   CDS_pept        complement(10601..12349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0006"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: sfr:Sfri_3762 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01881"
FT                   /db_xref="GOA:A1SQW6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SQW6"
FT                   /protein_id="ABM01881.1"
FT                   /translation="MKVHIQQLLEQAIVCLIKQEIIPADIQPRINIDRTKDKSHGDYAN
FT                   NLALMLAKPAKQNPRHLAELIIANIPESTLVIKMEIAGPGFINFFINPNFLEKQIDGAY
FT                   LDKRLNVQIEANPQTIVIDYSSPNLAKEMHVGHLRSSIIGDAVARTLEFKGNNVVRQNH
FT                   VGDWGTQFGMLLAYMEELRAKGEPIENNLANLEIFYRAAKGRFDESEDFATRARHLVVK
FT                   LQGGNKDCLKLWAKFNETSLSHCQETYQRLGVSLTRADVRGESSYNDQLAVVVEDLDKQ
FT                   GLLQQSQGAKCVFLDNFKNKEGDPLPVIIQKKDGGFLYATSDLAAMRYRQNELNADRIL
FT                   YFVDARQGLHFQQVFEVARSAGFVNEKTSLEHMPFGTVMGEDGRPFKTRSGAVAKLADL
FT                   LTEAEVRAYELVKEKNKEMSEPELRHIASVVGISSVKYADLSKNRTSDYTFSFDSMLSF
FT                   EGNTAPYLLYAYTRVVSIFNKAGIEMGSVTAAVSLTQEKEIDLANKLIQFNDIIDQVAK
FT                   QGMPHFLCSYLFELAGLFSSFYEACPILIAETETQKQSRLKLAGLTAKTLKQGLSLLGI
FT                   NTLERM"
FT   gene            complement(12572..13027)
FT                   /locus_tag="Ping_0007"
FT   CDS_pept        complement(12572..13027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01882"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW7"
FT                   /protein_id="ABM01882.1"
FT                   /translation="MPPKPIKDFLVYIEECHQALADLYLRLSLEENNEKVKLLLDFMKK
FT                   KEQLSGLQLHQYTQQAPPSLLETDLDSEFDDSFPIKCQQMELKAELSLDDVVALAIRFD
FT                   IQLIDLLQTAAHSSPTIKAEIALGKLANQEEETLHHVVTARHEFEYM"
FT   gene            complement(13204..15375)
FT                   /locus_tag="Ping_0008"
FT   CDS_pept        complement(13204..15375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0008"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: cps:CPS_0080 DNA
FT                   helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01883"
FT                   /db_xref="GOA:A1SQW8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW8"
FT                   /protein_id="ABM01883.1"
FT                   /translation="MDVSYLIDDLNDHQRAAVSAPEQNMLVLAGAGSGKTRVLTHRIAW
FT                   LMQVENIPTYSILAVTFTNKAAKEMRGRITDICPQQIGGMWIGTFHGTAHRLLRLHYQE
FT                   ANLPEQFQIIDSDDQKKMVKRIIKSLNLDEKYYPAKELQWYINDKKDEGLRAKHIQVGY
FT                   SQQEKQRLQVYQAYEEACQLAGLVDFAELLLRAHELLLNNPSLLLHYQQRFRHVLVDEF
FT                   QDTNKLQYAWLNLLTENNSYLTIVGDDDQSIYGWRGADVENIQRFLREKDNPVTVCLEQ
FT                   NYRSTGHILNASNQLIKNNSDRLGKELWTSGEDGQPIAIYSAFNDYDETRYVTSQLKLW
FT                   QNSGKKLAECAILYRSNAQSRLFEEQLMAQQIPYHIYGGQRFFDRLEIKDSIAYLRLIN
FT                   NHQDDAAFERIINKPKRKIGNTTLDKIRLCAREQGYTMWQASLFLIEQKQLSAGANISL
FT                   SGFIELIKRFENETSELPLFQTVDHVIRHSGLHSMFENEKGEKSRSRIENLQELVSATK
FT                   SFVIPPEEQEMSEVTAFLAYAALESGDNQADEFDDAVQLMTMHAAKGLEFPQVFMVGVE
FT                   EGMFPGQQSADDEVRLAEERRLCYVGMTRAMQKLTLCHAESRRLYGQEKFHSPSRFISE
FT                   LPEQDIEYIRLKTQVRRVQQPTVKQPAFTRENQDISGFRIGQQVTHPKFGEGTVIAQEG
FT                   SGENSRLQVNFMGVGSKWLMTAYARLETV"
FT   gene            complement(15412..16119)
FT                   /locus_tag="Ping_0009"
FT   CDS_pept        complement(15412..16119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0009"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: vpa:VP2980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01884"
FT                   /db_xref="GOA:A1SQW9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQW9"
FT                   /protein_id="ABM01884.1"
FT                   /translation="MKYYRAIKPFKAISFDLDDTLYDNHHIIKKANQSIIEHLNQTYPE
FT                   LAELTEKQWSLYKDIEVAEFPEIKHDVSLWRTQTLTRIMIIYGIPEFKAIKYAQRAFSE
FT                   FLKLRSDFVVPEASLTLLDKLAQTYPIIAITNGNVDEFKIQLDDKFKFILKAGNGFKSK
FT                   PEGDLFIEAARRLNIEVSDILHVGDHLISDVYGAQNNGAQAVWFNPNKQSLSGAMLLPT
FT                   VEISRLDQLYKLL"
FT   gene            complement(16153..17052)
FT                   /locus_tag="Ping_0010"
FT   CDS_pept        complement(16153..17052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0010"
FT                   /product="tyrosine recombinase XerC subunit"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: phage
FT                   integrase family protein; phage integrase domain protein
FT                   SAM domain protein; KEGG: sdy:SDY_3934 site-specific
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01885"
FT                   /db_xref="GOA:A1SQX0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SQX0"
FT                   /protein_id="ABM01885.1"
FT                   /translation="MSALQPLIDTYLNHIASQRGLSPVTITNYQSNLAEFVALLNENKV
FT                   GCWTELDGQLVRLMVKTLHKKGLKARSIATKLSALRSFLDYLVQFDILSNNPAKGIAAP
FT                   KLDKPLPKNVSVDDMFQLLDIDEKDPLSIRDQCMMELMYSSGLRLSELVGINLQDIKLS
FT                   AKEIMVTGKGSKQRLLPITDRAVATVKIWLKIRPEFCIKDEKALFVSKQKKRISARNVQ
FT                   ARMEKWGLKQALPGHINPHKLRHSFATHMLESSGNLRAVQTLLGHADLATTQIYTHLDF
FT                   QHLSKIYDQAHPRAKRKK"
FT   gene            17602..18108
FT                   /locus_tag="Ping_0011"
FT   CDS_pept        17602..18108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0011"
FT                   /product="Uncharacterized conserved protein UCP028301"
FT                   /note="PFAM: Uncharacterised conserved protein UCP028301;
FT                   KEGG: vfi:VF1004 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01886"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX1"
FT                   /protein_id="ABM01886.1"
FT                   /translation="MSMKDKRSGSVAPKERINISYKPAVGNAKEAVELPFKLLVLGDFT
FT                   QSQIVTSLEDRKLININKYNFSDVMDSFDLKVQFSVENKINKGSDEPIDISLSIKQLSD
FT                   FEPDSIIQQVDELKKVLELREALKALKGPIGNSPQMRKQIRNLLIDEKSRNELKLELGL
FT                   SANKQ"
FT   gene            18217..19665
FT                   /locus_tag="Ping_0012"
FT   CDS_pept        18217..19665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0012"
FT                   /product="hypothetical protein DUF877"
FT                   /note="PFAM: protein of unknown function DUF877; KEGG:
FT                   pen:PSEEN0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01887"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX2"
FT                   /protein_id="ABM01887.1"
FT                   /translation="MEAIKEESLVGSILGLSKLLSDPYSYDIASQGMQTLLTQVLEEDC
FT                   DFDNLRVDKRYVESLIDELDEKLSKQMDEIIHNSVFQALESPWRSLKLLTDRTDFKENI
FT                   KIEILSVSKNELLEDFEDAADIIETGLYRKVYTDEFGQYGGDPYGVIIGNYYISPSVPD
FT                   MNLLSHMSSLSAMTHAPFITSASEEFFGLEDFAELPELKQLEAMFEGPQYLSWRNFRSS
FT                   DDARNVGLTLPRFMLRRTYGENIPVSAFNYKESINNKSEYLWGNAAFAYATRLNNSFAK
FT                   YRWCPNIIGPQSGGEVADLPIDIVDDSGTDKVFGPVELKVSDRKEFELSELGFIPFTLR
FT                   KDSDSAVFFSSNSTQLPKKFTNDDEGKQAEINYRLGTQLPYLFIVNRLAHYIKVLQREN
FT                   LGSWKSKTELETELNKWIRQYVADQDNPSAATRSQRPLRKAAISVSDIDTEVGWYSVGM
FT                   EVTPHFKFMGASFTLSLTSILERA"
FT   gene            19699..20217
FT                   /locus_tag="Ping_0013"
FT   CDS_pept        19699..20217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0013"
FT                   /product="secreted protein Hcp, potential oxidative stress
FT                   protein"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   vpa:VP1393 BfdA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01888"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX3"
FT                   /protein_id="ABM01888.1"
FT                   /translation="MPTEIYMSINDPEGCLTEESCSKESIGSFFKADHEEESLILAYDH
FT                   KVSVPTNSLTGQVTGTRKHEYLEVSKFIDKSSPLLLNTVTSPSELEVILRFFRTPDETS
FT                   AGEPVEYYNITLQRAKIVSINTISPNILDEVNDGLMPYEKVRFTYGQIQADHVVCGTTA
FT                   IDDWSGEGG"
FT   gene            20228..20935
FT                   /locus_tag="Ping_0014"
FT   CDS_pept        20228..20935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3310 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01889"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX4"
FT                   /protein_id="ABM01889.1"
FT                   /translation="MKNFIYNSTIWIRITCISILLSGCSLLPNSQVEVQKKDNIDYWSD
FT                   SSGSWENWDENHPSNELVAWTYDKDGIQVNFVARPELNIFGQRSHTLVVKIVQLSEVSG
FT                   INTLFQTNEGIAAALTQETEMIPNAIFSESFVLGPKQNLMFRLARQENAKYIAIIAGFA
FT                   ELDRRQAVRIIPISVNTTLQEPIDAEWTTLDKMTFGYFVSKEPQPDILRPSNIRLNIDF
FT                   GENSITKFSATAE"
FT   sig_peptide     20228..20326
FT                   /locus_tag="Ping_0014"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.427 at
FT                   residue 33"
FT   gene            20951..22315
FT                   /locus_tag="Ping_0015"
FT   CDS_pept        20951..22315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0015"
FT                   /product="hypothetical protein DUF876"
FT                   /note="PFAM: protein of unknown function DUF876; KEGG:
FT                   gme:Gmet_3311 protein of unknown function DUF876"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01890"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX5"
FT                   /protein_id="ABM01890.1"
FT                   /translation="MDSMKSIYWNQGLFLKPQHFQQLDRYTSTMSNLYSKVRSGVESGI
FT                   SELKFDLSALKTGLLVIEKLECILEDGSLLLYPGNCQIPPLRLDKEQFDDSGNLNIFIA
FT                   LAPISAEQNNLVSNSSPDARFKLAADINKKDLFDNNEQATLSMLDFNCNLVPSYNLKST
FT                   AGLSLLKVAEIFLSVDQCTPSETFIPKITLLSGSEVLKNLVKSTKQSLVGRFEQLQNIT
FT                   SFESGLVNSSNNLSVGLAMMSISNHIATFIQFEENPSTQVSDIYLAYRQLISQLSMFST
FT                   EVSVIGETLTEENSIIPFNQNNLSDCFSKVNNLTTKLLNELTVQPELLVNLIYQGDSKF
FT                   VAQLSREFLDPGYRIYLRIRTKENVIDHLDNILNFLKVGADGQVDVYLKRALPGVQLSY
FT                   LDKKPQGVATVPNSYYFGLDRQSFQWQKVIELSRIGVIWSDYIEDVALDLIAVQG"
FT   gene            22319..22966
FT                   /locus_tag="Ping_0016"
FT   CDS_pept        22319..22966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01891"
FT                   /db_xref="GOA:A1SQX6"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX6"
FT                   /protein_id="ABM01891.1"
FT                   /translation="MKLIDKFIPVFQVIKHLPQNISDDSDITLIDLEQQFKTLLSNVKC
FT                   SGYSKEQNQHALFSVCALVDEIILDSEWKYRNEWAKSPLQKKYFDTHKAGTQFYEILDT
FT                   LNENDIKDQDVREVFLYSLVQGFSGCYFESGEESVKQEIIQANYALLSKDIKINLFSPP
FT                   IPIRRLNQISNANRKKQKELLTIFGPIGVLLLSYFLLRSNILDSVSQILSQI"
FT   gene            22981..26403
FT                   /locus_tag="Ping_0017"
FT   CDS_pept        22981..26403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01892"
FT                   /db_xref="GOA:A1SQX7"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX7"
FT                   /protein_id="ABM01892.1"
FT                   /translation="MKKFLKFLLVVFIWLVIFGVCVAGSLLLGATEVEGIQVFLAIFIA
FT                   WYAIKFCIYLYKRWQAKQRVEKLINIDASTKEKTKLSFFQFLFPKSIDKHIKRVLKRIN
FT                   HNVSSDENQQEADFIMHIKMDNKHADWLYTETVNRPQIADPIFSEYKYLQWIVLNDLVI
FT                   LDVDSYLIKNADSAANSEWLQLLNGLASSEKSKSLDGLLISIHVADLVDPATRSQIADQ
FT                   LRKKYEEIKEYCGVEVPVNISLLGLEERKGVDDWLGQLSNDWKKQTLGVINQQKEPVKN
FT                   IIQSCFSKIQAIFKQGSLDYIVNQGFDETVANLPHKIKDIQDSVELFCSRLFSSNSFQG
FT                   KPVCSGLFLVMAEKNKAVFVDDLLEQSALCWLPAISMNKNTASDIEKNKRLWTYLSATT
FT                   VLVILLGTLYNSDKNNIEQIYQDYESQLSKSEDQVKVRDNLESRYQLITKLNDVNISYW
FT                   LPLSESVFNIPTLKAELANDIQDVLISPVDKYFEDNIKQLSNKNIDSKVDYLNILMRRI
FT                   NVLSAASKGASLTDLAELPQPFDSAYIDNMSPDMIDGLNSLYIKSLFMIKDANDASYLK
FT                   NWQQQITKYRNDISTLLLSSNGTMDWLIDWVNHNGKVDSVQLSDYWQGSRHIQSPILIE
FT                   GAYTLAGKTIIDDFSEQILYALGEEHPFLLKFLPVFQQQYQHNYVAKWGAFLKNFHTGT
FT                   ATLSSRSEWLNVINNLTTGRNIFFKLLNDADYQLAPFNDLEDKPDWFDFSLYYQDMLAL
FT                   GEDEAQSNPAKNKVFTKLALKVVGSLGPVGKAISGSGKKALKTKKKLDKASGSGPGPSE
FT                   RALNLQEAGKGLDEYKGLIADLVFNIEQQKESHKSIRAFFEFENNPIDEGTVLANAKLN
FT                   IMNLQGLIGKAGNSTASFWNVYIGSILVLENFMLEESACLLEKSWEEDFLYELEGVPAY
FT                   KLDEFAYGESGVLWSFFDKTLQPFIQNKRGGGYSFKKVVEKKIPLSPDLLDYLIRAKDL
FT                   KTRQKFKSFDLFMTAKPTDTNANSLLYVSETDISLICEAETQTLVNKNYIVNKLFKWDE
FT                   TCRSVSLKLKVGNKILEKVYSGDDGVFNFLDDFKSGVKRFELEEFPVYFYELNSYRIEY
FT                   FDVKLNIKGADRLRQALSIKPPQPPESIAQCWM"
FT   sig_peptide     22981..23052
FT                   /locus_tag="Ping_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.616 at
FT                   residue 24"
FT   gene            26407..28101
FT                   /locus_tag="Ping_0018"
FT   CDS_pept        26407..28101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_2544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01893"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX8"
FT                   /protein_id="ABM01893.1"
FT                   /translation="MLDVKNISFLPKQGGTVPFKTLILAPLGGHNAIEQLLEPTEINIR
FT                   NFDTVIKEFSPTVDVDIANSGLCQLLNVDQQIITLSYTIDCYADFKPTAIIKKEPSLRE
FT                   VSHIIDLIHQQLQLDGTTFSTAPFELQHVKIAELEKESVKRHELELVVCELELILSRIL
FT                   NQILHQADWQQLEASWRGIYWLCQTAESSHSLIIECASATKQLLWDDLFTNTDLLDSNL
FT                   YQQVYVDSIGQYGAVPYGVLLIDDYFSGAGSDLTLLKAITEVCSKAHLPVVTGANARMF
FT                   DVNDFNTLQDSDYISEIHAGHRYIKWRNFISTEEASFLALTMPRLLFRNAYGKGDSALS
FT                   WFQENIGDSHEDCLWGNASFGFVDNLLKSFQESGFCTFISGMEGGRLNLSALLNKSPNL
FT                   PIEIAFSEEKEAELIKLGFNPVCTRAYHNILLFESANSVRWGNLKLNYRTQNIDTIASA
FT                   QLQYLFIVMRIIHCLKIIFRESVGATTNSTELSHILNRWIRQFVSDVEAPSKSLRAQRP
FT                   LKDAKVLVVETNNIGWFEIEIELSPHMKYLGSTISINTLIFMNEEVS"
FT   gene            28101..28589
FT                   /locus_tag="Ping_0019"
FT   CDS_pept        28101..28589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0019"
FT                   /product="hypothetical protein DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bte:BTH_II0868 hcp protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01894"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQX9"
FT                   /protein_id="ABM01894.1"
FT                   /translation="MEFSGYMKIEGDIQGVIEGSSIRKNRETSIDLFSFKHEIKLPTNV
FT                   QSGMGNGPVIHQPIVLLKEVDKSTPKLYRALVEKERLNTVEFEWFRYTAQGEELVYYRI
FT                   ELINAHIISISPWTPALEKAESEYLRFMENVTLAYEGITWSWGPDGDVTYQTNWRGEQ"
FT   gene            28589..28993
FT                   /locus_tag="Ping_0020"
FT   CDS_pept        28589..28993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01895"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY0"
FT                   /protein_id="ABM01895.1"
FT                   /translation="MLRLSEKLNLLTVKNESAKQLESLNIATSMRNYLQKILNTRQGSV
FT                   LIAPDMGMPKIDLSEGIVEQVDKQNVLNMIKILLEKYDPRIESLHTELKENHNITVILS
FT                   FQLLVTTRSKHVVTLFGKLQSDSTFELELQ"
FT   gene            28993..30762
FT                   /locus_tag="Ping_0021"
FT   CDS_pept        28993..30762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0021"
FT                   /product="hypothetical protein DUF879"
FT                   /note="PFAM: protein of unknown function DUF879; KEGG:
FT                   gme:Gmet_3313 protein of unknown function DUF879"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01896"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY1"
FT                   /protein_id="ABM01896.1"
FT                   /translation="MDLADLYQQELKLLKESSQVFSKEYPAITESLNRDIVDPDVDMIL
FT                   QGVSYLTAQFKKELDDQFPVALQALSQVLTPTLMQPIPAVSILSLTPKANLISPLMVKK
FT                   GTGFDSSPAKLDEEGHERIACRFSSAWEVEVLPVRVATLVMQQVEKTINQVQQKVVELN
FT                   VGFTSEKNDLANYSFDKLRFYINQPASDACIWLQMFAQKLQSIKVTSSAGVADISVKNL
FT                   QLTGYGAEHNIFDAGNSSNQHSLLQEYYTVPEKLQFFEINLQQWQQRSGDQFSIVFEFT
FT                   SPTWSLPEFKTDHLKLYCTPVINEFEHFAEPMAMNGIQLEFPLTAQQRNLSTEFVLPIV
FT                   DVLTVESIKREREKNNRYQNIIIPSNTNSKTGGFYYFRKHGVHDGDVANWLALEFEAGS
FT                   RPESREVLRVKVKCCHGELAAKLPPNEINVPTSSSPELVSFTNLTTSSDYLPAQIISNE
FT                   AWQVVSDQALSLQNIEKADQLKQLLRHHLPAQLKNTAKYKTLAHRIAAINDIKITAKDH
FT                   FEKGLLVRGVEYSVHINSDHFINQGEIFLFSALLNQLLALQVPINSFSQLIVTESRTEE
FT                   SQRWAINFGGIAK"
FT   gene            30759..31712
FT                   /locus_tag="Ping_0022"
FT   CDS_pept        30759..31712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0022"
FT                   /product="hypothetical protein DUF1305"
FT                   /note="PFAM: protein of unknown function DUF1305; KEGG:
FT                   bte:BTH_II0865 protein of unknown function (DUF1305)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01897"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY2"
FT                   /protein_id="ABM01897.1"
FT                   /translation="MIEQELLRNATQYSFIEVYKLLCELALSNKLNPLHAIRIRPVLGL
FT                   QHARTQVVSVTKQDQPSLYYLNVNLPGLYGNGSPLPKFFTEELIQASHKDQNQTRLFLD
FT                   IIHQRLYQLLYAANTQQSPHYLDQGRKNVYQFMLAMIGFKEASWLKDFPDQAFILRNIN
FT                   IIRHQKSTVVGLQKLLQNLFKKAQVSIEQCVNRDVSIAEGQKLALNQQANQISFSAVLG
FT                   GKMQDIQSKIIVSISPLSAKEYKQWCLTPEYWDALQNMIKYFIGQPLLVDLQIDVVADT
FT                   KFNLSLVPENEFSLGRNAWLKSSNTKQHITASIKLL"
FT   gene            31751..34876
FT                   /locus_tag="Ping_0023"
FT   CDS_pept        31751..34876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0023"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG: bma:BMAA0737
FT                   rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01898"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY3"
FT                   /protein_id="ABM01898.1"
FT                   /translation="MSQYHFKFIYQENGSQNNELTLLKFSGQEGISQLFNFELELKSTD
FT                   LNLDEDSLLNKSCSIEIYDGKQAKPIRIIHGLVNKFEDINYLPDCTLYRANIVPRIWQL
FT                   GLFETNEVYLNETIERTLSAILEEAGFIEGQDFRFELNRTYRKWPFRLQYNETHLDYLQ
FT                   RIIEREGIYYYFEQNDNAEVIVFCDNNQALPSIVQPDQSKKIVFQANSAINVESKACTV
FT                   TNIICKRQTLPKKVTLRDFNDETPSLDIRGEYIIDKTGMGEINLYGLNITSPEEGQQLA
FT                   EIHANAYLSRQKSYIGEGDAATMVIGHTFKLAKHPRDKFNQLTYLLESIDHEGANLNQY
FT                   QELDLNTDAVVNYSNSFTALSTEHPFAPKRQTLAPEINGTLNAVIDAEADSGYAELDEF
FT                   GRYKVKLPFDRKDRNGGKASHWVRMMQPYGGANEGMHFPLRNGTRVLLGFIGGDPDRPF
FT                   ISGTINDNGEQKSIVTGENQTNNLIKTASGNKIELEDKEGKNRIKLQTGDNKTYMHLGS
FT                   PNHPGDGFVVMSKGIERKEVTGGKQITRVTTNFATTAYLNDDNTLGSFHNSFDEDTSSV
FT                   ESEDLLDEQNYFLFPIKSLKGDGVAAADAVPEVPAKAARTSPDVAAEAAIPAVASTFTA
FT                   SSVLSLPADNLMTRNVELSGYYLIERTLGDKYTFEQGNEYEFNSPGDKRFQYGADREII
FT                   VCQDDASLGKSIKGEVYNKENHLKENQNKNRNLDAGSRLYRSLVELLTLKLTGYQSFTQ
FT                   SPLDGICKRFHKKLTPEEANDLLDNKCNFRVARHNTFNIQEGNIFDFGGYWNYDLGNSY
FT                   AEVHGTQETEINKLYSKDIAKKAGPWWEKIEGKKLSFAQKDEEQVEKSYNNQYSYTKGK
FT                   TIEVHKGDAESQHYGNSYDYHTGDSYEEVDGHSISHVRGSCHSTHHGATNEMFMGAKSE
FT                   FLLGVSSSVVVAAVNDMFVGPKIEIQVAPGFYFSAGSKTEIESFKFKNVATEAANAAID
FT                   LQAAIATVDNDITILMNSINTIQSSVNTVVTKANEVDFTMIKLSSGAVNMLN"
FT   gene            34893..37742
FT                   /locus_tag="Ping_0024"
FT   CDS_pept        34893..37742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0024"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: bbr:BB0795
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01899"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY4"
FT                   /protein_id="ABM01899.1"
FT                   /translation="MNIIKPLQLAVLHKSFSYLEKDIFAVSIPIAFSLTDGEILLEQKL
FT                   WESVGEQIGNNIFDAAMPKACAEVLVAGDFIAPNNKAVAAGLVHLQVSRQDQRGQWQDL
FT                   VDKELLVFGDRNWYKQLGAGLASSSAELITTMTISYQNAYGGEGYQLNPEGKGFKPVQT
FT                   DTGEKQFLPNIEYKNQLLTSSSQQVPPASFGRVDMMWPQRLSLAGTYDQAYLDNQMPGL
FT                   ANDIDWLYFNDAAKDQWLDGFFQGDEQYFISNMHAEHAVLKGQLPPIYGRAFVNQNVPL
FT                   KDNNQQMTGEYQNEFKEIKTKLDTLWLFPNANMGVMIYRGTIKGYSDDGCDITALLLAC
FT                   ENRNDTPRHLQHYQDQLTKRLDPDHGYKYMLFSSPLIAEGMRCGFKQLQDDFDFPLEML
FT                   GKANMDEFADTKKAEAMLQVDDAKLQIIEQCKAAGVDPTPYLDKINNPEKAPEQLKIEA
FT                   LMEKMAPGIVTDPENIDIFNIDLSVMDEIKAYTDEMAAQKTAEAKAQIKVEVEKLKSMP
FT                   DVHLFADAIAKMENAINEIDLPPMWPRPDIKGQLVEVKKQVAETEKKIADLRAQGVSEE
FT                   QLPKIDINIEKIEKQLLDAEVKLKETYAMGAHLMPTSRSPHPGQEAQIKADFLQKWRTG
FT                   QALTNGDYACIDLSGENLVGIDLSGCYLEGVNFSHCDLSNANLEKSILAGANLSNAKLI
FT                   NANCQGANIGAANLSDADFSEANLSKAQLGGSNFTRTQLLRCEMPEINFLDTTFEQTVF
FT                   NGAVLKQCNFINPIFNNCEFIGTDLTQVNMVKPVLVQANFSQATLDGANFVEAQASESD
FT                   FSQAQMINSRFVGGCILNNSNFSQVNLSKSCLRENQLNHCDFSHAQLAEADFSGAELAD
FT                   SQFVGAKAHRTQFMKSQCQNADMRELNLMEGSLYKAYLVGVTFDRANLYCVNFIDSTLG
FT                   NNSYKDANLDQTILKNWRP"
FT   gene            37743..38789
FT                   /locus_tag="Ping_0025"
FT   CDS_pept        37743..38789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0025"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   bpm:BURPS1710b_A0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01900"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY5"
FT                   /protein_id="ABM01900.1"
FT                   /translation="MLKDELIKAVKGGEPLIQGSDLSGGDYQGADLGGGTFESVNFSGA
FT                   DLTGAKLKECNFINCTFTKAKLDSANLILANFIEPNGEGISIKGSDLRLANFIDANFAQ
FT                   ADLSDANLENTSFINPNLKAAKLIGAKLTQCHFINANLEQADFSNVIMFRANFIEAQVQ
FT                   GIVFTGAHLELPFFMKADFTGYDFTNIKMIKPQFQESILVEANFSNMDISHAGFMEANL
FT                   SKANFSNVIAKEANFIKANLHQANFVNAQMPRALFQEANLTKAYFTNVYAEQTLMVKTD
FT                   CTGAVFAGADFTYADFSHAILTEADMSGTRLFSTNLHEIIEQKTNWQNASRQLAKETDE
FT                   MKKKAEKW"
FT   gene            38873..39523
FT                   /locus_tag="Ping_0026"
FT   CDS_pept        38873..39523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0026"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A1706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01901"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY6"
FT                   /protein_id="ABM01901.1"
FT                   /translation="MANVLPIHQQATVTENELATIQGGFANDYMVLSERGVFRANKAYS
FT                   CLVQPIPGDKVLIANIADEHYILAIIERPETNNMTLSFPGDVAFEATSGALKLTSGKQM
FT                   SLTSAEKIQSTSTEIGINTANMKVQANECSVVGDKAVSQWREVNSFSSAMNLVTDRLTQ
FT                   RIKNSFKTVEGLDQQTSLNFLQTIGKTLSIRSRDAVITARKDVKIDGERIHMG"
FT   gene            39545..39958
FT                   /locus_tag="Ping_0027"
FT   CDS_pept        39545..39958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB0797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01902"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY7"
FT                   /protein_id="ABM01902.1"
FT                   /translation="MPFWTTQMCSINFAFPNVCITPIPTPVGPIPVPIPYPSIAITCTA
FT                   IPSQVKVMVMAMFTHNMMTITPMSNGDSTGVWMNPLSGMIMGPQKQLMGSIKTFVGGLP
FT                   VNKMLGLSGQNGMMPGAFGLTLSPSQIKVMSMV"
FT   gene            40134..43757
FT                   /locus_tag="Ping_0028"
FT   CDS_pept        40134..43757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0028"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Carbohydrate-binding family V/XII; Rhs element
FT                   Vgr protein; KEGG: bma:BMAA0737 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01903"
FT                   /db_xref="GOA:A1SQY8"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY8"
FT                   /protein_id="ABM01903.1"
FT                   /translation="MSQYHFKFICQGHDSQDKDSPDSELTLLKFSGQEGISRLFNFTLE
FT                   LKSTDLNLDEDSLLDKPCRIEIYDGKQAKPIRIIHGLVNEFEDINYLPDCTLYRATIVP
FT                   RIWQLGLFETNEVYLNETIEQTLSVILEEAGFIENQDFRFELARTYRKWPFRLQYNETH
FT                   LDYLQRIIEREGIYYYFEQSDSAEVIVFCDNNQALPSIAQPDQSSKIVFQANSGINVAS
FT                   KANTVTNIICKRHTLPKKVTLRDFNDETPSLDIRGEHIINNRGRGEINLYGLNITSPEE
FT                   GQQLAEIHANAYLSRQKVYIGESDAATMVIGHTFKLSEHPRDKFNQLTYLLESIDHEGT
FT                   NLNQYQELHPETDLVVNYSNSFTALSTEHDFAPKRQTLAPEINGTLNAVIDAEADSGYA
FT                   ELDAFGRYKVKLPFDRKDRYGGKASHWVRMMQPYGGANEGMHFPLRNNTRVLLGFIGGD
FT                   PDRPFISGTINDSGDQQSIVTAENQTNNVIKTASGNKIELEDKEGKNRIKLQTGDNQTY
FT                   MHLGAPNHDGSGYVMVTGGIERRDIGGGQRVDIRTVPETLNAPAYSSDETYSLGDLVRH
FT                   SGKFYKCNTAIITIESFAKTKWDFVANVGNSVTAYSNSSTYTVDDIVSHNGKSYKCTTA
FT                   IDPAEGFTASKWSVIGSVATYLNTNTYVLNDIVSHNGKSYKCTTAINSGEEFTALKWSG
FT                   IHLFRASVDSASAFISPHDEYSGKYIISRINGEQHNYNVGNRFNYYATASDGTGVFTPN
FT                   SANKHFFFGNNWEVHHSAHGSIEIDSLSTIMEQYGLAGVLDYAGNPLPASEQADIDKAQ
FT                   TAADNALTTAQYNRDNPVSSDKIAGLDKAVTAAKKAATTDAVNATAKWYKYLEKGRVSV
FT                   AQHDTFTAQNGNIFDFGGYWNYNLGNSYEENTITQGNTEINRDKLDYDWCDIGGPNWTV
FT                   LTPPSDAFSKFGNPDLTGFIGSTNMGKNIDGHTYDYSTNTHGIEINHKCNSFELSVGGE
FT                   SREVKYNGEGKKTYESKSGAGKSEEWSWTPGGEWGTYSKSVFTDEDGKYNESKNFLNYT
FT                   QTSYETSSEPAPGAKFSFKADYLPTLEMKMEVDVGETKLSTHIGVMSNEVDIDLTAIRN
FT                   VIKVEGFLLNTENILALETKFDYGGKYKNFSLVADFNLDTVRLQLEKRAAVIEMAVYEL
FT                   SVKQNAKIALNAGNIAINKKDIEVNKSSIKINSTDIMHLIF"
FT   gene            43781..46711
FT                   /locus_tag="Ping_0029"
FT   CDS_pept        43781..46711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0029"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: bbr:BB0795
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01904"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQY9"
FT                   /protein_id="ABM01904.1"
FT                   /translation="MKSIKSLQASLLTNTFKYQQKHFFVASTLWGFYLDSGEAVLEQTL
FT                   WPIIAANLGKDSLFDEAFKKDASEFVVFADAFAPQLQPAPRVDVSVSLAEITKILNVYG
FT                   ERYWQGFGPSPADPFMQMPLSYEHAYGGQAHLYNKDGKGLPGNDSNEVLRFLANIEHPD
FT                   FPVISKKIPDNKSAYTPQGFAAINSEWPQRKNLYGTFDDNYLQNHMPGLAPDINWDYFH
FT                   TAPPDQRFDRYLTGNEPFCITNMHETMAEIKGNLPGVVGRCFIEQELPLNALEQGELAQ
FT                   YSDAQKRDDKLVLFKEIPLNLDTVYFFPNDNIGIVVHRGTIEINHPQAKDIKKLLVAHQ
FT                   SLTEPAKPSAFYQDQLQLRCDPEDGFKYMMYSAPLIPEDVTCGFKQLLGDEEYKQVMGD
FT                   NLSAFAEGKKQQAEQEMDEAIDKQVAELRANGMDKQADELLDKIKNPPQDIELPEDAKK
FT                   LQALTDKILPGISAMKEAPKLDDLDLTKLNLKAMDEVQAHMEAMAEKQKKEALLKVEQQ
FT                   LDELKQQAAQQPEMAEQLDPSIKQLEEMLASIDAIPVLTRPDTVEQDTQLSAQLAQAAE
FT                   QLTEQKKMMAEHNIELSAEQQQQMTELEQLLDNNETLSAQMAEANDFINDSYLKGAHFI
FT                   AESSSPHKGKEPELVAALLDSYNAKQVITAKDFAFCKLTQQKFKQIDLNHGFFEYSELT
FT                   HIEFEQADLTAINLAHAKLSNVSFDNCAIEGANLGAAELTACQFKNMKLIEITLAHSSL
FT                   IDCEFTDCEFGERMDMLLETKLLRCKFVNCTFLKLNFIELDLTGCEFIDCDLSESNFIK
FT                   PILTDASFTGSTLNGTNFVIAELNNSCFERARMKNTRFVGGCLLNEACFNFATINETNL
FT                   RDCQLNNCDFSDADISKSDFGESSIKNSQFNCTIARQVQFIDSNLNGSQFKKADFMEAN
FT                   LMQADIRGCNFSGANLYGASFLNATLGSTSFYGAILENTLLKDWRP"
FT   gene            46717..47796
FT                   /locus_tag="Ping_0030"
FT   CDS_pept        46717..47796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0030"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   bpm:BURPS1710b_A0543 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01905"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ0"
FT                   /protein_id="ABM01905.1"
FT                   /translation="MAKQTKLSKQALQNRIKGLSDEPPAISEIDFSNQDYRGIDLSGGA
FT                   FSKVNFTECDFSGANLQQATFVECNLNNVNFSRSQLAGCNFVKCTANKALFHSAMGEGV
FT                   NIIESDFSLAVFDGWLCKQLNVVESNLKGSHFQGCHLFEANFITCQLSRSYWVNSVHYR
FT                   SNYIDCEFDQANFDQAELELVFFQNANFDNFDFTKVVIKICQFRESTLQNANFSHCDLT
FT                   QCGFMEAKLNRTNFKGAIANNAMFIKAQINNSDFRDCQLEQALFNEATVRQSNFAKAKL
FT                   VQAQFTDADLSQSSFDGCDLTYADFSNANLSGALISHASLFRTNLHCIIEEKTNWFGSN
FT                   KSLTLATDKKKQAAENFSK"
FT   gene            47840..48484
FT                   /locus_tag="Ping_0031"
FT   CDS_pept        47840..48484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0031"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bps:BPSS0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01906"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ1"
FT                   /protein_id="ABM01906.1"
FT                   /translation="MLNNVISMHSPTTASLFSGHVKKEVKDVFIVQSESGVFPAKHAAS
FT                   CLLQPEVDDKVLLSMTDGELYILAILEKSSQKSKLKFKGDVCLESDAGLSLSSAKALQL
FT                   TSLQSVSQIAPEINTLSKKHTLTTEQLSAHSQKMTVKSEQVQAHVKELHGMFERVYQKA
FT                   DQVIRWVETIETLNIGNWVQNIKGTLNSRAKNQVITAKGDIKVDAERIHMG"
FT   gene            48493..48903
FT                   /locus_tag="Ping_0032"
FT   CDS_pept        48493..48903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01907"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ2"
FT                   /protein_id="ABM01907.1"
FT                   /translation="MFAKTQMGGLDFAMPDVCLTPIPSPVGPIPVPIPYPNISIPMMAI
FT                   PTQFKVLTVCMPNHNLMTMTPMSNGDNSGLMMNPLSAMVMGPSRNLIGSFKTFIGGMPA
FT                   TTMLKPTGQNGVSPGAFGMSLAPSQVKLLIMA"
FT   gene            48954..50753
FT                   /locus_tag="Ping_0033"
FT   CDS_pept        48954..50753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0033"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   KEGG: ret:RHE_CH02648 putative transcriptional regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01908"
FT                   /db_xref="GOA:A1SQZ3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ3"
FT                   /protein_id="ABM01908.1"
FT                   /translation="MKTSFGIKFGILMLFAMTALVGSMLVFFYQYSNTMMKKDLQDKIL
FT                   DVTRTGAFILKEEDRELIETFRNQVYTLLPADYKDRVDRYINKEGKGELLDSDAYEQLQ
FT                   YEVDFHYIVQLLRRIKEGSKDQVNKLSLLPQKKIDEAGASKIAWTYLLVKIPDIPVEKS
FT                   MMFLALSFYLADDNYAATPISTLYTPDDASLTAIKGNIGISKDWYVGAESGNTVMSAVI
FT                   PLKNEQGEVIAALGVDYLVGSFRERIAEQKFVSMIVFVVVVAIALVLIFFITAWISIPL
FT                   SKLRIGAEQLSKHDFEHRVDIKSNDEFGLLADTFNKVSDELGKFTRDLDGIVKAKTAGL
FT                   TKAREEVVALNNILNQENAHLGAEVKNLIALRERTLPYLNQKLKVNNYEITFNYLPSQA
FT                   VCGDFWQVKSDKECTDISFGFISGYGLETAMMAMQIQSLFKVADGNNSKRLSVINDFLF
FT                   EQGDSINLKLLCKLLLLQINEDNITLSGSGEPPIRFSPNQQAFIKLTGSLPLGVNRDIT
FT                   MESVQLSLHRGEGLLLYSAGFKLALAHLAKSEGYELQAQDIIHLSGILGESSGNIMDKF
FT                   TEQPWFDDFNQDISFILINRKGS"
FT   sig_peptide     48954..49052
FT                   /locus_tag="Ping_0033"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.912) with cleavage site probability 0.571 at
FT                   residue 33"
FT   gene            50753..51106
FT                   /locus_tag="Ping_0034"
FT   CDS_pept        50753..51106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01909"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ4"
FT                   /protein_id="ABM01909.1"
FT                   /translation="MMHALSVNACYQFIEEEHKLVFKADAGLFHLTDIQKAQRFLKFLK
FT                   RNKVTILQLEIDKLQTLDSNCESFVYQIGCYFAKNKQSSFLIQANGDNETQNNLIRNLL
FT                   VITPAAKVTFVVS"
FT   gene            51362..53788
FT                   /locus_tag="Ping_0035"
FT   CDS_pept        51362..53788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0035"
FT                   /product="transporter major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bbr:BB1643 putative inner membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01910"
FT                   /db_xref="GOA:A1SQZ5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ5"
FT                   /protein_id="ABM01910.1"
FT                   /translation="MKVTLKKLKIFWAASAIIALSLTLNFLLNMSSFEDVYKSTLISKY
FT                   KQINRNLNTKLEAAVSYGKPLYKFSGIDDLINEIISKEEDVTNVFVTLKSGQVLYSFDK
FT                   TYIEKHVLNEIIPGEKELNSEEKVSVFKIENNYFLASPIYYENSEIKGFLYIEFNTKVI
FT                   TDKVMVVIKESINFVAVVLIISMCLLLALIMLLDMKSNRKNFIVIMAIITVSQFSYSYI
FT                   NIQHFENRYLLLLNQNVSNFAENIEDEIVYFNNLGLPIQRLKGFEKYLAKEIQEVPGCL
FT                   EVYVTDKNNNELFYADASGDNRSRYQNKRGEVFYDKNQAKYYQTLRVDLAGQDSGNIIL
FT                   RLNDSLINKKITEQILDAVTIFVISLIISYKILLLVSIQRKQTLDGSEEGKTSPTLDGS
FT                   EQEKNTPKKDTNVVIQLLAFIFYFGEMLPISFIPLLAADMYKTESLSFLGMSESMIIGL
FT                   PITTYMLGAAIFVLVIGFFAGKISEKKIFVGCSLFLVIGAFGAAFSNDIGLLSFFRFIS
FT                   GLGYGGISINATSLILRIFKKNGNVATGFGYWASGYGAAAICALPIGGILVYRFGFFYA
FT                   LGVSGIISVILMLFAIFFIHFQQTEKTEPRIEPKTEKTKLHLNIFNDRNVFANFFFRLV
FT                   PFHLVFIGIFQFIMPLTMNKEGISEANIGRILTIFGLVYLLMPFVSKLVNKVKNDRMFI
FT                   AFGSMLIGVVLLTLKFSDNIVAFIFVVAGISLGSMIADAAEESFITSTKKAKEIGEVKF
FT                   MSIYNSYERLIMVFAPLLCSFAVTQIGFSDSIFVIGLFTMASSVAYLFISKKNPQ"
FT   sig_peptide     51362..51466
FT                   /locus_tag="Ping_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.884) with cleavage site probability 0.677 at
FT                   residue 35"
FT   gene            53800..54942
FT                   /locus_tag="Ping_0036"
FT   CDS_pept        53800..54942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0036"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="KEGG: sar:SAR2170 D-alanine--D-alanine ligase;
FT                   TIGRFAM: D-alanine--D-alanine ligase; PFAM: ATP-dependent
FT                   carboxylate-amine ligase domain protein, ATP-grasp;
FT                   D-alanine--D-alanine ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01911"
FT                   /db_xref="GOA:A1SQZ6"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ6"
FT                   /protein_id="ABM01911.1"
FT                   /translation="MSDSRMKVAVVFGGKSTEHDVSIISAGHILANIDMEKYFVEPFYV
FT                   KKDGTFADHQELTLCLENLLNEHRDKIFPAMKEGEIELKKWIAKGTSSDFLGGIAGKKF
FT                   DIVFPVLHGLNGEDGTIQGMLEFMGVPYVGCGVSASAFCIDKEATKVICQVNDIPVMDY
FT                   TAVKKYEWENSTENIINDIQKKMNYPFYVKPARLGSSIGISRAENTVELKTSLKDAFKY
FT                   DCKVVVEQGVESPRELTVGVMGIDDQVSLSAIGEFSRGSNLYFNFDSKYGKTGHKGLVP
FT                   APLEENIQEIIEKYSHLIFKKFELSGFARIDYFLCGDKVYLNEINTMPGFETGDTFMRI
FT                   WQNKGVDMQKFIDKAIEYGVLSFHSKSTRLYEIEIKSLIE"
FT   gene            complement(55201..56406)
FT                   /locus_tag="Ping_0037"
FT   CDS_pept        complement(55201..56406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0037"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /note="KEGG: hch:HCH_03644 ABC-type uncharacterized
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01912"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ7"
FT                   /protein_id="ABM01912.1"
FT                   /translation="MNKFTKLLFTVFCVFLFGCNSEDSIKSIFKEDSPKFQTEIKKTDK
FT                   TKDSFSPEQKLGGGKYKIAVIQSDDYPEYYEVLTAILQGMQLTGWIKENNVVVKDNYTS
FT                   NRELINGINGKDYSDYVEFSPDTFFSFRADENNASDPQFKKVMQRAIDGEFDAVILLGT
FT                   LASHKVLENKEYSTATLMDAVSDPIGSGFVESIDNSGKDFLTARIDPNQYIRQVRLFYK
FT                   VIGFKSLGIIYENSENGRWYAAVDDVEKVAEENGIKLVVDNDVMTEPTQQQYHQAYGMY
FT                   LRAMDRVSPKVEAMFLGISGGLEPENLPNVVNKLIDYKLPSFTMEGAQAVKKGVMIGVS
FT                   GKETGLYNAKKLARILKGETPSTLDQRYEKMPKISINLKTTEKIGYDLPVDIIRSADEI
FT                   YQ"
FT   sig_peptide     complement(56341..56406)
FT                   /locus_tag="Ping_0037"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.952 at
FT                   residue 22"
FT   gene            complement(57147..57404)
FT                   /locus_tag="Ping_0038"
FT   CDS_pept        complement(57147..57404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01913"
FT                   /db_xref="UniProtKB/TrEMBL:A1SQZ8"
FT                   /protein_id="ABM01913.1"
FT                   /translation="MKMDFETKMTIGESPSIKGNDNNYKGFGSYDLPRPEGVGWQLKQV
FT                   IPVYNNNKYLQYFWEREIEIVNDSTDTLKIKNNDINISFG"
FT   gene            57783..58040
FT                   /pseudo
FT                   /locus_tag="Ping_0039"
FT   gene            complement(58562..59389)
FT                   /locus_tag="Ping_0040"
FT   CDS_pept        complement(58562..59389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0040"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: pat:Patl_4074
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01914"
FT                   /db_xref="GOA:A1SQZ9"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SQZ9"
FT                   /protein_id="ABM01914.1"
FT                   /translation="MNIQFSKMHGLGNDFMVIDNVTQNVFLSKDTISRLADRNFGIGFD
FT                   QLLMIEPPYDPELDFHYRIFNADGSEVEQCGNGARCFARFVKMKGLTQKRIINVSTAKG
FT                   KIQLKIEHDGNITVDMGKPILEPAKVPFEAQKEEKTYILRVEDHTVLCGVVSIGNPHCV
FT                   VLVDDIDNAPVETLGPLLENHERFPNKVNVGFLEIKSRDHARLRVWERGVGETLACGTG
FT                   ACAAAVVGQLQDKLNPHCTIELPGGELRLFWQPGQSVKMTGTADFVFDGQIQI"
FT   gene            complement(59442..60707)
FT                   /locus_tag="Ping_0041"
FT   CDS_pept        complement(59442..60707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0041"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: pat:Patl_4073
FT                   diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01915"
FT                   /db_xref="GOA:A1SR00"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="PDB:4XG1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR00"
FT                   /protein_id="ABM01915.1"
FT                   /translation="MDHFNYQNDGRLFVEGLPVEQVVKKTGTPAYIYSRATIERHWQAF
FT                   DSAAGKHPHLICYAVKANSNLAVLNLMARMGSGFDIVSVGELMRVIQAGGDPKKIVFSG
FT                   VGKTEIEISAALQANIMCFNVESISELYRINSVAKALNVKAPISIRINPNIDAGTHPYI
FT                   STGLKENKFGIEIEQALDVYKIASDLEFLEIKGVDCHIGSQLTEIAPFIEALDKLLILI
FT                   DLLAEKGITISHLDLGGGLGVPYDDETPPEPAEYMTAIINRMAGRSLKLIFEPGRAIMA
FT                   NAGVLVTKVEFLKLNDYKNFAIVDAAMNDLIRPALYSAWQNIIPLNTDYQDGQDRPVRS
FT                   YDIVGPICETGDFLGKERQLALAEGDYLVIRSTGAYGSTMSSNYNSRCRAAEILVDGEK
FT                   AFIVREREELKDLWRGEHILPI"
FT   gene            61094..61411
FT                   /locus_tag="Ping_0042"
FT   CDS_pept        61094..61411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0042"
FT                   /product="Frataxin family protein"
FT                   /note="PFAM: Frataxin family protein; KEGG: plu:plu4642
FT                   cyaY protein, which belongs to the frataxin family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01916"
FT                   /db_xref="GOA:A1SR01"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="PDB:4HS5"
FT                   /db_xref="PDB:4LK8"
FT                   /db_xref="PDB:4LP1"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR01"
FT                   /protein_id="ABM01916.1"
FT                   /translation="MNDSEFIQLADQLYQKIEEKIEESGADVDYDQNGSLLTLEFENHT
FT                   KLIINRQQPLHQVWLATLENGHHYDYNNGKWIDDRSGDEFLTFLSAAIFKQSKETVDFT
FT                   E"
FT   gene            61851..62336
FT                   /locus_tag="Ping_0043"
FT   CDS_pept        61851..62336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0043"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: hdu:HD0453 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain;
FT                   PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01917"
FT                   /db_xref="GOA:A1SR02"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR02"
FT                   /protein_id="ABM01917.1"
FT                   /translation="MKTVVFPGSFDPVTLGHIDLITRASKLAERVVIAVAVNTSKRTLF
FT                   NLNERCDLLSEATAHLSGIEVIPFSGLLADFAKEHNAQALIRGIRGTTDADYELQLAQV
FT                   NKALNSELETILLPANAATGFISSTVVKEVFKHNGDIDPFAPPCVKQALLIKHSENS"
FT   gene            63117..64823
FT                   /locus_tag="Ping_0044"
FT   CDS_pept        63117..64823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sdn:Sden_3050 protease-associated PA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01918"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR03"
FT                   /protein_id="ABM01918.1"
FT                   /translation="MKKIITKMLVVTAITGIFSPLAVAGTTTVTRQTHSVEGLVGVTAS
FT                   QTSNSISYTLGDNYSVGDEITFTFPVGALTPQNFPPNISSANLDLTLVSNDGSSILYQV
FT                   DTVTGNSSGDVIALGQATINSTFLSSNRITVTVSSQHLGAAFDAAGTRSSTVAEAKSQF
FT                   GTVSINPTFDNTIANDNENDPDGGTFFASADDTITFSVTNPAITGWLNIATVNSTQVTL
FT                   SGEAGKMAGFSASNFSTAGTKTLTENEAKLDISYTGLITTDTITFTPDTAPLLAQTFKM
FT                   DVIYNYQSAGAVSGSKKVGNQVTAGAWTLSYPNVANASVVFNHHSNTFNGAYCDIDNVF
FT                   DAGETSMLTVTLPDADWGSVSSIIATVESAADITFANEGIINFVDGTLSAGLEMTLNTA
FT                   GTNEQIDIVVSFTSNDANLALPQPITSTMKVNFDYEGATPTVVADSGECVNRKPVLGDV
FT                   TGSGSIVERAEVTLTAQAIDHDFDNLTYTWLQTAGKTLDVDSTSATLIFNAPAVENNET
FT                   YTFSVIANDGHLSSDAKEVSFTVTPSNSGGGSMGLFSLLLLPLCFLRRKKR"
FT   sig_peptide     63117..63191
FT                   /locus_tag="Ping_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            complement(65289..66059)
FT                   /locus_tag="Ping_0045"
FT   CDS_pept        complement(65289..66059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0045"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   rru:Rru_A2127 serine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01919"
FT                   /db_xref="GOA:A1SR04"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR04"
FT                   /protein_id="ABM01919.1"
FT                   /translation="MNTKLMPTVLITGATSGFGLATAKKFAQHGYPLIITGRRKERLQK
FT                   LSDQLSPITDVFFYQLDVRDSEAIKTFTQAIPDNFKQVSILVNNAGLALGTESADKASL
FT                   DDWHTMIDTNVTGLVNVTHSLLPILRKQASASIINLASIAANWSYPGSHVYGASKAFVA
FT                   QFSRNLRSDFAGTGVRVTSLEPGLSESEFSLVRFKGDKEKYQQIYNNADALQPEDIANI
FT                   IFWIAEQPAHININSIEVMPTSQAWDNFKIIKHP"
FT   sig_peptide     complement(65988..66059)
FT                   /locus_tag="Ping_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.740 at
FT                   residue 24"
FT   gene            complement(66314..67786)
FT                   /locus_tag="Ping_0046"
FT   CDS_pept        complement(66314..67786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0046"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   csa:Csal_0157 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01920"
FT                   /db_xref="GOA:A1SR05"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR05"
FT                   /protein_id="ABM01920.1"
FT                   /translation="MADFLINIELHQNSTYQQQIREKLVQLITQDTFGDKPLPSGRKMA
FT                   ELLGVSRNTVVLVYESLVDEGYLVARERCGFFVDPDLSMEQLPKTVQLNPKKISRQPNW
FT                   CERLQKKPSKLSTLNKDENWIKYTYPFIYGHIDVNEFPLYQWRECSRIAESKGKLHEWV
FT                   EGFIDMDDPQLVSQIRQQILSKRGISAKTDEVLITLGTQNSLFLLTSLLADKSVTFGVE
FT                   NPGYANLRHVISLCDSPVKALKIDHQGVQVGEQLKACDYVCVTPSHQYPTTVTMTIERR
FT                   KALLEQACKDDFIVIEDDYESEVNFIEKPLPALKSFDQDGRVIYTGSLSKSLSPGIRIG
FT                   YLVADSSLITELRKLRALHYRHPPSNNQRITALFLSQGYYDSHIRRMRQSYEKKWLLMQ
FT                   QGIERHLGDCEIHSTAGSFCFWIGLPAGINSHLLVDIAAEQGILVESGDSLFMQENAPE
FT                   NYIRLGFSAISGDKILPGLAILGELINTLKNK"
FT   gene            68054..69061
FT                   /locus_tag="Ping_0047"
FT   CDS_pept        68054..69061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0047"
FT                   /product="taurine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="KEGG: bxe:Bxe_B0694 ABC taurine transporter,
FT                   periplasmic ligand binding protein; TIGRFAM: taurine ABC
FT                   transporter, periplasmic binding protein; PFAM:
FT                   Substrate-binding region of ABC-type glycine betaine
FT                   transport system; SMART: extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01921"
FT                   /db_xref="GOA:A1SR06"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR06"
FT                   /protein_id="ABM01921.1"
FT                   /translation="MKKCKPLKIMAAMAGLFFASTLAAKDVTIGYMGMNNPWKHAINEK
FT                   LIEKETGYKVDWRRFYSGSKVITAMASGSIDIASAGSSPIAAAVSHGIEIELVWILENI
FT                   ADAEALVVRNGAGITSPSDLKGKRIAVPFVSTTHFHTLFALEQFGLSDEDVRLINMQPN
FT                   TIGAAWERGDIDGAFIWDPVLGKIKKDGKVLITSRTLSSWGKPTFDGLVVDKKFGKENA
FT                   DFMAKVLKIAADLDQEYRSNKESFDATHPIAKSISKISGSDVNDVAGVLDLYEFPDFAT
FT                   QLSCNWLGCGMEGGAAKSLKSTSEFLKKGKKINDLMPDYSVFVNPEYALAASKL"
FT   sig_peptide     68054..68128
FT                   /locus_tag="Ping_0047"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 25"
FT   gene            69103..69942
FT                   /locus_tag="Ping_0048"
FT   CDS_pept        69103..69942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0048"
FT                   /product="ABC transporter for nitrate/sulfonate/bicarbonate
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0693 ABC taurine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01922"
FT                   /db_xref="GOA:A1SR07"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR07"
FT                   /protein_id="ABM01922.1"
FT                   /translation="MNTLKICDVSVVYPGSEGGESVAALSNVNLAMEQGDLVVALGASG
FT                   CGKTTLLNLIAGFISPTKGYLTLGNSTVKGYPRVVCGQDIGDEITGPDAGRGVVFQKHA
FT                   LLPWLNVIENTALGLKLQGMDKIARRQRAAEYLKLVGLEDFHQHKIYQLSGGMQQRVGI
FT                   ARALANDPKMLLLDEPLGALDALTRESLQELLLDVWRETNKMMFFITHSVDEALLLATR
FT                   LVVMSPRPGRITHQFDLDFNKQFLDCRDARKVKSSPEFIAMRDQVLAIIHGDELAIA"
FT   gene            69952..70944
FT                   /locus_tag="Ping_0049"
FT   CDS_pept        69952..70944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0049"
FT                   /product="ABC taurine transporter, binding protein inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0692 ABC taurine
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01923"
FT                   /db_xref="GOA:A1SR08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR08"
FT                   /protein_id="ABM01923.1"
FT                   /translation="MTNITKPFATSAAELGISKIKEINSKPVPEQKMVDTKEERATAAA
FT                   AVSFLDKIELKIKKLTAPSAVPSGEYFGTPGVGDSRLISVCSTIFFIAIWAIATEGGFI
FT                   KPIFLPSPFDVVERLIDITVDGFAGATLLEHLNASLVRIFGAFILACLIGIPLGITIGC
FT                   NRVFRGIFDPLIEFYRPLPPLAYLPLIIIWLGIDESSKVTLIFLAMLAPIVLSARAGVT
FT                   SVRIEQIQVAYSMGASPWQVVTQVIARGAMPDIMTGMRIAIGFGWTTLVAAEMVAAEQG
FT                   IGFMVLNASEFLVTDVVIAGILVIGIIAYCFDLLMRYLEAKLIPWKGYN"
FT   gene            complement(71683..72420)
FT                   /locus_tag="Ping_0050"
FT   CDS_pept        complement(71683..72420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0050"
FT                   /product="hypothetical protein DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   csa:Csal_0160 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01924"
FT                   /db_xref="GOA:A1SR09"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR09"
FT                   /protein_id="ABM01924.1"
FT                   /translation="MEQIWLLIPVVIFAAVVRGFSGFGFAAIAVVGFNVFLAPQQSVAI
FT                   VLSLDLICSMNLWRQALKQADFTTLKRLVCGSLLGIPLGYALLMLMPTEILKILICITI
FT                   LFFCVLLLSEYRPFNTDKTGTKIGFGLASGAGTASASVGGPMIVYYMLSSNLSTSSQRA
FT                   TMILFFIASEAFTIIALIAGGVVDSTLPNALLILVIPTLFSVHFGQYLFNRKPPQSLKS
FT                   FALPVLIAVALFGIINATLTLLR"
FT   sig_peptide     complement(72340..72420)
FT                   /locus_tag="Ping_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.789) with cleavage site probability 0.712 at
FT                   residue 27"
FT   gene            72640..74052
FT                   /locus_tag="Ping_0051"
FT   CDS_pept        72640..74052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0051"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG: rde:RD1_0981
FT                   taurine--pyruvate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01925"
FT                   /db_xref="GOA:A1SR10"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR10"
FT                   /protein_id="ABM01925.1"
FT                   /translation="MGIMALPASEIIEKDRNHVWHHLSQHSVLKHQDPLVMVKGVGSRV
FT                   WDAKGNSYLDASSGGVWCVNVGYGRTEIADAIRDQVLKLNFFASTAGTAPAAEFAEKLL
FT                   EKMPGMSRVYYASSGSEANEKAFKIVRQIAQQKHGGKKHKILYRDRDYHGTTIAALSAT
FT                   GQEERRMHYGPFVPGFVEFPHCCEYRSQFGDVSNYGVLAANELEKVILREGPDTVGAVV
FT                   FESITAGGGVITPPEGYWPAVMEICKKYNVLIHMDEVVCGMGRTGKWFGYQHYGIKPDI
FT                   VTLAKGIASSYAPISCVVTTEALFDEFIADSSDRAAYFRDVSTYAGCTAGPAAALANLQ
FT                   ILERENLVNNSAQMGDYLLKQLVTLKDKYSVIGDVRGKGLLLGIELISDSKTKKPVAEE
FT                   VAIKIAGMCMKKGLIIGRTNRSFTHFNNTLCLCPVLTLTQKEADFIVATLDAVFRELLE
FT                   SVDLLSSTLVES"
FT   gene            complement(74599..75579)
FT                   /locus_tag="Ping_0052"
FT   CDS_pept        complement(74599..75579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0052"
FT                   /product="hypothetical protein DUF1568"
FT                   /note="PFAM: protein of unknown function DUF1568; KEGG:
FT                   sdn:Sden_3323 protein of unknown function DUF1568"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01926"
FT                   /db_xref="GOA:A1SR11"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR11"
FT                   /protein_id="ABM01926.1"
FT                   /translation="MMAQPRKTIVSLDDTPYYHCCSRVVRKAFLCGIDSTTGENYEHRR
FT                   VWVDARIIELATIFAIDICSYAVMSNHLHVVLKVNADKAVNWSDKAVLVQWHKGFKGTL
FT                   LTQKFVKGEDLSTFELKTVNECITEYRHRLIDISWFMRSLSEPIARQANKEDSCTGRFW
FT                   EGRFKSQALLDETAVLACMAYVDLNPIRAKMATTPETSDHTSIQRRIHSAIKGEQPAEL
FT                   LPFVGDECLNMPDGLMFSVKDYIALVEDTGRIIREDKRGAISSNSQDILNRLNIPADNW
FT                   LKITIEFGHLFKGAVGALPALTEYCEHLDRKRRHGAANCQRWLCG"
FT   gene            complement(76031..76843)
FT                   /locus_tag="Ping_0053"
FT   CDS_pept        complement(76031..76843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0053"
FT                   /product="DNA-(apurinic or apyrimidinic site) lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: sde:Sde_3681 pseudouridine synthase, Rsu;
FT                   TIGRFAM: formamidopyrimidine-DNA glycosylase; PFAM:
FT                   Formamidopyrimidine-DNA glycolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01927"
FT                   /db_xref="GOA:A1SR12"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR12"
FT                   /protein_id="ABM01927.1"
FT                   /translation="MPELPEVETSRKGISPHLINKSVQNVVLRHTQLRWKIPQDLLSDI
FT                   KDKILLSIDRRAKYLLFNFTSGTLLIHLGMSGSLRICPLNSPPKKHDHADLIFADCLLR
FT                   YTDPRRFGAILWLGLTPEDSPLLNKLGPEPLNDDFNAKYLYQQATKRKLPVKQFIMDQK
FT                   VVTGVGNIYATEALFNSGISPIRAAGNISEKRYQILVTEIKEILQQAIKQGGTTLKDFV
FT                   GSDGKPGYFQQTLQVYGKTGQQCPSCETPLKAVKLAARASVYCPECQS"
FT   gene            complement(77146..77301)
FT                   /locus_tag="Ping_0054"
FT   CDS_pept        complement(77146..77301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0054"
FT                   /product="LSU ribosomal protein L33P"
FT                   /note="PFAM: ribosomal protein L33; KEGG: sde:Sde_3680 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01928"
FT                   /db_xref="GOA:A1SR13"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR13"
FT                   /protein_id="ABM01928.1"
FT                   /translation="MRDKIRLNSSAGTGHFYTTDKNKKTMPEKFEIKKFDPVVRKHVMY
FT                   KEGKIK"
FT   gene            complement(77313..77549)
FT                   /locus_tag="Ping_0055"
FT   CDS_pept        complement(77313..77549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0055"
FT                   /product="LSU ribosomal protein L28P"
FT                   /note="PFAM: ribosomal protein L28; KEGG: pat:Patl_0048
FT                   ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01929"
FT                   /db_xref="GOA:A1SR14"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR14"
FT                   /protein_id="ABM01929.1"
FT                   /translation="MSRVCQVTGKRPAVGNNVSHAKNRTRRRFLPNLQTHRFWVESENR
FT                   FVKLRLTTKGMRIIDKKGIDSVLTDIRAKGEKV"
FT   gene            complement(77684..78361)
FT                   /locus_tag="Ping_0056"
FT   CDS_pept        complement(77684..78361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0056"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: pat:Patl_0046
FT                   DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01930"
FT                   /db_xref="GOA:A1SR15"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR15"
FT                   /protein_id="ABM01930.1"
FT                   /translation="MTKLKDWPNQERPREKLLQKGTAALSDAELLAIFLRTGCRGVDVV
FT                   TLSKQLLSQFGSLHALFAASESDFCEKKGLGQAKYVQLQAVLEMSSRYLQEPLSKGNAL
FT                   TSAAQTKAFLIAKMHNLPYEVFAAILLDTQHRIIRFHEFFFGSIDCATVHPRIIAQKVL
FT                   SENAAAIILVHNHPSGDPSASEADKMITQKIVSALQLIDVRVLDHLVVGHKKCTSFAEN
FT                   GWI"
FT   gene            78569..79804
FT                   /locus_tag="Ping_0057"
FT   CDS_pept        78569..79804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0057"
FT                   /product="Phosphopantothenate-cysteine ligase /
FT                   Phosphopantothenoylcysteine decarboxylase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: vch:VC0215 DNA/pantothenate metabolism
FT                   flavoprotein; TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01931"
FT                   /db_xref="GOA:A1SR16"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR16"
FT                   /protein_id="ABM01931.1"
FT                   /translation="MSEHHILSGKKILLGIAGGIAAYKCAELTRRLKDQGADVRIVMTS
FT                   SAKAFITPLTMQAVSGHAVADDLLDPNAESGMGHIELARWADLVLLAPATANLIARLRA
FT                   GMADDLLTTLCVATSSPIAVSPAMNQQMYLAQATQDNISVLKQRGVMIWGPGQGAQACG
FT                   DIGPGRMLNPADLVEKVMDYFSDKNSYFTGVNITITAGPTQEALDPVRYISNHSSGKMG
FT                   FALAEVAQKIGANVTLISGPVQLSTPNGVTRLNVTSALEMHQASLSGLKNCDIFIACAA
FT                   VADYRAETVAEQKMKKQPGIDELTIKLVKNPDIIKDVSNHQNRPFCVAFAAETQHLEVY
FT                   AKDKLKRKNVDLIAANDVAKNGQGFNSEKNALSVFSSEERFDITLADKKAVASQLLKII
FT                   SQQYALKNKGFK"
FT   gene            79804..80259
FT                   /locus_tag="Ping_0058"
FT   CDS_pept        79804..80259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0058"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="KEGG: she:Shewmr4_3599 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; TIGRFAM: deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01932"
FT                   /db_xref="GOA:A1SR17"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR17"
FT                   /protein_id="ABM01932.1"
FT                   /translation="MKQIELKILDPRIGKEFPLPEHATAGSAGMDLRACIDQALIIKPG
FT                   ETQLIPTGIAIHISDPGLAATILPRSGLGHKHGIVLGNLVGLIDSDYQGPLMVSCWNRS
FT                   TESFRLEPGERLAQLVFLPVVQATFEIVDEFKSSERGEGGFGHSGKH"
FT   gene            80294..80896
FT                   /locus_tag="Ping_0059"
FT   CDS_pept        80294..80896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0059"
FT                   /product="cell division inhibitor SlmA"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sfr:Sfri_3831
FT                   transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01933"
FT                   /db_xref="GOA:A1SR18"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR18"
FT                   /protein_id="ABM01933.1"
FT                   /translation="MLAKTTKKKVNRKEDILHALAKMLESQPGQRITTAKLAAEVGVSE
FT                   AALYRHFPSKARMFEGLIDYIESTIFTQINLIKEQQKQTFVRIEHILYFLLGFAEQNPG
FT                   ITRILTGDALLGENERLQTRIEHVFSKLESQLKLILREKAIFDGGKLSIDEAIVANLLL
FT                   AYVEGRMSQFVRSQFKQKPTQYFNTQWPFLYRQLQQS"
FT   gene            complement(80966..81256)
FT                   /locus_tag="Ping_0060"
FT   CDS_pept        complement(80966..81256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0060"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: sfr:Sfri_3552
FT                   methionine repressor, MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01934"
FT                   /db_xref="GOA:A1SR19"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR19"
FT                   /protein_id="ABM01934.1"
FT                   /translation="MSTKWNGEYISPYAEHGKKSEQVKKITVSIPTKVLKILTDERTRR
FT                   QVNNLRHATNSELLCEAFLHAYTGQPLPEDGDLDKNQATGIPESVKKLMKK"
FT   gene            complement(81340..83949)
FT                   /locus_tag="Ping_0061"
FT   CDS_pept        complement(81340..83949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0061"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase, class-I; KEGG:
FT                   ppr:PBPRA3526 putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01935"
FT                   /db_xref="GOA:A1SR20"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR20"
FT                   /protein_id="ABM01935.1"
FT                   /translation="MKWVAGSLLNPEIKRLRDKADELTRLRIQSAELLMNADTLTVFRT
FT                   FPLLLHYNHPSLPGYTKGDTPTGIHQFNVNKKQKKQLAELFPYQEEPQKKAQATNLITK
FT                   PTDLKIQLNNLLSFQDEPQKKPQQADLIGLYAMGSTASIGQSSESDLDIWICYPHQMDK
FT                   QRVQLLKNKSWLITHWAEGYGVELNFFLIPDNKFRIDNKSDMTMDACGTSQHLLLLDEF
FT                   YRTELHIAGKRILWWQVPFEHEKNYNEYVKKLYDNGGLNPDDWLDLGGFDRIPAEEYFG
FT                   ATLWQLYKGIDTPYKAVLKTILMEAYSWEYPNTELIALYYKKRFQEQQTDLEYLDPYCL
FT                   MLEKVTSYLNKINDFKRLEVVRACFYLKTEENLSKICTLNPPTWRRQVLTKFVNRWDWN
FT                   KDHIADLDNRKKWKVRAVSNAKDILLDTLMASYSKLLRFARDNNIEGSISAEDLGILSR
FT                   KLYAAHESLPGKVDLINPKISPDLSEPDLSFIQVPKNRKNAAGWYLYNCSLDSFTLINT
FT                   PTLMYAKYIAKLVAWCHMNGLYEEETQLHLYNQGSDLVDKKLNQFIQDLYSVFPIYIPK
FT                   ASNNALSRPCEIKHLTIFLNLERDPTRHWESTSESEDDQQGDIFSYGEDKECLIGSIDL
FT                   IYRNSWNEVRTLHFNSNQSVIDALHTILGKMHQGACPPEQIDLFCYSCQFQAQISQAFK
FT                   SKLNEYIQLRLDSLSQRSVQTLKTGEENFAFYFEQTGVSVQHLKNLVDIYSHISNKKVS
FT                   NSALNLKNTYFDKTVSIIGSHISEGIVQFFFENYHDGFNVYIANADNEIETLHSFTGGK
FT                   DDLVQNVNRFYASNNNEMNKQDDRINFNLPQFYEIELSDNKELILSSFTSTTKENEP"
FT   gene            complement(84139..85116)
FT                   /locus_tag="Ping_0062"
FT   CDS_pept        complement(84139..85116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0062"
FT                   /product="glycine cleavage T protein (aminomethyl
FT                   transferase)"
FT                   /note="PFAM: glycine cleavage T protein (aminomethyl
FT                   transferase); KEGG: stt:t2966 conserved hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01936"
FT                   /db_xref="GOA:A1SR21"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR21"
FT                   /protein_id="ABM01936.1"
FT                   /translation="MFKLSQLNNISQLPDLVLCPLTSWDLLSVTGEDRITFLQGQLTCD
FT                   LTILKPGEQTLAAQCNPQGKVWSIFRVVVLNDRILLIQPKSVTAKQLPELQKYATFSKV
FT                   EIKKETEYQLLGLAGCKSAANIAKNFNISATHEESHLLDDDQGVIIKQPYPSLRYLMIV
FT                   KNQQATQLTEDLKDQASVYDDSLWNAMNIAAGIAFIEEETSGLFIPQMLNLQALNGISF
FT                   TKGCYIGQETIARTKYRGANKRALFILTGRATEAPKAGQNVKVLLNNNWKRVGTIISGC
FT                   QYGDGHIEVLAILPKNSESESVYQIQGIEGSTLYYAPLPYQIDD"
FT   gene            85557..85808
FT                   /locus_tag="Ping_0063"
FT   CDS_pept        85557..85808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0063"
FT                   /product="protein of unknown function DUF339"
FT                   /note="PFAM: protein of unknown function DUF339; KEGG:
FT                   cps:CPS_4131 TPR repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01937"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR22"
FT                   /protein_id="ABM01937.1"
FT                   /translation="MAEAVNKSRLLWACRRGMLELDVLFIPFVKEAYDDLSYSEQLTFE
FT                   RLLTNEDPDLFAWFMGHKSCPDAEQAKIIDVILKRVKV"
FT   gene            complement(86239..87870)
FT                   /locus_tag="Ping_0064"
FT   CDS_pept        complement(86239..87870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0064"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: yps:YPTB2898 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01938"
FT                   /db_xref="GOA:A1SR23"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR23"
FT                   /protein_id="ABM01938.1"
FT                   /translation="MTESKSISEKQHTCDVLIIGAGAAGLSLALKLAPHARINVLSKGK
FT                   LSEGSTLYAQGGVAAVFSDDDSIEAHVKDTLIAGADLCDEEAVRFTVSNAKESIQWLID
FT                   TGVGFDTEINDDGQAQYHLTREGGHSHRRILHSADATGKEIETTLLSAVKKHKNINLME
FT                   GYNAVDLITSRQLNLPANRIIGAYVWNRKAERVEIIKANFVTLATGGASKVYQYTSNPD
FT                   VSSGDGIALAWRSGCRIANMEFNQFHPTCLYHTDAKNFLLSEALRGEGAYLRRPDGTRF
FT                   MLDFDERAELAPRDIVARAIDYEMKRLGADCMYLDISHKSKEFIVKHFPTIYHRCLSLG
FT                   IDMAEQPIPIVPAAHYSCGGVMIDHHGQTDIDGLYAIGEVSYTGLHGANRLASNSLLEC
FT                   IVYAHACAKDIINRIPFYKERKFAKIPDWDESQVDDSDEAVVIQHNWHELRLFMWDYVG
FT                   IVRTDKRLERALHRVQLLQQEIDEYYGNFKVSNNLLELRNLVQVAEIIIKSAMKRKESR
FT                   GLHYNLDYPEQLDNPKPTILTPEKSC"
FT   gene            88101..88682
FT                   /gene="rpoE"
FT                   /locus_tag="Ping_0065"
FT   CDS_pept        88101..88682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="Ping_0065"
FT                   /product="RNA polymerase, sigma-24 subunit, RpoE"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   pha:PSHAa0726 sigma E (sigma 24) factor of RNA polymerase,
FT                   response to periplasmic stress (TetR/ArcR) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01939"
FT                   /db_xref="GOA:A1SR24"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR24"
FT                   /protein_id="ABM01939.1"
FT                   /translation="MSERDLDLQLVRRIQNGDQVAFTLLVRKYQTRVANILTRYVRNTG
FT                   DIADVAQEVFIKVHNSLPSFRGESAFYTWLYRITVNTAKNYLTSQSRRPPASDIDAMEA
FT                   DSFDGSDALREVDSPEGILRSQEVKKVILTTINELPSELKAAITFREIEGMSYEQIAII
FT                   EDCPIGTVRSRIFRAREMIDKHLKPLLAED"
FT   gene            88695..89228
FT                   /locus_tag="Ping_0066"
FT   CDS_pept        88695..89228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0066"
FT                   /product="anti sigma-E protein, RseA"
FT                   /note="PFAM: Anti sigma-E protein RseA family protein;
FT                   KEGG: sfr:Sfri_2934 anti sigma-E protein RseA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01940"
FT                   /db_xref="GOA:A1SR25"
FT                   /db_xref="InterPro:IPR005572"
FT                   /db_xref="InterPro:IPR005573"
FT                   /db_xref="InterPro:IPR026279"
FT                   /db_xref="InterPro:IPR036147"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR25"
FT                   /protein_id="ABM01940.1"
FT                   /translation="MKDVNEQLSAIVDNEFIDEKLIDELLINKDKQELFSRYHLIGDVM
FT                   RGDITDQFINFDISQQVMAKIEQPTKIAAVVELDTPTEKSKNNVISFVKRFGQYAIAAS
FT                   VAGVVVLASLVTSEPTFQNNSAGLEVLKTVPLGAANPVSLQTTKKQSQQEVKKHNDRLE
FT                   ALLNDHQLQLQTQP"
FT   gene            89413..90420
FT                   /locus_tag="Ping_0067"
FT   CDS_pept        89413..90420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0067"
FT                   /product="sigma E regulatory protein, MucB/RseB"
FT                   /note="PFAM: MucB/RseB family protein; KEGG: cps:CPS_4127
FT                   sigma-E factor regulatory protein RseB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01941"
FT                   /db_xref="InterPro:IPR005588"
FT                   /db_xref="InterPro:IPR033434"
FT                   /db_xref="InterPro:IPR033436"
FT                   /db_xref="InterPro:IPR038484"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR26"
FT                   /protein_id="ABM01941.1"
FT                   /translation="MKLLFYSKTLITAVFILIAGAAFSVQATEMSNDQTVKKDNITAIE
FT                   YLQLMQTAYKNLNYEILYLNNLKNTVEPKQLLHGVINQEEIAYFRYLNGAMRESLQYLQ
FT                   KISYFEQGSQPYTLQSTRNQSVFANIANFNYDKGLDSYEYIILGKGRIAGKTAMAIRMI
FT                   SKDQYRYSYIVWIDLDTHLPLRLDTINSSNIILDQIMVVSLKVSEQVNPWLESLSNQKL
FT                   PELFHLSQTSNLQASLWKVDWLPAGFNIVKDDQHKLVMYENEPVSYIMLNDGIVSVSVY
FT                   ISAKKTTSEQQQKTIQRGATVLYTDQKNNFEINVIGEIPVATAKRLIESISIVE"
FT   sig_peptide     89413..89496
FT                   /locus_tag="Ping_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.910 at
FT                   residue 28"
FT   gene            90424..90873
FT                   /gene="rseC"
FT                   /locus_tag="Ping_0068"
FT   CDS_pept        90424..90873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rseC"
FT                   /locus_tag="Ping_0068"
FT                   /product="positive regulator of sigma(E), RseC/MucC"
FT                   /note="PFAM: Positive regulator of sigma(E), RseC/MucC;
FT                   KEGG: shm:Shewmr7_2933 positive regulator of sigma E,
FT                   RseC/MucC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01942"
FT                   /db_xref="GOA:A1SR27"
FT                   /db_xref="InterPro:IPR007359"
FT                   /db_xref="InterPro:IPR026268"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR27"
FT                   /protein_id="ABM01942.1"
FT                   /translation="MVAEKGKIIAIEKSEGKTLAHIEYISKSACSSCQNNDTCGVGVVS
FT                   KTFSDKALQFTIPYAKEMEVDKFVELNISNNDLIKSAMLVYLVPLLFFITSALIAKQFN
FT                   ITNEAIIILIAISWAAAGFVITHFVTKKLYPQKSINQLISSKTIQ"
FT   gene            91410..92948
FT                   /locus_tag="Ping_R0006"
FT   rRNA            91410..92948
FT                   /locus_tag="Ping_R0006"
FT                   /product="16S ribosomal RNA"
FT   gene            93088..93163
FT                   /locus_tag="Ping_R0007"
FT                   /note="tRNA-Glu1"
FT   tRNA            93088..93163
FT                   /locus_tag="Ping_R0007"
FT                   /product="tRNA-Glu"
FT   gene            93714..96605
FT                   /locus_tag="Ping_R0008"
FT   rRNA            93714..96605
FT                   /locus_tag="Ping_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            96807..96922
FT                   /locus_tag="Ping_R0009"
FT   rRNA            96807..96922
FT                   /locus_tag="Ping_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            97662..98561
FT                   /locus_tag="Ping_0069"
FT   CDS_pept        97662..98561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0069"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sdn:Sden_3399 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01943"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR28"
FT                   /protein_id="ABM01943.1"
FT                   /translation="MINLTDTFCDVDDFCKAFIPEWEARLITNGEIKRRRVNRMSKAEI
FT                   MTIIISFHQSHYRDFKNYYLGYVAKYLKPYFPALLSYTRFIEVMPSVIIPLNTYLTTLF
FT                   GKPTGIAFIDSTKIAVCHIIRAKRNKVFNGTAKHGKGTMGWFFGFKLHLIVNHLGDILS
FT                   VKITEGNVDDRNPVPDMVGALSGKLYGDKGYLGKALASKLQEKGVELITNVRKNMKKGV
FT                   ISKWDKAMLSKRYLIETINDQVKNISYVEHTRHRSITGFVANMLGGLIAYCLQKDKPSI
FT                   NLTPNEKNVIIGENIIMA"
FT   gene            complement(98920..99183)
FT                   /locus_tag="Ping_0070"
FT   CDS_pept        complement(98920..99183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hso:HS_0309 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01944"
FT                   /db_xref="InterPro:IPR009383"
FT                   /db_xref="InterPro:IPR038134"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR29"
FT                   /protein_id="ABM01944.1"
FT                   /translation="MQSDRINKVIELLKPYWLKNKELSLIETLVRLTQESGFDKPLEKL
FT                   NDEVIIYHLKMDQIEANEMLPGIAKDCKDDFKTALLQARGLI"
FT   gene            complement(99340..100158)
FT                   /locus_tag="Ping_0071"
FT   CDS_pept        complement(99340..100158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0071"
FT                   /product="shikimate dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="KEGG: ppr:PBPRA3571 putative shikimate
FT                   5-dehydrogenase; TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding, N-terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01945"
FT                   /db_xref="GOA:A1SR30"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR30"
FT                   /protein_id="ABM01945.1"
FT                   /translation="MDNYAVFGNPIKQSKSPFIHTLFAQQTQEKIVYSAIEPATDDFKT
FT                   ALKDFFLEQGKGCNITAPFKEQAYQYAQQLTERAALAGAVNTLKLTDDGIIIGDNTDGA
FT                   GLVLDLKNNNVTLKGSRILLIGAGGAARGVCGPLLAEHPKELIIANRTFSKAQTLTTIF
FT                   TKLGNISACEFSELSGEFDLIINSTSASLHGEVPLIGTKLIRPETTIYDMMYSAQVTPF
FT                   NAWAKEQGAKFILDGLGMLVGQAAESFAIWRGVKPDAKQVLNELRHHLAT"
FT   gene            complement(100251..100826)
FT                   /locus_tag="Ping_0072"
FT   CDS_pept        complement(100251..100826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0072"
FT                   /product="translation factor SUA5"
FT                   /note="PFAM: SUA5/yciO/yrdC, N-terminal domain; KEGG:
FT                   vfi:VF2536 Sua5 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01946"
FT                   /db_xref="GOA:A1SR31"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR31"
FT                   /protein_id="ABM01946.1"
FT                   /translation="MLLLLKQSELNDALKILKSQGVIAYPTESVFGLGCDPDCEAAIQK
FT                   ILLLKQRPAYKGLILIAASIEQLEKYADFSLLTAAQLTVIKKTWPGPITWIVPSQKNLS
FT                   KLISGDFESVAVRVTAHPIVRQICLAFDKPIISTSANLSSLEAALSSQQVNKMFKSNTL
FT                   LNLVIDAPVSGLSTPTQIFHASTGKRLR"
FT   gene            complement(100832..101341)
FT                   /locus_tag="Ping_0073"
FT   CDS_pept        complement(100832..101341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0073"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: ppr:PBPRA3574 hypothetical
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; TIGRFAM: phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01947"
FT                   /db_xref="GOA:A1SR32"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR32"
FT                   /protein_id="ABM01947.1"
FT                   /translation="MTKPFVAILMGSDSDLPVMQGTIEILKSFSIAFEVKVTSAHRTPA
FT                   ATHAYVTDAENRGCKVFICAAGLAAHLAGAVAGITTRPIIGVPIDCGPLNGQDALLSTV
FT                   MMPAGVPVATVAIGSAGAKNAAYLAAQILAVADDELAKRVKENRAENAQAVIAKDAALQ
FT                   LKLASL"
FT   gene            complement(101393..101956)
FT                   /locus_tag="Ping_0074"
FT   CDS_pept        complement(101393..101956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0074"
FT                   /product="DNA topoisomerase, type IA, zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase, type IA, zn finger domain
FT                   protein; KEGG: pha:PSHAa0027 DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01948"
FT                   /db_xref="GOA:A1SR33"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR33"
FT                   /protein_id="ABM01948.1"
FT                   /translation="MPNSQEGLHSHHKKTKELCPECASELHIRNSKQGIFLGCSNYPEC
FT                   KYLRPLHEKSEIEKVLPGTRCALCGKEQVLKQGKYGLFIGCSAYPECSHTEQLSEKKEI
FT                   ADEKESVPCPSCKNGHLIKRHSRFGKIFYACDNYPSCKYAVNDKPVNQFCPDCHWPILV
FT                   ERKTASTFRIICPKKGCGYRGKPI"
FT   gene            complement(101958..102431)
FT                   /locus_tag="Ping_0075"
FT   CDS_pept        complement(101958..102431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0075"
FT                   /product="hypothetical protein DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   ilo:IL0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01949"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR34"
FT                   /protein_id="ABM01949.1"
FT                   /translation="MFEIIMYLFESYMQIDQSTEIDAQEITDELLEEGFQKNDISKALA
FT                   WLDNLTSLHEQNPESKTQLAKETSHRIYSAAEQHRISCDGQGFISYLNQADILNTHTQE
FT                   VVIDCVMSLDVDELTLSDLKWLILMVLFNDPNSEDAFMQLESMLLDFEDGLIH"
FT   gene            complement(102477..103535)
FT                   /locus_tag="Ping_0076"
FT   CDS_pept        complement(102477..103535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0076"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: pat:Patl_0025 DNA protecting protein
FT                   DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01950"
FT                   /db_xref="GOA:A1SR35"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR35"
FT                   /protein_id="ABM01950.1"
FT                   /translation="MVLDAIPTLHKRTLLKLLTYHSIEQLLQLSRNQLQAYGLKDNQIA
FT                   ALLKPNLKLIESNLSWLDNSPENHIICYDSPHYPQLLREISSPPLLLYLQGNIGLLSTP
FT                   QIAIVGSRNCTPYGQEKAYQFAQQLSTSGFTITSGLAIGIDGLAHQGAIDKQGHTVAVL
FT                   GTGLNNIYPKRHLKLAQQIKEKGLLVSEFWPNAAAFPANFPRRNRIISGLSLGVLVIEA
FT                   SKRSGSLITARYALEQNRDVFALPGSIDNAEAWGCHQLIQQGAKLVMNTQDICDEFSHL
FT                   CDPFSSSDGETTSLATPCHPLLKHIDFHLTTLEQLLNRSGFDVATLQNQLIELEITGRI
FT                   TVTTQGYIKLSN"
FT   gene            complement(103658..104740)
FT                   /locus_tag="Ping_0077"
FT   CDS_pept        complement(103658..104740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0077"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   sfr:Sfri_0025 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01951"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR36"
FT                   /protein_id="ABM01951.1"
FT                   /translation="MKLNLITAFLIGIVVSVVAIADTLTLKDNHPETYEVVKGDTLWDI
FT                   SAHFLNSPWLWPRLWQKNSQIKNPDLIYPGDILTLIWVDGEPQLSRKILKKLSPTPRLQ
FT                   EKQAAIPTIPLASISSFLSRDHIIDPALLTGAPRLLGDGKATPRFFEGDIFYGQGQYDK
FT                   GKLYGVYRLGEDYIDSVSKEFLGKQLIFIGLSEVSKNPNVSGTEQVTPHDFISSSREAR
FT                   QGDLILPIPEYETLPAYFLPQSVPKTMQGQIIAALNNSKAAGKWDIVVINKGQRDNVQI
FT                   GSMFSILRSGPGILINKNSVVYQKYASKLDQIGSPDIKIPAERIGELLVFRVYDKVSIA
FT                   MIMRSTEVIAPNYKIQGLAF"
FT   sig_peptide     complement(104675..104740)
FT                   /locus_tag="Ping_0077"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            104839..105342
FT                   /locus_tag="Ping_0078"
FT   CDS_pept        104839..105342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0078"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: vvy:VV3225 N-formylmethionyl-tRNA deformylase;
FT                   TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01952"
FT                   /db_xref="GOA:A1SR37"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR37"
FT                   /protein_id="ABM01952.1"
FT                   /translation="MALLEVLRFPDKRLRTIAKPVEQITVELKKTAENMIETMYEEEGV
FT                   GLAATQVNFHRRLVVIDVSEQRNQAMVIINPVIVEHSGEEISEEGCLSVPETNAEVKRA
FT                   EFVTLEYLDIEGKQQVLKADGLLAVCLQHEIDHLNGKLFIDYLSPLKQKRIKTKLEKLQ
FT                   RHNV"
FT   gene            105437..106387
FT                   /locus_tag="Ping_0079"
FT   CDS_pept        105437..106387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0079"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: she:Shewmr4_0028
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01953"
FT                   /db_xref="GOA:A1SR38"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR38"
FT                   /protein_id="ABM01953.1"
FT                   /translation="MEKLNIIFAGTPDFAAKHLSALINSEHNVIAVYTQPDRPAGRGKR
FT                   LTASAVKELAMEQQIPVYQPANFKEVDSTKQLAALNADLMIVVAYGLLLPQLVLGIPRL
FT                   GCLNVHGSLLPRWRGAAPIQRAIWAGDTETGVTIMQMDEGLDTGDMLAKVSCPIERDET
FT                   SASLYEKLALQAPDVLVDTINKLVKGELKAEKQDPQLACYAKKLSKSEALIDWSKDAVF
FT                   IERCIRAFNPWPVSYFVLDDKVIKVRQAGLLATKSEQTAGTIITASKNGIQVATGEGII
FT                   NLEVLQLAGKKALPVQDILNSRRELFAQGTLLQQG"
FT   gene            106392..107702
FT                   /locus_tag="Ping_0080"
FT   CDS_pept        106392..107702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0080"
FT                   /product="16S rRNA m(5)C-967 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: vch:VC0044 Sun protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01954"
FT                   /db_xref="GOA:A1SR39"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR39"
FT                   /protein_id="ABM01954.1"
FT                   /translation="MNVRALAAKILNQVVEQGQSLSNVLPPVQQDLSPKDKALLQVLCY
FT                   GVLRTLPRLDFFCRSLMDKALKGKQRDLHFLILVGFYQLLYTRIPSHAAVGETVNGAKE
FT                   LKKQALKGMVNGVLRNFLREQESLVEKANKQPALVYCHPSWLVKRLQAAYGDELAAQIM
FT                   HNNNQQAPMWLRVNALHHTRDQYQVLLNDAGLLSFSSEFNDNALRLEKPTDVYKLPGFT
FT                   EGWVSVQDGAAQLAAHYLDAQAGDLVLDACSAPGGKTVHVLELQKNIKQMVAVDADAKR
FT                   LLRVQENLDRLKLKASVIHGDASQPGSWWHGELFDRILCDAPCSATGVIRRHPDIRWLR
FT                   RESDIAGLVSLQKNILHALWDKLKPGGILLYATCSILPDENDLQIQDFLESRQDASLIP
FT                   LIVQDNLQNNIQNKGRQILPNEDAMDGFYYAKLQKSL"
FT   gene            107913..109289
FT                   /locus_tag="Ping_0081"
FT   CDS_pept        107913..109289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0081"
FT                   /product="potassium uptake protein with TrkA-N domain"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: vfi:VF2546 Trk system potassium uptake protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01955"
FT                   /db_xref="GOA:A1SR40"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR40"
FT                   /protein_id="ABM01955.1"
FT                   /translation="MKIIILGAGQVGASLAENLVGENNDITVVDLSPDNLQELQDRFDL
FT                   RVVQGSASSPVILAEAGAEDADMLIAVTNSDEVNMVACQIAFTLFNVPKKIARIRSQSF
FT                   IQYEKELFGSGAFPIDHVIAPEKLVSDYITQLIDYPGALQVANFANGKVNLMAIKAYYG
FT                   GSLVGNAISTLKQHMPNIEARVAAIFRRGKAIRPRGTTIIEADDEVFFISASQHIRAIM
FT                   SEMQKLEKPYKRIMIVGGGYIGESLAKRLEKDCSVKLIEKNLKRAEYLSETLSNTIVFC
FT                   GDSSDQELLTEEHIDQIDLFITVTNDDEANIMSAMLAKRMGARKVMVLIQRSAYLDLVQ
FT                   GGILDIAISPQQATLSALLTHVRKADLKHVYSLREGLAEAIEIIARGDSMTSKVVGREL
FT                   CQLKLPPGTSIGAIVRNETVLIAHDNTVLETDDHVILFLVNKKFISDIEKLFQPSPFFL
FT                   "
FT   gene            109302..110747
FT                   /gene="trkH"
FT                   /locus_tag="Ping_0082"
FT   CDS_pept        109302..110747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="Ping_0082"
FT                   /product="potassium uptake protein TrkH"
FT                   /note="PFAM: cation transporter; KEGG: vpa:VP3046 potassium
FT                   uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01956"
FT                   /db_xref="GOA:A1SR41"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR41"
FT                   /protein_id="ABM01956.1"
FT                   /translation="MVTRPLLFITGLVLSKMAIFMYPPMVFAFYNNTLGGVEFLSSIII
FT                   THLASALFIFMGKEKEFSRLGVREMFLLTTGVWVLASMFAALPFVLIEHINFSNAFFET
FT                   MSGITTTGSTVLNNLDTMHPSILLWRSILQWLGGVGFIVMGVAILPFLNVGGMRLFQTE
FT                   SSDWSDKAESKTRSVAIDILLVYIFLSVCCFVGYRLAGMGSFDAINHAMTTISTGGYST
FT                   SDRSMGNFSNAAHWNAIIFMFLGGLPFLLLIRAFNQHSLVTLFRDAQVLGFIKVVLFFT
FT                   LSLTAYLVFSDQFSPANALRLSLFNVVSVVTTTGFGLDDFISWGDFSLVVFWGLMFSGA
FT                   CSGSTSGGIKIFRFQIATSMLKRQLMILIHPRGIFPQRYNNRTVSDDILRSLIAFILAY
FT                   MGTIAVSTLLLALFGSTAIVALSASITAVSNVGPGLDPSIGPSGNFSALSDPSKWVLAI
FT                   GMLMGRLEILTVVVLFLPHFWRR"
FT   gene            complement(111015..112376)
FT                   /locus_tag="Ping_0083"
FT   CDS_pept        complement(111015..112376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0083"
FT                   /product="hypothetical protein DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   ssn:SSO_4007 putative alpha helix chain"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01957"
FT                   /db_xref="GOA:A1SR42"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR42"
FT                   /protein_id="ABM01957.1"
FT                   /translation="MLLSPLMLLVSSASLIFSLIIIFSWALLRLKKQRDHLFIEQKLTA
FT                   QELLHNQNINIEKSQTLLEKQSFIDSLQHQSNKLTVRLRETEVHLQSATQRLREQQENE
FT                   QKLSNQFELLSQRIFSEKSAQFKQLNQDSISQLLDPLKTQLDSFKKQVTDCYVNESKER
FT                   YNLQNEISNLAKLNELMQQETNNLTNALKGDNKQQGNWGEIILQRILESSGLREGHEYK
FT                   TQVSFQNDQGQRLQPDVVVQLPQNKNIIIDSKVSLVAYERFFNADDLQTQKEALQAHAL
FT                   SLRQHIKGLGKKNYQNLIGSNTLDYVLLFVAVEPAFITALEHDPELVKLALDNNVLLAS
FT                   PTNLMIALRTIDNLWRFEQQEQNGRLIAQQAGKLYDKLRLFSENMLDVGSQLNKAQNSY
FT                   DRALKQFSQGRGNLIQQAEQLKEMGVTVTKPLPETLVERTNLENSAFHAKNSQD"
FT   sig_peptide     complement(112296..112376)
FT                   /locus_tag="Ping_0083"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.926) with cleavage site probability 0.845 at
FT                   residue 27"
FT   gene            complement(112376..112630)
FT                   /locus_tag="Ping_0084"
FT   CDS_pept        complement(112376..112630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01958"
FT                   /db_xref="GOA:A1SR43"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR43"
FT                   /protein_id="ABM01958.1"
FT                   /translation="MLRSNFISFLLLSWKLSTVFIFPVIIYFYLILMTFYTDSFTFQQL
FT                   DQGSNIHKGVVVVVYIIYLLVWKSLNRKVKNYLKKFEYS"
FT   gene            113145..114980
FT                   /locus_tag="Ping_0085"
FT   CDS_pept        113145..114980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0085"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   ppr:PBPRA3599 putative glucosamine-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01959"
FT                   /db_xref="GOA:A1SR44"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR44"
FT                   /protein_id="ABM01959.1"
FT                   /translation="MCGIVGAVAQRDVSEILLEGLQRLEYRGYDSAGLAVISADGQLQR
FT                   TRRLGKVKELANAVAANPVSGGTGIAHTRWATHGEPSEANAHPHLSGDNIVIVHNGIIE
FT                   NYESLRETLRGRGYEFLSQTDTEVICHLVEWELRSAETLLEAVQKTLPQLEGAYGTVVM
FT                   DRRDPSRLVVARSGSPLVIGLGVGENFLASDQLALLNVTRRFIFLEEGDVAEITRRDIN
FT                   VFDLNGKAIEREVHESTIEQDAADKGKYRHFMQKEIFEQPSALINAMEGRISHDSVLVE
FT                   SIGVGAKDILKNVEHVQIIACGTSYNSGMAARYWFESLAGVSCDVEIASEFRYRDFVVR
FT                   PNSLLLTLSQSGETADTLAALRLAKQKGYMSAMSICNVSGSSLVRESDLAFMTRAGTEI
FT                   GVASTKAFTTQLAAMLILVTAIGKEQGTISKEKEAKIVRALHSLPAQIEKALAFDKPIE
FT                   ALAEDFADKEHTLFLGRGEFYPIAMEAALKLKEISYIHAEAYAAGELKHGPLALVDADM
FT                   PVVVVAPTNDLLEKVKSNIEEVRARGGQLYVFADESAGFESSEGMKIITLPSVDEIIAP
FT                   IFYTVPMQLLAYHVALIKGTDVDQPRNLAKAVTVE"
FT   gene            complement(115296..116246)
FT                   /locus_tag="Ping_0086"
FT   CDS_pept        complement(115296..116246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0086"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: ppr:PBPRB0059 putative transaldolase B;
FT                   TIGRFAM: transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01960"
FT                   /db_xref="GOA:A1SR45"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR45"
FT                   /protein_id="ABM01960.1"
FT                   /translation="MSNKLDQLRKFTTVVADTGDVEEIAKYQPEDATTNPSLILKAAQL
FT                   ADYKYLIDSSIAYAKSKSADKAQQIVDTCDMLAVNIGKEILKIVPGRISTEVDARLSYD
FT                   TEKSVLKARQLIKMYNDAGIKNDRILIKLASTWEGIRAGEILEKEGINCNLTLLFSFAQ
FT                   ARACAEAEVFLISPFVGRIMDWYKAKEGKSFAGVEDPGVISVSNIYNYYKEHGYKTVVM
FT                   GASFRNVDEILELAGCDRLTISPQLLQELKDSSGDVIEKLTEDVLLKASPEKMTHADFL
FT                   WQHNQDPMAVEKLAEGIRNFAVDQGKLETMIADLL"
FT   gene            complement(116597..117577)
FT                   /locus_tag="Ping_0087"
FT   CDS_pept        complement(116597..117577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0087"
FT                   /product="transcriptional regulator, sugar-binding domain
FT                   of SorC family protein"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   vfi:VFA0400 PTS system, mannitol-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01961"
FT                   /db_xref="GOA:A1SR46"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR46"
FT                   /protein_id="ABM01961.1"
FT                   /translation="MSQVKTTSTTPGIDDHEMLTEIAILYYQEGATQAEISKKFSISRI
FT                   KIGRLLRRAREEGVVEINVRYHPIYTAQLEKRLIKKFNLKRVLIALDQANNEEQRKQVA
FT                   GLVSAFLAINLQDDSTVAVGQGQNVAAVADHVGLVTQRKARFVCAIGGTHRSGDSINAD
FT                   HICRQLAKKFGGTSETLYAPAYVDNPETRNAFIAHNTVSETLKQARNADYALVGVGDMN
FT                   KNSHMIKLGWFTKQEFAEARINEGIIGDIGGFDFFKSNGQRANTRLRDRVIGLGTEDLR
FT                   RIPNVIAIASEERKSLALAGALRTGSIDILATSVSCAMTLLNMED"
FT   gene            118212..120098
FT                   /locus_tag="Ping_0088"
FT   CDS_pept        118212..120098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0088"
FT                   /product="PTS system D-mannitol-specific IIA component, Fru
FT                   family / PTS system D-mannitol-specific IIC component, Fru
FT                   family / PTS system D-mannitol-specific IIB component, Fru
FT                   family"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system, EIIA 2; phosphotransferase
FT                   system, EIIC; phosphotransferase system,
FT                   lactose/cellobiose-specific IIB subunit; KEGG: vpa:VP0370
FT                   PTS system, mannitol-specific IIABC component; TC
FT                   4.A.2.1.2; TC 4.A.2.1.2; TC 4.A.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01962"
FT                   /db_xref="GOA:A1SR47"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR47"
FT                   /protein_id="ABM01962.1"
FT                   /translation="MLSSQSKIKVQNFGRLLSNMVMPNIGAFIAWGLITALFIPTGWIP
FT                   NETLATMVGPMIKYMLPLLIGYTGGKIIAGERGAVVGAIATMGVIVGTDIPMFMGAMIV
FT                   GPLGGLAIKKFDAAIHGKVKSGFEMLVNNFSSGIIGMVLAIIAYVVIGPAVKMLSTALA
FT                   AGVDVLVVNNLLPLTSIFVEPAKILFLNNAINHGIFTPLGIAQSESLGQSVFFLIEANP
FT                   GPGLGLLLAYMVFGKGSAKETAPGAVIIHFFGGIHEIYFPYVLMNPRLILSVIAGGMTG
FT                   VFVLTLFDAGLISPASPGSIFAVLAMTPKGAYMGILLSVAAAAAVSFVVASILMKTQKT
FT                   VAGDEVALEEAANQMRDMKQSAKGQATGNDRVDMSAVKKIIVACDAGMGSSAMGASLLR
FT                   KKVQAANLNIEVINTAINDLPGDVDIVVTHKDLTDRARKHAPNAQHISLTNFLDNAMYD
FT                   NLVKDLKSAGNAPAANAPEGDAKKSEGPLKLTDKNIFLGLKPATKEEAIKFAGEQLIAL
FT                   NYVEPEYLQGMFDREKLVSTYLGESIAVPHGTIETKKHVLKTGIVFCQYPAGIQWGEDE
FT                   DDVAILVIGIAAQGDQHIHVITAITNALDDEEAIECLKTTVNKEDVLKILNN"
FT   gene            120193..121341
FT                   /locus_tag="Ping_0089"
FT   CDS_pept        120193..121341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0089"
FT                   /product="D-mannitol 1-phosphate 5-dehydrogenase"
FT                   /EC_number="1.1.1.17"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   ppr:PBPRB0362 putative mannitol-1-phosphate
FT                   5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01963"
FT                   /db_xref="GOA:A1SR48"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR48"
FT                   /protein_id="ABM01963.1"
FT                   /translation="MKAIHFGAGNIGRGFIGKVLSDAGIKVTFADVNKTVVNALIARNE
FT                   YDVNVVGADCVVEKVTNVTAVNSAGSEIVKLIAESDLVTTAVGPTVLNIIAKTIADAIE
FT                   LRLNSGNKFPLNIIACENMVRGTSQLKAQVFKYLPESLHVQSDQTIGFVDCAVDRIVPP
FT                   AEAGETDPLAVTVETFSEWIVDQTQFKGEIPTIKGMECTDNLMAFVERKLFTLNTGHLI
FT                   TAYLGVLAGYETIKESIEDEAIRSDVTAAMQESGEVLIRRYGFDPQAHAAYIQKILGRF
FT                   ANPYLRDEVDRVGRQPIRKLSANDRLIKPLNGTLEYGLPNGHLIKGIAAAFLYKNDQDP
FT                   QAVELQAMFAEKGLAATLAHYSGLAVDSETVKLVEQAYQSLK"
FT   gene            121396..121935
FT                   /locus_tag="Ping_0090"
FT   CDS_pept        121396..121935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0090"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: ppr:PBPRB0361
FT                   putative mannitol operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01964"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR49"
FT                   /protein_id="ABM01964.1"
FT                   /translation="MTKFARLKFDIDIVETLSEAETPYDFFTASFDLFEDAVDILIQNV
FT                   FRKDDYAVKYAVEPLLSRDGPLAHLPVRIKLLYGLGLLSQGSYQDIEKFIGLKEFVQSE
FT                   GESIEFLSLALIERLNAIRAVAKILPPNLGDNQLEESSHYIVQMKLEQNRQVIKSSLIL
FT                   AITEIIKELHRDTPLS"
FT   gene            complement(122411..123406)
FT                   /locus_tag="Ping_0091"
FT   CDS_pept        complement(122411..123406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0091"
FT                   /product="fermentative D-lactate dehydrogenase,
FT                   NAD-dependent"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: msu:MS2079 lactate
FT                   dehydrogenase and related dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01965"
FT                   /db_xref="GOA:A1SR50"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR50"
FT                   /protein_id="ABM01965.1"
FT                   /translation="MKVAMFSTRNYDIKHFDPLLAVQQESIQIKYFDTRLDIHTSQLAK
FT                   GYDAVCAFVNDDLAGPVLTELASLGIKLIVMRCAGFNNINLAVSKKLGLTIMRVPAYSP
FT                   EAVAEHAIALMMTLNRRIHKAYQRTRDANFSLDGLVGFNMFGKTMGVIGTGKIGLATMR
FT                   ILKGFGCEILAYDPYPSAQAIELGANYVSLTELFTRSDAITLHCPLTDDNYHLLNRESF
FT                   AQMKEGVMIINTSRGALINAKDSIDALKSKKIGALGLDVYEEEDSLFFDDHSNEIITDD
FT                   VFRRLSSCHNVIFTGHQAFLTREALTSIAQTTLDNLNCFASSKPNGNEVS"
FT   gene            123735..124835
FT                   /locus_tag="Ping_0092"
FT   CDS_pept        123735..124835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mag:amb2360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01966"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR51"
FT                   /protein_id="ABM01966.1"
FT                   /translation="MHLCFSITAHGFGHAAISCAVINQVKEKYPNIKITVLSLVSRVYL
FT                   QSRLTCEFELIPLGNDFGMLMVSPVEVDVQASALKYLSLYDNWQKAVEQEKLILEQIKP
FT                   DCLISNISPVSLDAAMQLNIPTASVAPFNWAQIYQAYCLKPEQPEINKAKSIFDKMVSI
FT                   YEKVDFIYKPLPSVPFTKEKEIQVASICDHPPLPSVPLLQKLPAGTDKIGLVALGGLPM
FT                   RLDLENWPHITGWHWLVDQNAGQLRDDMSQLTELPFSFLQLLSCSDLILTKPGYGTYCE
FT                   IAAIAKYQKVRVISIERPDWPETPFLNQFLSARVPFVEIKLSQLSNDSLTTVIKQLDRL
FT                   DYPRIQACEDGAVQLVIHLLGQLNNG"
FT   gene            complement(124919..126550)
FT                   /locus_tag="Ping_0093"
FT   CDS_pept        complement(124919..126550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0093"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   eci:UTI89_C3903 ATP phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01967"
FT                   /db_xref="GOA:A1SR52"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR52"
FT                   /protein_id="ABM01967.1"
FT                   /translation="MATTNTFSAETLSQYGITDIPEVIYNPSYDKLYEEEIAENLEGFE
FT                   KCTVTSNGTIAVDTGIFTGRSPKDKYIVKDDTTRDTVWWSDQGKNDNKAIDQGTWDYLK
FT                   KIVAKDLSTKQLFVVDAFCGANENSRLKVRFIMEVAWQAHFVTNMFIRPTQDELVDFEP
FT                   DFVVMNGSKTTNQEWKSHGLNSENFVAFNLTEKIQLIGGTWYGGEMKKGLFSVMNYLLP
FT                   LNGMASMHCSANVGEAGDTAIFFGLSGTGKTTLSTDPKRKLIGDDEHGWDDDGVFNFEG
FT                   GCYAKTVRLSEEAEPEIFNAIRRDALLENVVVGADGVVDYDDASKTENGRVSYPIYHIE
FT                   NIVKPVSKGGHAKKVIFLTADAFGVLPPVSKLTKAQAQYHFLSGFTAKLAGTERGITEP
FT                   TPTFSACFGAAFLLLHPTQYAEQLVKRMEASGAEAYLVNTGWNGSGKRISIKDTRAIID
FT                   SILNGSIEDAPTKTIPYFNLEVPLALPGARSDILDPRDTYATPAEWETKAEELSNLFIN
FT                   NFARYTDKAEGLALVSAGPQLTKLLV"
FT   gene            complement(126788..127648)
FT                   /locus_tag="Ping_0094"
FT   CDS_pept        complement(126788..127648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0094"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: eca:ECA4105 heat shock
FT                   protein (33 kDa chaperonin)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01968"
FT                   /db_xref="GOA:A1SR53"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR53"
FT                   /protein_id="ABM01968.1"
FT                   /translation="MNDQLQRFIFDAYQIRGEIAQAHNSFNDIIKKHDYSTEVANLVGE
FT                   LLIATSLITATLKFNGKITVQLQGDGPLNTAVINANQNLEIRGTANVTGDTTGLSFKQL
FT                   VGKGHLMITISPEEGERYQGIVALEKDSLSECLEDYFIKSEQLATRIILHASVKNKAQA
FT                   AGLLLQTLPAVDENHEADFQHVSALASTVKEEELYTLSNDELLYRLYHQEKVRLFEIQP
FT                   ISFKCSCSKERCLTSLASITADEILEMLNEQGSIDMHCEYCASDYHFEKDDLQILLHDE
FT                   QGLQH"
FT   gene            complement(127724..128128)
FT                   /locus_tag="Ping_0095"
FT   CDS_pept        complement(127724..128128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0095"
FT                   /product="heat shock protein Hsp15"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   vfi:VF2476 heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01969"
FT                   /db_xref="GOA:A1SR54"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR54"
FT                   /protein_id="ABM01969.1"
FT                   /translation="MTDKKIRLDKWLWAARFYKTRSTAREMIQGGKVRFNGQRAKASKI
FT                   VELGAVLSIRQGEMIKHVSVEILSEQRRGAPIAETLYKETSDSIKKREEHQILRKLSLQ
FT                   NAPHPNKKPDKKQRRELIQAKIERNTANFD"
FT   gene            128460..129293
FT                   /locus_tag="Ping_0096"
FT   CDS_pept        128460..129293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0096"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; PFAM:
FT                   PDZ/DHR/GLGF domain protein; KEGG: sfr:Sfri_0104 general
FT                   secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01970"
FT                   /db_xref="GOA:A1SR55"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR55"
FT                   /protein_id="ABM01970.1"
FT                   /translation="MPLSIFLQKLPNIVLLLLVALLAYQLALFTWSLLPVEKSAGQWAM
FT                   PEITGLNSANNIDSDKLKGLQLFGKTVAPAAKPKKRLLPETMSATKLNLTLAGVVAASD
FT                   PLYSSAIIANNGRQDSYFINSKIEGTSAFVYEIYEDHIVLDENGTYQILMLDGFDTANN
FT                   RSSKETPTQAPMKEIALDRSEILKDPSKLTNYINISPVREGSEIKGYRLTPGRDPALFE
FT                   QAGLENGDLVVELNGVDLTNMAESMSLMQEFPTMTEISLTVDREGQLYELYFSIP"
FT   sig_peptide     128460..128552
FT                   /locus_tag="Ping_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.844) with cleavage site probability 0.510 at
FT                   residue 31"
FT   gene            129387..131375
FT                   /locus_tag="Ping_0097"
FT   CDS_pept        129387..131375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0097"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: cps:CPS_4591 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01971"
FT                   /db_xref="GOA:A1SR56"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR56"
FT                   /protein_id="ABM01971.1"
FT                   /translation="MNLFMIQKKLSKQLIFSLLVLLICAINAGRVSATEYSASFKNADI
FT                   NEFINIVGKNLNKTIILDPSVRGSINVRSYDLLNERQYYQFFLNVLEVYGFATVEMENG
FT                   IVKVVKAKDAKTAAIPVVDDGTTYIGDQMVTRVVPVTNVSVRELAPLLRQLNDNAGGGN
FT                   VVHYDPSNVLMITGRAAVVNRLVEIVNRVDKAGDQEVDIIKLKYASALEMVKIVDAIQG
FT                   SSSGAKNISSSVLQPKLVADERTNSVIISGEPKSRSRIVKLIKSLDAELLNEGNTQVFY
FT                   LKYASAQEVVDVLKGVSKSIDSPQGNAAGQSGSAQGGLSIEAHEGTNAIVVSAQPALMS
FT                   SLTSIIRQLDIRRAQVLVEAIIVEVSEGDGINLNVQWGTTNGGTQFQDSAVTTGNIVAG
FT                   TQDNDAAISAIGNISGGIAGYIGSNWGVVLQALSSATTSNILATPSLTTLDNQEASFIV
FT                   GDEVPVLTGSTSSATNDNPFQTIERKEIGIKLKVTPQINEGDSVQMIIEQEVSDIKNDT
FT                   SAVDVIFSTRSVKTTVLAKSGETIVIGGLIDETVKETVQKVPLLGDIPLLGFLFRSTQS
FT                   STEKRNLMIFLRATIIRDDQTMMNLSTRKYSLIRAVQEKQRDTGINLMPNATPPILPEW
FT                   GQSYEINPDHFIKSESKIRKPTTEGVN"
FT   sig_peptide     129387..129488
FT                   /locus_tag="Ping_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.959 at
FT                   residue 34"
FT   gene            131375..132910
FT                   /locus_tag="Ping_0098"
FT   CDS_pept        131375..132910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0098"
FT                   /product="type II secretion system protein E (GspE)"
FT                   /note="KEGG: sfr:Sfri_0106 general secretory pathway
FT                   protein E; TIGRFAM: general secretory pathway protein E;
FT                   PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01972"
FT                   /db_xref="GOA:A1SR57"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR57"
FT                   /protein_id="ABM01972.1"
FT                   /translation="MITPEQDTLQVVAALNEAELIEVTPGGQLPFPFSKKHELVIFYEN
FT                   ENAQLCYKKAPSADLILEVRRAIGCEFTLKQVDNVLFEQLVTTAYQTSSSQAQQLMEDI
FT                   GSDDLFTLVDELPLDEDLLETQDDAPIIKLINAMLGEAIKEEASDIHIETFENSLVIRF
FT                   RIDGLLREILKPQRKLSNLLVSRIKVMAKLDIAEKRVPQDGRISVRIGGRAVDVRVSTM
FT                   PSSHGERVVLRLLDKNVIKLDLATLGMTEENHQLVRDLIHKPHGIILVTGPTGSGKSTT
FT                   LYASLLEINSKDRNILTVEDPIEYAIDGVGQTQVNTKVDMTFARGLRAILRQDPDVVMI
FT                   GEIRDLETAQIAVQASLTGHLVLSTLHTNSAVGAVTRLHDMGVEPFLLSSSLLGVLAQR
FT                   LVRRLCPECRQTHTTTAQEKQILGLQEKDNARIYKAKGCSQCNQTGYRGRTGIHELLIV
FT                   DEQVRELIHSGAGEQAVEKLIRQRTPSIRDDGLAKVLAGVTTLEEVLRVSRED"
FT   gene            132936..134126
FT                   /locus_tag="Ping_0099"
FT   CDS_pept        132936..134126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0099"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: shm:Shewmr7_0153
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01973"
FT                   /db_xref="GOA:A1SR58"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR58"
FT                   /protein_id="ABM01973.1"
FT                   /translation="MDDRGKLKKGTEEADSARLLRHQLRTAGLTPLEIEVVSNESPKKG
FT                   GSLFSKKIKTADLALITRQLSTLVASAIPLEECLHAVAEQCDKPNIKGMIVSVRGGVLE
FT                   GNSLADSMRAFPLIFDNLFCSMVAAGEKSGHLDQVLDRLADYAEQREEMKSKMTQALIY
FT                   PLILTLVAISVVAILLTSVVPQVVGQFEHMSADLPASTKFLIAASDGLNSYGLIIVILI
FT                   FASLFIFKRLLRKPANQLLFDQKLLKFPVVGRVANELNTARFARTLSILNSSAVPLLEA
FT                   LSIAGNVLSNQFIRLKVSEATERVREGTSLGQALDSTKLFPPMMLHMIKSGERSGEIGN
FT                   MLERSADNQDKQFAAQVTIALGIFEPALVISMAGIVLFIVMAILQPILQLNNMVSG"
FT   gene            134210..134644
FT                   /locus_tag="Ping_0100"
FT   CDS_pept        134210..134644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0100"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: sfr:Sfri_0108
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01974"
FT                   /db_xref="GOA:A1SR59"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR59"
FT                   /protein_id="ABM01974.1"
FT                   /translation="MKRNKNQQKGFTLLEIMVVIVILGILASLVVPNLMGNKDKADRQK
FT                   VVSDLVALENALDMYRLDNSYYPTTDQGLDALVEKPSGTPAPRNYREEGYIRRLPQDPW
FT                   GNDYILVSPGEQGRIDVFSVGRDGEEGTDDDIGNWNLDGK"
FT   gene            134713..135258
FT                   /locus_tag="Ping_0101"
FT   CDS_pept        134713..135258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0101"
FT                   /product="general secretion pathway protein H"
FT                   /note="KEGG: cps:CPS_4587 general secretion pathway protein
FT                   H"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01975"
FT                   /db_xref="GOA:A1SR60"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR60"
FT                   /protein_id="ABM01975.1"
FT                   /translation="MLVVLLIGLASLAVVMTFPNTLSTENNARWQAQRFATLLQLAEDE
FT                   ALISGNELGLVIEKNSYQFAVYDYSKQRWLAARVGEIEEKVELPELIRLEYSLSDSVWG
FT                   EISSSDQDSFIEESERVDIEDDNKLKTLNPPIYVMSSGEVSPFSLVFSKADNDPEKQSI
FT                   TVSVSMNGAISLTELSKE"
FT   sig_peptide     134713..134784
FT                   /locus_tag="Ping_0101"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.595 at
FT                   residue 24"
FT   gene            135255..135641
FT                   /locus_tag="Ping_0102"
FT   CDS_pept        135255..135641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0102"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG: eca:ECA3104
FT                   general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01976"
FT                   /db_xref="GOA:A1SR61"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR61"
FT                   /protein_id="ABM01976.1"
FT                   /translation="MKSERNSVMYKDSGMTLLEVLLALVILATAGLAVMNAASGALNSQ
FT                   AYLQDKTFALWIASNGLAELKLENEWPSNTWRSDQVDFAGSTWYSRYQGVVTVDDNFKA
FT                   LDIEVSDKKDGNALAYIRTYIVKP"
FT   sig_peptide     135255..135395
FT                   /locus_tag="Ping_0102"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.437 at
FT                   residue 47"
FT   gene            135628..136263
FT                   /locus_tag="Ping_0103"
FT   CDS_pept        135628..136263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0103"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; KEGG:
FT                   ppr:PBPRA3475 putative Type II secretory pathway, component
FT                   EpsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01977"
FT                   /db_xref="GOA:A1SR62"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR62"
FT                   /protein_id="ABM01977.1"
FT                   /translation="MSNPNRTDKKSIQGFTLLEVLIAIIIFAMMSLAAYQVLQGVLRSS
FT                   EISKTHSERLTELQRAMLIIEQDFTQIVARKSRQEGVDKEELRALTIGKGLFSSQDQGI
FT                   EFNRLGWTNPLNLLPRSNILRVRYILQDGQLQRLYFLYPDTVSGQQPEVQVLLKDIEQL
FT                   SFRVWSNGWKESWSPAETLPQGIEINFTSKYFANIRRVFLVSSGEVIE"
FT   sig_peptide     135628..135738
FT                   /locus_tag="Ping_0103"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.875) with cleavage site probability 0.302 at
FT                   residue 37"
FT   gene            136263..137246
FT                   /locus_tag="Ping_0104"
FT   CDS_pept        136263..137246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0104"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   vch:VC2726 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01978"
FT                   /db_xref="GOA:A1SR63"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR63"
FT                   /protein_id="ABM01978.1"
FT                   /translation="MASSYNKKQRGVALITVLMILAIMVTVAATMTGRLTMSLKRTEGL
FT                   IFSQKVYWYGQASAELGKKILDQNFSDSRVVSLDQLWAIPNMVFPLENGNIGGRMRDLR
FT                   SCFNVNALQSPDKEGTPAIPLRQFQNLLAALGVSEYGAQMIAESTRDWIDEDDSNDAAL
FT                   GAEDSFYQAKRVPHLTADNLMTDISELRSIQGVGPKTYEKIVPYLCAVPSRVQKINVNT
FT                   VDIEQAEILYALFKDELNISIDNLQNLLQNRPISGWANVDEFLAMPLFQGVSISAPLKT
FT                   QLSVTSDFFQLRGITEFADRLLAIDLTFQIKAQQAKVIRYQSGGLK"
FT   sig_peptide     136263..136349
FT                   /locus_tag="Ping_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.799 at
FT                   residue 29"
FT   gene            137299..138510
FT                   /locus_tag="Ping_0105"
FT   CDS_pept        137299..138510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0105"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: sfr:Sfri_0113 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01979"
FT                   /db_xref="GOA:A1SR64"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR64"
FT                   /protein_id="ABM01979.1"
FT                   /translation="MNERLIIRLASSASQKNYWLIWSDSENEIIASGEVDNAEQLSLLT
FT                   EKAFQRRVICLLPGVDICIKKVVIKGAFNRQMQQALPYLVEEELASDVEKLHFNVIAKE
FT                   THLVHVAICDKQKMYDWIDWLEKAQINCKQFIPEGLTLPLPEDGKWQAIKLGEQWLIRE
FT                   TANIAWSCDHSMLNTILESKLKNSADEDLVPRIESYSPVIEDSVAEWSSHDAMLPMELL
FT                   AIGTKNNPVNFLTAEFKPVKEVSPYIKKWRIPAAAGVLLFIVSVLNIYSHTLQVQAETE
FT                   LIQQQVETIYSQAFPRESKLRYARINYKLDTMLKELQGSSVEFDFLTVLDDLSPALMSL
FT                   KEFEISSLKFDSKKQELQLALTAPSFQAFETFAAELPEHLSAQQGALNNSKSGVSGVLT
FT                   IRKK"
FT   gene            138640..139122
FT                   /locus_tag="Ping_0106"
FT   CDS_pept        138640..139122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0106"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   ppr:PBPRA3472 putative general secretion pathway protein M"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01980"
FT                   /db_xref="GOA:A1SR65"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR65"
FT                   /protein_id="ABM01980.1"
FT                   /translation="MVERLNTWWESITEREQQLSLVSVLLILIAIIYWGIWQPLSIGLD
FT                   NSENQLQRAQQTLSTTQQRATLLVSAGVGQGSAVSENQNVTQIVTISAQQNGITFSRII
FT                   NRNEQVEVQVSNVEFDRFINWVSVLSSQYSVSVLNADISRADEEGYIKVTRLSLGY"
FT   gene            139160..139912
FT                   /locus_tag="Ping_0107"
FT   CDS_pept        139160..139912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0107"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   ppr:PBPRA3471 hypothetical general secretion pathway
FT                   protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01981"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR66"
FT                   /protein_id="ABM01981.1"
FT                   /translation="MKIKFIIFFVSFYLVALLATLPATALLRFIPQNTGLQIAGVSGSA
FT                   WQGEAALLSYNKKLNLQRVSWDVDWFALAALQIKLNVKFNNGQNAMSGKGFVKLGLSGL
FT                   AIENVLLDLSAQELLSYADLPIPVEASGDITLVIKEASQGEPYCDTLDGFFVWKNAGIN
FT                   SDLGKIDLTTMNINLSCDKGNAVAILQQESEQLSSNINILLQQGGAYRLVGTVKGSNKL
FT                   SPDINQALSFLGPKDASGATVVRFNGRL"
FT   sig_peptide     139160..139237
FT                   /locus_tag="Ping_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.954 at
FT                   residue 26"
FT   gene            140042..140671
FT                   /locus_tag="Ping_0108"
FT   CDS_pept        140042..140671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0108"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /note="KEGG: pat:Patl_4247 SOS-response transcriptional
FT                   repressor, LexA; TIGRFAM: LexA repressor; PFAM: peptidase
FT                   S24, S26A and S26B; LexA DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01982"
FT                   /db_xref="GOA:A1SR67"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR67"
FT                   /protein_id="ABM01982.1"
FT                   /translation="MKELTKRQNEVLDVIKDQILKTGMPPTRVELAKILGFRSANAAEE
FT                   HLKALARKGAIEILAGTSRGIRLLGEHQHNEKAHQDGLPLIGQVAAGEPILAQQHIETY
FT                   YDVDPALFHPSADFLLRVQGESMKDIGIMDGDLLAVHKTQDIKNGQVVIARVEDDVTVK
FT                   RFYREGRQVILKAENNDFGPIKIDLAYQSFDIEGIAVGVIRTADWM"
FT   gene            140766..141404
FT                   /locus_tag="Ping_0109"
FT   CDS_pept        140766..141404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0109"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; KEGG:
FT                   pat:Patl_4237 electron transport protein SCO1/SenC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01983"
FT                   /db_xref="GOA:A1SR68"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR68"
FT                   /protein_id="ABM01983.1"
FT                   /translation="MKKILLFIMPFFLLFFLLLGRAQFKNDLTQNESLILFKEGKSLID
FT                   FSFDVAGGEHFTNQDLQGKWTLFFIGYTFCPDICPTTLAHLDSVYPKLTAQPYDDIQIV
FT                   FVSVDPNRDKAEELAEYVHYFNSEFIGVTSTHKQLWPVVQNLGLIYSIVDQGVGDPYYL
FT                   VDHSASIVLINPKGEHHASFQATINAEGIFSVKMDLMVENIHQMYKNWH"
FT   sig_peptide     140766..140843
FT                   /locus_tag="Ping_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.972) with cleavage site probability 0.591 at
FT                   residue 26"
FT   gene            141500..142909
FT                   /locus_tag="Ping_0110"
FT   CDS_pept        141500..142909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0110"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: vfi:VF2440
FT                   Na(+) driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01984"
FT                   /db_xref="GOA:A1SR69"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR69"
FT                   /protein_id="ABM01984.1"
FT                   /translation="MSYAKRSLCLQLSIFIMIKSPLFNLTIHQKIFAIAFPMMISNISV
FT                   PLLGLVDTAVIGHMPESYYLAGVAVGSMIVTLIFWMLGFLRMSTTGLVAQAYGAGDHQQ
FT                   IIRLLLQAILVALLLAIAILLLQKPLIILALKFIEGSEQVLFYAQLYFNIRIWSAPAAL
FT                   INMALLGWLLGMQNAKVPMFLLIISNAINIGLDVLFVVFLDWGVAGVAWASLFADYISL
FT                   LCGLLLVKNHIKPFYKQGDLLKLSKQLSDLNSLKKFILLNRDIFIRTLCIQVTFAFMTI
FT                   QGVKLGDAVVSANLVLMHFLLLISFSMDGLAYAAEALVGKSIGTRCLIKLKESVYVTLF
FT                   WSVIFSLLQLLLFYVYGQWIIAQITSIESVQKEALSYLPWLVIIPITSVLGFIFDGIFI
FT                   GMTRAKEMRNSLIFSLLLVYFPVWFLFSEQGNHALWIAMNAFMLARGLSLAWIYRQLSK
FT                   KDQLIPKELKR"
FT   gene            complement(143052..143534)
FT                   /locus_tag="Ping_0111"
FT   CDS_pept        complement(143052..143534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0111"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   syn:slr1340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01985"
FT                   /db_xref="GOA:A1SR70"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR70"
FT                   /protein_id="ABM01985.1"
FT                   /translation="MFNIVQADLSHTEHAKAYLHLMSHYASDPMGGGQDLSNFAKQNLI
FT                   PTLLKRNDIFIVLIFSNNKPAALLTAIEGFSTFACKPLFNIHDVVVYQDFRGQGLTSLL
FT                   FKKIEEIAKLRDCCKITLEVLEGNTIAKNAYSKLGYSDYVLDPKCGSALFWTKSLY"
FT   gene            143670..144587
FT                   /locus_tag="Ping_0112"
FT   CDS_pept        143670..144587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0112"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="PFAM: homoserine O-succinyltransferase; KEGG:
FT                   vvy:VV1492 homoserine trans-succinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01986"
FT                   /db_xref="GOA:A1SR71"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR71"
FT                   /protein_id="ABM01986.1"
FT                   /translation="MPIRISDDLPAADILRSENIFTMSESRASLQNIRPLRVLILNLMP
FT                   KKIETETQIMRLLSNTPLQVNVELIRVDARASRNTPKEHLDKFYSDFDRVKNQKWDGFV
FT                   ITGAPLGQLPFEDVYYWEKFVEIVEWSRHNVTSTLFLCWAAQAALTYLYGLKKETRGDK
FT                   LSGIYLHRTHHHHHPLVRGFDDEFWAPLSRFAEFNSEVVSENSDLTIFADAPNAGIYLA
FT                   ASPDCRQVYVTGHPEYDASTLHNEYLRDLEEGLEPKQPVNYYPDNDQNKTPRAIWRSHG
FT                   NLLYSNWLNYCVYQVTPYDLADLI"
FT   gene            145732..149415
FT                   /locus_tag="Ping_0113"
FT   CDS_pept        145732..149415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0113"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; homocysteine S-methyltransferase;
FT                   Methionine synthase, B12-binding module, cap domain
FT                   protein; Vitamin B12 dependent methionine synthase,
FT                   activation region; cobalamin B12-binding domain protein;
FT                   KEGG: vfi:VF0337 B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01987"
FT                   /db_xref="GOA:A1SR72"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR72"
FT                   /protein_id="ABM01987.1"
FT                   /translation="MVVNDRSALIKAQLEKHILLIDGAMGTMIQSYKFEEEDYRGERFA
FT                   DWSCDVKGNNDLLVLSQPRVIADIHREYLDAGADILETNTFNATTIAMADYQMQSLSAE
FT                   INREAARLARQEADQKTAETPERPRFVAGVLGPTNRTCSISPDVNDPAFRNVSFDELVE
FT                   AYTESTRALIEGGCDLILIETIFDTLNAKAAVFAVSGVFDELGYKLPVMISGTITDASG
FT                   RTLTGQTTEAFYNSLRHIEPISFGLNCALGPEELRQYVQEISKISETYVSAHPNAGLPN
FT                   AFGEYDLEADEMAAHIKEWAESGFLNLVGGCCGTTPAHIKAMADAVAGVKPRALPEIEI
FT                   ACRLSGLEALTIRKDSLFQNVGERTNVTGSARFKRLIMDELYDQALEVALHQVTAGANI
FT                   IDINMDEAMLDSLYAMKRFLNLCASEPDISRVPIMIDSSKWEILEEGMKCVQGKGIVNS
FT                   ISMKEGVDNFIAQAKLIRRYGFAVIVMAFDEDGQADTRARKFDICKRSYDILVNQVGFP
FT                   PEDIIFDPNIFAVATGISDHNNYAVDFIEAVKDIKTNLPHVMISGGVSNVSFSFRGNNP
FT                   VREAIHAVFLYHCIQNGMDMGIVNAAQLAIYDDIPKELKEAVEAIILNTSPDATDNLLE
FT                   LAEKYRDSGSEKVDDGKSLEWRNLPVNERIAHSLVKGITEFIVEDTEEARVNAEMPIDV
FT                   IEGPLMDGMNIVGDLFGDGKMFLPQVVKSARVMKQAVAYLNPYIEETKAVGATNGKIVM
FT                   ATVKGDVHDIGKNIVGVILQCNNYEIIDLGVMVPTEKIIKTAIAEKADIIGLSGLITPS
FT                   LDEMVYVAKEMQRQGLKLPLLIGGATTSKAHTAVKIEQNYDQPVVYVSNASRAVGVCQK
FT                   LLNPVHKLEFVKKLDEDYVRVREQYANRRPRSAPVSLQRARANAAKIDWANYQPPVPNQ
FT                   LGVQVIKKMSIKILREYIDWTPFFLTWGLAGKYPRILEDEVVGEEAKRLFADALAMLDV
FT                   VEAQGEISASGMVGIFPANSVGDDIEIYTDQTRSKILQMSHHLRQQSEKKPPFVNHCLA
FT                   DYIAPKSLGIADYIGAFAVTGGIGEKEVAERYKAELDDYNAILVQAICDRLAEAFAEYL
FT                   HQKTRKEYWGFAANETLECDDLIREKYQGIRPAPGYAACPEHTEKQVIWDLMDVEQQIG
FT                   MQLTSSYAMFPGAAVSGWIFSHPESRYFAVAHIQQDQLEDYAGRKGWDLLTAERWLGPN
FT                   LS"
FT   gene            149908..153150
FT                   /locus_tag="Ping_0114"
FT   CDS_pept        149908..153150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0114"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   zinc finger, SWIM domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: shm:Shewmr7_2687 SNF2-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01988"
FT                   /db_xref="GOA:A1SR73"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR73"
FT                   /protein_id="ABM01988.1"
FT                   /translation="MPKITPQDISTSFGRNIIDRGTRYFKESRVLSCEYDEDKKQLHGS
FT                   VKGSSETPYQTSASIKPSNKGGFIIHSTCTCPVGWNCKHAVALLLAYQADTPNYNIENS
FT                   YQTWFELLQSQLSKKKSITAPSAYQGHFRLSFNKSAYNHSLLYLQVEYGSVRFLKSENA
FT                   NVFAAKDLISVVENESWMESYKWVQEEDVSILQLLLAKEGRVPKLEKTSMHTENDLLAL
FT                   HKILATGRCFWRNLNLPLQAGEKKPIQLEWVDEEDLKQLQVSLENTDNWLLIPTPTPFY
FT                   IDTDRGLVAEIDSVFDSGWILSLLKTPPLGEQQCVHFTEQVSLRFPQAVLPNPMVYQTR
FT                   EILDELQVVLSLNEKEIKGQKLFISRLYFRYGDLELNPGIVDEPDRTQFMCNNKIVTID
FT                   RDLNQERLALKHFEQLCLLDLSMYDPKQPDTDQLLGILPPELGGSQEFQWLSLLTAHKA
FT                   RLEVMGWRFEISSNLVLLSDQVNSIDIEVEEQGQWFDLGVSIEIEGKRIELLPLLLEWL
FT                   RNNEDWQQHRFDILLAQPNGRPLRIKRESIQPILSILQELGEVNNDNIHLPQSQAALLA
FT                   QLPEINSWVGGSHVKALAEKLSNFTGIQEVTLPEGLDATLRDYQHTGLNWLVFLNEYGF
FT                   SGVLADDMGLGKTIQTLAYILYKKQHQQLVHPALVICPTSLVGNWLNETTKFTPDLKVL
FT                   ILHGADRHKSFEYVPDYDLVITTYPLVGRDFTQLEAFQFSDLILDEAQTIKNPLAKMTK
FT                   SIKRLNAKQRLCLTGTPMENHLGELWSLFDFLMPGFLGSYATFNRFYRKGIEGEGNAQV
FT                   QSWLIQKTHPFLLRRTKDDVAKELPAKTEIIQNIVLPNDQRTLYESIRVTMEEKVRDLL
FT                   KEKGLARSRIEFLDALLKLRQACCDPRLVKLEHAKNIKSSAKLDYLMGVLPEMIEEGRR
FT                   ILIFSQFAQMLGLIEQSLLASDIDFVKLTGQTRNRSEVIDKFQNGNVPIFLISLKAGGV
FT                   GLNLTAADTVIHYDPWWNPAVENQATDRAYRIGQDKPVFVYKLICEHTVEERVLALQTR
FT                   KQKLADSVYGSEQEEKFVPDNSDTLLKLFERY"
FT   gene            complement(153210..154310)
FT                   /locus_tag="Ping_0115"
FT   CDS_pept        complement(153210..154310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0115"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: ferredoxin; MOSC domain containing protein;
FT                   MOSC domain protein beta barrel domain protein; KEGG:
FT                   vfi:VFA0264 oxidoreductase (iron-sulfur cluster
FT                   biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01989"
FT                   /db_xref="GOA:A1SR74"
FT                   /db_xref="InterPro:IPR000949"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR005303"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR74"
FT                   /protein_id="ABM01989.1"
FT                   /translation="MQTLTDIYIYPIKSVKAINQPAAKVEKAGLKFDRRYMLIDQQGQF
FT                   ITGRSYPQLTQIEVQFSKKTLIVNAPNMPSLTINPAHFGQQTKNAQLWSDNVNALHCHE
FT                   DYDQWFSAFLQKKCQLVFFAEETQRLVKNTNAPVSFADGYPLLLINQTSVEQLNARLTT
FT                   PVTALHFRPNIVVKGDFPFVEDSWSRIKIGEVEFEVSKPCSRCIFINVDPKTGIADQSE
FT                   PLLTLSKFRYSHGNIDFGQNLIPLNEGLIRAGDEVQVIIAQGARFYSAQDDQQENNKET
FT                   LAIHYQGSNVTTQGDNQQLLLDQAEQAGIDIPYSCRGGQCGSCKVKLIEGEVQVLNDEG
FT                   LSEEEIEQGYILACSCIPTSDISINH"
FT   gene            complement(154335..154793)
FT                   /locus_tag="Ping_0116"
FT   CDS_pept        complement(154335..154793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0116"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: stm:STM1076 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01990"
FT                   /db_xref="GOA:A1SR75"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR75"
FT                   /protein_id="ABM01990.1"
FT                   /translation="MQYITRELPKYKRIALVAHDHMKTELLNWSQRRINVLKDHQLYAT
FT                   GTTGSLLANKLGLPIECLLSGPMGGDLQLGAKIAEGEIDLLIFFWDPMNAVPHDPDVKA
FT                   LLRISAVWNIPVATNISTADFIIDSLHIGKSYTTRIPDYLGYMAERTE"
FT   gene            complement(155281..155697)
FT                   /locus_tag="Ping_0117"
FT   CDS_pept        complement(155281..155697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VP2940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01991"
FT                   /db_xref="GOA:A1SR76"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR76"
FT                   /protein_id="ABM01991.1"
FT                   /translation="MIYHAIFNVNISTYRRKHSMNQPIISLKWLVYTYIIGLSLSACYS
FT                   MLTKEPVPFSFFAFLTLFFSVNHFYGLYIKEPDNEISIRPAWVSFFIGIFSYSAFIGTQ
FT                   YPELGSNLFSVTLTLILTIWLIYKLMFGDKRYSA"
FT   gene            155863..157293
FT                   /locus_tag="Ping_0118"
FT   CDS_pept        155863..157293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0118"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   dimerization region"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; FAD dependent
FT                   oxidoreductase; KEGG: vpa:VP2942 pyridine
FT                   nucleotide-disulfide oxidoreductase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01992"
FT                   /db_xref="GOA:A1SR77"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR77"
FT                   /protein_id="ABM01992.1"
FT                   /translation="MSTVKDTTVKPKHDHYDAIVIGSGPGGEGAAMKLAKGGLRVAIVE
FT                   KYKDIGGGCTHWGTIPSKALRHSVSQLIELKKNPLFLTNYPQNKTFTFRDVLTHTQSVI
FT                   AKQVTMRSGFYNRNNCSLYFGGANFVDKNTVLITKDDGTTETITAKDIIIATGSRPYRP
FT                   ADIDFTAANIYDSDTILALDHHPQHIVIYGAGVVGCEYASIFNGLGVKTDLINTRDSLL
FT                   SFLDTEMSDALSYHFRNSGMILRHDEEYEKVESTEEGVVIHLKSGKKMKADCLLYANGR
FT                   TGNTDKLALENIDLKPDPRGQLTVNEHYQTGVDNIYGLGDIIGYPSLASAAYDQGRIAA
FT                   HFILTQEGKKKLIKDIPTGIYTIPEISSVGKTEQMLTQQKVPYEVGRALFKDLARSQIL
FT                   GSEVGSLKILFHRETKEILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVKTTFNYP
FT                   TMAEAYRVAALNGLNRLF"
FT   gene            complement(157390..157947)
FT                   /locus_tag="Ping_0119"
FT   CDS_pept        complement(157390..157947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0119"
FT                   /product="nucleotide phosphate derivative
FT                   pyrophosphohydrolase, MutT/nudix family protein"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: ilo:IL0323 NTP
FT                   pyrophosphohydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01993"
FT                   /db_xref="GOA:A1SR78"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR78"
FT                   /protein_id="ABM01993.1"
FT                   /translation="MSQSSPTLPQILKRSLVASSRFFKIEALQLKFSNGQQREFERMQG
FT                   YHKGAVLIVPFYDPQTLLLIREYAAGTHSYEIGFPKGLIDSGETAEQAANRELKEEIGF
FT                   GAKRLQKLKTVTMAPSYFSSEMTLFMAFDLYPEKLEGDEPEPLEVIKWPLNKVDELLAR
FT                   DDFQEARGISALLLTLKALNEA"
FT   gene            159129..160433
FT                   /locus_tag="Ping_0120"
FT   CDS_pept        159129..160433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0120"
FT                   /product="diverged AAA-family ATPase containing protein"
FT                   /note="KEGG: cac:CAC1437 diverged AAA-family ATPase
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01994"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR79"
FT                   /protein_id="ABM01994.1"
FT                   /translation="MQTNTHLALKKETYVIEEVLEEIQNQYFGSGNFNGMPIYRLADNF
FT                   DIESDGFRSAIRAGIENEIITATFHGNTHIRAFSGFKKEQLLEWFDSEKYPAHICLYPH
FT                   QNVLKGSKLLDKYKDSPYELELAKGAGQLDYRTFDLSVLEYYRNDPRYSYETDFIHGSI
FT                   SIESEYFESELVPESDQILLKTFGFAYDKDFGRYVAVFIRYLSDLSPEHQKVWAAKEIK
FT                   GDIKLHPDYYASSIQGSWGTKISIFQAFVEELELINKMSKLIGKPELFRNSYCAQRPVE
FT                   FGFLLRPTVSEFNDFVLLIDKMMSDNINKKFFEDDVPTESDEERDDGKIIVRAKGTIQI
FT                   LESWVNKYFHPQDPEPIDQMMMTFKKVRRLRQQPAHKVNTNVFDQGIFKKQRELVIDAY
FT                   DAVRTLRMILANHPNVKNNPPDINERLFKGEIWDI"
FT   gene            160558..161634
FT                   /locus_tag="Ping_0121"
FT   CDS_pept        160558..161634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0121"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: psb:Psyr_2649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01995"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR80"
FT                   /protein_id="ABM01995.1"
FT                   /translation="MNDGVGRNHLGELTINNIVLKSFDIVPNSFTDMQQMNESNKVKVR
FT                   LFNIQSNIIRNDERIELEMINSVKNETFLVVFGGWIPCAFIKSNTILYADRNVITEITT
FT                   RYKGGIKKSDKALDYFDSIFLHNKSVSIDISAFVIEANERKIPTNELINQQVASVKESL
FT                   KRALPNLKIANYPGGNSYYHDLKDLLEPIMKKRMAFLQEVTPKLNRQFTAKSRKEAVNV
FT                   VFKAAKKAQLSKNDLVIVLALLRVTMIGKKTAAQLVLKDAQNYTEDMAYNAVCDLSTIE
FT                   VLINMHNSHEKEDKSNYNVALITKDKGLSLFSALLSNTKINGSDGDNLQVTAKLTSSIF
FT                   GDDEDLLNTYEKWLKGEY"
FT   gene            161807..165100
FT                   /locus_tag="Ping_0122"
FT   CDS_pept        161807..165100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01996"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR81"
FT                   /protein_id="ABM01996.1"
FT                   /translation="MDLECLNINGCYMTEKSDSKFSPKSFLKSRRPERFSDSVIREVGR
FT                   LDRSALEHQLSTLNKRNMELAFEDFSKQLCEKIICPNLLEQTGPVAGGDGKVDTQTFPV
FT                   SEQAKVLWYLGLNEKSDEERWAFAVSTQENWKAKCRKDVRKIKATDRNYTKAFCVTNMY
FT                   AKANQRSDLEDSLSEETGIDVRILDISWILDQIFKNGYEKLAIDTLSIDIDWRREVEIG
FT                   ASDYSKNLRLQELKKDIREKVNTSKILPHQLDWILEEAVISKELEHPPIETQGLFDRAV
FT                   RASKRHGTKYHLFDAHYQYAWASYWWYEDMALYEENLLECIEIAKDLEQSGKWGDVVSL
FT                   LGLYSGYYRGNKEKFQNIVAPIQVEIQKILLKQSLRDERPSNSLMSRAYIELINLHAIE
FT                   NINEASDIFSSLLLVIKESGYLVGFPFNELYSLVTELDGVFGDIASYEALLDYFTEQAS
FT                   SRDGEAKGALLWLKRGTRRLESGEPYQAITLIGKSLAGLYKKETKKDLYAALNVLSQAY
FT                   QEVGLLWASRANLLLAASIVTDDYWRSGDLIVAQVYIYTRLAKIELQLGRLNYALAWWR
FT                   LACVIDANVEESVISERESQGFDGFLSQCFLNTNHERLNLFSKLPDLLDDYQLFVSRLM
FT                   LLHALGYEEVVENEYELNIDQEYLDYLKIVRDADLGALVPNLIVCEGRYSHLKGSVMGC
FT                   KIEISFPFRSPLVELAETLLSVIEGFFSTCIVGQAMVFESKLHIEITADDDDEIAVSHE
FT                   IDTSGSILKMEVLCSSFTPDMLNILGQNEIQKWLHHFVIEVFAHIMRPKNPEVTLESML
FT                   GNDKALERSVSFGACFVGLQNVMGNSAVNDIKELFLDKQLKDYTLKRPEPWDKDFPKES
FT                   AVNNSFSDYKPGKGEPPEGLIDNEKLSHKDMKVQSLIKVRLWDRTTWCGTGFAIYPNST
FT                   PELILLFKDEKAAQLIFDDLEIEVGKEDKSNRLKISIVRHIDKMSPAHYRVCISENHSF
FT                   DESKIIQMVARKNTMTPSTSDNLDRFLAAYKACNYFIMSYGIVENEVLLPPSSNNRKMI
FT                   KKFDITVVDAWEVGPNDIEIMAIDRNDNPIIPKGIENPPILEALKRKFV"
FT   gene            complement(165658..166902)
FT                   /pseudo
FT                   /locus_tag="Ping_0123"
FT   gene            167064..167435
FT                   /pseudo
FT                   /locus_tag="Ping_0124"
FT   gene            167753..168175
FT                   /locus_tag="Ping_0125"
FT   CDS_pept        167753..168175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0125"
FT                   /product="universal stress protein containing UspA domain"
FT                   /note="PFAM: UspA domain protein; KEGG: ppr:PBPRB0088
FT                   putative universal stress protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01997"
FT                   /db_xref="GOA:A1SR82"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR82"
FT                   /protein_id="ABM01997.1"
FT                   /translation="MSYKHILVAVDLSESSEKVINKAVSLAKDAKANLSLIFVDDIANI
FT                   GVVTIEVAPLPSVEEREKKLKGELQELADKADYQFDNIIVVTEDLKNKLVATVKKMNID
FT                   LLVCGHHRDFWSRLLSSVRKLINSVAADLLIVNLDE"
FT   gene            168596..168974
FT                   /pseudo
FT                   /locus_tag="Ping_0126"
FT   gene            complement(169056..169562)
FT                   /locus_tag="Ping_0127"
FT   CDS_pept        complement(169056..169562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01998"
FT                   /db_xref="GOA:A1SR83"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR83"
FT                   /protein_id="ABM01998.1"
FT                   /translation="MPELDFPQAIGLVAFSIGATAFLHKDGHKFRLHLTLFQIFLCSHF
FT                   ILMGAVTAAIGCGISALRSYVSTRTQSSHVMWFFIGLLWLMGLPNVEHSYEILTIFGAS
FT                   VATWALFKAQGIHMRLLILFNSFCWLTNNLLLGSIGGIMMEATFIMVNILTTYKMYRTS
FT                   KQLSA"
FT   gene            complement(169555..170247)
FT                   /locus_tag="Ping_0128"
FT   CDS_pept        complement(169555..170247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV7247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM01999"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR84"
FT                   /protein_id="ABM01999.1"
FT                   /translation="MNIAFLHTLKANEVLFKQYIDKYLKYLPVTVSHFTNERLLQNAIK
FT                   DGLTEQIATDVQQSITEISAGNADIIICTCSTIGDLAEKTPNISPQIIRVDRPMAEVAM
FT                   QHNTILVLAALSSTLTPTSELLHSVNTATKIDNHSDQATTQPKKLPVIHTELVPKAWSY
FT                   YAAGNTEMYARTIAAYINAITTKPGIVILAQASMAPAAQYCHKNTFEILTSPEMCLRYL
FT                   VKRVKLHA"
FT   gene            complement(170407..171033)
FT                   /locus_tag="Ping_0129"
FT   CDS_pept        complement(170407..171033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0129"
FT                   /product="2-keto-3-deoxy-phosphogluconate aldolase"
FT                   /EC_number="4.1.2.14"
FT                   /note="KEGG: ppr:PBPRB1883 putative
FT                   4-hydroxy-2-oxoglutarate
FT                   aldolase/2-deydro-3-deoxyphosphogluconate aldolase;
FT                   TIGRFAM: 2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase; PFAM: KDPG and
FT                   KHG aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02000"
FT                   /db_xref="GOA:A1SR85"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031337"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR85"
FT                   /protein_id="ABM02000.1"
FT                   /translation="MSNLVKQLAALKVIPVIALERAEDILLLGKALYDNGLPVAEITFR
FT                   SDAAVEAIRLLRRAYPDMLIGAGTVLNKAQAQAAKDAGATFIVSPGFNANTVRACQALD
FT                   IPIIPGVNNPSTVEAALEMGLKTVKFFPAEASGGINMLKSLLAPYTQIQIMPTGGINSA
FT                   NINDYLAIDRVIACGGSWMVDKKLIDNGQWDEIGRLTREAVELVK"
FT   gene            complement(171030..171998)
FT                   /locus_tag="Ping_0130"
FT   CDS_pept        complement(171030..171998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0130"
FT                   /product="2-keto-3-deoxygluconate kinase"
FT                   /EC_number="2.7.1.45"
FT                   /note="PFAM: PfkB domain protein; KEGG: ppr:PBPRB1882
FT                   hypothetical carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02001"
FT                   /db_xref="GOA:A1SR86"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR86"
FT                   /protein_id="ABM02001.1"
FT                   /translation="MKRLAIIGECMIELSGSPFGAMQQTYGGDSLNTAVYLARTAGKSV
FT                   NIDYVSALGTDAISEGMLNRWQAEGVNTRYVLKDVTRQPGLYLIQLDTQGERTFLYWRN
FT                   QSAARYLLQHNEFPLVADHLSEVDMVYVSGISLAILPAADRQQLVDLLQTLASKGVEIA
FT                   FDSNYRPALWQDAQEARDCYQQILTYTDLALVTDDDEATLWGDTSSQQIMLRLQKSGVK
FT                   QVVLKMGEIGCLYTDFNSETPELIKTTPVTNVIDTTSAGDSFNAGFLAGYLTDKSPRES
FT                   ALQGHQLAAIVIQHKGAIIPTSATESIDYNATNNSNKETTQ"
FT   gene            complement(171998..173431)
FT                   /locus_tag="Ping_0131"
FT   CDS_pept        complement(171998..173431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0131"
FT                   /product="D-glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: vvy:VVA1594
FT                   glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02002"
FT                   /db_xref="GOA:A1SR87"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR87"
FT                   /protein_id="ABM02002.1"
FT                   /translation="MESSMKAFLCEDFLLNNNVARRLYHDFAKDMPIYDYHCHLNAQEV
FT                   ADNRQFDNLGQMWLEGDHYKWRGMRTAGISESLITGKDTSDFEKYMAWAKTVPQTLGNP
FT                   LYHWTHLELRRPFGITGKLFNPDTAEVIWHECNEMLATPEFSARGIMKKMNVVMAGTTD
FT                   DPIHSLEHHKAIAEDPACDIEVAPSWRPDRAFKIEIEGFSEYMRLLGEVTDIEIGRFSD
FT                   LLSALEQRIEHFSAHGCRAADHGIEVVRYATVPVESTLDSILTRRLSQQTLTEQEIDQF
FT                   TTAVQIWLGTQYAKRGWVMQLHIGAQRNNNTRMFKLLGPDSGFDSIGDRPFALQLGALL
FT                   DAMDITNELPKTILYCLNPRDNEMLATMMGNYQGGGIAGKIQFGSGWWFNDQKDGMQRQ
FT                   MQQLSQLGLLSKFVGMLTDSRSFLSYTRHEYFRRILCNMVGQWVEDGEAPNDIAMLGKL
FT                   IQDVAFNNAKTYFKLPGEQ"
FT   gene            complement(173478..174941)
FT                   /locus_tag="Ping_0132"
FT   CDS_pept        complement(173478..174941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0132"
FT                   /product="fructuronate reductase"
FT                   /EC_number="1.1.1.57"
FT                   /note="PFAM: Mannitol dehydrogenase, C-terminal domain;
FT                   Mannitol dehydrogenase rossman, N-terminal domain; KEGG:
FT                   ppr:PBPRB1880 putative mannonate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02003"
FT                   /db_xref="GOA:A1SR88"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR88"
FT                   /protein_id="ABM02003.1"
FT                   /translation="MKNIANSEINAQVIRPNYNRTALNSRIVHLGFGAFHRAHQALFTS
FT                   EMLEETGSDWGICEINLFGGEELIKQLRAQDHLFSVAEKGADATLVKIAGSVVESLHPT
FT                   LDGQQAVLEKMAEEQVAIVSMTITEKGYCADPATGRLDANNALIKADLSHPAEPNSAIG
FT                   YIVEALRMRKERGIKPFTVMSCDNVQENGHVARASVLGFAALVDKDLAAWIEANVTFPS
FT                   TMVDRIVPAVTAETLSEIAALLGVNDPCGIACEPFRQWVIEDNFVNGRPEWNLVGAEFV
FT                   PDVVPFEEMKLRMLNGSHSFLAYLGYLGGYAHISDTMTNKDYRKAAFDMMMKAQAPSLK
FT                   MPEGADLEGYANLLIDRFTNPSLKHQTWQIAMDGSQKIPQRMGGSLRFHLANGSDYKWL
FT                   AMGIAGWMVYISGEDEKSQAIDVRDPMREQFQAIYKQHGKNNSVIKALLGIEAVFSTDL
FT                   IQNNEFVEQVTQAYQLIVTKGARAAVASL"
FT   gene            complement(175017..176324)
FT                   /locus_tag="Ping_0133"
FT   CDS_pept        complement(175017..176324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0133"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: ppr:PBPRB1879 C4-dicarboxylate
FT                   transport system, putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02004"
FT                   /db_xref="GOA:A1SR89"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR89"
FT                   /protein_id="ABM02004.1"
FT                   /translation="MEWQIILTLFGSFAVLLVIGVPVSFAIGLSSLATIMLSLPAGPAI
FT                   AVIAQRMASGLDSFALLAIPFFILAGNIMNQGGIATRLINLAKVLGGRLPGSLAHVNVI
FT                   ANMMFGSISGSAVASAAAVGGTMAPLQKKEGYDEHFSAAVNITSCPTGLLIPPSNTLIV
FT                   FSLVSGGTSIAALFLAGYIPGLIMGLSLMCVAGFISKRRGYPLAPRAPLSEVIDTTLKA
FT                   LPSLTLVIIIMGGIIAGIFTATEASAIAVVYTFLLAFVFYREAKLSELPKIILESAVTT
FT                   SIVLLLIGASMGMSWAMANGDIPYMIADALLAVSDDPLIILLIINVILLIIGIFMDMTP
FT                   AVLIFTPIFLPIALDLGIDPVHFGIMMTFNLAIGLCTPPVGSALFIGCSVAKISIDKVI
FT                   KPLLPFYAALIVALMAVTFIPELSLYLPRLFLGYGD"
FT   sig_peptide     complement(176244..176324)
FT                   /locus_tag="Ping_0133"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.914) with cleavage site probability 0.658 at
FT                   residue 27"
FT   gene            complement(176391..176882)
FT                   /gene="dctQ-4"
FT                   /locus_tag="Ping_0134"
FT   CDS_pept        complement(176391..176882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ-4"
FT                   /locus_tag="Ping_0134"
FT                   /product="tripartite ATP-independent periplasmic (TRAP)
FT                   C4-dicarboxylate transporter subunit DctQ"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: ppr:PBPRB1878 putative
FT                   small integral C4-dicarboxylate membrane transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02005"
FT                   /db_xref="GOA:A1SR90"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR90"
FT                   /protein_id="ABM02005.1"
FT                   /translation="MGKVITFINRGLAAFTIFLSTFLVFCVIWQVFSRYVIGEPSTVTD
FT                   ELARYLFMWVALIGAAYTSGAKRHLAIDLLTRKLTGKRKIINEIVIEIAISTFAIVVLV
FT                   YGGAGLALKTLSVGQVTPALGLQMGYVYFCLPISGLLMVFYSFVFAGGKIKELFSTSAQ
FT                   "
FT   gene            177167..178141
FT                   /locus_tag="Ping_0135"
FT   CDS_pept        177167..178141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0135"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: vpa:VPA1702 putative dicarboxylate-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02006"
FT                   /db_xref="GOA:A1SR91"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR91"
FT                   /protein_id="ABM02006.1"
FT                   /translation="MNIRKNILTTVIGTALFIGLSASSIAATTLKLSHNHNRDHAVHKA
FT                   MTAMATEVKAETKGEVIIRIYPDAQLGTQRESMELLQNGALDLVKSNAAELEAFSSDYS
FT                   AFNLPYLFRDKQHFYNVQEGAVGEDILEASRSSGFIGLTYYDAGARSFYAGKPINSPED
FT                   LKGLKVRVQPSPSAINMVTALGGNPTPLAYGELYTALQQGVVDAAENNIPSFSLSGHAE
FT                   VSKFMTLDEHTMVPDVLVISTKAFDAMTPENQKIVKQAALHSSQLMKTLWAESETKERT
FT                   KAEKMGVTFINPDKTPFMEAVQPIYQQLTPEITALVERIKAVK"
FT   sig_peptide     177167..177247
FT                   /locus_tag="Ping_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            178308..179492
FT                   /locus_tag="Ping_0136"
FT   CDS_pept        178308..179492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0136"
FT                   /product="D-mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="KEGG: ppr:PBPRB1874 putative D-mannonate
FT                   dehydratase; TIGRFAM: mannonate dehydratase; PFAM:
FT                   Mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02007"
FT                   /db_xref="GOA:A1SR92"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SR92"
FT                   /protein_id="ABM02007.1"
FT                   /translation="MEQTWRWYGPNDPVSLNDIRQAGATGIVNGLHDIPNGQVWGKKAI
FT                   LARKEIIEGSSLTWSVVESVPVHEEIKTRTGNYATWIENYKQTLINLAECGIDTVCYNF
FT                   MPVLDWTRTDLEFEMEDGSRALRFDQIAFAAFELHILKRPNAENDYSADEQLQAKVYFD
FT                   NMSEAQIAKLTANIIAGLPGAEEGYTLEEFQAQLDRYKDIDKETLRNNLAFFLKELMPI
FT                   CESYGLKLAIHPDDPPRPILGLPRVVSTIDDINWLTTQVPEKMNGITMCTGSYGVRGDN
FT                   DLVNMIKQHGDRIYFTHLRSTQREKNQKSFHEAAHLGGDVDMYNVVMELLREEQRREKS
FT                   GNIRLIPMRPDHGHQMLDDLKKKTNPGYSAIGRLKGLAEVRGLEVGLKRAFFNK"
FT   gene            179718..179915
FT                   /locus_tag="Ping_0137"
FT   CDS_pept        179718..179915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02008"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR93"
FT                   /protein_id="ABM02008.1"
FT                   /translation="MRNVTIDEIKVEGCKLGDLQIIETLMSLAIKKMLGEHELKLNCFL
FT                   KAVLAERHGLSELDQIEKQI"
FT   gene            180220..181026
FT                   /locus_tag="Ping_0138"
FT   CDS_pept        180220..181026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0138"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: vpa:VPA1701 putative transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02009"
FT                   /db_xref="GOA:A1SR94"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR94"
FT                   /protein_id="ABM02009.1"
FT                   /translation="MIVVGYANRWKIIMNAVVTPQKRLYQKIGQGLKDRIVSGEFVVGD
FT                   RLPPEREIAVQCQVSRSVVREALIMLELQDVVEVRKGSGVYIINQPKEDIDAKTGTSES
FT                   DDAGPFEMLQARQLLESHIAEFAATQVTRNDIFRLRKALQMERQQIEGASFDYDGDKMF
FT                   HMAIAEATQNKVLVDMVEDLWVRRQNSSMWLQLHARIVNQNYRKAWLEDHEKILLALQH
FT                   RDASAARDAMWQHLENVKQTLLELSDVDDPLFDGFLFSNNPVVSLA"
FT   gene            182140..184401
FT                   /locus_tag="Ping_0139"
FT   CDS_pept        182140..184401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0139"
FT                   /product="glycoside hydrolase, family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: bur:Bcep18194_C6710 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02010"
FT                   /db_xref="GOA:A1SR95"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR95"
FT                   /protein_id="ABM02010.1"
FT                   /translation="MKNKMNKVFSVTPIALAVFLAGCNNDVIETTQVVKAEFAQTKLDA
FT                   RGVDLISTDGYQFKDLNKNGILNVYEDWRKTVDERVGDLVSQMTLEEKVGMMLIDTMNA
FT                   AAYGSVNGTHVDYIEQQKMTRFIFRNAILPQNEVDALPIGERAPGGDIVTGRASASISP
FT                   SEAAQYMNIVQELSESTRLGIPALFKSNARNHNDPNARAGINVSAGAFSEWPKEAGLAA
FT                   TRDMELIGEFAQIMRTEWNAIGLRGMYGYMADLSTEPRWYRVHETFTEDSDLASEIMTV
FT                   LVSNLQGKEVTPSSVVLTMKHFPGGGPQFLGLDPHYMAGQHQSYPTGNFDYHVKPFKAA
FT                   IDAGVAALMPYYGIVGGGEWSLSNPDETNLDVGGIQLAEVVSDRVQDTVRVPYNGYSTT
FT                   EGTPAGNVGIAFSKGILSDLLRRDLGFSGVINSDTGIIGETNNGLSDTDTIQNNRAWGL
FT                   QDKDKSEQLVVAIEAGTDVFSGFHSNSEVRTLVEQGLVSEARIDESVKRLLKVQFELGL
FT                   FENPYVDPVRANAIVGNASFQEKALLAQRKAVVLLDNKVAEGAVEAILPLPAAANLYTM
FT                   GMDSGVVEGYGYTVTNGDLEGERPSAAESDYALIRVRVTNKDTGLLVFGGADFKEVDVL
FT                   DFTGMAAAGTWDITPSLTDIQAVMAEVGAENTVLSVYFRQPFVMDEASGLKDAGAILAT
FT                   FGSKDNALMDVVTGGFNPSGKLPFALANSSQAIIDQASDAPGYAEADTLYPFGFGLSYE
FT                   "
FT   sig_peptide     182140..182208
FT                   /locus_tag="Ping_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.865) with cleavage site probability 0.478 at
FT                   residue 23"
FT   gene            186170..186406
FT                   /pseudo
FT                   /locus_tag="Ping_0140"
FT   gene            complement(186414..187397)
FT                   /locus_tag="Ping_0141"
FT   CDS_pept        complement(186414..187397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0141"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   cbu:CBU_1544 transposase, IS30 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02011"
FT                   /db_xref="GOA:A1SR96"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR96"
FT                   /protein_id="ABM02011.1"
FT                   /translation="MGQKYSHLSLHERKLIFNWFHYRKMSIRKIGDLLSRSHTTISREV
FT                   KRNESQYYVPTYYPHSAQRYYAMRMRRRVTKGRLSNEGTKQYVINKLKIGWTPELISGR
FT                   LKLTGEEKYICHESIYQYIYKEAKELIIYLPRKHKRRRMKYPSRAYVAKTSLKTSILER
FT                   PEEIDNRSIPGHWESDSIESKGRKLALNVVVERVTRMSHITKLSSKKALATKNALIKKL
FT                   ANHPNDFVCSVTYDNGSENAGHLKVNEKLDCKSYFCQAYHSWEKGAVEQVNGLIRRFLP
FT                   KGTDFALVSHKRIGEIENILNSRPRKCLGYKTPFEIYNEICGALPS"
FT   gene            187432..189051
FT                   /locus_tag="Ping_0142"
FT   CDS_pept        187432..189051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0142"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: rfr:Rfer_4055 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02012"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR97"
FT                   /protein_id="ABM02012.1"
FT                   /translation="MVHFYVEQGFTRISGYSAEEVIGQTPKLFSSGRQDKVLYKAMWNS
FT                   INTTDAWEGEIWNRRKNGDTYLAHMTIASVRDTGKMISNYVATITDITLNKAASEKINN
FT                   LAYFDQITQLPNRLLLVDRLNLALAESAHSNHHGALLFIDLNQLKIINNTHGYSVGNLL
FT                   LKEVTARLTQIVRKADTIARLSGDEFVILLEKLSERDIEANTEIQNIAKKIIFLLTQPY
FT                   QLNMHKYRGTISIGATIFNGNEFASEKLLKQADIAMHQSRLAGHNRLCFFNQTMQEAIT
FT                   ARAEMEHELREAIEHNQFQLYYQIQVSSSGQALGAEALIRWQHPEDGYISPFNFIPLAE
FT                   ETGLILPIGEWVLNTACAQLKKWQKKPLTQDLVLAVNVSALQIHQEDFVEQLKSILQKH
FT                   EITPERLKLELTESMLVENVSGIITKINTLRKIGVLFSLDDFGTGYSSLQYLKKLPINQ
FT                   LKIDQSFVRDLLTDTNDRAIVRTIITMSHNLGINVIAEGVETVEQRQYLLSEGCMNYQG
FT                   YLFSKPVPIDEFEALIFRLSDT"
FT   gene            189571..189792
FT                   /locus_tag="Ping_0143"
FT   CDS_pept        189571..189792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02013"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR98"
FT                   /protein_id="ABM02013.1"
FT                   /translation="MTKHFLDNSNVIEFLCETANKFVEEKFGDDGYCVDEEGSGYTEEA
FT                   QEYFDDTYDKIEGDLNDMLGVYRIEDDE"
FT   gene            complement(189946..190098)
FT                   /pseudo
FT                   /locus_tag="Ping_0144"
FT   gene            complement(190162..191559)
FT                   /locus_tag="Ping_0145"
FT   CDS_pept        complement(190162..191559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0145"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   KEGG: sfr:Sfri_3418 type III restriction enzyme, res
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02014"
FT                   /db_xref="GOA:A1SR99"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SR99"
FT                   /protein_id="ABM02014.1"
FT                   /translation="MLRAWQQECLTTAKNHYLEISKHFLCLATPASGKTVLAAEVAGYL
FT                   FDTKQIDFVLCFSPSITVAEGIKNTFARRLNCNFDGVIGAIGCSYTYQNMRFFNEDNWK
FT                   IIKNNRVLVVFDEIHHCSGSSFDDANAWGQDIVQHIQEQAAYTLALTGTPWRSDLIPIA
FT                   LANYSDPDNKIQCDYTYSLQQAVDDGVCRNPKIVLIDNEEISVTTKEQETKVFNSLHDL
FT                   LKAPLISYQDLICHEVVIQYILQKGCNKLAEIRQFNQDAGGLIVASSVEHAQQILKMLT
FT                   EQFQQTAVIVTYKEPDAAERIKHFRFCNTEWIVSVGMVAEGTDIPRLQVCCHLSRVKTE
FT                   LYFRQVLGRILRVNEAVNQEAWLFTFAEEKLSIFAHRIDQELPDSNVLVRGNAIAKQFD
FT                   ITTANKKSASSSTDLKPPLMMSLFDDGAFSDNLNDAPSENKKNYTPAYLESFGGFREKL
FT                   IEAFSPI"
FT   gene            complement(191553..192122)
FT                   /locus_tag="Ping_0146"
FT   CDS_pept        complement(191553..192122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02015"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA0"
FT                   /protein_id="ABM02015.1"
FT                   /translation="MSQKVNMNVFLHSLLVIKQMNDFSVIAAKDALLHEHAEFTDSTEA
FT                   RKFIYRQLLRGVDKGLLKRTDLVDDGIKNVLYSKTEKFFASTIVPMKRGDKQKKSSSPK
FT                   IIKQAPKTINYKALLEKELMTYEIDLNASIEEVNEYKRLSSRFPELKEKLQQHQLQTKN
FT                   QSVQLLGKVHALQKLLGYTVTGYQPC"
FT   gene            192455..192679
FT                   /locus_tag="Ping_0147"
FT   CDS_pept        192455..192679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0147"
FT                   /product="predicted DNA-binding transcriptional regulator,
FT                   helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   vpa:VP1073 putative immunity repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02016"
FT                   /db_xref="GOA:A1SRA1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA1"
FT                   /protein_id="ABM02016.1"
FT                   /translation="MNTIGKKIREIRKQRGLTQEQLAAACCLLGFDLSRSTLAKVESQN
FT                   RQVTDYEIRYFAQALKVSEGDFFINSEQK"
FT   sig_peptide     192455..192574
FT                   /locus_tag="Ping_0147"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.660) with cleavage site probability 0.656 at
FT                   residue 40"
FT   gene            192831..193517
FT                   /pseudo
FT                   /locus_tag="Ping_0148"
FT   gene            193517..194719
FT                   /locus_tag="Ping_0149"
FT   CDS_pept        193517..194719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0149"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: mma:MM3142 type I
FT                   restriction-modification system specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02017"
FT                   /db_xref="GOA:A1SRA2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA2"
FT                   /protein_id="ABM02017.1"
FT                   /translation="MEWKTEKLGNVCEIIKRGIAPKYVDEGGICVINQKCIRDHTVNYS
FT                   LARRHNLIIKSVNEERYVQVGDVLINSTGTGTLGRVAQVRNMPIEPTTVDTHVTIVRPK
FT                   NGLFHNDFFGYMLIKIEEEITSAGEGASGQTELARTKLQNDFFVSYPDSIQEQKRIVVL
FT                   LDTVFADLEQTRTKTEQNLKNARELFDSYLQQLFSKKSEGWVEKTLSEIAHVGTGGTPL
FT                   KSTIGFWGGDIPWYSSGELNDTYTLASKNKITEVGLSGSNAKLFPKGSLLIGMYDTAAL
FT                   KMSILDRDGTFNQAVAGVKPNPKINLEFILHSINVIKPELLKLRRGVRQKNLNQSKIKN
FT                   IPIRLPTIAEQIKIVAEINDLEEKTNLLVNIYSQKITSIDELKKSILQKAFSGELSTVA
FT                   K"
FT   gene            194756..197338
FT                   /locus_tag="Ping_0150"
FT   CDS_pept        194756..197338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0150"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   protein of unknown function DUF450; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like; KEGG:
FT                   cch:Cag_0810 DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02018"
FT                   /db_xref="GOA:A1SRA3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA3"
FT                   /protein_id="ABM02018.1"
FT                   /translation="MNRNESETRADLISPKLALDGWGTTERSIIRREFGITAGRILGGG
FT                   KRASSLSSDYVLEFQGRKLAAVEAKRESLSYTEGVRQAKDYAQRLQCRFAYATNGHDIY
FT                   QIDMLTGFEQLVDNYLSPADMWRLCFEPVTGKTEPDYTATWRTRFAQIPFEFKGDWQPR
FT                   YYQENAINQALEAIALGKDRILLALATGTGKTCIAFQTAWKLFHSRWSLQAAKNPSNAK
FT                   KRPRILFLADRNILTKQAFNDFGAFGEDAVVRITPSEIKKAKGVPKNASIFMAIFQTLM
FT                   TDSASNPTNDSDEEELPEDEDYSLPIVTDTSNCNFRQYPEDFFDFIIIDECHRGGANDE
FT                   SSWRDILNYFAPAVQLGLTATPKRTDNVDSYKYFGEPVYSYTLKEGINDGFLTPFKVYP
FT                   IVGTMDEYQYTPGDAVTFKGEPEAGRVYKEGDFNRIITMPQREQKRVHYWMDHINPHDK
FT                   TIVFCGTQEHAGMVRDYINQYAVQKGWTTNPTYCVRITANDGAAGENDLRTFCDNEKTI
FT                   PTILTTSRKLSTGVDARNVRNIVLMRPCNNMIEFKQIIGRGTRLYDGKSFFTVYDFVKA
FT                   HHNFADPEWDGEPLPPKEKPDEQPCDICNVSPCICICEVCGFNPCNCKDDTPNEPCGEC
FT                   NQSPCQCLTEPCNNCGDTPCSCNTDDDDGNTGRPDKIFITLTDGKVRQIQHMKSVLFMG
FT                   ADGEMLTAKQFVEQLFGDLPRFFGNEDELRQIWSNPSTREKLLTDLYEAGYDDEKLDSM
FT                   KDIIDAKDSDVYDLLAFVAYAKDTHTRKERVATAKPGISSEFTYKQVEFIEFILDKYIE
FT                   DGVQELAAKKMRSLVELKYNTISDAAAEFGSPAAIRDTFIGFQKHLYQ"
FT   gene            complement(197542..198213)
FT                   /locus_tag="Ping_0151"
FT   CDS_pept        complement(197542..198213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0151"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pat:Patl_0139 HAD-superfamily hydrolase,
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02019"
FT                   /db_xref="GOA:A1SRA4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA4"
FT                   /protein_id="ABM02019.1"
FT                   /translation="MELNWNNIKTVLLDMDGTLLDLNFDSFFWREHLPMRYAEYHNLTL
FT                   VQAKSYLKNETNNVAGKIEWYCLDYWEEKLSLPITDLKREIEDKISLRPDTIPFLDALK
FT                   AAKKEVVLVTNAHPNSLSLKVEKTALDSHIDRLISTHQYGVTKESQTLWKKLQADLNFD
FT                   SESTLFVDDSLTILDSAKSFGIKYLLAVANPDSQRPPLQKEQLKGYPFITDYRHILADI
FT                   R"
FT   gene            complement(198292..198819)
FT                   /locus_tag="Ping_0152"
FT   CDS_pept        complement(198292..198819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02020"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA5"
FT                   /protein_id="ABM02020.1"
FT                   /translation="MMDDGYLEQFLDADELSNEPLEEVEKEKIPKWVSSENSSLNAYNA
FT                   LLLLNKKKKAYIKKHGLKSQYIIKSNYQIKKSEVARATGKTAQPLFHSTAYSESLLRFF
FT                   NQLNKQLEEAKEKRILTVKNGLQSRNKEDLVNEHKDLLKNHEETQLQTVDGVYQRLLDN
FT                   MSLDVKSKLGLI"
FT   gene            complement(198816..201569)
FT                   /locus_tag="Ping_0153"
FT   CDS_pept        complement(198816..201569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02021"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA6"
FT                   /protein_id="ABM02021.1"
FT                   /translation="MRETDLHAKTSAYQNFMDMLDDLLQQLSPINSVTITDDLWIFTDR
FT                   EKKISINFNHFNLPYTEFVREVSLSSKSDLIRVTTKEFAKLLWLSQHEDKVTYQSSIKI
FT                   LDVLSLLFSYLANKQITYIAESELEDFFTYLLSYNLNQEGLNLRFYPPAYRTRLHFLNI
FT                   KLLLQTLKIYGCPSLLPRLHYNKYKDAINNSCLNVLGITFSDYQKGGSFNFLGLDTGRH
FT                   YIDFCSQTFEEQISYATACRLTMSEMSTEVSRQMGYKYTDVIQLVCSEILMGIPSNEIR
FT                   GREIKKTSLPTLKGIVEIVHCLFFKHYYAVIQQNNAFKLDTINSIIVKLGLPENRFDNQ
FT                   EFVRSMLFARYYGKNGKSRLNIIKEFIASLRSTHPKLKPQWSESDFNGIVDSVTQTTPI
FT                   DINSVVSFFKEHHSMCDKLQRFNKITHTIGVRKLERALMNVESAGVTLFVALTGWRATE
FT                   FGFALNNIHISVNKDVLDSTYTPYQFHVKWIVPKTSKNTPLNREITLSGYLLATQLATL
FT                   NQSGINKPCLHSAMKKASINKVITNRVSRIWQGFIDYYSLFEELDELEKLIVLQKDTTL
FT                   SNHQQSELVKLSKNHNLQQSQTQALQGLRDQLREELPCYLLANQVNQQSFGKKLKGYRE
FT                   GSLKTEERALLEKYLSDDTKMSLKSGITLDQATVKHIKEEFLQRATHPTPHALRHIWAE
FT                   AVLRRYRGNVGRFIRANFKHLNDDFFMAYLRDKEMSAVYEISQRNVINDIVRQHLLALK
FT                   DDQRNYTGGFDSYLNKVVNITNIASNEDYIKMSQKISDRIGSIKPNPWVTCLLRSGTEE
FT                   RAKCSQNGIPQRRNASPKLCLGCINADITEGNYIGIVVYTSIDVAACRNPELPAFIKIQ
FT                   HLPVLQLAISQIKKLRNNSQDEKYNKFINHLQESIDIAQKTIDGAK"
FT   gene            complement(201571..203889)
FT                   /locus_tag="Ping_0154"
FT   CDS_pept        complement(201571..203889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02022"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA7"
FT                   /protein_id="ABM02022.1"
FT                   /translation="MDDTTRSDENDIKSQQIITEWNNNQGVIRPLFIPESTQFTIPAMR
FT                   KNVAKTVRLSDINCKYKKLIFSALYTAFYIIYFTDREAISNRVIYRRTVVSFIEYLNER
FT                   TITKNNRTRIFKDYEEFRVKKMGVKPQSTGLKSIRKFIYFSIAYEPFSNLLSAEQYKYL
FT                   GVLNKTKAAPSEKQESYTLTDWFSFHSWLRRDDIGIGNELFNRLASPKALSLSLRITAE
FT                   VALYSIQQAKYALIEFFKENNITTHQILIPMPAPKKADFSAEEFKDKRKRWLCYIYPHI
FT                   TEQLAYLQKTYKKSPCQNKYLGIAFEIILHSWCKSNSIGDSLARFHKEQYVERFIVDKD
FT                   KRNTDRFSITESWLFSHQFLYAISEYAHSEKKGILPVCKAEHLLFQWLMAYQSVQPSDI
FT                   AKLKLSDFNFLKRRNGIITHISSSYFKGRSQATHYLKDIKANSTMGKAVLSFINDNTAN
FT                   RKIDLGALTTSYNDGGMTTYQQGLLAPLISLLATSTINLDINHALQKHNTTSVFIEAFN
FT                   LIIRSGVDYEKYRVDQSRKSSTTTEASREKWQERCETYCNKNIFGLSAIKNSAIHARSD
FT                   SFSPTMMQNYNSHSNETEQKNYRTEASLQWLNSCGRVTRAVMQDMYINVFSPSKAQIQS
FT                   YNSEFTQAAELINSHKTDLLNRIKTITGQKSGRVDELGFIESNKVHHTELADVILLVDA
FT                   PETVMKFYHYEAEVSKKYKSLASKSPEFLLFTVLPMAEYVSTLLHEKKFSMESMKKGKA
FT                   LYLKYAAHLPPHFTSHLGM"
FT   gene            complement(203882..205105)
FT                   /locus_tag="Ping_0155"
FT   CDS_pept        complement(203882..205105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0155"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bca:BCE0986 Tn554-related, transposase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02023"
FT                   /db_xref="GOA:A1SRA8"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA8"
FT                   /protein_id="ABM02023.1"
FT                   /translation="MLSFSSIHHGCKLFTKDDLSPIVLPCFFSNFLTKNLIVYAINKNN
FT                   ILIENQIEKTTSTSILNRLEQFLHWLEFYSNQSEFVSIETHQNLPSELLNNYVNNILIE
FT                   ENSLGEASVKQSIQALTSYYNYLYHTGIIPYPKVLRIRPALRNTARSNTKKRTSVKYFT
FT                   PELRNILYHNTESIRDELLLRTGGECGLRSKENQGFLLNDFRIGTKTHKGLLSLFEDME
FT                   DNPEKSEFEYYLQGRFSKAKRHSGGSSRKVYIHSDLLRRFKEYYEMERPESDSDSFFLN
FT                   DSNSTRAKPIAAARATKIFNIVRNKVMLIQEKGLLPAYGQLLEKGHTHHILRHSFATDK
FT                   FYFFSKQWNIAIDNVTTTSQVYLAVAALLGHSGSSKSAPTTTKNYIRSCHIKESFEASE
FT                   EINDYRYG"
FT   gene            205197..205802
FT                   /locus_tag="Ping_0156"
FT   CDS_pept        205197..205802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0156"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pfo:Pfl_0283 HAD-superfamily hydrolase
FT                   subfamily IA, variant 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02024"
FT                   /db_xref="GOA:A1SRA9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRA9"
FT                   /protein_id="ABM02024.1"
FT                   /translation="MLDLHYDNHFWMEYVPSQYAKKAHISLAQAEHHMSAEYAKVAGSL
FT                   DWYCYDYWSATLGLDIHQLQYQTKHKIQLRSDTLWFLEYLKKLNKRVIMLTNAHRSGIA
FT                   LKMQQCEITHYFEAIVSSHDYQIAKENRTFWQKAAEQHGVDFKQSLFIDDNEKILQVAQ
FT                   QVGVAYLRGIKTPDSEKPAQEMQYFQSINLFSELLIQE"
FT   gene            complement(206186..208741)
FT                   /locus_tag="Ping_0157"
FT   CDS_pept        complement(206186..208741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0157"
FT                   /product="penicillin-binding protein, 1A family protein"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase, family 51; penicillin-binding
FT                   protein, transpeptidase; KEGG: ppr:PBPRA0274 putative
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02025"
FT                   /db_xref="GOA:A1SRB0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB0"
FT                   /protein_id="ABM02025.1"
FT                   /translation="MMQWIKRLVLFSIFTGLMGIGAIVAIYYHVKSDLPDVATITEIQL
FT                   QVPMKVYSIDGELLSQFGEKRRIPLTKEDIPEMLTNAFIAIEDSRFYQHFGIDPIGIIR
FT                   AATVWASTGSATQGASTITQQVARNFFLTRDKTFIRKIKEVFIAVQLEQILTKDEIMML
FT                   YLNKIALGQRAYGIGAAAQVYYGKNVSELTLAEMALLAGLPKAPSNLNPIASPKNAEMR
FT                   RNVVLYRMLSENYITQDQYETAKASPITATYHGAEITLSAHYVAEIARNKLIELYGSER
FT                   SYNEGFNVYTTINKIDQQAANKATLNNLHDYDKRHGYRGASKVLWQAPAENWSTKAIVS
FT                   SLNQTPDSGDLQPAVVVEVNKQAIKVITKNSQGALQEIDWDGLKWARPFITNSRQGTEP
FT                   KKASDIVAVGQQIWVREIAQKLELSQYPAVSAAFVSLNPQDGAITSMVGGFSFEQSKFN
FT                   RATQAQRQVGSNIKPFIYSAALDSGYTLATLVNDAPINEWAGSTAWRPKNSPEVYAGPI
FT                   RLRQALGQSKNVVSVRLVQDLGLTKVTNQLEKYGFERENLPQNNTIALGSASISPLNLA
FT                   TGYAIIANGGFKIEPYIIERIEDAYGSVIYQANPKIVCSYCAELYAQQGDNQQFIATQT
FT                   ELDKSANICPISPVSADQIASAVISAENAFLTRELLKTAIWGGGSWQHNSGWNGTGWRA
FT                   GRALERHDMGGKTGTTNGSKDAWFSGFAGNTVATSWVGFDDFNLDLGRTSYNNNLDKDQ
FT                   ATGGEYGARTAQPAWIEFMQETALSNPRVTVDTPSTISTVRIDRKSGLLTYETDHTTLF
FT                   EYFRADSVPTEYMNRTAVFKTEGNQDIPYNAPTSVDELF"
FT   sig_peptide     complement(208667..208741)
FT                   /locus_tag="Ping_0157"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.626) with cleavage site probability 0.369 at
FT                   residue 25"
FT   gene            208944..210008
FT                   /locus_tag="Ping_0158"
FT   CDS_pept        208944..210008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0158"
FT                   /product="type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   shm:Shewmr7_0242 type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02026"
FT                   /db_xref="GOA:A1SRB1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB1"
FT                   /protein_id="ABM02026.1"
FT                   /translation="MFKGLKKSNPSALIGIDFGSSAIKAIALSKRKGTFQIDAVAEIAV
FT                   EKGVIVDHRFENIAKLTEIIKQLCKKFPASYQNVAIAVSGADVITKVIPMNTNLNDQSL
FT                   EYQVEIEAENSIPFPLDEIFLDFEIIRINANNPDLKDVLVSAARKDTVLSQVHCIEEAG
FT                   LQVKIVDIASHTLARACNLLFSSDDFEKGIAVVDIGASEMTLNILHQGQVIFSRTKNHG
FT                   GAVCTQMIADRYGLKLDEAEKIKIEREWPIDCDIDVLAPFITMTVNHLRFDLRMFTNAP
FT                   KNIGVAKIMLTGGCQLLPGLAVQIQEQLDFETEIANPFLEFEYKNPSDKSLLHQFSTKY
FT                   MMALGLALRGQGNV"
FT   gene            210001..210558
FT                   /locus_tag="Ping_0159"
FT   CDS_pept        210001..210558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0159"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   sfr:Sfri_0371 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02027"
FT                   /db_xref="GOA:A1SRB2"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB2"
FT                   /protein_id="ABM02027.1"
FT                   /translation="MSNINLLPWRDELKKKKKKMFLIFLGLSSILILGVSYLGKLYVDA
FT                   LIGAQNQRNEYLQVQNTILDRRIADVRQIKKEKEELERRILLIQKLEEKRNYATHLFNI
FT                   LPQVVPTGIYLNSITFANEQVDVRGMSESNNRLAEMTRNIDNSGWLGEAYISSIISGPT
FT                   EPIKLSQFVMKFVVIPERKGGE"
FT   sig_peptide     210001..210120
FT                   /locus_tag="Ping_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.940) with cleavage site probability 0.451 at
FT                   residue 40"
FT   gene            210558..211130
FT                   /gene="pilO"
FT                   /locus_tag="Ping_0160"
FT   CDS_pept        210558..211130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="Ping_0160"
FT                   /product="type IV pilus biogenesis protein PilO"
FT                   /note="PFAM: Pilus assembly protein, PilO; KEGG:
FT                   sdn:Sden_0258 pilus assembly protein, PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02028"
FT                   /db_xref="GOA:A1SRB3"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB3"
FT                   /protein_id="ABM02028.1"
FT                   /translation="MDLNDLDFETVGSWPALHRVVFIACVCAVLSGVFFYFITMPQINN
FT                   LAKVEEKEIALKNEFKTKAALSSHLEEYRTQMVDIRLVFKGLLNRLPSSAEVASLLDDI
FT                   SFVGADNGLQFKSINWGIKTEGELSTEVPISIQVIGRYQDLGNFAADIAALPRIVILDN
FT                   LTLTKGEQGLMTLNVIAKTYRYKESQK"
FT   gene            211127..211651
FT                   /gene="pilP"
FT                   /locus_tag="Ping_0161"
FT   CDS_pept        211127..211651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="Ping_0161"
FT                   /product="type IV pilus biogenesis protein PilP"
FT                   /note="PFAM: Pilus assembly protein, PilQ; KEGG:
FT                   sfr:Sfri_0373 pilus assembly protein, PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02029"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB4"
FT                   /protein_id="ABM02029.1"
FT                   /translation="MRFFIILLMTFPLFSCVDADIDDLTRFVAETKTKNYPLDDKVPTF
FT                   KQINPLTFTQATGRNPFSEPTAEEVAIAVINAPKSCPQPNLNRKKQALEMYSLDNLTMR
FT                   GTVMVDQVLWGLVQVTGGELYKIKPGYYLGLNHGKVVNIAKDKIDLLELAVDRDGCWQE
FT                   RITKIMLSSSE"
FT   sig_peptide     211127..211186
FT                   /gene="pilP"
FT                   /locus_tag="Ping_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.931) with cleavage site probability 0.915 at
FT                   residue 20"
FT   gene            211679..213748
FT                   /locus_tag="Ping_0162"
FT   CDS_pept        211679..213748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0162"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   Secretin/TonB, short N-terminal domain; KEGG: sdn:Sden_0260
FT                   type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02030"
FT                   /db_xref="GOA:A1SRB5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB5"
FT                   /protein_id="ABM02030.1"
FT                   /translation="MNTSYLKTLFNIFPLVFLLYSPIGSAESQLGKLDINPLVDGKFEL
FT                   RFGFNESISGYQDKLYYRPNKLVIDIKDASSVLALNPIKIEKGGINNVATKRTEEGLRL
FT                   TITLDTLMPYRVVQENSLLFVRFGHTGADIAGSDKQELALASAVVQNSGSQTTKTATEK
FT                   VNASALSSNQTTPKGYVNSIHSLDFKRGLEGQGKLLVYLDNSSIAVDIRRRNNQLIAEF
FT                   QSTYIPDELLYIMDVVDFATAVEKVETFKEDGKTRLIFDIKDQYNYRYDQLDTLFMIEI
FT                   SEKLQDQKESAYQGKAISLNFQDIPVRTVLQLIADFNGFNLVITDSVSGNITLRLDDVP
FT                   WEQALDIILKVKGLGKSLDGNVLMIAPAVELAAKKREQLESENAVANLAPLYSEFIQVN
FT                   YAKVADISAMLSSDKTSLLSERGAVSVDNRTNTLLVKDTAAVIDAVKKMIQILDIPVRQ
FT                   VVIEARMVTVDDSVSEELGVKWGMTSTSSSTVDSLNVNLPATDAAGTIAFKLAKFSNGD
FT                   ILDLELSALESENKAEIIASPRITTANQQTAYIEQGTEIPYVESASSGATSVAFKKAVL
FT                   SLTVTPQITPDNKVILDLEITQDTVGETVSAGTGEAVAIDTQKIGTQVLVGNGETLVLG
FT                   GIYQQRNSIAVSKVPLLGDIPYLGALFRSTNEENTKSELLIFVTPRIVMQTKFR"
FT   sig_peptide     211679..211759
FT                   /locus_tag="Ping_0162"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.869) with cleavage site probability 0.771 at
FT                   residue 27"
FT   gene            213919..214434
FT                   /locus_tag="Ping_0163"
FT   CDS_pept        213919..214434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0163"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: vfi:VF2292 shikimate
FT                   kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02031"
FT                   /db_xref="GOA:A1SRB6"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRB6"
FT                   /protein_id="ABM02031.1"
FT                   /translation="MAEQRNIFLIGPMGAGKSTIGRHLAQMLHLDFLDSDAEIEKKTGA
FT                   DIAWVFDVEGEEGFRNREQSMIDELTQKHGIVLATGGGALIRPENRIHLSARGIVVYLK
FT                   TSVNKQLARTLKDKRRPLLQTDDPRTVLEALAEKRNEFYDEVADYTMETDEQSAKVVAS
FT                   QIIALLDF"
FT   gene            214434..215504
FT                   /locus_tag="Ping_0164"
FT   CDS_pept        214434..215504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0164"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   shm:Shewmr7_0248 3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02032"
FT                   /db_xref="GOA:A1SRB7"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRB7"
FT                   /protein_id="ABM02032.1"
FT                   /translation="MEKIVVALGKRSYPISIGEGLLTHAELFKSAIKGKRVMIVSNEIV
FT                   APLYLACCKETLIDFQIDEIILPDGEKFKNLHTFEIILTALLSNKHARDTTIIALGGGV
FT                   IGDMAGFAAACYQRGVPFIQVPTTVLSQVDSSVGGKTAVNHPLGKNMIGAFYQPQSVII
FT                   DIDCLKTLPAREFSAGMAEVIKYGILYDQAFFIWLEENVTAIKTLQPAAITYMIKRCCE
FT                   IKAEIVSLDEKEGGIRALLNLGHTFGHAIEAEQGYGNWLHGEAVASGMVLAAKTALNLG
FT                   LIESAQIEQIILLIKQFDLPVNAPENMHYDQFFDHMQLDKKVLDGKLRLILPTSIGRCE
FT                   IFDNVSETVLRSVIES"
FT   gene            215708..216643
FT                   /locus_tag="Ping_0165"
FT   CDS_pept        215708..216643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0165"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: vfi:VF2290
FT                   DamX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02033"
FT                   /db_xref="GOA:A1SRB8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB8"
FT                   /protein_id="ABM02033.1"
FT                   /translation="MSTNSGYDKQPSWVKENLSQLLLLLAMLMVVVSFTVYLFSSSLSE
FT                   LIDPVDPDAAQKRVVNKAPETVITENWYKDQQGPIENTTYKVGASDLSDQRVVISKEEL
FT                   IGLEQRYRIDLVDIEKEPLLDKIENQQPAENQLPTESQLPTESQNQQPTKMRPGNNDQP
FT                   NRSIIKMDDSSDSQIDVVNGEAELFSSLEKSDHFLKDAGQFNELNLILRPVESLLAKSP
FT                   SLFTLRLADMPTREKLQAFVVLHDLLKENIYVYRSIRNNKPWYVVLLGEYSSFSAAKIA
FT                   QQDLPDASSELRSQVFTYKEIQQDLQLKND"
FT   sig_peptide     215708..215830
FT                   /locus_tag="Ping_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.750) with cleavage site probability 0.415 at
FT                   residue 41"
FT   gene            216636..217463
FT                   /locus_tag="Ping_0166"
FT   CDS_pept        216636..217463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0166"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: vfi:VF2289 DNA adenine methylase; TIGRFAM: DNA
FT                   adenine methylase; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02034"
FT                   /db_xref="GOA:A1SRB9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRB9"
FT                   /protein_id="ABM02034.1"
FT                   /translation="MTKKNRAFLKWAGGKFTLTEQINQRLPEGRRLIEPFVGAGSVFLN
FT                   SNFDEYLLNDINPDLIEMYKIVKRKPKQFICDAKYYFQDAFNNEAIYYQLRSEFNNCKD
FT                   VYKRSLLFLYLNRFGYNGLCRYNKSGGFNVPFGRYKKPYFPEKELLIFSEKSKKATFTC
FT                   KPYQKLFQYLRDDDVLYCDPPYVALSKSASFTSYASDGFSLDDQANLAKLARESKCSVL
FT                   VSNHDTILTQELYRDAFCDKIQVSRTISSKSSTRQPVGELFALFDAQLSTRVK"
FT   gene            217676..218344
FT                   /locus_tag="Ping_0167"
FT   CDS_pept        217676..218344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0167"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; thiamine
FT                   monophosphate synthase; KEGG: sfr:Sfri_0381
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02035"
FT                   /db_xref="GOA:A1SRC0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC0"
FT                   /protein_id="ABM02035.1"
FT                   /translation="MTDYLIAPSILSADFARLGEDVEKVLDAGADVVHFDVMDNHYVPN
FT                   LTIGPMVCKALRDYGITAPIDVHLMVKPVDTMIVEFAKAGASIITFHPEASDHVDRSLQ
FT                   LIKEHGCKAGLVLNPATSLEVLTHVMDKLDVVLLMSVNPGFGGQSFIPHTLEKLRQVKK
FT                   LITTSGRDIRLQVDGGVKTDNIKEIAEAGADMFVSGSAIFNQPDYKVVIDKMRGELANI
FT                   "
FT   gene            218355..219356
FT                   /locus_tag="Ping_0168"
FT   CDS_pept        218355..219356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0168"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: pat:Patl_0658 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase, class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02036"
FT                   /db_xref="GOA:A1SRC1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC1"
FT                   /protein_id="ABM02036.1"
FT                   /translation="MTKPIVLSGCQPSGSLTIGNYMGALRQWVEMQKTHDCLFCLVDLH
FT                   AITVRQDPQALRKAIYDGLAMYQAVGIDPQKSTMFIQSQVTEHAELAWILNCYTQMGEL
FT                   NRMTQFKDKSQKNITNINVGLFSYPVLMAADILIYGPKHVPVGSDQKQHLELARDIAIR
FT                   FNNAYGDTFVVPEPAIPEHGARIMSLQEPTKKMSKSDDNVKNFIGLLEDPKKILKKIKS
FT                   AETDSDQQARIYFDPVEKPGISNLLTLLSCSTGKSIESLIPEYEDKMYGHLKSDTADAV
FT                   VNLLEPIQARFKELRKDETALQAIARAGAQKARVRAADTLAKVYDKVGFLPK"
FT   gene            complement(219431..219844)
FT                   /locus_tag="Ping_0169"
FT   CDS_pept        complement(219431..219844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0169"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: eca:ECA1929 lactoylglutathione lyase; TIGRFAM:
FT                   lactoylglutathione lyase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02037"
FT                   /db_xref="GOA:A1SRC2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC2"
FT                   /protein_id="ABM02037.1"
FT                   /translation="MRLLHTMLRVADLQKSIDFYSNILQMKLLRQSENADYKYTLAFLG
FT                   YGDESDTTVLELTYNWGTTEYDLGNAYGHIAIETDDIYATCEMIKKMGGQVTREAGPVK
FT                   GGTTVIAFVKDPDGYQIELINKKDAGKGLGAGS"
FT   gene            complement(219957..220394)
FT                   /locus_tag="Ping_0170"
FT   CDS_pept        complement(219957..220394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0170"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: vpa:VP0042
FT                   cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02038"
FT                   /db_xref="GOA:A1SRC3"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC3"
FT                   /protein_id="ABM02038.1"
FT                   /translation="MEFTVNLIKRITLLMGLTISLFSTAGFAQDLSEAAIAERIAPVGS
FT                   VYLDGEIMTAQQSPVSAEPAGPRSGEKIYNTYCMACHATGVLGSPKKGDAAAWAPRIAQ
FT                   GAEIMLKHAIEGYNSMPAKGTCGDCSEQEIASTIAFLTAGL"
FT   sig_peptide     complement(220308..220394)
FT                   /locus_tag="Ping_0170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(220480..221076)
FT                   /locus_tag="Ping_0171"
FT   CDS_pept        complement(220480..221076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0171"
FT                   /product="acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   ppr:PBPRA0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02039"
FT                   /db_xref="GOA:A1SRC4"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC4"
FT                   /protein_id="ABM02039.1"
FT                   /translation="MINLMTLIFILGTYLFGSLNGAILLCKVKGWPDPRAAGSKNPGAT
FT                   NMLRLHAAQAASAVLIFDLLKGTIPVYLAYFWGYSPIMIGVIAIAACLGHIFPVYFQFK
FT                   GGKAVATGLGTLLPLGMDLTGLLVLTWLFTIAVSGYASLAAIVVAIVAPFFVEQINPEY
FT                   TISVCMLSILILLRHIGNIRRIFSGKEKKIVNWKR"
FT   sig_peptide     complement(221011..221076)
FT                   /locus_tag="Ping_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.733 at
FT                   residue 22"
FT   gene            221202..221555
FT                   /locus_tag="Ping_0172"
FT   CDS_pept        221202..221555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0172"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG: vfi:VF2247
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02040"
FT                   /db_xref="GOA:A1SRC5"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC5"
FT                   /protein_id="ABM02040.1"
FT                   /translation="MDIIFIKQLEVISSIGVYDWEKSVQQKLYFDLEMAFDNKPAASSD
FT                   DIKLALNYFSVSEAVTKFAQTHQFELIETMAESVAALIMAEFAVPWVKVRLHKPGALPK
FT                   AQSLGVQIERGVR"
FT   gene            221555..222049
FT                   /locus_tag="Ping_0173"
FT   CDS_pept        221555..222049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0173"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
FT                   KEGG: pat:Patl_1045
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02041"
FT                   /db_xref="GOA:A1SRC6"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC6"
FT                   /protein_id="ABM02041.1"
FT                   /translation="MAAVFIGVGSSINRSENIRLGIAALQAEFGELLLSPLYESEAVGF
FT                   SGVNFYNLVVKLHTEQNIVELIKKLKGIEKQHGRPEKSSKFTPRTLDLDLLLYDQQIDP
FT                   DIDLPRGEILKNAFVLKPLSELAPTLRHPVLGETYQALWRNYPQQKQKLWKVSKQLPDH
FT                   Y"
FT   gene            222077..222880
FT                   /locus_tag="Ping_0174"
FT   CDS_pept        222077..222880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0174"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="2.7.1.66"
FT                   /note="KEGG: pha:PSHAa2300 undecaprenyl pyrophosphate
FT                   phosphatase; TIGRFAM: putative undecaprenol kinase; PFAM:
FT                   Bacitracin resistance protein BacA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02042"
FT                   /db_xref="GOA:A1SRC7"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRC7"
FT                   /protein_id="ABM02042.1"
FT                   /translation="MSELQIVVLALIQGLTEFLPISSSAHLILPSQLLGWQDQGLAFDL
FT                   ILNIGTLSAVLIYFRMEVINMSRAWVGSLRGKGETQDSRLAWWILWSTIPAALIGFFGK
FT                   SLVETYLRSGYVIAVTTTVFGLLLWWADANAKQVKTEYQTGLKGALFIGFAQVLALIPG
FT                   TSRSGITITAGLMLGLTRNGAARFSFLMSIPIIAMASGYDLLKFILSDEYVDWGPLFLG
FT                   AGISFVSAILCIHVFLILLNRVGMMPFVIYRLLLGGFLFYILSGT"
FT   gene            complement(223058..223783)
FT                   /locus_tag="Ping_0175"
FT   CDS_pept        complement(223058..223783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0175"
FT                   /product="conserved hypothetical protein 245"
FT                   /note="PFAM: conserved hypothetical protein 245; KEGG:
FT                   cps:CPS_4093 putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02043"
FT                   /db_xref="GOA:A1SRC8"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRC8"
FT                   /protein_id="ABM02043.1"
FT                   /translation="MSNSLTILPLHNLAIAFIPVFLVIVILFKWSLNGKFALYALSRML
FT                   VQLLLVGYFLNYLFAGANAWIVVLLLMLMVLFSSWIALGNIKELRLPLLKRTMISVAIG
FT                   GGFTLLIITQGVLTLQPWYQVQTMIPLAGMIFANCMNSVSLSAERFYAELSREADYINA
FT                   RKTAFHASMIPNINALFAVGLISLPGMMTGQILSGTSPFIAARYQIVVMCMVFASAGIS
FT                   SACFLVLNKNTIKNNSSIT"
FT   gene            complement(223829..225058)
FT                   /locus_tag="Ping_0176"
FT   CDS_pept        complement(223829..225058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0176"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: Polynucleotide adenylyltransferase region;
FT                   metal-dependent phosphohydrolase, HD sub domain; KEGG:
FT                   sfr:Sfri_2984 metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02044"
FT                   /db_xref="GOA:A1SRC9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR012006"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRC9"
FT                   /protein_id="ABM02044.1"
FT                   /translation="MQIFLVGGAVRDQLLQLKVKDRDYVVIAATPDKLLKLGFQQVGKD
FT                   FPVFIHPQTGDEYALARTERKKGSGHNGFECYAGLDVTLTEDLKRRDLTINAIAQSPQG
FT                   ELIDPYHGLQDIQTKTLRHISTAFSEDPLRVLRVARFAARFYDLGFKIAPETLDLMRSL
FT                   SSSGELNHLTAERVWQETANALKTNNPQIYFQVLRDCGALPLLFPEIEALFGVPAPKKW
FT                   HPEIDTGIHTLMVVEQSVKLSDSLAFRFACLVHDLGKALTPKELWPSHKGHGKLGLQLI
FT                   NNLCERLKIPNECRELACLVSEHHTLIHKGLELEADSLITLMDQNDAWRKPERFSQMLQ
FT                   CCVADSKGRTGFEEKDYPSADYIWRAFQVAQLVDVQPIIKQGYQGAEIKAQLKHARIRS
FT                   VEQYKQKHSV"
FT   gene            225135..226889
FT                   /locus_tag="Ping_0177"
FT   CDS_pept        225135..226889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0177"
FT                   /product="General secretion pathway ATPase protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; SMART:
FT                   AAA ATPase; KEGG: sdn:Sden_2822 peptidoglycan-binding
FT                   domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02045"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD0"
FT                   /protein_id="ABM02045.1"
FT                   /translation="MYQDFFSLKEQPFSISPDPDFLFLSNRHQEAIAHLQYGVQGNGGF
FT                   VLLTGEVGTGKTTVCRKLLQEIGATTDIAFILNPALTDIELLATVCDEFHIDYEKDKIS
FT                   LKLLFDSLTAWMMNNHHQGRSAIVLIDEAQHLSFSVLEQLRLLTNIESNNKKPLQVILI
FT                   GQTELQQKLKQPELRQLAQRISARYHLMPLTEQESVYYIQHRLNVAGVSFPIFEHRAVR
FT                   EVFKRSQGVPRLINLLCDRSLLCAYTQNSLKVTVLMVKKASDEMALSPPQTLFNAIFKS
FT                   SWRFIALSLLAVFTAFQAPELLNRFKEVKAQPAELIIPAIAATLGESLPELIVPPEEHI
FT                   TPLPENIVPPEELIAPPAEYTVPTELEQATEVGVLQKNESPDWFDNYELLDISNATFAN
FT                   ALLNLYAVWGYQVDPETVNCEQGKSVLLSCYSENTSLKKLKQLNYPSVVRLERDNLESL
FT                   HAVLYAINDSYQLLIDGQVIEVSETWFNTYWSGELTVLWQAPFELQGNLKFGQQSEQIA
FT                   WLARQLNKLQGMPIESKNRFDLPLLQQVMRFQIENGLKDDGIVGERTLIPLMQIVNSQL
FT                   PRLQQEVN"
FT   gene            226889..227716
FT                   /locus_tag="Ping_0178"
FT   CDS_pept        226889..227716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0178"
FT                   /product="General secretion pathway protein B"
FT                   /note="KEGG: ilo:IL1964 general secretion pathway protein
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02046"
FT                   /db_xref="GOA:A1SRD1"
FT                   /db_xref="InterPro:IPR032389"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD1"
FT                   /protein_id="ABM02046.1"
FT                   /translation="MSTILAALQKQKSSPGAHFIQQPEVEKGLFKWRVTLLISLLVIIS
FT                   LLSVLLYLQLNGETNGIKIKQSIVLDKVVDVLEVDSDIMEVDSNIIKVDSDIIEVTPPA
FT                   VNEVPIKIIKKAPKAVKEMTFVTQPLPEVEKPEPPIKLVPDESTTDAANLTSELDYSAV
FT                   SNELQQRFEFALADSKKQNKLSPIELSHDGRDLYEMAGNFQQKVPSIRYDTHIYSSIVE
FT                   ERWIKINGNKLKEGQFDPQGKIQLLEIQPNRSIFRLDRQSFSLESLTDWKVNR"
FT   gene            complement(227769..228338)
FT                   /locus_tag="Ping_0179"
FT   CDS_pept        complement(227769..228338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0179"
FT                   /product="SH3, type 3 domain protein"
FT                   /note="PFAM: SH3, type 3 domain protein; SMART: SH3 domain
FT                   protein domain protein; KEGG: eca:ECA3587 putative membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02047"
FT                   /db_xref="GOA:A1SRD2"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR016476"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD2"
FT                   /protein_id="ABM02047.1"
FT                   /translation="MLCMNATAETRYVSDDIFIYMHSGPSREYRIIGTLDVGSPVTTLT
FT                   YNKKTGFYQVKTANGKTAWVKGDQLQTTLPAKNLLPAIQKELQEAQIKLQNIDQKNSEI
FT                   LNQQKQSIIDKDNLIAALENEKNSLQENIIELKATNLELDLLQDTKDERVKMEWMLYGG
FT                   SVLFFGLLCGLLIPSLPRRKKNNNNW"
FT   gene            complement(228782..230047)
FT                   /locus_tag="Ping_0180"
FT   CDS_pept        complement(228782..230047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0180"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: pat:Patl_3319
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02048"
FT                   /db_xref="GOA:A1SRD3"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD3"
FT                   /protein_id="ABM02048.1"
FT                   /translation="MDILTSYGSILVLFAGAVGFLMAWGIGANDVANAMGTSVGSKALT
FT                   IKQAIIIAMIFEFAGAYLAGGEVTSTIRKGIIDASFYVDQPELLVFGMTSALLAAGVWL
FT                   MIASYFGWPVSTTHSIVGAIVGFSAVGVGVDSVVWIKVTGIIGSWVITPLISGIIAYMI
FT                   FMSSQKLIFDTQDPIKNAKRYVPFYMFLAGFLLSLVTITKGLSHVGLHFTTFEAFALAT
FT                   IVGISVAAIGKIFINRIKIDPKADKKMHFANVEKIFAVLMVVTACAMAFAHGSNDVANA
FT                   IGPLAAVVSIVENNGQIAAKAALAWWILPLGGLGIVLGLAIFGRRVMATIGTGITHLTP
FT                   SRGFAAELAAAATVVIASGTGLPISTTQTLVGAVLGVGMARGIAALNLGVVRNIVISWV
FT                   VTLPIGAGLSIIFFYMMKAIFS"
FT   sig_peptide     complement(229976..230047)
FT                   /locus_tag="Ping_0180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.882) with cleavage site probability 0.609 at
FT                   residue 24"
FT   gene            complement(230064..230744)
FT                   /locus_tag="Ping_0181"
FT   CDS_pept        complement(230064..230744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0181"
FT                   /product="hypothetical protein DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   sfr:Sfri_0565 protein of unknown function DUF47"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02049"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD4"
FT                   /protein_id="ABM02049.1"
FT                   /translation="MPINSIFGVFAKSPIKPILTHIDKVAACSELLIPFFKASNEQDWI
FT                   KAEEIRKELSMLEKKADALKRKLHLRLPKGLFMPIARGDLIELAIRQDKIANTAKDIAG
FT                   RILGRKLQIPHEIEKNFMVYLQRCLDAVQQAQKAINELDELLETGFKGREVDIVTKMLA
FT                   ELDAIEDDTDSLQIKLRADLFAVEQHYNAVDVMFLYQILEWVGRLADHSESIGDQLELM
FT                   IARS"
FT   gene            230918..232426
FT                   /locus_tag="Ping_0182"
FT   CDS_pept        230918..232426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0182"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: vvy:VV0577
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02050"
FT                   /db_xref="GOA:A1SRD5"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD5"
FT                   /protein_id="ABM02050.1"
FT                   /translation="METEIEIKFFFNSEFALELDEKVNFHHVISSKRQLLHNVYFDTDK
FT                   RSLRKMGMGLRIRSFDQKSEQTIKTAGRVIGGLHQRPEYNEPIEGLHPELAKFQRKIWP
FT                   ADCDIKQLENELLPIFSTDFNRQTWVIEMPEETLIEVAYDSGFIETDLGKEEICEVELE
FT                   LLKGDENQLFVLGEKIVELPQVRLGNISKAQRGYMLAEGIDFKAKALAPSPLIKSMSVE
FT                   QALLINLQHGLQHTQYHEHCYLDSFDDAALYQLLQGIKFLHQNLKLFKNVVPQILNADW
FT                   VGELHWLARSFSCFDERFILQNMLEDKGFYIRKLPDFKSLIKKLEKQYNEQPDRQAIKD
FT                   ILTSTRYCQFVLKFTKWLIQFEKEPFFSQKTSSIESFATDSLEAGWRELKLASHHQQFS
FT                   IVQLLSYQGLLESNLLLGLCLGNLFPAQKSNTFHSSWLDIKQGIKELAMVNIVAEYAEF
FT                   ETDKRLQAEYLKWVTRKQNSLLHALQQSKQQAMLKKSYWQNGTN"
FT   gene            complement(232541..232882)
FT                   /locus_tag="Ping_0183"
FT   CDS_pept        complement(232541..232882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_4193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02051"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD6"
FT                   /protein_id="ABM02051.1"
FT                   /translation="MVKGELPKKWQQSANVAKAVQIAFDMDTQLQYSIRRSALDKGISP
FT                   SEQIRYLLALPTNKKPKRPRLTVSLSDQDYQQLGERYQIPADQQLEIKKSVIEELTHFA
FT                   QQSEYDKPK"
FT   gene            complement(232885..233532)
FT                   /locus_tag="Ping_0184"
FT   CDS_pept        complement(232885..233532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0857 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02052"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD7"
FT                   /protein_id="ABM02052.1"
FT                   /translation="MSFFKSLFAKKQPLPTRSLNHPSELQAGDIFSFGDSFALPKAMRK
FT                   QQLEVSEINTIEFKHEHYIQVVGRGMHPQPVYISFPKNPQKLIKYSLLLTRKDVGELFD
FT                   LEDFSNIFEAPGNACLKPVTFEHPYAELVAAQYIQQDFMTTGYFHQEDYRDSTPPQFNE
FT                   ERHGREFEFYSLAGDQEQRFIEIFIFENGDTDVYLSFLRPANEITELWIKGE"
FT   gene            complement(233944..234627)
FT                   /locus_tag="Ping_0185"
FT   CDS_pept        complement(233944..234627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0185"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: cps:CPS_4191
FT                   PspA/IM30 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02053"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD8"
FT                   /protein_id="ABM02053.1"
FT                   /translation="MSIFKKIITALRGGVRETGEAIVDANSTRIFEQEIRDSEKHVTIA
FT                   KRDLTEVMAKQMQAARELAQLQESIKEHEGYAMQALNQGNEALAIEVAEKIAELENSAA
FT                   DQQQTNESYLKSADRLKVLIKKSERQLTDYKRQLSMVKTTQSVQKATSAITDNFVASNS
FT                   KLLSAKDSLERIKQKQTLFDDKLKAAEQLESENSDTSLKSKLQGAGIGAQQSNAQSILA
FT                   RLKTK"
FT   gene            complement(234643..235056)
FT                   /locus_tag="Ping_0186"
FT   CDS_pept        complement(234643..235056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0859 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02054"
FT                   /db_xref="InterPro:IPR019231"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRD9"
FT                   /protein_id="ABM02054.1"
FT                   /translation="MNIHNIATHLNQLDDNSETGFNFDCTPIKGEIDVLQVEVIGREEI
FT                   PIFISISDNQILCIAYLWGENEVKPELRGNMMEAMLEMNIPMPLSSFAKVEDKYVLNGA
FT                   LSINSTLDDIELEIVTLSDNSLEVINEMSSYLN"
FT   gene            235412..238252
FT                   /locus_tag="Ping_0187"
FT   CDS_pept        235412..238252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0187"
FT                   /product="fused deadenylyltransferase and
FT                   adenylyltransferase for glutamine synthetase"
FT                   /EC_number="2.7.7.42"
FT                   /note="PFAM: glutamate-ammonia ligase adenylyltransferase;
FT                   KEGG: ppr:PBPRA0448 putative glutamate-ammonia-ligase
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02055"
FT                   /db_xref="GOA:A1SRE0"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRE0"
FT                   /protein_id="ABM02055.1"
FT                   /translation="MSLLNDAALHHFENLNNRIDLNSLKLSQHTELMKVLGLSDFVAES
FT                   LIKQPALLTDLLDNELLSLADRKEVITTELESAIAKVKDEVTLHRVLRLFRRKHMVVIA
FT                   WRELLGKAHLVESLDHISYLADQLILQCMSWLYKKQCVEQGIPMNNEGVRQPFFIFAMG
FT                   KLGGKELNFSSDIDLIFTYPERGETQGERRRIDNQSFFTKLGQRIIGALHQTTVDGFVY
FT                   RVDMRLRPFGESGPLITNFASIEDYYQSHGRDWERYAMIKARVMGEEGDYKTTLEALLK
FT                   PFVYRRYIDFSAIESLRKMKAMISSEVRRKGLKDNIKLGKGGIREIEFVAQAFQLIRGG
FT                   RRAELQCKGLRETLKVLAEIGEVPKERVQSLLDAYHFLRAVENVLQQIGDKQTQTLPDN
FT                   ELDKLRLITVMGYSNWQDFYSKLNQEMDNVHAEFNWVIGDDEEAHDEADQALSELWALH
FT                   LSQQEATHLLHEKGLDESLAAHFATALSALKEELKKRPIGPRGQATLDKLMPRMIELIC
FT                   VYPDPVELLNRITQLLLKIISRTAYLELLNENDGALKQLLKLCNESTRVASQLARHPIL
FT                   LDELLDPQQLYKPTQLDNYRTELQLFMLRIPEEDMEQQMEALRQFKQIQFLYIAAADIE
FT                   KSIQLPQVSDHLTYLSEAIMDYVVQIAWLQMVDKFGLPSNVIGSDRKGFAVIGYGKMGG
FT                   IELGYGSDLDVVFLHDDNIKGETNGRRKIDNQLFYFRLAQRIIHLFSARTNSGILYEID
FT                   MRLRPSGDSGILVSSVASYKKYLQNNAWTWEHQALVRARAVFFDKLILAKFNEARETVL
FT                   SQARNNSALATEIRDMRAKMRKHLSREKEGQFDLKQSPGGMVDIEFFAQYLVLAHACHC
FT                   GEELCKWSDNLRIFETCRKLGLLTLDEEKKLTGAYCALRDATHRLTLNKKTRIIKGDQF
FT                   IQERQNVIKIWEKFLD"
FT   gene            complement(238361..239281)
FT                   /locus_tag="Ping_0188"
FT   CDS_pept        complement(238361..239281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0188"
FT                   /product="lipid A biosynthesis lauroyl (or palmitoleoyl)
FT                   acyltransferase"
FT                   /note="TIGRFAM: lipid A biosynthesis lauroyl (or
FT                   palmitoleoyl) acyltransferase; PFAM: lipid A biosynthesis
FT                   acyltransferase; KEGG: yps:YPTB2490 lipid A biosynthesis
FT                   lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02056"
FT                   /db_xref="GOA:A1SRE1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE1"
FT                   /protein_id="ABM02056.1"
FT                   /translation="MSSYKLQLNFCHPKYWLTWLGILLLFLSSFLPYGHLLAIGKFLGQ
FT                   ITARMAKSRYKIAYRNIELCFPNLSPSEITTKVQTNFENTGIAILEIGMAWFWPSWRVR
FT                   GLLKVSGLEHIEQARMHNQPIIFLGAHFLPLEMTGRATGLQLPSAAVYRKHRNPVLDSW
FT                   FYWGRMRENKAMLDRSDFKAMLRTLKGGTPLWYAPDHDYGRHKSSVFAPFFTVQNTNTI
FT                   SGTSTLARLSKGCVIPAFLKRLPGLQGYELVFYPKIENFPSKDLVADAQKTNQQIENMI
FT                   LECDEQYMWVHRRFKTRPEGEDSFY"
FT   sig_peptide     complement(239177..239281)
FT                   /locus_tag="Ping_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.753) with cleavage site probability 0.651 at
FT                   residue 35"
FT   gene            complement(239372..240769)
FT                   /locus_tag="Ping_0189"
FT   CDS_pept        complement(239372..240769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0189"
FT                   /product="O-succinylbenzoic acid--CoA ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   she:Shewmr4_3770 O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02057"
FT                   /db_xref="GOA:A1SRE2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE2"
FT                   /protein_id="ABM02057.1"
FT                   /translation="MDKQLSFCPVRHQAIINANALAIESDGVSLTYQQLDNRLNILSRQ
FT                   LLNLHLKAGDRLVCISENSLKVILLQLTCIRLGLIFCPLNPRFSAAEIEQRLNVLKSDF
FT                   IWLANPQKHSHLSSLAIDFSIYPKGVVAPAPLKIDPQKVCNIIFTSGSSGQPKAVMHCF
FT                   SNHYYSAIGSQYGIALRAKDRNLLSLPLFHISGFATVIRTLIAGATLVVSAEKLCVSLL
FT                   KKEKITHLSLVATQLYRLLSSLDFQQKELSIKHLLLGGSLFSDRLLVQTRQRGFVYHLS
FT                   YGLSEMSSQVATSTNSKKLILLPGQQVKIINNEICLRGKMRFAGYFNGHLDSSRLPEDQ
FT                   WFASKDLGALMGNELCILGRTDRLIISGGENIQAEELESILLNFAHIKQAYIVAVTDPV
FT                   FGERPAAFIDWENGKIKQQQLQIYLQDKLSSYKQPVHYFTLPEQTGLKVSLRELQVIAQ
FT                   VAHNMTL"
FT   gene            complement(240754..241767)
FT                   /locus_tag="Ping_0190"
FT   CDS_pept        complement(240754..241767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0190"
FT                   /product="O-succinylbenzoate synthase"
FT                   /EC_number="4.2.1.-"
FT                   /note="KEGG: ypn:YPN_2119 O-succinylbenzoate-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02058"
FT                   /db_xref="GOA:A1SRE3"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE3"
FT                   /protein_id="ABM02058.1"
FT                   /translation="MQQGINKPIFQQAKLFRYQLPFKIPIVFKGIKLTAREGVILQVQN
FT                   DKGEFNFAEIAPLPGFSKETLQQATAQIIALLNTPPLNSQSDILLYPSVAFALDCILHN
FT                   IPISELFKTAESIPLLQGDNHSVLKQYLQLNKPNSVKLKIGRQSVAKDITLFSALSALN
FT                   NNLLIRCDANQSWTFAQADLFFANINTQLIDYIEEPTASLSDNINLAERYEVQLALDET
FT                   LQQKQFQYQHHRCFKALILKPTLIGSFERLNYFIKTAKKFHLSVSISSSFESPLGLSQL
FT                   AFLASQWSKEVDISCGLDTLKFFESAILNKNSDKKLDNKTPINQQVKHLECLWTSN"
FT   gene            complement(241782..242858)
FT                   /locus_tag="Ping_0191"
FT   CDS_pept        complement(241782..242858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0191"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: ssn:SSO_4233 alanine racemase 1; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02059"
FT                   /db_xref="GOA:A1SRE4"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE4"
FT                   /protein_id="ABM02059.1"
FT                   /translation="MDTIRAVINLKALQHNFQVLQKTAPQSQIIAVIKANAYGHGMVKV
FT                   AQKLQHVHAFAVARLSEALILRSAGIKHPIILLGGFFKDGDLATLSAADLQCVVHSQEQ
FT                   VAAIMQAKLPNPLKIWLKLDTGMHRLGFHPEQFDAVYKRLEGSINVQKPINFLTHFHSA
FT                   EEVNNNATAQQLSLFKQYIQAGSGLKSLANSAAVFAWPETHFDAVRPGIALYGISPFAD
FT                   RLAKDLQLRPVMTLKSSLIAIRDHKARESVGYGAHWTAQNDTQLGVVAMGYGDGYPRLA
FT                   PEGTPVLVNGRIVPIVGRISMDMLTIDLGLMNQDKVGDDVTLWGEGLPAEIVAQKIGTI
FT                   AYELVTKLTSRVTLHYQE"
FT   gene            complement(242921..244321)
FT                   /gene="dnaB"
FT                   /locus_tag="Ping_0192"
FT   CDS_pept        complement(242921..244321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="Ping_0192"
FT                   /product="primary replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: ecs:ECs5034 replicative DNA helicase DnaB;
FT                   TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase, N-terminal domain protein; DnaB domain
FT                   protein helicase, C-terminal domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02060"
FT                   /db_xref="GOA:A1SRE5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE5"
FT                   /protein_id="ABM02060.1"
FT                   /translation="MAGKPPFSQQKPKINTPIKTVPHSFEAEQAIIGGLLLNNEAWNDV
FT                   AERVVERDFYHRAHRQIFAMIERLSSEDIPVDLVTLSEHLENKKELEGVGGIAYLAELL
FT                   QNTPSAANINNYSDIVRERAIVRELIGVANEIAEAGYETEGRDSNELLDFAETRVFQIA
FT                   ESRSNKSEGPQAIKDILKATVAKIDDLCKNPRDGITGLSSGYNDLDQMTTGFQAGDLII
FT                   VAARPSMGKTTFAMNLAEHAALNADKPTVIFSLEMPAEQIMNRILSSLGRIDQGKIRTG
FT                   QLDENDWASLSSTMSILLQKGNMFIDDSSGLTPTELRSRARRIARDHGGVSLIMVDYLQ
FT                   LMRVPSLSENRTLEISEISRSLKALAKELRCPVIALSQLNRGLEQRADKRPINSDLRES
FT                   GAIEQDADLIMFIYRDEIYNEASEHKGIAEIIIGKQRNGPIGKVRLTFQGRYSRFDEYT
FT                   GTAYHGED"
FT   gene            complement(244433..244789)
FT                   /locus_tag="Ping_0193"
FT   CDS_pept        complement(244433..244789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0193"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: sde:Sde_1725
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02061"
FT                   /db_xref="GOA:A1SRE6"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE6"
FT                   /protein_id="ABM02061.1"
FT                   /translation="MQKNTGLKRIILAMGYSLQGLKSTFKYEAAFRQELLLAIILIPIA
FT                   CFLEVSQIERILLITPIILVMILEIVNSAIEAVVDRVGIEHNKLAGRAKDMGSAAVFVA
FT                   LGLTAYIWIEIIFL"
FT   gene            245011..247410
FT                   /locus_tag="Ping_0194"
FT   CDS_pept        245011..247410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0194"
FT                   /product="glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   she:Shewmr4_3788 glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02062"
FT                   /db_xref="GOA:A1SRE7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE7"
FT                   /protein_id="ABM02062.1"
FT                   /translation="MLVKGSIFHRVINKYWVSNHYVPVNPVAELQLDLSRPIIYLVAQN
FT                   CASDLLALQSCCLQAGLPDPYRPINVDQENLSATIFIDDSVLSSPKAQLQDAAYLRQYQ
FT                   QLLTLHRRLPNLNIQLLPVTFYWGRNPGKQGRRSCFDRVEQRSVGSLHKIGIVLKNGKD
FT                   HLLRFNKPISIAALRHRLDPQKSDQQKNSDSKQSANKLAKIALTYFANQKRYSIGPKLP
FT                   NRSAMIEAVLQQPLLRKTIRTAALREQCSEQQVDRQCRKYLLEISANFSYPLLRVFRLI
FT                   LKGLWNHLYRGIEVNHAEAVRQANQSGAEIIYLPCHRSHMDYLLLSYLLVEQGLVAPHV
FT                   AAGVNLSFFPLGPIFRRSGAFFLRRTFKGAPLYAAIFNAYFSMLFKQGYPIEFFSEGGR
FT                   SRTGRLLPPKTGLLATTLQTYLNQPERNVILVPIYIGYDHIMEVNTYIKELSGQKKEKE
FT                   SVWQLLAAVKQLGNFGRVFVNFGVPINIKKHFDQQTPNWQKAGVDDRQFKIQVQQVARQ
FT                   VMVGINQATAVSALPLCAAILLASKNFQSKKTVFLALLDKHQQLLGLKSENSSLTYAKE
FT                   KNCLVYRQALSMNKFEQDGERVFCSKNQAMQLNYYRNNIVHVFALPSLVCHVLGYLMRI
FT                   NKTLSFDNIIYYGAKVYPFLAADYFLKIPVNIALLLENELSQLRAIGVFKFEKGRYSVV
FT                   DAVLFNVLAQHLQETFLRYQQLFVLLLSCKYWSNVDHRAICVQAKENCQPSSIDFFDEK
FT                   VTHVFLQTMQNEYPDFVTQEQGEILQDLFAPFCSIDLQPIEKEKKC"
FT   gene            247404..247814
FT                   /locus_tag="Ping_0195"
FT   CDS_pept        247404..247814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0195"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ilo:IL1695
FT                   rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02063"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE8"
FT                   /protein_id="ABM02063.1"
FT                   /translation="MLIDGRELVESLRSQVQEISAAQLHDILHKIPHDGTQAVLIDIRE
FT                   VAEIAAGTIANAVLIPRGVLEMQISSEESLKRRFPTLEMLAEQPVYLLCRSGARSVLSA
FT                   ISLQQMGFKHVYSVAGGFLAWQAAGYECTNKI"
FT   gene            247894..248517
FT                   /locus_tag="Ping_0196"
FT   CDS_pept        247894..248517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0196"
FT                   /product="elongation factor"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   plu:plu4400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02064"
FT                   /db_xref="GOA:A1SRE9"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRE9"
FT                   /protein_id="ABM02064.1"
FT                   /translation="MEPYFIPMENLFFQEEIKKSRFMTYVARIEGKEQALTYVHGIKKS
FT                   HQAASHHCWAYIGAAPDNDMCMGRSDDGEPKGTAGKPILSTLQGSQIGEIIAVVVRYSG
FT                   GIKLGTGGLVRAYSNGVQQLIKQLITTEKRFYQRYQLHCDYAQMAQIESLLVVLSGRIV
FT                   EVDYLQSIQALIEVDQQLCQQFIEKLDSLTQGQVIAKKIPITVR"
FT   gene            248522..249988
FT                   /locus_tag="Ping_0197"
FT   CDS_pept        248522..249988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0197"
FT                   /product="potassium uptake protein, TrkH family protein"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: vvy:VV0031 Trk-type K+
FT                   transport system, membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02065"
FT                   /db_xref="GOA:A1SRF0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF0"
FT                   /protein_id="ABM02065.1"
FT                   /translation="MAFRSIIRIVGMLVGLFSLTMLPPAFISTFYEGAAGEDGGNFLAA
FT                   FVMTLFIALLLWIPNRHVKKELRVREGFLIVVLFWVTLGSVGAIPFMMSSSIEMDAASA
FT                   FFESFSGLTTTGATVIEQLDTLPKSILFYRQMLQWFGGMGIIVLAVAVLPMLGIGGMQL
FT                   YRAEAPGPVKDSKMTPRIAETAKALWNVYLFVTVACMLAFWLAGMSLFDAIGHSFSTVS
FT                   IGGFSTYNESIGHFDSNLINLITVLFLLISGVNYALHFSAFSSRKFSFNIYRQDPELRA
FT                   FIFIQVLLTTVCFIGLMGHEVYDSIENTFSQALFQAVSISTTAGFTTTSFHDWPAFFPI
FT                   LLIMSSFIGGCAGSTGGGMKVIRILLLNLQGIRELKRLVHPKAVFKIKLANNALPDRVI
FT                   EAIWGFFSTYALVFVVCMLALLLTGMDELSSFSATAAMLNNLGPGLGAVALHFNEVSAA
FT                   SKWIMILAMLFGRLEIFTLLVLFTPIFWKN"
FT   sig_peptide     248522..248626
FT                   /locus_tag="Ping_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.837) with cleavage site probability 0.608 at
FT                   residue 35"
FT   gene            249992..250513
FT                   /locus_tag="Ping_0198"
FT   CDS_pept        249992..250513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0198"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: yps:YPTB0271 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02066"
FT                   /db_xref="GOA:A1SRF1"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF1"
FT                   /protein_id="ABM02066.1"
FT                   /translation="MTIKTLILYSSVDGQTLKIINRIIELVEGEVTLVNIDDKPIIDFS
FT                   LYNKVLIGASVRYGNFRKNLLNFVNQHKTELDSLPNAFFVVCLTARKPEKAIPANNAYM
FT                   NKFDQLSQWQPRLKGVFAGALLYSRYNWWQTLLIQMIMKMTGGSTDSSRDIELTDWSKV
FT                   DIFSQDFSAL"
FT   gene            250662..252470
FT                   /locus_tag="Ping_0199"
FT   CDS_pept        250662..252470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0199"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: vvy:VV3187 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02067"
FT                   /db_xref="GOA:A1SRF2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF2"
FT                   /protein_id="ABM02067.1"
FT                   /translation="MTQSSADNAKQILLDVFGYNEFREGQELIINQLCEGRDALVVMPT
FT                   GGGKSLCFQIPALVKPGICFVISPLISLMKDQVDALRACGVAAAYLNSSLSYQQQNQVL
FT                   NDMHSGQLKLVYMAPERLLRPDFLSRLDNLPINLFAIDEAHCISQWGHDFRPEYALLGQ
FT                   LKQRFPDIPLVALTATADYATQQDILARLQFNDPLIAIHSFDRPNIEYLLIEKYRPLNQ
FT                   LANYLDEHKNESGIIYCTSRRRTEELAEKLRVKGLSVRCYHAGMMIEERQSVQDLFIKD
FT                   KVDIVVATVAFGMGIDKPNVRFVVHYEIPKNIESYYQETGRAGRDGLPAQAMLFYDPAD
FT                   AGRVRSMLEKNTNEQQQRIELHKLNTMVAFAEAQTCRRQVLLNYFGEYSHKSCGNCDVC
FT                   LDPPKSYDATEDAQKILSCVYRTGQHFGMGYVVEVLKGAQTARVKSLGHDKLSTFAIGK
FT                   DQPVEYWLSLLRQLIHCGLLMQNLTRGSALQLTEAARPVLKAEQPLYLAVPRLKLVKSK
FT                   DKKRLLSNFSDNNLFAKLRQLRKKIADRQDLPPYIIFSDVSLSEMSEIMPTTESQFLNI
FT                   SGVGQIKLKKYGAEFLTLIKQYEEQL"
FT   gene            complement(252542..252895)
FT                   /locus_tag="Ping_0200"
FT   CDS_pept        complement(252542..252895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02068"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF3"
FT                   /protein_id="ABM02068.1"
FT                   /translation="MQNTHCLEHLPSQDAIDLIADYHHELKQKNLNYQHLLEKLKKDLC
FT                   RLGFMLNVDNKIWMETRGNDYLRNPKLFNYAPLTCICAVLSEIFKEDDLAELAEKLPAI
FT                   TLKKALLRLNEFK"
FT   gene            253191..254867
FT                   /locus_tag="Ping_0201"
FT   CDS_pept        253191..254867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0201"
FT                   /product="ATP-dependent endonuclease of the OLD family
FT                   protein"
FT                   /note="KEGG: eca:ECA2660 predicted ATP-dependent
FT                   endonuclease of the OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02069"
FT                   /db_xref="GOA:A1SRF4"
FT                   /db_xref="InterPro:IPR022602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF4"
FT                   /protein_id="ABM02069.1"
FT                   /translation="MLLDQIEVVGFRGINRLSINVKSLSAFLGENSWGKSSLFDALSLF
FT                   LSGTKKAYKFTGDDFHRPSISDVSCNKLIHLVFTFKEQANGESLQRQYKSISAAWNLPK
FT                   GECSYIYYQVDGSITESGNIITQRYFLDNHGQKKSFKKDVLANLVNEFISFVPALRMGS
FT                   ERSLMVTAEDTGDVEYCSKRASCEARIKRIFKRLNKSSQQLSESEMKMGYQALVYLFDH
FT                   YLLKHYGRSHFHRGDAQNDTKGQMPFSFQALTHFNDLLKTGHKSDRAMLLLVLGEFLEV
FT                   RGEHLLRRGATPILLLEEPENNLHPVNLAITWRFFSLLPMQKLVSTNSSQLLSFLPLSC
FT                   VQRLVRCTGLTQSYSLNLKHFSQNDLRRVAFHIRMTRPQSLFARSWLLVEGETETWLLT
FT                   ELSRLCGYNLVVEGVQILEFAQCGVAPLIKLAQDLHIEWFVLTDGDAAGQKYAARVAEM
FT                   LLVKDSLVNRLVVLPALDIEHLFFDHGFANVYLEAAHYTEKDLARITTHKIIDKAVHKY
FT                   SKPELGLAIANAVEERGTDSIPPLLKRLFSRLVGLARSQSG"
FT   gene            complement(254890..255348)
FT                   /gene="hslJ"
FT                   /locus_tag="Ping_0202"
FT   CDS_pept        complement(254890..255348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslJ"
FT                   /locus_tag="Ping_0202"
FT                   /product="heat shock protein HslJ"
FT                   /note="PFAM: protein of unknown function DUF306, Meta and
FT                   HslJ; KEGG: vch:VC1663 heat shock protein HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02070"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF5"
FT                   /protein_id="ABM02070.1"
FT                   /translation="MKLFKQLSLLFISTALVACSLKTADSMTSKNMISKNRVLQNTAFS
FT                   QIQKKWQLESIDGTPISAEISSTLAIDPQRQATGRLACNNFFGRLELKDNTLKIDQMGS
FT                   TRMLCAGVMNEIEMIVSSVLNNRSEINFTNNRLSLTGQKHTLIYRADR"
FT   sig_peptide     complement(255277..255348)
FT                   /gene="hslJ"
FT                   /locus_tag="Ping_0202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.706 at
FT                   residue 24"
FT   gene            complement(255345..257492)
FT                   /locus_tag="Ping_0203"
FT   CDS_pept        complement(255345..257492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0203"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /note="KEGG: shm:Shewmr7_0328 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase, HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase, HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02071"
FT                   /db_xref="GOA:A1SRF6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF6"
FT                   /protein_id="ABM02071.1"
FT                   /translation="MSIFQPLKDLTESYLSAEQCAFIERAYRFAYLAHEGVKRASGEPY
FT                   ITHPVAVAEILAGMHLDHEAIAAALLHDVLEDTDATYQELADAFNTSVAELVEGVTKLD
FT                   KVNFRNHKEAQAENIRKMLIAMSKDFRVMLIKLADRVHNMRTLGSLRQDKRRRIAQETF
FT                   EIFTPIADRLGLHNLKNELEHLAFKAQNRARYNVLKEAINKAQKNRKDFIQNICAEISD
FT                   KLQTLPMEAKVIGRQKDLYSLYTKMRQKGCQFHDVMDVYAFRIIVKDLDSCYRALGQVH
FT                   HLYQPKLGHFKDYIAIPKANSYQSIHTTLLTHHGVNIEIQIRTEDMDEVAKYGIAAHWG
FT                   YKEGSNNQNMTAQLQTRNWFQGLSDQEDHTTNSVLMLENIKQELGKNEIHVLTPQGKII
FT                   VLPAQATPVDFAYALHTKIGHRCIGTKVDNEFALLSNKLESGQTIEIITSDEEHPCGDW
FT                   LNFVATHKARLNIRQYLKQLPQEHTVPEGRRLLKQALGSTNLTDIPQENIDKLLADHRL
FT                   NDFDSLLNEIGSGKLMSIIVARRLRGNAAELTESELKQQNRRSAIKGTEGMMVSYAKCC
FT                   KPLPGDAVIAHTSPGRGLVVHAKHCHNVTGFEDELDKYIPVEWDMNVMNQFEYSSDLII
FT                   MMINHKAGLAQLFNLISKCNANVVEIQTTELPDHLYLINLTLVVINRIHLSKVMRQIKK
FT                   LPSVKSVKRSNQKDRSKRQIN"
FT   gene            complement(258159..258764)
FT                   /pseudo
FT                   /locus_tag="Ping_0204"
FT   gene            complement(258924..259208)
FT                   /locus_tag="Ping_0205"
FT   CDS_pept        complement(258924..259208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02072"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF7"
FT                   /protein_id="ABM02072.1"
FT                   /translation="MPSVIILLTFLFSCSVSADIYTWQDAGGVTHFSEKKPAQAFKTIA
FT                   SDFNHHKTYQQGVKISYDVEALTPQTASVENAGLNVQTDLIKESQQRQK"
FT   sig_peptide     complement(259152..259208)
FT                   /locus_tag="Ping_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.994 at
FT                   residue 19"
FT   gene            complement(259352..260476)
FT                   /locus_tag="Ping_0206"
FT   CDS_pept        complement(259352..260476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0206"
FT                   /product="anhydro-N-acetylmuramic acid kinase"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   pmu:PM1831 hypothetical HI0753"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02073"
FT                   /db_xref="GOA:A1SRF8"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF8"
FT                   /protein_id="ABM02073.1"
FT                   /translation="MLSDPIIGNYYIGIMSGTSLDGIDVAIAQRTRHGFVQIAAAAPAL
FT                   DNKLRQQILTICQDKKVELQTLGEVDFQFACACAHVVNQLLEDSRLSAAQIEAIGSHGQ
FT                   TIFHSPNGAFPFTQQIGDANLIAAKTGITCVADFRRMDMAYGGQGAPLVPAFHQALFAK
FT                   SGENRVILNIGGIANITILESDNKVLGYDTGPGNTLMDAWCEKVNGECYDKNGEFAFQG
FT                   EVLPALLKLLLSEPYFSQSPPKSTGREKFNLQWLAKRLAQLDSGLNSNADIQRTLLELS
FT                   AVTISEQIQLHSAACAVFVCGGGALNPLLMQRLQALMPDYWVSDTAALNIDPMFVEAIA
FT                   FAWLAEQRLLENTIPLKAVTGARRDALLGCVYRP"
FT   gene            complement(260466..261833)
FT                   /locus_tag="Ping_0207"
FT   CDS_pept        complement(260466..261833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0207"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="KEGG: vfi:VF0080 coproporphyrinogen oxidase,
FT                   anaerobic; TIGRFAM: oxygen-independent coproporphyrinogen
FT                   III oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02074"
FT                   /db_xref="GOA:A1SRF9"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRF9"
FT                   /protein_id="ABM02074.1"
FT                   /translation="MDKFVWDQALIEKYNYSGPRYTSYPTALEFDEAFTYQESIAATEV
FT                   YPERSLSLYIHIPFCHKICYFCGCNKIITRHQEKADIYLDYLEKEIKQQALHFKNRHVS
FT                   QLHWGGGTPTFLLPAQITRLMTMLRENFSFNPNAELSIEVDPREIELSTIDHLANEGFN
FT                   RLSLGVQDFNKEVQKAVNRDQDEDFIVALLKRAKEQGFQSTNLDMIYGLPLQTKQNFAH
FT                   TLEKVVELDPARLSIFNYAHMPSIFPAQRKINEDDMPSPAEKLEILQYTIEFLTQAGYQ
FT                   FIGMDHFAKPTDELAIAQQKGVLHRNFQGYTTQEDADLLGMGVSAISQIGHSYSQNQKK
FT                   LSTYYKQIEQSGHAQWRGVGLNEDDLIRREVIKKLICNFKLDVSEIEKQFNLNFKNYFS
FT                   EDIKLLQCFIDDKLIEMTDDSITVLAKGRLLIRNICMCFDIYLRNKARQQQFSRVI"
FT   gene            complement(261850..262329)
FT                   /locus_tag="Ping_0208"
FT   CDS_pept        complement(261850..262329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pha:PSHAa2750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02075"
FT                   /db_xref="GOA:A1SRG0"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG0"
FT                   /protein_id="ABM02075.1"
FT                   /translation="MQLNVLLAIFLVVIIIGLAFYVVILLYKIKVQKANKLAMVAEQKK
FT                   QQTIGQQQRNDTICESIRVIALATAQKQCNVSEAAIRLTVLLEALLLEQPIDLINSYPA
FT                   LSEMFDKVKDMPTHDERKKVPVKELKALDKKREKLESELEQQIMTEAQQLANFSV"
FT   gene            complement(262345..262911)
FT                   /locus_tag="Ping_0209"
FT   CDS_pept        complement(262345..262911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0209"
FT                   /product="hypothetical protein DUF414"
FT                   /note="PFAM: protein of unknown function DUF414; KEGG:
FT                   eca:ECA0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02076"
FT                   /db_xref="GOA:A1SRG1"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG1"
FT                   /protein_id="ABM02076.1"
FT                   /translation="MSRTKKTRTAGNSDAKFDGQRKESSAQSQVSRENKRQSKLKGNKA
FT                   GARNAIESKQQQNTKKGINDHRIGSQKAVPLTVAKEVPADIAKVAPQPKTKVVKIPAEV
FT                   KPSPEAKQAPEQEIVEIENDQRLNELLEQLDNGEKISKTDQSWIDKQMLRHQQLMKELG
FT                   WLDDEGEEDLLQQFEDAGSALNEFK"
FT   gene            complement(263126..263728)
FT                   /locus_tag="Ping_0210"
FT   CDS_pept        complement(263126..263728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0210"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: vvy:VV0188
FT                   cytochrome c4"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02077"
FT                   /db_xref="GOA:A1SRG2"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG2"
FT                   /protein_id="ABM02077.1"
FT                   /translation="MNKLLIAFVAVLSFSSFVQAQGNIEAGKAKSATCAACHGADGNSA
FT                   SNLYPKLAGQHAPYLEKQLQQFKNGERANAIMMGMASVLSTQDMQDLAAYYASNTMTPE
FT                   MVSPEIVTAGEKLYMAGKADRKMAACTACHGPRGNGLELANFPKISSQHPAYIKAQLEK
FT                   FRSKERMNSPNGMMNDVAAKLSDADIELLSKYISALH"
FT   sig_peptide     complement(263666..263728)
FT                   /locus_tag="Ping_0210"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            264061..264717
FT                   /locus_tag="Ping_0211"
FT   CDS_pept        264061..264717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0211"
FT                   /product="cell division checkpoint GTPase YihA"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; KEGG:
FT                   ilo:IL0027 GTPase essential for cell cycle"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02078"
FT                   /db_xref="GOA:A1SRG3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRG3"
FT                   /protein_id="ABM02078.1"
FT                   /translation="MEFQKIHFQKAHFLISAPDIRHLDKHLPPESGIEIAFAGRSNAGK
FT                   SSALNRLTRQKGLARTSKTPGRTQLINVFEIEEGKRLIDLPGYGFAKVPLAMKLKWQKS
FT                   LGEYLQERESLKGLVVLMDIRQPFKELDQQLIYWAIDADIPVLALLTKADKLKQGARKT
FT                   TLLKMREEAKNFEGDVQVELFSSLKGIGLEMLEQKVTSWYAQGETPSTALDEISI"
FT   gene            264982..267033
FT                   /locus_tag="Ping_0212"
FT   CDS_pept        264982..267033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0212"
FT                   /product="oligopeptidase A, Metallo peptidase, MEROPS
FT                   family M03A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B, thimet/oligopeptidase
FT                   F; KEGG: shm:Shewmr7_3935 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02079"
FT                   /db_xref="GOA:A1SRG4"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG4"
FT                   /protein_id="ABM02079.1"
FT                   /translation="MNNSEISSIKQTDGLPSFSQITPDQIVPAVTEAISNNKALIEEKL
FT                   QSLTHFTWDNFVNVLDEADDHLGKLWSPVGHMNAVVSNDSLRQAHDACLPLFAEYATFV
FT                   GQHQGLYDAYLSISKSDEFTNLKEEQQKVINNALRDFKLSGIALPEDKKRRYGEITQQL
FT                   SQLQSEFSNNVMDATLAWSKLISDVKELDGLPESALAAAKQAAQEKDQQGYLLTLDFPS
FT                   YLPVMTYAKNRTLRHEVYQAFATRASDQGPQAGEFDNSDIIEKILALRHELALLLGFDN
FT                   FADYSLATKMAESPLQVINFLTELAEKSYPQGLRECDEVLAFAKGLDGIEHLESWDLSY
FT                   YAERLKQQKYAISDEELRPYFPENNVLKGLFEVVHRLFGLTIKEIPGVDTWHADVHFFE
FT                   IYDQQKNHLGSFYLDLYARAHKRGGAWMNDCRVRRRLVNGQLQLPVAYLTCNFTKPVGD
FT                   QPALFTHNEVTTLFHEFGHGLHHMLTKIESASVSGINGVPWDAVELPSQFLENWCWEPQ
FT                   ALALISGHVKTGETLPAELLEKMLAAKNYNGALMMLRQIEFSLFDFVLHHQYQPEKGSQ
FT                   AEKVLNDVRDQVAVIRPPSFNRFQHGFSHIFAGGYAAGYYSYKWAEVLSADAFSRFEEF
FT                   GIFDEETGREFLQAILEKGGSSDPMELFKNFMGREPSIEALLRHSGIE"
FT   gene            complement(267138..267734)
FT                   /locus_tag="Ping_0213"
FT   CDS_pept        complement(267138..267734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0213"
FT                   /product="cob(I)yrinic acid a,c-diamide
FT                   adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="KEGG: hch:HCH_06467 cob(I)alamin
FT                   adenosyltransferase; TIGRFAM: cob(I)alamin
FT                   adenosyltransferase; PFAM: ATP:corrinoid
FT                   adenosyltransferase BtuR/CobO/CobP"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02080"
FT                   /db_xref="GOA:A1SRG5"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG5"
FT                   /protein_id="ABM02080.1"
FT                   /translation="MTTDPKHLKRMKAIKEKQDQKIAAADQERGVTILLAGPGKGKSSS
FT                   SFGMLARSLGHGHKVAVVQFLKGAMSTGEEMFFSQQDNVDWYAMGDGFTWETQNKEQDI
FT                   ASAKRAWAKAEALLADDRYQLVILDEITYMFKFNYLELQPTLDALKNRPEKMNVILTGR
FT                   GPKQELIDAVDTYSHILDEKHAFKAGVKAQPGIEW"
FT   gene            complement(267796..269115)
FT                   /locus_tag="Ping_0214"
FT   CDS_pept        complement(267796..269115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0214"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG: wsu:WS1251
FT                   NA(+)/H(+) antiporter 1; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02081"
FT                   /db_xref="GOA:A1SRG6"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRG6"
FT                   /protein_id="ABM02081.1"
FT                   /translation="MSSRGKWSWLHSPITGGILLIIAATTALFWANLAPSLYHHAWHDA
FT                   LFSVSSGFSATIYSISLHQIVNEFLMAIFFFFIGLEMKRELLDDDLSTLKKAALPLFSA
FT                   LGGVVLPASIYYFFNAGTDTVNGWGIPMATDIAFALGVLAMVGSRVPLSLKIFLSALAI
FT                   GDDLMAVLVIAIFYTEQIFVNELLVGFLGLIVLAVANKMGVRNRLVYYSIGLIIVWISF
FT                   LASGVHATIAGVAVAFTIPSRREISMGNYLITAKGLLSGLDKERHNKADVLTKNAISSL
FT                   REIRDLSYQASNPLQLKEEALHPISALFIVPLFALGNAGVIVDDSMLAELTNPIVLGIA
FT                   AGLIIGKPLGIFLFAKLLTLLKLGQLPEGVTWRHIIGTGFLAGMGFTMSLFISDLAFSE
FT                   PEQKIVAKVAVLLASIISGIVGYLILISAPVIKKDNKLNS"
FT   gene            complement(269538..270185)
FT                   /locus_tag="Ping_0215"
FT   CDS_pept        complement(269538..270185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0215"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   yps:YPTB1433 metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02082"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG7"
FT                   /protein_id="ABM02082.1"
FT                   /translation="MSNNSMKIIVIPVTPYQQNCSLIICEETKIAAIVDPGGDPLRILN
FT                   IVEKQGVKVDKIILTHGHLDHVGGTQAVAGKLNVPVIGPEKEDLFWLEQLEAQSRRFGL
FT                   PTTESFSPNRWLTEGEVLEVGKIKLKVLRIPGHTPGHIALYDKQSKQVIVGDILFNGGI
FT                   GRFDFPRGNRSLLVSGIKEKLLTLPPETTVYPGHGPTTTIGKEKASNPFLRL"
FT   gene            complement(270302..271861)
FT                   /locus_tag="Ping_0216"
FT   CDS_pept        complement(270302..271861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0216"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: sfr:Sfri_3820 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02083"
FT                   /db_xref="GOA:A1SRG8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRG8"
FT                   /protein_id="ABM02083.1"
FT                   /translation="MSDQVIIFDTTLRDGEQALSASLTVKEKLQIAFALERLGVDVMEV
FT                   GFPISSPGDFESVKTIAREIKNSRVCGLSRALPKDIDAAWNALKGADAFRIHTFISTST
FT                   IHVENKLKRTFDAVLEMGINAVKHARNYTDDVEFSCEDAGRTPIDNLCRIVEEAIKAGA
FT                   TTINIPDTVGYTYPSEFGGIIKTLFNRVPNIDQAIISVHCHDDLGMSVANSITAVENGA
FT                   RQIECTMNGLGERAGNCSLEEVAMILQTRKDKLGFTTNVNPMEISRTSQLVSQLCNMPI
FT                   QANKAIVGANAFSHSSGIHQDGVLKSQNTYEIMTPESVGISTNKLNLTSRSGRHVIQHR
FT                   MQELGYRDTDYDLEQLYASFVELADKKGQVFDYDLEALMFFNKVDSDPQHYRLESINVQ
FT                   SGSGLVATATIVMSIGEDKKVVEAATGNGPIDAAYQCLMRISGLDINMDDYHINAKGAG
FT                   KDALGQVDIVATYNGQKFHGLGLSTDIIESSTKAMVHVMNHIHLAKAVAIEKEQLIHID
FT                   QV"
FT   gene            272473..272919
FT                   /locus_tag="Ping_0217"
FT   CDS_pept        272473..272919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0217"
FT                   /product="methionine-R-sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="KEGG: vch:VCA0615 peptide methionine sulfoxide
FT                   reductase; TIGRFAM: methionine-R-sulfoxide reductase; PFAM:
FT                   Methionine sulfoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02084"
FT                   /db_xref="GOA:A1SRG9"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRG9"
FT                   /protein_id="ABM02084.1"
FT                   /translation="MTDYKKPDEQKLREQLNNVQYQVTQQDATEPPFDNDYWDNHAAGI
FT                   YVDIVSGEPLFSSLDKFDAHCGWPSFTQPLQPKKVLEKVDTQLFATRTEVRSAIADSHL
FT                   GHVFDDGPAPGGLRYCINSASLRFIKLEDMAEQGYQEFLYLFDK"
FT   gene            273270..274334
FT                   /locus_tag="Ping_0218"
FT   CDS_pept        273270..274334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0218"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: hin:HI0268 UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: FAD linked oxidase domain protein;
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02085"
FT                   /db_xref="GOA:A1SRH0"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH0"
FT                   /protein_id="ABM02085.1"
FT                   /translation="MIETNTSLKAFNTFSIDVNAQILFHFNNLKQIPELLDLVKTTRAD
FT                   NKPVLILGGGSNILFCEDFTGLVIKVDLSGVDITESADSYLLKVAAGENWHKLVADCID
FT                   KGINGLENLALIPGVVGAAPVQNIGAYGTEFKDFCESVEYLDLNSGALHCLSAKECLFA
FT                   YRDSIFKTLKMQDALITRVTLKLTKDWQAQNQYGRLKNAAESAQKLSAKQIFTSVCQIR
FT                   SEKLPDPAKLGNAGSFFKNPLVTAPQAEQLLALYPHMPHYPQPDGQVKLAAGWLIEQAN
FT                   LKGAHIGGAAVHQQQALVLINQNNACAADVIQLANLVRTTVKEKFNINLEHEVRFICAM
FT                   GESNLTEAVNKCRN"
FT   gene            274322..275290
FT                   /locus_tag="Ping_0219"
FT   CDS_pept        274322..275290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0219"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: eci:UTI89_C3803 bifunctional
FT                   biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon
FT                   repressor; TIGRFAM: biotin--acetyl-CoA-carboxylase ligase;
FT                   PFAM: biotin protein ligase domain protein; biotin/lipoate
FT                   A/B protein ligase; Helix-turn-helix, type 11 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02086"
FT                   /db_xref="GOA:A1SRH1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH1"
FT                   /protein_id="ABM02086.1"
FT                   /translation="MSELNEQGNILLTLLADGEFHSGEKIGELLGVSRTSVNNYIKGLQ
FT                   GIGVDIYKVPGRGYQSATLIKLLNEQKIRQLCGYDNIKVEQIVDSTNQILLDQIPHLEN
FT                   GQTCIAEYQLAGRGRRGRTWVSPFASHLYFSFYWYFDSGIDKISGLSLLVGIAVVNTLE
FT                   KMGIQGVSLKWPNDIYYQGKKLAGILIELNAQATAACHCVIGIGINIKMPPEQAKLINQ
FT                   PWADLNALIPTGVDRNELSAILIKELQYLLPRYEKSGLTPYLSRWFELDCFLDKKVNLL
FT                   IADTITMGICRGVNRHGALLLEIEGQVKEFIGGEISLRLAN"
FT   gene            complement(275335..275583)
FT                   /locus_tag="Ping_0220"
FT   CDS_pept        complement(275335..275583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02087"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH2"
FT                   /protein_id="ABM02087.1"
FT                   /translation="MQAFLGNTWHLLTVCLKKNQQCLFSFTNQTTSCFPVSLILWQRYI
FT                   NLGFSAQRAKKRVKTIRLKDKIIIFRQQGKTASDKNP"
FT   gene            275625..275700
FT                   /locus_tag="Ping_R0010"
FT                   /note="tRNA-Thr1"
FT   tRNA            275625..275700
FT                   /locus_tag="Ping_R0010"
FT                   /product="tRNA-Thr"
FT   gene            275711..275794
FT                   /locus_tag="Ping_R0011"
FT                   /note="tRNA-Tyr1"
FT   tRNA            275711..275794
FT                   /locus_tag="Ping_R0011"
FT                   /product="tRNA-Tyr"
FT   gene            275906..275980
FT                   /locus_tag="Ping_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            275906..275980
FT                   /locus_tag="Ping_R0012"
FT                   /product="tRNA-Gly"
FT   gene            complement(276412..278772)
FT                   /locus_tag="Ping_0221"
FT   CDS_pept        complement(276412..278772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0221"
FT                   /product="periplasmic sensor diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: sdn:Sden_3396
FT                   GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02088"
FT                   /db_xref="GOA:A1SRH3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR007892"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH3"
FT                   /protein_id="ABM02088.1"
FT                   /translation="MDRILKSRKIDQTSLGRCMLIFMTGLLVSIGTLFWWGAYSQLATS
FT                   FDAFDVSYYENELKRVAGVLKQNQLSFELQIKDYAHWDDTEAFVSGDYPVYIEENFTPI
FT                   SLANNKISGYLIARLDGSFAAPPMILSDDALIPMPAKMRSVLSPLLPALMTADKPTANT
FT                   ALFWLNDQATFVSGVTITDSNESRPPSGYLLFFRHFDSAILDGFRSLTSVDFTLLPQLE
FT                   NNKANFKVQYLSDLDEPAWVVSKNLKNLPAMIEIQGTTHLKKERYMSFVLLGSSVAGLT
FT                   LFSLLGIYLCLHFRILKRLHIFSQLADKHRLSPQQPVRWPIKNNDELDNLAFALNELMS
FT                   EVEVRHKEMSFLADHDPLTGLGNRRLLMAQLDANINRQKRHPTFISTLLLIDLDEFKLL
FT                   NDGLGHNAGDDILKLMSLRMLSQVRNYDTVVRLGGDEFAILLDGVGLEMAQSFAERLLD
FT                   TITQPFKQNGQDLILRASIGLTAVNNGLCKENLIRYADLAMYEAKRRGKGQVTIFKMAL
FT                   LDTVSRRVLLEQALHSALNDDQLEVWFQPIVDLNSGEVVNMEALSRWSLAGEFVPPEEF
FT                   INIAEITGMIIPLGQQLFDKVGCALQELRVEHPNLQCNINLSVKQFRDRNLFTEITSCL
FT                   NKYQLPTSAFHLELTESMVVETETDILPMMQKLVEHGLKFHLDDFGTGYSSLDRLNNLP
FT                   FDTLKIDRSFVTSLGMGDDIMARNIINIGNELGLNIIAEGVETQVELDRLMDLGCSQIQ
FT                   GYYFAKPMPLSELKDWLYDKQHQVIQMKSKRQA"
FT   sig_peptide     complement(278650..278772)
FT                   /locus_tag="Ping_0221"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.679) with cleavage site probability 0.364 at
FT                   residue 41"
FT   gene            279687..281114
FT                   /locus_tag="Ping_0222"
FT   CDS_pept        279687..281114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0222"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: Na+/H+ antiporter NhaA; KEGG: sdn:Sden_1480
FT                   Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02089"
FT                   /db_xref="GOA:A1SRH4"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRH4"
FT                   /protein_id="ABM02089.1"
FT                   /translation="MNLRIVYLRSLNIQGLTKMTDDKNNLLHRGLDNIQPPFSNFIRAQ
FT                   ATASVFLLVATITALWWANSDYSSTYQMLKHMQIGFFLGDIELQASLKHIINDGLMVIF
FT                   FFFIGLEIKREVLAGDLAIAENRRMLILCALGGMICPAVIYSLFNWSLDSQIGWGIPMA
FT                   TDTAFALGALTLVRKHIPISLLAFLVGLAIVDDVGAIVVIALFYTQEISVIFLSISFSL
FT                   IAFLAIANYAGVLRPIFYILIGIAAWWTMLKSGVHPTFAGVAIALTVPARPMLPPDELL
FT                   SKVKAKITAMKKNKGHQLDALANREDHEQVLDVRDFAEHGSAPLRRWEDALDLPVSLFV
FT                   LPLFALVNAGVEVSFSSLIETLQHSVGLGIVIGLVIGKFVGISGACWLGLRYKIGSLPE
FT                   GINMQHVIGMSLIAGIGFTMSTFIATLGFDSQPEYLQSAKGSILFASLLSAILGLLYLR
FT                   IIAAKKAPNSASKNGEN"
FT   gene            complement(281415..282098)
FT                   /locus_tag="Ping_0223"
FT   CDS_pept        complement(281415..282098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0223"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   eba:ebA6908 conserved hypothetical protein, predicted
FT                   short-chain dehydrogenase/reductase SDR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02090"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH5"
FT                   /protein_id="ABM02090.1"
FT                   /translation="MNYQTVFITGATKGLGRALVIDLCSKGYKVFATGRDETQLQQLMQ
FT                   QTGCLGVSCDLSQAEAAVEIFQKATKALGHIDVLINNAGMNSRKCELAETTLEEFEQQY
FT                   AVNLRAPYLLCREAMQQMLPKEHGYIINIVSTAAKRSNPTMSIYSAMKQGFAGLNNVLM
FT                   KEAQPHGIKVTAVYPGGMNTAFREQERPQYMQPASVATLVSQLLSNPIDVVIHELTCRP
FT                   MVELE"
FT   gene            complement(282480..283931)
FT                   /locus_tag="Ping_0224"
FT   CDS_pept        complement(282480..283931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0224"
FT                   /product="xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: ppr:PBPRA0467 putative xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02091"
FT                   /db_xref="GOA:A1SRH6"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH6"
FT                   /protein_id="ABM02091.1"
FT                   /translation="MFIGIDLGTSGVKVILVDQSGLILGTKTVSISVSRPAPLWSEQDP
FT                   AEWWSATNQAIKALAKDISLSNVSAIGLAGQMHGAALLDDNGKVLRPAILWNDGRCAEE
FT                   CLEMEQLVPTSRDITGNIMMPGFTAPKLKWVQKNEPECFAKIAKVLLPKDYLRYCMTGD
FT                   FASDMSDAAGTMWLDVAKRDWNAQLLAATGLTRQQMPKLYEGSQITGTLSKELANEWGM
FT                   PCVPVVAGAGDNAAGAIGVGITQPRQAMLSLGTSGVYFAVSDGFSANPESALHSFCHAL
FT                   PATWHTMSVILSAASCLTWVAELTGASSVPEMIAEVEADADLNSEVIFLPYLSGERTPH
FT                   NNPDAKGVFFGMTHATKRAELAQAVLEGVGFALADGLDALHATGVEPEEISLIGGGAQS
FT                   AYWRQMLADIFNKKLAYRVGGDVGPALGAARLARLGLAGQEKLSEVCPVPRLIQTHLPN
FT                   IGKHAAYALKREKFQKIYVQLKDIF"
FT   gene            complement(284627..284863)
FT                   /locus_tag="Ping_0225"
FT   CDS_pept        complement(284627..284863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0225"
FT                   /product="regulator of information in SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: ppr:PBPRA0060 SirA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02092"
FT                   /db_xref="GOA:A1SRH7"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH7"
FT                   /protein_id="ABM02092.1"
FT                   /translation="MSEEKTQALNTLGLRCPEPVMMLRKTVRKMQEGELLSVIADDPAT
FT                   TRDIPSFCRFMDHTLVEADIQQAPYRYLIRKGA"
FT   gene            complement(285034..287670)
FT                   /locus_tag="Ping_0226"
FT   CDS_pept        complement(285034..287670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0226"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   vfi:VF2308 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02093"
FT                   /db_xref="GOA:A1SRH8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRH8"
FT                   /protein_id="ABM02093.1"
FT                   /translation="MTEEYSNLRSNVSLLGQLLGKSIGGHLGEEFLDKIETIRQLSKSS
FT                   RAGNQQDGVALIDMLTHLSDDELVPVARAFTHFLNLANIAEQFHGISRHCDSGVCAPEP
FT                   IKDLISKFKNSNLSQQEMQQSVNELKMEMVLTAHPTEITRRTLIHKHIAINDCLSYLEI
FT                   SDISDKERDLLLNRLEQLITQAWHTNDIRQKRPTPVDEAKWGFATIEKSLWQAVPQFIR
FT                   DLESELQSGLGLSLPLEASPITFTSWMGGDRDGNPFVTAKVTQEVLLSSRWVAVSLYLK
FT                   DISQLTDELSMDNCDPALRSVVGDNAAEPYRAILRKLRSELKETLASLSATLQNQRSDE
FT                   KDIITTSKQLKEPLLLCYHSLKNMGMNSIANGLILDILRRLNCFGINLLKLDIRQDAER
FT                   HGNTLSELTRYLGIGDYNAWNEEDKQAFLLQELNNKRPLFPSQWNPSAEVQEVLDTCKV
FT                   VAQTDPEALGIYIISMARQASDVLAVQLILKEVGCPFRIPVAPLFETLDDLNNSAAVMK
FT                   RLFAIDWYRGYINGIQHVMIGYSDSAKDAGVIAANWAQYTSQEALVKLSAENDINLVLF
FT                   HGRGGTIGRGGAPARQALLSQPPGSLKGGLRVTEQGEMIRFKFGLPKVAVQSLNQYAAA
FT                   VLEANLLPPPAPKQEWRDVMQQFSDQSCQEYRHFVREEPDFVPYFRSVTPEVELGKLAL
FT                   GSRPSKRKPSGGIESLRAIPWIFAWSQNRLMLPAWLGAGTSLKTLLNEGKKPLLQEMYQ
FT                   HWPFFHTRLEMFEMVFLKADEELTKFYEERLVPKELWPLGQRLRDNLTLTRETVLETIP
FT                   DHQLMQEQPWIKESISLRNPYVDPLNMLQAELLYRSRENGDEICPVVDQALMVTIAGIA
FT                   AGLRNTG"
FT   gene            complement(287814..288962)
FT                   /locus_tag="Ping_0227"
FT   CDS_pept        complement(287814..288962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0227"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="KEGG: ilo:IL0611 acetylornithine deacetylase;
FT                   TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02094"
FT                   /db_xref="GOA:A1SRH9"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRH9"
FT                   /protein_id="ABM02094.1"
FT                   /translation="MALPTFLNLYKDLIKIPSISSTDPSWDQSNLNVINQLASWLEELG
FT                   FKSEIQAVRSAPGKYNLIATLGEGDGGLLLAGHTDTVPYDAGKWTTDPFTLTEKDNRLY
FT                   GLGSIDMKGFFAFVIEVLKEIDINKLNKPLRILATADEETTMAGAQEIAEQKTFRPDYA
FT                   VIGEPTGMAPVTMHKGHMSEGIRITGRSGHSSDPDKGLNAIEIMHLVIGELKKVQQQFK
FT                   EKYHNPHFDVPYPTLNFGAISGGDSPNRICGCCELHIDMRPIPGITTSELFITVKQALS
FT                   EIEKRYPKSVEIYHLHEPIPSYQCPAHSDLINNAEIFTGNPAQSANYCTEAPFIQQLGC
FT                   DTIILGPGHISQAHQPNEYLDLSFVKPTKEVIKKLINHYCVI"
FT   gene            289475..290497
FT                   /locus_tag="Ping_0228"
FT   CDS_pept        289475..290497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0228"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: vfi:VF2306 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   dihydrodipicolinate reductase; Semialdehyde dehydrogenase,
FT                   dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02095"
FT                   /db_xref="GOA:A1SRI0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI0"
FT                   /protein_id="ABM02095.1"
FT                   /translation="MELLMLKAIIVGASGYTGAELANFLVRHPHIELAGLYVSPGSLDK
FT                   GKKLSALYGHLLGVVDLPLQPLGNADIKTVCADIDIVILATAHEVSHDLVPLFLAQNTA
FT                   VFDLSGAFRVQEAGFYDKFYGFTHQYPALLEKAVYGLAEWNFEAVKKTDLIAVPGCYTT
FT                   ASLTALKPLVEAGLIKDNTKPTINATSGASGTGRKASLASSFCEVSLQPYGVFTHRHKP
FT                   EIDQHLGMPVVFTPHLGSFKRGILASINVQLKAGVTAQQVNQAYQNAYADKPLVRLMDG
FT                   TYPALKNVVGTPFCDLGWAVDGEDLVAFSAIDNLLKGASSQAIQCINLRFGFAITTSLL
FT                   "
FT   gene            290513..291295
FT                   /locus_tag="Ping_0229"
FT   CDS_pept        290513..291295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0229"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: ppr:PBPRA0267 putative acetylglutamate kinase;
FT                   TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02096"
FT                   /db_xref="GOA:A1SRI1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRI1"
FT                   /protein_id="ABM02096.1"
FT                   /translation="MTQALKPLLIKLGGAVLENEQALENLFSALTVYLQTEQRPLLIVH
FT                   GGGVIVEDVLKKMNIVSYKKEGLRITPFEQIPYVAGALAGTSNKLLMAKALKAGLSAVG
FT                   LSLADGFSCKVTQLDPDLGAVGICSPNNPALLNTLLKEGYLPVISSIAIGDDGRLYNVN
FT                   ADQAAITICELVGAELLFLSDVDGVWDAHKQVIPELNTQLADRLIAEKVIQDGMAVKVK
FT                   AALQAAEQLGYVMLASWKNPENLVSLLAGQAVGTKVVK"
FT   gene            291319..292227
FT                   /locus_tag="Ping_0230"
FT   CDS_pept        291319..292227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0230"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase, Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding domain; KEGG: pha:PSHAa2289 ornithine
FT                   carbamoyltransferase (OTCase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02097"
FT                   /db_xref="GOA:A1SRI2"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI2"
FT                   /protein_id="ABM02097.1"
FT                   /translation="MKNLLTGMEMTQQQALDLIALGKDLKANPAKYSQALAGKSVVTLF
FT                   EKQSLRTRVTFDIGVNKLGGHVVYLDQSNGEMGSREDVKDFAANISRWADCIVARVFDH
FT                   KTLVEMQAHSSVPVINSLCDLYHPCQAMADFLTIAQQYDDLSKVKIAYIGDGNNVTHSL
FT                   FIAGAILGATVTAVCPVGHSPDAQILKMSEEIAAKNGGSIHVTDNIEDIKGYDVVYGDT
FT                   WLSMGDDTPLEQIKAKFMPYQINQALLDLTGIKHVLHCQPAHRGLDITSDVMDGPASLI
FT                   FDQAENRMHIQNAIMLTLINK"
FT   gene            292252..293460
FT                   /locus_tag="Ping_0231"
FT   CDS_pept        292252..293460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0231"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="PFAM: argininosuccinate synthase; KEGG:
FT                   shm:Shewmr7_0239 argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02098"
FT                   /db_xref="GOA:A1SRI3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRI3"
FT                   /protein_id="ABM02098.1"
FT                   /translation="MSKVKKVVLAYSGGLDTSAIIPWLKETYDDCEIIAFCADVGQGAE
FT                   ELVGLEEKALASGASECHIVDLKEEFVKDYIYPTMASGAVYEGTYLLGTAMARPIIAKA
FT                   QVEVALKVGADALCHGCTGKGNDQIRFESCFAALAPELQVIAPWREWEMESREDLLDYL
FT                   AERNIETTASATKIYSRDANAWHISHEGGELENPWNAPSKGVWTLTVDPEDAPDKPEYL
FT                   TIKVENARVVAVDGVELSPYDALMLLNEKAAAHGVGRVDITENRTVGMKSRGCYETPGG
FT                   TVMVAALRGIDELVHDKPARKWRDQVGQEFTHLVYDGRWFTPLCGSLLAASEALAKDVN
FT                   GEVVVKMYKGQVTAEQKRSPNSLYSEEFATFGDDNVYNQKHAEGFIRLYSLSSRIRTLN
FT                   SKK"
FT   gene            293604..295484
FT                   /locus_tag="Ping_0232"
FT   CDS_pept        293604..295484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0232"
FT                   /product="argininosuccinate lyase / N-acetylglutamate
FT                   synthase"
FT                   /EC_number="4.3.2.1"
FT                   /EC_number="2.3.1.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: GCN5-related
FT                   N-acetyltransferase; fumarate lyase; KEGG: vpa:VP2756
FT                   argininosuccinase and n-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02099"
FT                   /db_xref="GOA:A1SRI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR011244"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI4"
FT                   /protein_id="ABM02099.1"
FT                   /translation="MALWGGRFSHAADVKFKLFNDSLRFDYRLAEQDIIGSIAWSKALQ
FT                   TVDVLTNDEQKRLEAALNELLVSVKDNPELVLQSDAEDIHSWTEGQLINKIGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKKRAQELVVHLDALEAKLIELARIHQGVVLPGYTHLQRAQPV
FT                   TFSHWCLAYLEMLERDHDRLEGCLERLDTCPLGSGALAGTGYAIDRTALAHSLGFKRAT
FT                   RNSLDAVSDRDHVVELMSCATMSMMHMSRMAEDLIFYNSGESGFIEMSDLVTSGSSLMP
FT                   QKKNPDAMELIRGRTGRVFGSLAAMLMTLKGLPLAYNKDMQEDKEGLFDSLDTWGDCLE
FT                   MAAMALTDLKVNEERTKEAAQGGYSNATELADYLVAKGIPFREAHHIVGVAVVGAIEKG
FT                   IPLEDLTVTQFKEFSSVIEDDVYPVLTLEATLAARKALGGVSPEQIEYALTEAEQRLAD
FT                   RDTSGIVIRAARLTDIDRIEAMVNHLADTGENLRRDKTDLAESVAEFAVAEIDGKVTAC
FT                   ASVHIYDTGLAEIRSLGVEPGFERRGQGSALVDFLVKRTEKQAIKRLFVLTRMPDFFMK
FT                   LGFSPESKTTMPEKVLKDCSMFVSEHASDEKALELNYKTSMLLHKGMSKI"
FT   gene            complement(295533..296072)
FT                   /locus_tag="Ping_0233"
FT   CDS_pept        complement(295533..296072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0233"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: shm:Shewmr7_0037 carbonic anhydrase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02100"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI5"
FT                   /protein_id="ABM02100.1"
FT                   /translation="MLPVLRGYKNSFPVLGDSVYIDPFSSIIGDVTLGDDVNIWPMCVV
FT                   RGDVNFITIGKRSNIQDGSILHVARAGEASIDGYPLIIGDDVTVGHKAMLHACRIGNRV
FT                   LIGMGAIVLDNAQIDDDVILAAGALVPPNKHLESGYLYIGSPAKAARKLTDDELAFLPR
FT                   SAAHYVTLKNEYIAQG"
FT   gene            296678..298216
FT                   /locus_tag="Ping_R0013"
FT   rRNA            296678..298216
FT                   /locus_tag="Ping_R0013"
FT                   /product="16S ribosomal RNA"
FT   gene            298420..298496
FT                   /locus_tag="Ping_R0014"
FT                   /note="tRNA-Ile2"
FT   tRNA            298420..298496
FT                   /locus_tag="Ping_R0014"
FT                   /product="tRNA-Ile"
FT   gene            298547..298622
FT                   /locus_tag="Ping_R0015"
FT                   /note="tRNA-Ala2"
FT   tRNA            298547..298622
FT                   /locus_tag="Ping_R0015"
FT                   /product="tRNA-Ala"
FT   gene            299135..302026
FT                   /locus_tag="Ping_R0016"
FT   rRNA            299135..302026
FT                   /locus_tag="Ping_R0016"
FT                   /product="23S ribosomal RNA"
FT   gene            302228..302343
FT                   /locus_tag="Ping_R0017"
FT   rRNA            302228..302343
FT                   /locus_tag="Ping_R0017"
FT                   /product="5S ribosomal RNA"
FT   gene            302550..302625
FT                   /locus_tag="Ping_R0018"
FT                   /note="tRNA-Thr2"
FT   tRNA            302550..302625
FT                   /locus_tag="Ping_R0018"
FT                   /product="tRNA-Thr"
FT   gene            302809..304059
FT                   /locus_tag="Ping_0234"
FT   CDS_pept        302809..304059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0234"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   son:SO1471 site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02101"
FT                   /db_xref="GOA:A1SRI6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI6"
FT                   /protein_id="ABM02101.1"
FT                   /translation="MAKTTPLSDTQIRLTKASDKVITLSDGGGLQLRIKPNGSKLWQLR
FT                   FNKPIEKKPALMGFGAYPAISLANARKLREAANELLAQGINPKAQRDSEIKEKELILNN
FT                   TFEMVTAAWIKLKASEVKPDSLKTISTTLTNHILPRIGKCPITEITAPMAIEALRPIEA
FT                   KGNHEVIARACQYLNQIMRYATNLGMIHSNPLTGIKGVFMTKKITNNPHVKPEELPQLL
FT                   MAIATANIKKITRNLILWQLHTMTRPAETALAQWNEIDYENNLWIIPGERIKTGMTHQI
FT                   PLTVQTLAILEACKVISGNSDYIFPADRNPNAHANKASANMAFKRMGYQGRQTAHGLRG
FT                   LARTTLSDKGVAYEPSEACLSHKVGNSVSQSYNHSTYLNQRIKIMAWWSNYIEEASYGN
FT                   ISMAGSKGVKVVGTDQT"
FT   gene            complement(304283..304837)
FT                   /locus_tag="Ping_0235"
FT   CDS_pept        complement(304283..304837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0235"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02102"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI7"
FT                   /protein_id="ABM02102.1"
FT                   /translation="MFSKKKKDIQGKLTVFYLKLNLDEISTYLKDKCVVTPDKGNNWKR
FT                   NDKVKSYDITYLGTDPFIFYHKNANEFASSINGRDCVNDGEIDIEWEWVEGYFLATANN
FT                   QIIFCAPELEIIQLMVNGKLESNNIKKSMQGEVIELDLGIDNVNAVHKSLVFRYGVVFS
FT                   NRLVSLSVCHSRANDFVHYHE"
FT   gene            complement(304922..305641)
FT                   /locus_tag="Ping_0236"
FT   CDS_pept        complement(304922..305641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02103"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI8"
FT                   /protein_id="ABM02103.1"
FT                   /translation="MQSKVVWLIGRGASIACGLDWDLSNSEGKLNRESQISIIKEKLPQ
FT                   AMKKVNSEPYSKLVRILEKRTTSKYFHRFVTTNWDCLLQNELSSLCESKAAVPDAFGMN
FT                   SHVYHLNGTVEDTPEDLRSKILLESDEPELREMWFESNEAFNIILESSIFVVVGMSFEC
FT                   VIDRYTLVALGRCGSEMPVASSNWLLVNPNREQAEKVSSEISRHLPDAKFKFVNEGFNE
FT                   WINRGARELCDIGVLSA"
FT   gene            complement(305755..306222)
FT                   /locus_tag="Ping_0237"
FT   CDS_pept        complement(305755..306222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02104"
FT                   /db_xref="GOA:A1SRI9"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRI9"
FT                   /protein_id="ABM02104.1"
FT                   /translation="MKLTMWFTLEMFLTCLLVVGKVVFITTYLYTGYSIWLLLLVTLLL
FT                   ISLPIYYGIYESVVGEEKVNKIESKIGKSIHLLIAFIIVISAVCVFVFQTYTYLKSGVW
FT                   LPLSVIDGFSTIGFEWAKNPTDWIGLWELVDQVPLSVGLFLIGLYVFQFYD"
FT   gene            complement(306307..307245)
FT                   /locus_tag="Ping_0238"
FT   CDS_pept        complement(306307..307245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0238"
FT                   /product="hypothetical protein DUF511"
FT                   /note="PFAM: protein of unknown function DUF511; KEGG:
FT                   rso:RSc0886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02105"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ0"
FT                   /protein_id="ABM02105.1"
FT                   /translation="MSRLSQSQKIVELLKVNPNQKFNARQIAEQIVESHPEDYRDKRQN
FT                   PRFADEKAFISQVVAEIGSQKDQIVKNDSHVFWQDKPRPRVYWYNPEKIVGEIGPELDE
FT                   SEDENLVISTIAETVFSEHDLYPILIDYLKTELKLYCQRIDEKRSKNSRGSGGNQWLHP
FT                   DIVAMQPVDKEWDELIRSCVKKGAGQSVRLWSFEVKKELTGSNARKSFFQAVSNSSWAN
FT                   EGYLVATSISDSSVEQELRMLSALHGIGVILLNPENPTESEMMLPAKSRADVDWQSVNR
FT                   ILVENADFKDYIELVSTYYQTGRVRARDWNK"
FT   gene            complement(307385..307978)
FT                   /locus_tag="Ping_0239"
FT   CDS_pept        complement(307385..307978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02106"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ1"
FT                   /protein_id="ABM02106.1"
FT                   /translation="MSFSSMMNDQLVLKKQNSEIVEGIKAAVTPNFIVTERHDVQIESG
FT                   DLLVRKLPNGLEDTFKIIDPGFYQGMGRISSGYKVTYKKLGIPEAEAEVKNITYNFHGD
FT                   NARVNNDSVDNSTNNVNSATEITEHIELLKSEVSRLIKGEQQKADALDVVDAIESQLTS
FT                   EKPSKAVVDTLLAALPHAGSIATIGSFLLSVIAK"
FT   gene            complement(308098..308970)
FT                   /locus_tag="Ping_0240"
FT   CDS_pept        complement(308098..308970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02107"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ2"
FT                   /protein_id="ABM02107.1"
FT                   /translation="MEFEPFYYDTLDFRRKLIVDSQPPHYLYHYTTAAGFLGIIQSNKD
FT                   NSFQMWASDSRYLNDSSEYIGGLEVAGECINSSKYKSSDLIQKASVLLKGANGRIAVLS
FT                   MSSKENLLSQWRAYSENGGYSIKFRTDLFKAIGYLANHYLAECIYSKEDLSVKVNNCIE
FT                   WHQNKFETATTNQPQAVIEHHLDNCLKGLVGTIRALATLLKHKSFSEESEWRYVVTYPQ
FT                   GNELNIRNCNGLLVPYIYLKFPEKSIFQVAVAPGSRALLAKISAEDVLTNNIKDCKAGV
FT                   ELSDTSFRW"
FT   gene            309481..310512
FT                   /locus_tag="Ping_0241"
FT   CDS_pept        309481..310512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0241"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: cps:CPS_0377 ISCps1, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02108"
FT                   /db_xref="GOA:A1SRJ3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ3"
FT                   /protein_id="ABM02108.1"
FT                   /translation="MLKSNIIGIDLAKNILQICHISKYGELISNKAVSRQKLKQILANQ
FT                   QPAVVAIEGCGSSHYWGRYAEQFGHDVRVISPKKVKCFLQGHKTDANDALAIANASLQI
FT                   GLKTSKPKSEEQQTLQTLDTSRLFLSRSITALGNHLRAMLYEYGIVSTVGVKGLTKAVL
FT                   ETLEASLLPECLRSTVNQLWVTYLNLKTELAQLIKTKNGLVRQLQPCKALMDLEGVAEV
FT                   CAGMLYSSIGDGKQFKSGREASAFVGLTPKQHSSGGKVFMTGIDRAGGIKELRSALYQG
FT                   ALSYICRLPDEPKTAKQAWLIKLVQRAGIKRSCIALANKTVRTAWAMLRYENQYKQQSL
FT                   LVI"
FT   gene            311828..312040
FT                   /locus_tag="Ping_0242"
FT   CDS_pept        311828..312040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0242"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: vvy:VV0810
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02109"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ4"
FT                   /protein_id="ABM02109.1"
FT                   /translation="MKFIRIKEVLNRTGLSRSVLYAKVAAQTFPQSFTLSGSTVAWLES
FT                   EIEEWIESRIQERDQRVKINSKGGV"
FT   gene            312326..312550
FT                   /locus_tag="Ping_0243"
FT   CDS_pept        312326..312550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0243"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: vvy:VV2250
FT                   predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02110"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ5"
FT                   /protein_id="ABM02110.1"
FT                   /translation="MKILRLADVVKKTGLSRAMLYKLMKDGRFPLNLHISMRSVGWVDS
FT                   EVEIWMENRLEMRATKEGKVTAGGDVCLQ"
FT   gene            312718..313293
FT                   /locus_tag="Ping_0244"
FT   CDS_pept        312718..313293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0244"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO0390.1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02111"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ6"
FT                   /protein_id="ABM02111.1"
FT                   /translation="MSKSVSIQPYYRYGDLLWKVNAGEYTPIYPSHLRKIIEQIYMMRK
FT                   TYRRTFVTFFDLHMPTNAETNTLVTNFLRRLRTKLKSVYKISKFGFSWCREQNTAENPH
FT                   YHFMLMVNGSAIRYPDKLMRLIKSLWSDICNGTARQSKNGYYMIFREDEEIMAEVIYRA
FT                   SYQAKLLSKSNRPIQTKTYGTSRLKSEK"
FT   gene            313396..314163
FT                   /locus_tag="Ping_0245"
FT   CDS_pept        313396..314163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0245"
FT                   /product="cell-division initiation protein DivIVA"
FT                   /note="KEGG: yps:YPTB1810 putative small subunit
FT                   bacteriophage terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02112"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ7"
FT                   /protein_id="ABM02112.1"
FT                   /translation="MANDWNRLNQQFMNEYALTKISVKEWCEKNNLIYNTARRYIKIIP
FT                   KLAQLRGDALSSEDVKNAQESFISKSNKDQIQSLRESEEDEVIYDNSAEIPGSKKRVKS
FT                   LGNQNARTYGHYSEFISTDQDAQRYSSAILATLQDELNLMRMQLSNLMVVIKKVEADLR
FT                   SELTAEQKVRLYKSYAKYQDILNVKIARIESLANSLMSQAKMKADIEKSNALTHKTQLE
FT                   ADKLGRDSGDSKTPLDEIYNDILNMDNNGMMNT"
FT   gene            314355..314894
FT                   /locus_tag="Ping_0246"
FT   CDS_pept        314355..314894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0246"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /note="PFAM: Resolvase, N-terminal domain; KEGG:
FT                   gsu:GSU1711 integrative genetic element Gsu5, resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02113"
FT                   /db_xref="GOA:A1SRJ8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ8"
FT                   /protein_id="ABM02113.1"
FT                   /translation="MKIGYARVSTQEQTLEVQIEQLNNIKCEAIYKEHASGKSSDRKQL
FT                   NLLIDFARKGDVVHVMKVDRLARNTIDALQLADKLANKGVGLVCHDLADLDINSDIGRV
FT                   IYTTISAFAEMERKRILQRCNEGREKAKEDGKHLGRFPDHDLHEQIHNLAGQGRNKHAI
FT                   SKELGCSRTTVYKVLG"
FT   gene            315442..315696
FT                   /locus_tag="Ping_0247"
FT   CDS_pept        315442..315696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02114"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRJ9"
FT                   /protein_id="ABM02114.1"
FT                   /translation="MASVFVLLLKSAYVEDIRNPVKKSDTASLAQASLVNSLNNEASKA
FT                   IPTAEGLVQNTANNYKLNFAYQALNRKHYDVAFSYCFDK"
FT   gene            315743..325579
FT                   /locus_tag="Ping_0248"
FT   CDS_pept        315743..325579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0248"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Hemolysin-type
FT                   calcium-binding region; Thrombospondin type 3 repeat;
FT                   Fibronectin, type III domain protein; KEGG: son:SO4025
FT                   OmpA-like transmembrane domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02115"
FT                   /db_xref="GOA:A1SRK0"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK0"
FT                   /protein_id="ABM02115.1"
FT                   /translation="MRKGIQIQKFLSVLCFFFVALLSTHAQASSTISGTVYGGPAVLEG
FT                   ASVGLLDENQEAIESITADITDSQGLYHFPMLADGTYYLTVTPPQSSGFPSSSAEQIVI
FT                   AGNDVQHNVVLLGSAVKLSGYLKDSQGRVIDNTQITLHGQESSDQIGNPVYTDSTGYYE
FT                   FSVAPGEYKLKPYLSPYGWYESGFGSHFPDYPVPDSARIYYLPQHIIVSADTVQDAILP
FT                   LVWLSGKTVDANGVAVPGVQLKISHYFSDYSTTPSTYYSLDNRGTNTNSNAISDENGDY
FT                   QFAVFANQAMDIIVTPPVERADLAVTTIFDVDITNDTSMDLAMVPSVKLSGYLKDSQGR
FT                   VIDNTQITLHGQESSDQIGNPVYTDSTGYYEFSVAPGEYKLRPYLSPYGWYESGFGSHF
FT                   PDYPVPDSARIYYLPQHIIVSADTVQDAILPWVWLSGKTVDANGVAVPGVQLKISHYFS
FT                   DYSTTPSTYYSLDNRGTNTNSNAISDENGDYQFAVFANQAMDIIVTPPVERADLAVTTI
FT                   FDVDITNDTSMDLAMVPSVKLSGYLKDSQGRVIDNTQITLHGQESSDQIGNPVYTDSTG
FT                   YYEFSVAPGEYKLRPYLSPYGWYESGFGSHFPDYPVPDSARIYYLPQHIIVSADTVQDA
FT                   ILPLVWLSGKTVDANGVAVPGVQLKISHYFSDYSTTPSTYYSLDNRGTNTNSNAISDEN
FT                   GDYQFAIFAHQAIDIAINPPEGSGFAITPISGITLTGDTSMTIVLDFVDTEAPLILNGP
FT                   MIRDVTSSSAVIEWTTDEPTNSVVSIGGQTINDTDFVTYHVVPLSGLSSNTPYTVTVKS
FT                   TDAQGNGPATGSSSFTRLAQLDTQAPVIISGPLVEQLTHNSAVVKFETDEVANGVVRLY
FT                   QSDVLVRELSSAAGTMHEVKINSLSANTQYSVRVEATDALGNGPTVSLQVELVTLSAPD
FT                   LTAPVILSGPLLIDVTSHEATVLWTTDEPAISGVSYNDNTVYDVLSDEALVTEHRMRLT
FT                   GLKSGVEYFITVSSEDANGNGPTLAGPVSVTTLLTDDINAPILLGAPLLHEINQNHIGL
FT                   FVHTDESAVVEVLYGTDQSNLNLTAGRAAPGTKTKVNLQHLEAATRYYFQLRLTDEVGN
FT                   TVLLPEIHSVITANNQKNRTLSFAIPPTVDYTSKSIMVVNWRTHQQTEGTLRCVDDSGN
FT                   TYSVSSRVMDNDNGSRNKGLRHQASLTGMTAGEYYSCSVVAYTAKDGAIEMAVEQQQLT
FT                   ASTQNISMVSSGTVSMANSIDNSAPMFLIEPTASYLNNNLAIIGWETDELANASILYWA
FT                   QNNDQRYSSGRTDHLASQQIVLSGLSSATHYEYQVTSTDLAGNQLVSAVKTLTTNSSAD
FT                   NNNPSFTEVPQSSDIQLTSLKLTFLSDELATAQIRYGLAADRFDNQAASELFTTNHAVV
FT                   LTGLEQGSRYYVEIVINDPAGNSSVTETLQVTTTGVPSVDETDTDNDGVLDVNDAFAGN
FT                   AAASTDTDSDGQPDNFNENCTETCVANSGLELDLDDDNDGYSDVDELANETDSLSAESL
FT                   PSDNDGDFVSDLTDTDDDNDGVLDVNDAFAGNAAASIDTDSDGQPDSFNENCAETCVAE
FT                   SGLVLDVDDDNDGALDTEDAFPLDAAESVDTDGDLIGNNTDTDDDGDLIEDTSDTCPLN
FT                   SGLSSVNDSTGDIQFFQYCLSNDAVPQIHFELELSDSFSSSQSFKLLYWLKDNEQHWIT
FT                   LTRDSTTGIFIANIELNQYTASGLYNVRAINLIDNQGNEVNLNENQLNLLGFTTSVSFD
FT                   NPIADTIKPSPKILTSSGWLINEEGQPQVNFSLVVEDNLSGVQERIVLELNSPTGVSLQ
FT                   EYGTKVDVDTYHFDFALNKYANSGEYTINTIRLYDNAGNSNNSQSWILENTEAYALTNP
FT                   NSDSTLSSLSYINIDVKFDELSDRPILMANGLVTDDVSGVQSVYLRLTRPNNGNLDKWQ
FT                   ELEVDTNKLNLTFSSEIALPQIYENGEYKIDFVRLIDFAENENYLYKENIEQVNQNSVT
FT                   SINLYYPDDDTSNSYDIDGSTGDDFVFGANRSDDYLVGLSGNDYIFAGNGDDHVVAGEG
FT                   NDLVIGGSGQGNDNYEGDAGVDTLKYTSAELPIIVDFISGTASGVDIDNDIFSGFEKII
FT                   AGQNNDVIITDANPNIVYGYDGDDIIVTSEGADELTGGNGKDEFIFNDLSKTRLSSFTT
FT                   IVDYQVEDTLVINGYTSMSTLAWSNNLNDSIIAIPNESQLYFTTDGNDGYLITVLDINA
FT                   KENSSVLKLSGVNDLNNLSVVNKSSKDNDGDGSYNYFDTDDDNDGIEDTLDAFINNVTA
FT                   SIDTDLDGQPDSFHSNCDETCVAESGLTLDLDDDNDGYSDVDELANDTNRLSAESLPSD
FT                   NDGDFVSDLTDTDDDNDGVLDVNDAFTGNAAASIDTDSDGQPDNFNENCTETCVANSDL
FT                   VLDVDDDNDGVLDVVDNYPVDNSESIDTDGDLIGNNADTDDDADGIIDLNDNEPLNAAV
FT                   GDEELPTFPTLDDVTVEATGANTVIKLAVPDVTDNNLNSAIVSSDYTDALSLGDHEITW
FT                   TATDFAGNKSTAIQLVHIVDTTAPSFGEMQIQTIDARGLRTNIANDITILAHDLVDGDI
FT                   EAKVNGDGLYSSGVHIVAVSAQDASGNKKETEVEIHINPQAELSKNRKVEPGATIDIPV
FT                   HLTGNAANYPVTINYEVTGVNLVVETAQITINEGVNGLLQVTIPSDAVNGEIVKISLKS
FT                   AANAILGDVFTMVLAVDVKNYSPRLHISIEQNDKPISIVDTQGGRVTITAVIDDMNILD
FT                   THDLTWNTGDDWLVDLNADAMVTTFELAPERLAADTYSLSVKVKENNTTELYEITIDVD
FT                   LVVNTALDALSAEFDNDNDGISDFDEGYADSDQDGISDYLDTDDNPSHLPIGEGMAPMQ
FT                   TINGLSLSLGDVVSSSRGANAQTASVDINDIAVNGGYKGSAVDNYVDSQFTRLSNITNF
FT                   NLSGLSNVGDIVPVVIPLAEGRYIPEAAIYRKYNAVKGWFDFIVDDDNALLSAFKDSDG
FT                   NCPAPLSSEYEKGLIAGDNCIQLLIKDGSNNDADGLVNGVIKDPGVLAIKIVNQAPVIN
FT                   INTRMEVNEESDTSIDASGTTDAENDTLTYQWSQVDGTLVTLTGEYSAILSFTTPSVSS
FT                   DELLTFELEVNDGQSSTTENIEVLVTQVNQIPSVTIGSHDASFNEGTSLTLSSQGLDAD
FT                   DNSLSYLWEQISGPSITISDATLANVTFTTPQVSNDQTIELKVTVSDGIEAVSTITSIE
FT                   VKNVVATTAAKESSSGAGAGAGGGSMGWWFILLGFAALGKRSFKQAA"
FT   sig_peptide     315743..315829
FT                   /locus_tag="Ping_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.956 at
FT                   residue 29"
FT   gene            326560..327123
FT                   /locus_tag="Ping_0249"
FT   CDS_pept        326560..327123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0249"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pub:SAR11_0874
FT                   phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02116"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK1"
FT                   /protein_id="ABM02116.1"
FT                   /translation="MLVRYLLLFFIISSGSVQSVFAATNVDPIMDKLREIDANVLFIRH
FT                   AIAPGFGDPDNFVINQCNTQRNLDAAGRSQAIALGQKLKQSNIVVDKVYSSYWCRCLET
FT                   AKLLQLGVVVKFAGLNSFFEEHADRNQTLKLLQEKLSELDQNSLTLMVTHQVVIQAVSG
FT                   IGVSSGGGVAYNTRTRKAVRVAIE"
FT   sig_peptide     326560..326628
FT                   /locus_tag="Ping_0249"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(327467..327748)
FT                   /locus_tag="Ping_0250"
FT   CDS_pept        complement(327467..327748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02117"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK2"
FT                   /protein_id="ABM02117.1"
FT                   /translation="MDKLWDDAQFKVENLIVMLTDATGSEIGKDLINVRTGRIEIAFKI
FT                   GDVSIEYGGDFYKLILGSLGYMASIKLSKTEANRLAKLLEIDITILDE"
FT   gene            complement(328062..328451)
FT                   /locus_tag="Ping_0251"
FT   CDS_pept        complement(328062..328451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02118"
FT                   /db_xref="GOA:A1SRK3"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK3"
FT                   /protein_id="ABM02118.1"
FT                   /translation="MSIIKQSSLFTVFLIIFGFILRYYSVYNLGIEINFLSIAVSVLIA
FT                   GLIGGAGFYLGQRTAKESLAIKHLAFSATLVFLVSHTLSYLLGLYQISWFAYVGVVFAA
FT                   SFIAAVRIPSLFSKTKHSTAKKSLN"
FT   gene            complement(328931..329404)
FT                   /locus_tag="Ping_0252"
FT   CDS_pept        complement(328931..329404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0252"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aae:aq_567 ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02119"
FT                   /db_xref="GOA:A1SRK4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK4"
FT                   /protein_id="ABM02119.1"
FT                   /translation="MKIRFMKKADLEGAASIHKLAFIRQKNSFEWIQCNFNAFPRFLNF
FT                   VAEKKGEVVGYITWVQKSGFRPEAVIELEQLAVLPNFQGQGIGRKLINESLPLVKGQLL
FT                   LNGSTLKHILVTTRADNFAQQLYKKTLGAEIETTIKNLYSADEVLMIARNVSI"
FT   gene            complement(329821..330783)
FT                   /locus_tag="Ping_0253"
FT   CDS_pept        complement(329821..330783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0253"
FT                   /product="prolyl aminopeptidase, Serine peptidase, MEROPS
FT                   family S33"
FT                   /EC_number="3.4.11.5"
FT                   /note="KEGG: cps:CPS_3964 proline iminopeptidase; TIGRFAM:
FT                   proline iminopeptidase; PFAM: alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02120"
FT                   /db_xref="GOA:A1SRK5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK5"
FT                   /protein_id="ABM02120.1"
FT                   /translation="MNELYPEIEPFNDFLLDVGCQHQLYVEQCGNVNGQPVIFIHGGPG
FT                   AGSSANDRRFFDPEKYHIILFDQRGCGRSTPYGSLADNTTVQLVADLEKIRNHLQLDKW
FT                   HVFGGSWGSTLALVYAQTHAEQVLSLVLRGIFLGRVQDTEWTFAGGGGSRIFADYWQEY
FT                   LATLPAAILSQHNHVKVAYDIMTGNDKDAAEKVAQAWANWEMRCCTLEPNDEFVSAATS
FT                   DDSCWTLARHEAHYMVNKCFLTDNQILKNCDKIANIPTVLVHGRYDIVCPFDNAWLLHQ
FT                   QLPNSQLVISKTAGHASVEPETKHHLLNATNAMLELSHY"
FT   gene            331406..332098
FT                   /locus_tag="Ping_0254"
FT   CDS_pept        331406..332098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0254"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: par:Psyc_0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02121"
FT                   /db_xref="GOA:A1SRK6"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK6"
FT                   /protein_id="ABM02121.1"
FT                   /translation="MLSHRSNEKEILDLGPDYYTEEEFTHCQKMLYRINKILGFFHGTV
FT                   NVLKTGGEKAHVVDVGCGAGLFILNLSRYFPKMTFHGIDISSEAINMANYEKSVFRSDT
FT                   SNVKFEKMAEPKLTFGENSVDVILATMVCHHMSNEEIIAFFKQALYTTKDKVIINDLHR
FT                   NSIAYWFYRLFSQILFSSRLITYDGLISIKRGFIRQELITLLEQAGMKHYQVKWCFPFR
FT                   WRVIIWKK"
FT   gene            332086..333144
FT                   /locus_tag="Ping_0255"
FT   CDS_pept        332086..333144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0255"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   par:Psyc_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02122"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK7"
FT                   /protein_id="ABM02122.1"
FT                   /translation="MEEVVIIGGGVAGLSCLNALLDQGISALLIEGSTIGTPKMCGEFL
FT                   APIAAQQLQRWDVDPLIPIPHAAFYAGIRQLDIHFTKPSAAISRSDVELKLAARARRLG
FT                   GRIRENTSLEHTTPATERTPFYFKLSTGEIIEAKSAFFATGKFGNNKDNKKIALPYFGF
FT                   KLHFSHTENDQSLKMFSLDKAYLGIVPITETISNCACLAKREAVDAATSPNEYFQHLTK
FT                   SHPVLKKIFTPLDLSSIDILSGRAPAFTQKNPPNWPNSYWIGDTLASLYPAIGSGFAHS
FT                   VDSAIQAVQFYLKQQPKLYRTNYSKSIKTKVLLGNVFNTALLHPKVGQLALPLLKRSPK
FT                   LVNLVLKKLDYV"
FT   gene            complement(333141..334229)
FT                   /locus_tag="Ping_0256"
FT   CDS_pept        complement(333141..334229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0256"
FT                   /product="Naringenin-chalcone synthase"
FT                   /EC_number="2.3.1.74"
FT                   /note="PFAM: chalcone and stilbene synthases domain
FT                   protein; Chalcone and stilbene synthases domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal domain protein; KEGG: par:Psyc_0421 possible
FT                   chalcone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02123"
FT                   /db_xref="GOA:A1SRK8"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK8"
FT                   /protein_id="ABM02123.1"
FT                   /translation="MKSSISAIGTAVPQHKFKQSEAAALISERLQLSPAKKRMLRSIYK
FT                   ATGIESRHSVISDMGHLSNSRSDISSPDLSTAGRMALYKEHALPLAISAIKQCMDQSDA
FT                   TFADITHVITVSCTGMYAPGLDIEIVQQLKLRTNAKRTAINFMGCYGAFNALKVADDIC
FT                   RANKGAVVLIVSVELCSLHFQNDEDLDHLLSNAIFADGAAAALIQPMAENQKSLSIEAF
FT                   NCDLLPQTSEDMAWHIGDSGFDIVLKSYIPEVIESGIAEFMDKLLRQEAITEVNHYAIH
FT                   PGGMKILQACETALNITKDKNKHAYHVMREYGNMSSATILFVLKELMTHLTVNNHQETI
FT                   FSCAFGPGLTLESMLLKINQPH"
FT   gene            334620..337346
FT                   /locus_tag="Ping_0257"
FT   CDS_pept        334620..337346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfa:PF13_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02124"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRK9"
FT                   /protein_id="ABM02124.1"
FT                   /translation="MNDNNSPDENNVWRIDKTPNLLHRCFISEQLCVEERKICKYWEER
FT                   QSGKNTPQAFVVMAFNFRNNMLYERQIKPMLANLDEPLLPCRADTLIRTGYIVCRKVCQ
FT                   PILESDLVVVELTILNKNVTYELGLSLALERKILLMVQEQEPEEKIDLSNDVNNLFRRL
FT                   DIKESELFRYKPFGFITTSAQELQNSLWKGADKELRQTDSLQCRIGVLGADHLVPLSTS
FT                   NIDFQIPLPNSNIETQPKSQLTDALRCHLGNVIRDAVCNILGYESEKEYEEYLKSRGNS
FT                   KQKKEDKVDVDKCKERNDFLGNYTATQGKKFSDISAQEYNKKKYYPWMHLQSMRTDKKS
FT                   FTEIVDFIDSRECLAIDLTKTGNNLNDAINLFWLGYAHGKGKTVIPVYAYSSDKEQAEL
FT                   GHSNFDVQGLYFLGYDIRNPKAIDDDLMAMFKDILESTETERSRNKLWKPIFEGADLQI
FT                   SVGATVHKGSEKYSLIEWDHMVLAELHSFISEKRSTLHYKISYPTYQQPDTVNKKLIEG
FT                   VCLDKFLQGKIEKQNVIIIGSPDVNIITELVLAKAKGIAPFSPEKITKESQKFFEGLVS
FT                   VKSNNNNTRGIRYYYKDSKDKEEDKYESSYNYRFLDKPDNSEQSDDKVVSSNQYTFFQN
FT                   EDEDEDEDKDKEEKEKEKKGEKAKKDKGSTGFTKFHRSYGHIAIFENPYSEGKRIIVLS
FT                   GISGPATLALAQMLTGCINEETNYQLQYRVDKEKIKVDERKIHILGGVAENENENENDK
FT                   SKTESFIADLFYEHQDQEDLRSIFKGVKEDNKTEEVKKKIKYETDSGKQKGYRPLKIDL
FT                   SKKSLEMLEKINTEITEGYKQQTKNKKQTNNNFMVEAVVEVLLTENVEHEDKNTVIHWQ
FT                   DPRKVVAWRFAKDPFRTKTPLKDISSDLHFPKSEKQQ"
FT   gene            complement(337553..338977)
FT                   /locus_tag="Ping_0258"
FT   CDS_pept        complement(337553..338977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0258"
FT                   /product="phospholipase"
FT                   /note="KEGG: lpp:lpp1568 phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02125"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL0"
FT                   /protein_id="ABM02125.1"
FT                   /translation="MLVIFIHGWSVVDTSAYGLLPEALAEQADQYKLKIEIKHIWLGRY
FT                   ISFNDEVSVADVARAFHDALHDQIPNGVGGIADFSCITHSTGGPVVREWLNRFYMGSLL
FT                   SQSPLRHLVMLAPANHGSPLAALGKQRVGRIKAWFSGVEPGQRILDWLSLGSHQQIALA
FT                   QSYLTYKPAENKFFPFVLTGQTIDKKLYDFVNNYLVEAGSDGVVRVACANLNYSMIKLV
FT                   EEKVAHDSDEKKARLLEVEGELQRPSLAPFGVIPGASHSGKDKGIMRSVLSAKSKNKPQ
FT                   VTEILKCLTVNNQADYTNRGKELEILTQESQKGTHRYVMLVFIIKDDQGDPVNDYDLLL
FT                   LGGDSHNPNKLTKGFFVDRQQNAAHPNHLIYYVDYDLVIKNKLTGFRVIARPADGFVFY
FT                   HVVEYRANGLNINDLIKPNETFYVEIQLHRCVDKNVFRMDNASDPKLRKEGFLIKSETR
FT                   HSFENLEPSKEEINKS"
FT   gene            339014..339340
FT                   /locus_tag="Ping_0259"
FT   CDS_pept        339014..339340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02126"
FT                   /db_xref="GOA:A1SRL1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL1"
FT                   /protein_id="ABM02126.1"
FT                   /translation="MIQSGKVYFPFYNLISNPMIKCRKFLEITRTVALFVGSAENNHCV
FT                   FHFYLILVPFLSISIIPSWYFHNLKSISGRKQILVLILDDGDNGGYFIGFSDFLLINRS
FT                   DKLI"
FT   gene            complement(339696..341531)
FT                   /locus_tag="Ping_0260"
FT   CDS_pept        complement(339696..341531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0260"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor, extracellular
FT                   region 2; Diverse 7TM receptor, transmembrane region; KEGG:
FT                   sde:Sde_3939 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02127"
FT                   /db_xref="GOA:A1SRL2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL2"
FT                   /protein_id="ABM02127.1"
FT                   /translation="MPYHKNSTKPAYRTLTFLFTSLLVLLFFLLSTRFSLAESTISLKQ
FT                   VMQGQSTDLSIYYLEDPEKSYNIDQLQSAPLFSKFQPLPNGKSSFGISSSDYWLKIIVR
FT                   NTDDTDLLWLLEIVHQQWDHVNLYINGEKKFYAGDHIPFTQRAFASENNVFEITTAVKA
FT                   EQQLLIHFSYEQAGQAETQIRLWTVKEYSQYYANRYFIIGAMFGLGIILFFYNLFIGYS
FT                   TRLPQFLWYSGYIISALLAFLTDKGFGYRYLWSNSNWFSDFSPVFFIALVMIMATQFTR
FT                   SFLNTATESVNIDRLLQLIFVVAGLSIFFSLIGYRDYAVILGLLSMLTSIFFPVIGWVI
FT                   YLKGRSYARFYILGWSIWSLGMILAVLQHIGMIPVTLYSDLSTGLCFSIEAALLSFALA
FT                   DRFNQLRNEKEEIELIHIEHLKNDQQLLEQLVTERTEELEQAKDRAELLARTDPLTNML
FT                   NRRAFFECGSVEIKRSLRYKSSLAIMMIDLDHFKSINDNYGHAAGDNALLSVANTLKAM
FT                   IRNVDIIGRIGGEEFAVIIPHADLEIATELAQRLRLGIEKVEIIIDNQPVKITACFGVT
FT                   SIDIKSESLDEALKRADKALYLAKENGRNRVEQLA"
FT   sig_peptide     complement(341418..341531)
FT                   /locus_tag="Ping_0260"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            341934..342392
FT                   /locus_tag="Ping_0261"
FT   CDS_pept        341934..342392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0261"
FT                   /product="probable transposase"
FT                   /note="KEGG: pha:PSHAb0027 Peyer's patch-specific virulence
FT                   factor GipA (transposase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02128"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL3"
FT                   /protein_id="ABM02128.1"
FT                   /translation="MSNSFKWGAGFNACQNEASVKNRGSRLFTGKLSSLIISKPTSGKH
FT                   YVLLLVKEDFKLLPAVNKTVWIDVGIKDLAICSDDTKFNNPRLTVKYAAKLAKASRRLA
FT                   KIKKGSNYFNKQKEAGYCLNPQKNNPLTQRFYPQDDLKTYKQKQNDRY"
FT   gene            343179..343451
FT                   /locus_tag="Ping_0262"
FT   CDS_pept        343179..343451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1546 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02129"
FT                   /db_xref="GOA:A1SRL4"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL4"
FT                   /protein_id="ABM02129.1"
FT                   /translation="MTVSFEDKSKADQYWQENINLVIRLLIIWAVVSFGFGILLVDVLN
FT                   EVTFMGFKLGFWFAQQGAIYVFLFLIFYYRAKANKLDEKYGVQED"
FT   gene            343463..345181
FT                   /locus_tag="Ping_0263"
FT   CDS_pept        343463..345181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0263"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: sfr:Sfri_1547
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02130"
FT                   /db_xref="GOA:A1SRL5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR019899"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL5"
FT                   /protein_id="ABM02130.1"
FT                   /translation="MDVQTLTYTIVGMTFALYIVIAIWSRAGSTKEFYVAGGGVHPIVN
FT                   GMATAADWMSAASFISLAGIVSFVGYDGSVYIMGWTGGYVLLALLMAPYLRKFGKFTVP
FT                   DFVGDRYYSQTARTVAVICALVVSFTYIAGQMRGTGVVFSRFLEVDIDTGVYIGMAVVF
FT                   FYSVLGGMKGITYTQVAQYCVMIFAFMVPAIFLSIMMTGHVFPQIGFGSELLDAAGNNS
FT                   GVYLLDKLDGLSTQLGFAEYTVGTKDTIDVFFICGALMFGTAGLPHVIVRFFTVPRVKD
FT                   ARTSAGWTLVFIAILYTTIPALAAFSRVNMIETINGPEGKGVSHAEAPSWINSWEKTGL
FT                   IAWDDKNGDGKMYYAKGEANEMKIDRDIIVLATPEIANLPAWVIALIAAGGLAAALSTS
FT                   AGLLLVISTSVSHDLLKKNMMPDISDKRELLYARMAAGVGVLIAGYFGVNPPGFVAAVV
FT                   AIAFGLAASSLFPAITMGIFSKKMNKEGAISGMAAGLLFSIAYIVYFKFVNPAGNISEN
FT                   WLFGISPEGIGLVGMCLNFIVAIIVCRMTAPVPQDVQDMVEAIRFPKGSGEASDH"
FT   gene            345301..347145
FT                   /locus_tag="Ping_0264"
FT   CDS_pept        345301..347145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0264"
FT                   /product="signaling protein with a cAMP-binding site and
FT                   CBS domains"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative; KEGG: shm:Shewmr7_1582
FT                   cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02131"
FT                   /db_xref="GOA:A1SRL6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL6"
FT                   /protein_id="ABM02131.1"
FT                   /translation="MDNSELQPIVDFMGKLAPFDSLPEHIIKQCCQILTIAYYSKQQKL
FT                   VSVDSNAPQLYIVRSGAFEVTTEDGELIDRVGEGQYFGFSGLLSGEKVVNQIHILEDGL
FT                   VYHLPAKMFDQLRANSHSFDRFFNQAFAKRLRNQGTLQHDNISTARITHIMSKDLTTIT
FT                   ADASIHQAALLMSKKRLSSLVVVDQEKLCGILTDRDLRNRVLAKGLNGDLLVGQIMTKD
FT                   PVIIEPNALMFEAMLKMSENNIHHLPVVREGRPIGIITSTDLIRSQSSQPLLLIGQIER
FT                   QNSLEALIKVSQKIPDLLHNLISSDAKAIEIGRILTSVTDSLTRRLITLKQKQLGPAPM
FT                   GFCWLAFGSQGRQDQMAGSDQDNALILARDTTAAEKDYFKQLSEYVCSALNECGFPFCP
FT                   GNIMAQNPQWQLTLQQWQQQFSSWVKTPKPSALLNATIFFDMRGVFGDLALFNTLQLSV
FT                   LKNTKNNDIFIAALSQNALQSTPPIGFFRSFVIERDGSEVKGIDLKHKGNALINDIVRI
FT                   YALAAGIKEVNTTKRLESLMAKSKIDKDIAMSLLDSWEFIAHKRLINQGRQFNNTEPVS
FT                   NYILPDSLSSLVRHQLKDAFKVIHEAQDTVRLKFLRQF"
FT   gene            347145..347831
FT                   /locus_tag="Ping_0265"
FT   CDS_pept        347145..347831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0265"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: she:Shewmr4_1516 exonuclease,
FT                   RNase T and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02132"
FT                   /db_xref="GOA:A1SRL7"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL7"
FT                   /protein_id="ABM02132.1"
FT                   /translation="MFKQWWLQYKLKRLIKNSKLAALKAHYQYLLTQLNRPIAEATLLA
FT                   LDIEMTGLDPKKDQMVSIGIIPIINAKIQPEFAQHKLIKIQGSVGQSAVIHGVLDKDLA
FT                   DALPLEEALQWLFEQCKDKVLVAHHAQLDLQFLQQSLSKSGAHSFSMLAIDTLIIEKER
FT                   ELRKHQVLKTGSLRLNACRDRYNLPIYNAHNALTDALACAELLLAQLNQMGGLDNITLV
FT                   QLLTKR"
FT   gene            complement(347926..348807)
FT                   /locus_tag="Ping_0266"
FT   CDS_pept        complement(347926..348807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0266"
FT                   /product="predicted outer membrane protein"
FT                   /note="KEGG: pat:Patl_2401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02133"
FT                   /db_xref="InterPro:IPR022565"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL8"
FT                   /protein_id="ABM02133.1"
FT                   /translation="MKHIKLITAFSLSLFTLIANANVSIIETDSFNQVSNTVAKKAQQY
FT                   GVKNTLIVFDIDNTLLTSNVDLGGDIWYQWQTGKLEIKPTKAQIVPCLFEDAIGLLYKL
FT                   GTMVPTEAQVPSLISQWQLNGHNVIALTARPPNVRPPTERALTRRSINFSGSAVAPIGE
FT                   KSPVYRAMVTIDNQTREVSYMSGIMMTTGLHKGDSLKYLLNLTERHFDAIVFVDDSENN
FT                   ITDMSQSFKSESDVDLTAIHYTYIEEQRKKKFGAVLTQQQANTMASQWNDLKLKLDTLF
FT                   PGRKNGGKCLNQ"
FT   sig_peptide     complement(348742..348807)
FT                   /locus_tag="Ping_0266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            348831..349111
FT                   /pseudo
FT                   /locus_tag="Ping_0267"
FT   gene            349324..350451
FT                   /locus_tag="Ping_0268"
FT   CDS_pept        349324..350451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0268"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="PFAM: peptidase M14, carboxypeptidase A; KEGG:
FT                   pcr:Pcryo_1240 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02134"
FT                   /db_xref="GOA:A1SRL9"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR040626"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRL9"
FT                   /protein_id="ABM02134.1"
FT                   /translation="MRITANFDSGNIDVINLKDKKDIQLSIRPDFGGEFFQWFNFRLEG
FT                   EVGQQYILNILNAGEASYLEGWENYQAVASYDRKHWFRLPTFYKEGKLTIVADLDCETI
FT                   QIAYFAPYSYERHQDLLAAVQTHPLVSLEHLGETLDQRDLTLVKIGDGDTNKRNIWITA
FT                   RQHPGETMAEWLVDGLMDSLLDSNNPTGKLLLDKANFYIVPNMNPDGSARGHLRTNAAG
FT                   VNLNREWLNPSLEKSPEVFHVINKMEETGVDLFYDVHGDEALPFVFLAGSEGTPSYNNR
FT                   LAGLRKRFSEVLMLASADFQSEFGYDVDAPGEANMTLATNWVAERFDCLANTLEMPFKD
FT                   NDNLPDPMMGWSPERSLKLGEASLVAMLAVVDDLR"
FT   gene            complement(350646..350969)
FT                   /locus_tag="Ping_0269"
FT   CDS_pept        complement(350646..350969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA1132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02135"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM0"
FT                   /protein_id="ABM02135.1"
FT                   /translation="MLVTFSCPAYADITMFGDVAIKLLKIMGHSGTVPGAIGAEDVQAA
FT                   LLSLETATKPSPEPITPIKQEDDENDENDEPAISLSHRALPLIELLRAAAEEKCNVMWD
FT                   GNQ"
FT   gene            351737..352102
FT                   /locus_tag="Ping_0270"
FT   CDS_pept        351737..352102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0270"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA3195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02136"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM1"
FT                   /protein_id="ABM02136.1"
FT                   /translation="MNKKGLKIFTVLSLCSAVAQAEVECRDPVDKWQPQQQLRQRLEQK
FT                   GWQVKRIKVDDNCYEVKALDHQGNKIEARFGPAELDILELEVEIVGTEKIEKFLENHGE
FT                   AQPLPAIKHKNSKEIIK"
FT   sig_peptide     351737..351802
FT                   /locus_tag="Ping_0270"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.943 at
FT                   residue 22"
FT   gene            352099..352572
FT                   /locus_tag="Ping_0271"
FT   CDS_pept        352099..352572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0271"
FT                   /product="Tat (twin-arginine translocation) pathway signal
FT                   sequence domain protein"
FT                   /note="KEGG: bpm:BURPS1710b_A0492 Tat (twin-arginine
FT                   translocation) pathway signal sequence domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02137"
FT                   /db_xref="InterPro:IPR014469"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM2"
FT                   /protein_id="ABM02137.1"
FT                   /translation="MNRLIMLAFFVSSLIFATSSQARMINFTTEMTNYSGDGAYLVLYL
FT                   TDANGRYEDTLWVAGEKSKYYKHLRGWARSGANNGSRYDGLTGASRGNGETFTITVDVA
FT                   DNLIDTGYLLRMDTAVEDMRENRDDVVVPLSSEGAGKAVSGRGYVKSFTYTFN"
FT   sig_peptide     352099..352167
FT                   /locus_tag="Ping_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            352591..354813
FT                   /locus_tag="Ping_0272"
FT   CDS_pept        352591..354813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0272"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; PepSY-associated TM helix domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: eba:ebA3193
FT                   putative oxidoreductase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02138"
FT                   /db_xref="GOA:A1SRM3"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM3"
FT                   /protein_id="ABM02138.1"
FT                   /translation="MLRKLHSYLGLAASILVVLLAISGAVLAINPALDRAQAKVSGTDQ
FT                   ISVADVAANIARFYPNVEQLQRKASGGLIVYYSNANKAGADLVDPFTGEKIAAYSLSPF
FT                   KRWVQNFHRSFLLDTPGRAAGGIGALLMVVLSISGLFMLRTRQGGWRKIFRSMPGSIKQ
FT                   DLHGHFSRFAVLGLVLSAITGGYMSANRFELIPVYQQVDPAFPETVNGGKPAAVDALPA
FT                   LQDIAFSDLRELVYPYAGDIRDVYSLRTDQGVGFIDQATGELLSYQMYGTPQKIYEFIY
FT                   MLHTGEGLWWLALLVGLASFSVPLLAVTGLQIFMKRRRSIIRIKNNATANSADIVILVG
FT                   SESNSTWGFAKTLHDALSLSGYRVHSNSMNNIASTYPKAKQMFILTSTYGDGDAPASAK
FT                   LFMNKIKRFANNPNFQFCVLGFGDRTFDSYGQFALDVNNVLLNKGWNPLTNIDIIDKQS
FT                   TQAFNRWGTVVGSLMGLDLDLIYCPVHLNTQLLQLVDRVDYGAEVNAPTAILRFIPAEK
FT                   KTATFFNKIRRKPRLPQFSAGDLVGILPTESDGARFYSLASASKNRQLEICVHQHPQGI
FT                   CSNYLHKLQLGECIKGFIRENPTFRPRLEQSSIILIGAGTGIAPLIGFIRNNHTCHPMR
FT                   LYWGGRDPNSDFLYRAELEQYLQDKRLTELVTAFSRTEESCYVQDKVLADAPKIQALIS
FT                   EGAQILVCGGRPMSKCVAAAITRVISPLQITLQDLKEQGRYLEDVY"
FT   sig_peptide     352591..352677
FT                   /locus_tag="Ping_0272"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.792 at
FT                   residue 29"
FT   gene            355400..358636
FT                   /locus_tag="Ping_0273"
FT   CDS_pept        355400..358636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0273"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: tte:TTE1100 diguanylate
FT                   cyclase/phosphodiesterase domain 1 (GGDEF); TIGRFAM: PAS
FT                   sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; histidine kinase, HAMP region domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02139"
FT                   /db_xref="GOA:A1SRM4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM4"
FT                   /protein_id="ABM02139.1"
FT                   /translation="MSLTSWFRNISIRRKLIVISFFSITAATLLAILLSTLMQWSMLRE
FT                   DLIKNVSAQASIIAASSANELASNDREAAQKIVAVVVNINNIEFAGILDKKGNNFALYL
FT                   RPGVTIAAHSHQGEKGASQIQNAAYIEISLPVLLDQEQIGRIHVRSDMNPVYHKLKLNI
FT                   LIIVVSAAGAFLLVVLMLMRLLPVITKPLQDLVGLMEIVSRDNNFTLRAKLSGTVEIDM
FT                   LAKGFNAMLAQLQIFDNAFIQNSQHLEDEVAQGTEQFLESDTQLEKELVEHKLGKQKLK
FT                   NVNEQLSALLNSLPIAVYRSRAEGDFAMIYMSPNVLSFTDYEPKDFIEQSDLWLTRLHP
FT                   DDAEKMTSEMELLFEKEAHVYEYRWMRADGTYIWIQDSLRIIPEEDGIPLHLAGMWQDI
FT                   TTRKKVEEQLRKREFAYRTLTQNLPGIVYRLFVDEGHRMEFYNEMVLQTTGYRADELTD
FT                   SSIKPLILDEDRPAVMAKVMLAVKEQCPFTVEYRLKHKNGTICWMVEYGMPVYEDRNVL
FT                   LYIDGLIFDITDRKVAEEDSHKQQELTNLIIEAIPMRVFWKDQNLRFLGCNTLFAKDAG
FT                   YIKPEELIGKNDFDMAWKDQADLYHSDDRQVVDSGTPKLSFDEPQTTPDGRQIWLRTSK
FT                   VPLHNDAHQSIGILGIYEMITEYKQLELKLRESEERFRNVTELTSDWVWQIDQNGIYVY
FT                   SGGKSRDLLGYEPEEVYGNTLFDFMSPEEGARVGAIFKKLTCEQKPFSFMENTILHKDG
FT                   HQVILETSGVPLFSDDGIFQGFFGTEHDITERKQAKEALEESEYKFRTILDVAADGVCL
FT                   VDKQTRKFIQGNNAICKMLGYRDDELYELGIEDIHPAEALAEVFLQFNKKRQGEIIVVP
FT                   NIPVKRKNGSIFLADISSAAIILDGRTIMVGFFHDVTERKKVEEEIKLLATTDSLTGIA
FT                   NRRAFSTHLASELERSNRYGTPLSLVMFDIDYFKKVNDNFGHDAGDDVLQALSELVKRN
FT                   IRAVDIVARWGGEEFMLLMPESDISAATAAIEKLRREISDFPFGQVGSLTVSFGITVFV
FT                   LNEDSKVFLKRVDDALYQAKEKGRNRVEIL"
FT   sig_peptide     355400..355495
FT                   /locus_tag="Ping_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.473 at
FT                   residue 32"
FT   gene            358840..359130
FT                   /locus_tag="Ping_0274"
FT   CDS_pept        358840..359130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN5015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02140"
FT                   /db_xref="InterPro:IPR017162"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM5"
FT                   /protein_id="ABM02140.1"
FT                   /translation="MTIKPSKTQTSFLRRLLVAYLIDNDFNTVPKIIDATGMPRRTAQD
FT                   TIKALHEIEVKIEQSARGEYRITDWGAVNKDWVKNNLRHVCEVLSYLNVEI"
FT   gene            complement(359814..360869)
FT                   /locus_tag="Ping_0275"
FT   CDS_pept        complement(359814..360869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0275"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bpm:BURPS1710b_0135 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02141"
FT                   /db_xref="GOA:A1SRM6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM6"
FT                   /protein_id="ABM02141.1"
FT                   /translation="MHFVQQHHDRYAIALERCKSFTFDVNQQAESLIKWEQRYNQHSSG
FT                   RFSGYLDELKLGGIHLFEEFTNQTLLQQCCVKENSLWIGFSLQAQRPKINNNKIAAGQL
FT                   MMRPSGVDFELMTPQDFHIFGLVLDGKSLQDEMVEFDAERWQSQKNKILVSEPNHYMIY
FT                   ELAKLIQLLLGNNHYAAFQNRPSDESNRSRLNKLMPLILSRIADLLAQIESGVKELQVQ
FT                   PQTKQKVISAVSRYIKQTNRYPLTITELCKITHVSRRALHYCFEQGLGVSPIQYIRDCR
FT                   LNEIRRILLRDETEVIISDLALDFGFFHISTFNAHYKQLFEETPTQTIQRSANYKNAII
FT                   SYPKAGTDARS"
FT   gene            361059..362459
FT                   /locus_tag="Ping_0276"
FT   CDS_pept        361059..362459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0276"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: pat:Patl_1427 ethanolamine ammonia lyase large
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02142"
FT                   /db_xref="GOA:A1SRM7"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM7"
FT                   /protein_id="ABM02142.1"
FT                   /translation="MANYRYQLGSHVYQFASLADVMAKASPLRSGDQLAGVAALSSEQR
FT                   VVAQMLLADMPLKDFLQEMLIPYESDEITRLIIDEHDSGAFAEIAHLTVGDFRNWLLKE
FT                   TTTAVELARVRSGITPEMAAAVSKIMRNQDLILVAKKCHIITQFRNTIGLSGHLSTRLQ
FT                   PNHPTDDVNGIAASLFDGLMYGNGDAVIGINPATDNVQQAVKLMKLMDDVIQHYEIPTQ
FT                   SCVLTHVTNTIEAIELGAPVDLVFQSIGGTEATNQGFGINLNVLNEAHQAALELKRGTV
FT                   GNNLMYFETGQGSALSANGHHNIDQQTCEARAYAVARKFNPLLVNTVVGFIGPEYLFDG
FT                   KQIIRAGLEDHFCGKLLGLPMGCDICYTNHAYADQNDMDNLLTLLGVAECSFIMGIPGS
FT                   DDIMLNYQTTSFHDALYARQVLGLRPAPEFDQWLKKMNISSADNRFQLSDQLPASFAHP
FT                   LEMIKEAL"
FT   gene            362456..363292
FT                   /locus_tag="Ping_0277"
FT   CDS_pept        362456..363292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0277"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   pat:Patl_1428 ethanolamine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02143"
FT                   /db_xref="GOA:A1SRM8"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM8"
FT                   /protein_id="ABM02143.1"
FT                   /translation="MNKVVPSSEEMVHKDPWEKLRQFTNARIGLGRVGTSIPTAELLRF
FT                   QLSHAQAIDAVHVPLDVEQLDQQFAASDVLQPYLPIQKLHSKVRDRMEYLQRPDLGRQL
FT                   DDASIYKLQQKNTGESYDVVFVVADGLSSYAISNHAKPFLDILINSLNQDPNKEWKIAP
FT                   LCLVLQGRVAVGDDVCEALNAKAVVLLIGERPGLSSPDSMGLYLTWNAKRGIEDSQRNC
FT                   VSNIRPEGLQYQAAAHKCRYLLNESQRMKLSGVSLKDRSEDLQLESTTTQQFCLTI"
FT   gene            363314..364705
FT                   /locus_tag="Ping_0278"
FT   CDS_pept        363314..364705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0278"
FT                   /product="ethanolamine:proton symporter, EAT family"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: hch:HCH_06322 amino acid
FT                   transporters; TC 2.A.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02144"
FT                   /db_xref="GOA:A1SRM9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRM9"
FT                   /protein_id="ABM02144.1"
FT                   /translation="MSNNEEYLAQRQLKKGAAGWILLAGLGISYVISGDFAGWNFGIAQ
FT                   AGWGGFVIAAVLMGIMYLTLVLSLAEMSAAIPAAGGGYSFARQAIGPAGGYLTGLAVLI
FT                   EYTLAPAAIVIFIGSAVNELVGIDGPIVYALFYLIFVGIHIFGTGEALKVMMVISGLAV
FT                   LAIIATAVVLLPEFDAARLFDIEPALNGTEFLPMGYYGVWAALPFAMWLFLAVEGVPLA
FT                   AEEAKDPAKDVPKGIIAAIIFLLFTAVLVVVLVTGAAGAQVTGESAVPLVDALNMTGHN
FT                   NVATMVNILGLAGLVASFFSIIYGYSRLVFALSRAGYLPQRLSLTSKRKVPVRSLVYPG
FT                   ILGFLISLTGEGDLILSMAVVGATVSYAMMSGSHILLRIKQPELKRPYKTPGGIVTSGI
FT                   SFVLSLVALTGVYAYDVRAFLFTLVLFIVGMAYYFFIGRKNLVAATAEEEFALLSQAED
FT                   ELVSA"
FT   gene            complement(365395..365601)
FT                   /locus_tag="Ping_0279"
FT   CDS_pept        complement(365395..365601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0279"
FT                   /product="cold shock protein E (CspE)"
FT                   /note="PFAM: Cold-shock protein, DNA-binding; SMART: Cold
FT                   shock protein; KEGG: sde:Sde_3558 putative cold-shock
FT                   DNA-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02145"
FT                   /db_xref="GOA:A1SRN0"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN0"
FT                   /protein_id="ABM02145.1"
FT                   /translation="MSKVQGTVKWFNESKGFGFIEQASGPDVFAHFSAISSEGFKTLAE
FT                   GQKVEFTITQGQKGPNAENIVAI"
FT   gene            complement(366571..367218)
FT                   /locus_tag="Ping_0280"
FT   CDS_pept        complement(366571..367218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0280"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; 17 kDa surface
FT                   antigen; KEGG: vvy:VV1959 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02146"
FT                   /db_xref="GOA:A1SRN1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN1"
FT                   /protein_id="ABM02146.1"
FT                   /translation="MNKKLVTALMVVTLLSGCVNRQNATTGEQEMNTATKSAIGGAIAG
FT                   ALAGAATGKKNGALFGAVGGAAIGGGVGYYFDQQEAALRQELLNSGVQVKRVGEYELQL
FT                   IMADGIGFDTGNYQLSGSIFSTLNGVAKVLNEYPKSSLRIIGHTDSVGSSESNLTLSER
FT                   RAESVSNYLMQRNVKSGRLSTLGYGERRPIATNDTPYGRAANRRVEINIIAN"
FT   sig_peptide     complement(367147..367218)
FT                   /locus_tag="Ping_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.706 at
FT                   residue 24"
FT   gene            complement(367681..369108)
FT                   /locus_tag="Ping_0281"
FT   CDS_pept        complement(367681..369108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0281"
FT                   /product="sensor histidine kinase with ATPase domain"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; KEGG: shm:Shewmr7_3909 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02147"
FT                   /db_xref="GOA:A1SRN2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN2"
FT                   /protein_id="ABM02147.1"
FT                   /translation="MPKRATNLNSLKTRLIVSALLFILVLMPLIGLTLNDAFKEQVKSA
FT                   SKNELSAYVYSVLAVTEFDNGQLLMPDLLLENQFNVIQSGLYALITMPNVKDNDPRLES
FT                   DSTNLVSDRKKETGNTRIAWQSDSFLGFKAPANLPHPATGQSEFSEIKLEGKPYLIYSF
FT                   TASFEQSAQSDGAAALPITLHIIKDQVDFQRQVDLFTKQLWSWLLILMALLVIVQIVWL
FT                   LWTLKPLAKFTKELNDIEQGRTQQLNEIYPTELQAVARQLNALLNTEQSQRKRYRNALS
FT                   DLAHSLKTPLAVIQSQKGLNHAAIEQISIINSIIGHQLKRAQTAAGASWHLGIKVKSVS
FT                   DKLIRTLHKIYREPQISISQNINRQAVFKGDEADLTEILGNVLDNACKAATSQVALTVT
FT                   SNKKVLIITVEDDGKGISPEQHIQIFERGMRADSYQSGHGIGLAIVRDLTDSYNGQLAV
FT                   STSQTLGGAKFEFHFRF"
FT   sig_peptide     complement(369007..369108)
FT                   /locus_tag="Ping_0281"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.396 at
FT                   residue 34"
FT   gene            complement(369108..369800)
FT                   /locus_tag="Ping_0282"
FT   CDS_pept        complement(369108..369800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0282"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: son:SO4647 DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02148"
FT                   /db_xref="GOA:A1SRN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN3"
FT                   /protein_id="ABM02148.1"
FT                   /translation="MRILLVEDDISLQSNLKQHLIASHYRVDAASDGEEGLFQGIEYNY
FT                   DAAIIDLGLPKIDGITVITRLREKNRNFPILILTARDSWQDKVEGLDAGADDYLCKPFY
FT                   PEELVARLNALIRRSAGKASPVINNGPFSINTSSLEVKKEHEFISLSASEYKIFEYFML
FT                   HPGEVKSKTVLTEHIYDQDFDLDSNVIEVFIRRLRKKLDPDNEYGLIETLRGQGYRLTP
FT                   LPTSQSDG"
FT   gene            complement(369843..370109)
FT                   /locus_tag="Ping_0283"
FT   CDS_pept        complement(369843..370109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_1133 propeptide, PepSY amd peptidase
FT                   M4"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02149"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN4"
FT                   /protein_id="ABM02149.1"
FT                   /translation="MKMASILTLAVCLFLPLTASANDESLKIKVGSTARAVQLVKHQYQ
FT                   GKVLRVQASNAQGNPGYKVKMISKEGRVFYLFVDAQNGNISGK"
FT   sig_peptide     complement(370044..370109)
FT                   /locus_tag="Ping_0283"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 22"
FT   gene            370730..371785
FT                   /locus_tag="Ping_0284"
FT   CDS_pept        370730..371785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0284"
FT                   /product="selenophosphate synthase"
FT                   /EC_number="2.7.9.3"
FT                   /note="TIGRFAM: selenide, water dikinase; PFAM: AIR
FT                   synthase related protein; AIR synthase related protein
FT                   domain protein; KEGG: plu:plu2551 selenide, water dikinase
FT                   (selenophosphate synthase) (selenium donnor protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02150"
FT                   /db_xref="GOA:A1SRN5"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN5"
FT                   /protein_id="ABM02150.1"
FT                   /translation="MSADYEHTNVRLTQYSHGAGCGCKISPKVLDSILVSALPAFQDPN
FT                   LLVGNENKDDAAVYDLGNGSCIISTTDFFMPIVDDPFDFGRIAATNAISDIYAMGGKPI
FT                   MAIAILGWPINKLAPGIAAQVIDGGRSVCHEAGIVLAGGHSIDAPEPIFGLAVTGIVPT
FT                   DKVKKNSQAKEGDLLFLSKPIGIGILTTAEKKGLLQAAHKNLARDTMCELNKIGAEFAH
FT                   IEGVNAMTDVTGFGLLGHLSEICEGSGLSASLDFAAIPTLDAIEYYVEQGCVPGGSMRN
FT                   FDSYGHKVTPLSELQKTILCDPQTSGGLLISVSPSSADILLTTAKNSGVKLFQIGKIES
FT                   KNAQQPVISVL"
FT   gene            371802..372899
FT                   /locus_tag="Ping_0285"
FT   CDS_pept        371802..372899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0285"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="SMART: Rhodanese domain protein; KEGG: ppr:PBPRA2591
FT                   hypothetical ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02151"
FT                   /db_xref="GOA:A1SRN6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRN6"
FT                   /protein_id="ABM02151.1"
FT                   /translation="MQQSDLQEQQLYRSLFLLKTPLIDLRAPVEFAQGAFPESCNLPLM
FT                   TDNEREQVGTCYKKEGQAAAITLGHQLVASDIQNRIRKWAQFKEENPTAWLYCFRGGLR
FT                   SRLSAQFLKDHGVDINIVPGGYKALRRYLINVIDQASEKKLMIVGGNTGCGKTLLIQAL
FT                   DNGLDIEGRANHRGSSFGKQVTEQPRQISYENQLAVDILHISQHASSLVIEDESKAVGA
FT                   LYVPERLFAGMTRAPMVVVNDPLEIRLQRLCYEYCTLMTEKFNLALGAEQGWQAYEKYL
FT                   QNGLYGIRKRLGTEKFKVMNTVLEAALKQQKNTGSVEGHLNWIASILRDYYDPMYQYQL
FT                   EKKADRVQFRGTFQEVKEWLTVNTK"
FT   gene            373016..374077
FT                   /locus_tag="Ping_0286"
FT   CDS_pept        373016..374077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0286"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: sfr:Sfri_2916
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; TIGRFAM:
FT                   phospho-2-dehydro-3-deoxyheptonate aldolase; PFAM: DAHP
FT                   synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02152"
FT                   /db_xref="GOA:A1SRN7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN7"
FT                   /protein_id="ABM02152.1"
FT                   /translation="MPKNENIYIESETVLITPAELKDLVPASEEVYQFIAEARQTVSNI
FT                   VHKKDPRFLVICGPCSIHDIDAAKDYATRLKSLHEEYKDTLYIVMRVYFEKPRTTVGWK
FT                   GLINDPYMDDSFEIETGLKQARELLLWISELGLPIATEALDPISPQYLGDLFSWSAIGA
FT                   RTTESQTHREMASGLSMPVGFKNGTDGSLSTAVNAMKSASSPHRFMGINQLGQSALLQT
FT                   SGNRDGHVILRGGGGKPNYDSVNVALAEQALKKAKVEEVLIVDCSHENSNKNHTLQPLV
FT                   AKDVFHQVTEGNKSIVGIMLESNINEGNQAATLPKASLKYGVSVTDACIDWETTSQLLA
FT                   EAVNVLKDTLKTR"
FT   gene            374087..375214
FT                   /locus_tag="Ping_0287"
FT   CDS_pept        374087..375214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0287"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="TIGRFAM: chorismate mutase; PFAM: Chorismate mutase;
FT                   Prephenate dehydrogenase; KEGG: vfi:VF0554 chorismate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02153"
FT                   /db_xref="GOA:A1SRN8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN8"
FT                   /protein_id="ABM02153.1"
FT                   /translation="MPLSKLRDQIDAVDQQIIDLLAERLRLVGEVGEVKAKHGLPIYVP
FT                   EREAAMLAKRREEASSKGVPANLIEDILRRTMRESYASENDTGFKTVNPKMKRIVIIGG
FT                   NGLLGQRFVEMFKLSGYEVDILGRANWDKAEEICSHAGLVIVGSPIDVTVSVIEQLSYL
FT                   PEDCILADITSVKDGPLQAMLKVHKGPVVGLHPMFGPDISSFAKQVVVYCNGRGEEKYQ
FT                   WLIEQMKIWGAHLYNVDSTVHDESMTLIQALRHFTSFVYGSHLKEVNADLKQLLDLSSP
FT                   IYRLELAMVGRLFAQDPALYADIILSQKNNLVMIKRYHQHFAEAIELLENADREQFIKR
FT                   FESVTEWMGDYSSLFLDESRSLLQQAHDNRHYEDK"
FT   gene            complement(375301..375711)
FT                   /locus_tag="Ping_0288"
FT   CDS_pept        complement(375301..375711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0288"
FT                   /product="sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   yps:YPTB0844 putative sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02154"
FT                   /db_xref="GOA:A1SRN9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRN9"
FT                   /protein_id="ABM02154.1"
FT                   /translation="MRIEITSKQITITDTMRTKVEERFEKLEKLQIPLITPHVIITKEP
FT                   KGVKIEATINVPNDKIFAHAQNDDLYVAIGQLFQKLERQLTKYLHKSEASRAKNNGKDM
FT                   CRTGEISGEAIEEPEIEIESDAEIKLNKEFAA"
FT   gene            376027..377847
FT                   /locus_tag="Ping_0289"
FT   CDS_pept        376027..377847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0289"
FT                   /product="ABC transporter extracellular solute-binding
FT                   protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: pae:PA1810 putative peptide transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02155"
FT                   /db_xref="GOA:A1SRP0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP0"
FT                   /protein_id="ABM02155.1"
FT                   /translation="MFRLSLFKFTRLLLFCYLSSCSSLLFASAWQHGLSMYGDFKYAPN
FT                   FAHFQYVNPNAPKGGVFRQAAIGSFDSLNPFIVKGNAASGITMIYDTLLAQSRDEPFSS
FT                   YGLIAEKVKVASDFTSVSFMINKKARFHDGKSIQASDVKFSFELLVEKGAPHYRSYYSG
FT                   VKDVVVDNDQQVTFYFKEVGNRELSLIIGQLPILPEHFWADKDFSTSSLTIPLGSGPYQ
FT                   VESFDASKRITYKRVKDYWAKDLAVNKGLHNFDTMIFDYYRDDSVAFEAFKSGNFDYRL
FT                   ESSAKRWATGYVGENFDSGAIITSKIADKNPQGMQGFWFNLRKEKFKDVNVREAIALLF
FT                   DFEWANKTLFYGAYSRINSFYSGSELSTQENISAAERAVLRPYKAQLPKAVFEPIKFLE
FT                   SSADGNVRGRLRKAVALLELAGYQLKDSKMQDKNGRQLSFEFLLYSKDFERVVHPFRRN
FT                   LQRIGIKTSLRLVDVSQYINRLNNFDFDLVSLRKGQSISPGNEQSGHWGCDSMMEPGTA
FT                   NWSGVCHPVIDQLVTKLIMADTRKELVQTTKALDRVLLSQHFVIPQWYLPAYRIAYWNK
FT                   FSRPNIAPIYDLGLSTWWSTQAENDQEESQ"
FT   sig_peptide     376027..376110
FT                   /locus_tag="Ping_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.808 at
FT                   residue 28"
FT   gene            377847..378923
FT                   /locus_tag="Ping_0290"
FT   CDS_pept        377847..378923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0290"
FT                   /product="ABC transporter substrate binding inner membrane
FT                   protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pae:PA1809 putative peptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02156"
FT                   /db_xref="GOA:A1SRP1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP1"
FT                   /protein_id="ABM02156.1"
FT                   /translation="MNYYILRRLLLIIPTLLGIMTINFFIVQIAPGGPVEQAIAQYQGI
FT                   GDANTTRVASGTNSEIKQGGESKYRGSRGVDPEYIKALEKLYGFDKPIVERYFSMLWRY
FT                   IKFDFGESFYRNEKVTDLIISKMPVSISLGLWTTLLVYLISIPLGIKKATSHGHSFDIW
FT                   TSTIVTVAYALPSFIVAIMLIVLFAGGSYYDWFPLRGLTSDNFSELSLMAQIKDYFWHL
FT                   TLPVFASVLGSFATLTMLTKNSFLDEIHKQYVVTARAKGCSDKRILYGHVFRNAMLLVL
FT                   AGLPAALIGIFFTGSMLIEVIFSLDGLGLLSFESVINRDYPVIFASLYMFTLVGLVLKL
FT                   ISDITYTLIDPRITFEGR"
FT   gene            378925..379974
FT                   /locus_tag="Ping_0291"
FT   CDS_pept        378925..379974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0291"
FT                   /product="ABC transporter binding protein inner membrane
FT                   protein"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pae:PA1808 putative peptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02157"
FT                   /db_xref="GOA:A1SRP2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP2"
FT                   /protein_id="ABM02157.1"
FT                   /translation="MSLLNTWQEMRNNPVNVDRWLQFKNNKRGYWSLWIFLILFLASLL
FT                   GELWINDKPIMVSYQQHWYFPLVEDIPENQLGGDFDITTDFSDPYMVTQINKAGWIIWP
FT                   LIPFYFDSINFELTEPAPSPPSDINYLGTDDQGRDVLARLVYGFRISVFFALALTLVSS
FT                   VIGIIVGAVQGYYGGRIDLFGQRFLEIWEGLPMLFMLIILASFVEPTFLWLLGLMILFS
FT                   WPSLVGVVRAEFLRGRHLEYVKAARALGVGDKKIMFKHILPNAMIATLTFMPYLFTGAL
FT                   TTLTSLDFLGFGLPLGSASLGEMVAQGKDNLHAPWLAITAFISLSTILVLLVFIGEATR
FT                   DAFDPRRSL"
FT   gene            379971..381563
FT                   /locus_tag="Ping_0292"
FT   CDS_pept        379971..381563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0292"
FT                   /product="ABC transporter foroligopeptide/dipeptide
FT                   ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppu:PP_4150 peptide ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02158"
FT                   /db_xref="GOA:A1SRP3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP3"
FT                   /protein_id="ABM02158.1"
FT                   /translation="MSSKNELLKIENLAVSFGDKNIVSGVSFSLDKGQTLAIVGESGAG
FT                   KSLVALSILQLLPYPHAHHPAGEIYIDGLQLVGKEAAVLETIRGNKVGMIFQEPMTSLN
FT                   PLHTVQKQIAETLLIHKGLTGKASHARIIELLDLVGIEAPETRLASYPHELSGGQRQRV
FT                   MIAMALANEPELLIADEPTTALDVTIQRQILDLLKSLQKRLNMAVLIITHDLHVVKHIA
FT                   DSVLVMHDGKSIEYSSKNALFSNPKHEYTKLLLNAEPAGEMTELTAPQLILSAANINVS
FT                   YPLKKNFWGKTTRSLQAVKNVSLQIHQSETVAIVGESGSGKSTLAQAILQLNKSTGDVV
FT                   YLGEKINAIKHNELQKLRKKLQIVFQDPFASLSPRMSVRDIIAEGLQVHQPKKPLSSQE
FT                   IDAQVEQVLQRVGLEKDSGLRYPHEFSGGQRQRISIARALILKPQLIVLDEPTSALDRS
FT                   IQKQILALLISLQKELGLSYLFISHDLSVVRTISHRVLVMYNGEIVEQGTTKKIFAQPR
FT                   HEYTKILLLSSVL"
FT   gene            381835..383748
FT                   /locus_tag="Ping_0293"
FT   CDS_pept        381835..383748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0293"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   ppr:PBPRA0641 hypothetical soluble lytic murein
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02159"
FT                   /db_xref="GOA:A1SRP4"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP4"
FT                   /protein_id="ABM02159.1"
FT                   /translation="MNKFLLLCCGFFSLTSFVAADDLDKQRELYSQAVVLQAQGEWEQA
FT                   QKTAALIAEYPLTYLLEFETIKAHFATNNAAAVHAFINNNPNRSLSLDLERDYLRFLAR
FT                   NYAWKEFLDFYPQLPNSEDLKCNYFQAKINQGKTEEIWPEFKKTWLTGSSLPPACDNVI
FT                   AVYRDNNTLSEKLVWQRFSLAYQNNSPALMRYLTTWMKGDNRVLATQLYALYKKPESLL
FT                   NSELFQSRTQASFLFLQMSIKRLARVDLNSAMDLFNRYEKKIPFTASESQTLKKYFALR
FT                   TLLYEVESQLPWLDKELVSLDDDGLFELRIRYAIKLDNWKDIEYWLNVLPERLQEKDKW
FT                   IYWQARVLENKKQQKQADKLYLKIAGQRRYYSFLAAQKLGLDYQLNAKLVSEKSDSLKM
FT                   KKADLAYIGELAYQKHNALLKREWYALLNNNDKNTQLQLGLYAYQKGWAHLSVMASINS
FT                   KSWDALNIRFPKVKSGLFANTANQYQLEPTYIYALTRRESAFDEYAQSRVGASGYMQLM
FT                   PATAKETAQMIGMKDYKNQAQLNDGAINVQLGTAYFDMLLKRYSGNRILATAAYNAGPH
FT                   RVDSWKGKAGQSLEMDSWIETIPYKETRNYVKNVLAYNVIYQHILDQSREFFNKTELNT
FT                   RY"
FT   sig_peptide     381835..381897
FT                   /locus_tag="Ping_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 21"
FT   gene            complement(383806..384207)
FT                   /locus_tag="Ping_0294"
FT   CDS_pept        complement(383806..384207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0294"
FT                   /product="pilus assembly protein"
FT                   /note="KEGG: tbd:Tbd_1865 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02160"
FT                   /db_xref="GOA:A1SRP5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP5"
FT                   /protein_id="ABM02160.1"
FT                   /translation="MKKAQGFTLVELLVVIAIIGILAGIAYPTYKSYTLHANRSDAKNE
FT                   LQKAQLVQSSWHILNPDYSMVSADVGLPDNHNYYTFTIISAGSTTYAMKAVAKAGTMQA
FT                   NDKAECTTLVINQDNAHYDASDTNNDQCW"
FT   gene            complement(384448..384900)
FT                   /locus_tag="Ping_0295"
FT   CDS_pept        complement(384448..384900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0295"
FT                   /product="transcriptional regulator, ArgR family"
FT                   /note="PFAM: arginine repressor; KEGG: sdn:Sden_0825
FT                   arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02161"
FT                   /db_xref="GOA:A1SRP6"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRP6"
FT                   /protein_id="ABM02161.1"
FT                   /translation="MKQSTELMTFFKALLEKEHFSSQGEIVEALVNAGFNNINQSKVSR
FT                   MLSKSGAVRTRNAKQEMLYCLPAELGIPIITSPLKNLVLDIDRNDSMIVIRTSPGAAQL
FT                   IARLLDSIGKTEGILGNIAGDDTIFTTPTNSKKIQETMNIIKNLFN"
FT   gene            385109..385891
FT                   /locus_tag="Ping_0296"
FT   CDS_pept        385109..385891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0296"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: vpa:VPA0637 arginine ABC transporter, periplasmic
FT                   arginine-binding protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02162"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRP7"
FT                   /protein_id="ABM02162.1"
FT                   /translation="MNWILNNMLILRFFLSIFLLFSPLTVLSSTAVPNDNIKVRFATDA
FT                   NYYPFEYLDEQQQIQGFDIDMAKAICKAVNLTCSFHHQRFESLLLSLSFARFDAVISAL
FT                   DITSERLKTVGFTNSYYENTPVFISKKSAEERFSTVGKFIGVRSNSSNQEYLIKYEKEN
FT                   SFIISYVTYYEILSDLSAEKIDAAFVDQAVASEFLKQKDNRIHFDVQKINSSQRKLFSQ
FT                   GYGIAIQKGNVILQNRLNLGLKIITENGTYQKIYERYF"
FT   sig_peptide     385109..385204
FT                   /locus_tag="Ping_0296"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.783 at
FT                   residue 32"
FT   gene            386153..387112
FT                   /locus_tag="Ping_0297"
FT   CDS_pept        386153..387112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0297"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: shm:Shewmr7_0614 malate
FT                   dehydrogenase, NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02163"
FT                   /db_xref="GOA:A1SRP8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRP8"
FT                   /protein_id="ABM02163.1"
FT                   /translation="MKIAVLGAAGGIGQALALLLKLDLPANSILSLYDLAPVTPGVAKD
FT                   LSHIPTSVKVEGFAGTDPTAAIEGADVILISAGVARKPGMDRSDLFNINAGIIKNLVAK
FT                   VAEVAPEACIGIITNPVNTTVAIAAEVLKAAGVYNKNKLFGITTLDVIRAEEFVAELKG
FT                   LPSEDVRVNVIGGHSGTTILPVLSQIQGVSFTDQEVIDLTSRIQNAGTEVVEAKAGGGS
FT                   ATLSMACAASRFAIQLVHALSGKQGIIQNAYVDGGNPASPFFTQPLLLGKNGIDKVLPY
FT                   GELSSFEETKKEEMLSVLHADIEMGIDFVSKTLAAEVS"
FT   sig_peptide     386153..386206
FT                   /locus_tag="Ping_0297"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.702) with cleavage site probability 0.684 at
FT                   residue 18"
FT   gene            387379..388797
FT                   /locus_tag="Ping_0298"
FT   CDS_pept        387379..388797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0298"
FT                   /product="uroporphyrinogen-III C-methyltransferase /
FT                   precorrin-2 dehydrogenase"
FT                   /EC_number="2.1.1.107"
FT                   /EC_number="1.3.1.76"
FT                   /note="TIGRFAM: uroporphyrin-III C-methyltransferase;
FT                   siroheme synthase; PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: ppr:PBPRA3312
FT                   putative siroheme synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02164"
FT                   /db_xref="GOA:A1SRP9"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR012409"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028281"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037115"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRP9"
FT                   /protein_id="ABM02164.1"
FT                   /translation="MDYLPIFTKLENRPCLVVGGGSIACRKIHLLLKAGADVTVCALEF
FT                   NPSLLKQAANKELKILEQAFTEELLENKWLVIAATNKKQVNEHIATAAHAKQLLVNVVG
FT                   QADISSFILPSIVDRSPLVVAISSGGKAPVLARLIRERLETLLPMHLGRLAAISAQFRH
FT                   RVKEVIKVAPLRRRYWEKLFGNGMLANLLQKGQTEKAIALMETSLSEDITQGDVALVGA
FT                   GPGDPSLLTLKALQLMQQADVVLYDRLVSSDILDLVRRDADLISVGKAAGNHEVEQSRT
FT                   NQMLVEFAREGKKVVRLKGGDSFIFGRGGEELEELVEAGIAFQVVPGITAASGCSAYAG
FT                   IPLTHRDFAQSVTFVTGHRKTDGEELNWQALAAPNQTLVVYMGLIQSQEIQTQLLSHGR
FT                   APETPVALVNKGTTSDQHVVIGQLSELEQLGGGLQGPTLMIIGEVVNLADKLAWYQSDN
FT                   KPPLSRDPFLVNLA"
FT   gene            complement(388960..390234)
FT                   /locus_tag="Ping_0299"
FT   CDS_pept        complement(388960..390234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0299"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="KEGG: son:SO1498 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02165"
FT                   /db_xref="GOA:A1SRQ0"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ0"
FT                   /protein_id="ABM02165.1"
FT                   /translation="MRHNNHNSLSHLAQDTYAVILAGGRGSRLFELTNWRAKPAVYFGG
FT                   NFRIIDFPLSNCLNSGISRVGVATQYKSHSLIRHINRGWGHFKSRTSEFVEILPASQRH
FT                   NEDWYQGTADAVYQNLDIIRSQQPEHILILSGDHVYRMDYRTLLAQHVNSKAEMTVCCI
FT                   ETSVEEATGNFGVMTVDADNRVIAFNEKPAVPNEIPGKPGRCLASMGNYVFNTKFLFEQ
FT                   LKKDHKNESSSHDFGHDLIPSIIDECDVFAFSFKDPNTNLQPYWRDVGTLDSFWEANME
FT                   LVEPTPQLDLYDTSSPIYTYQEQLPPAKFIFDNEIRRGTALDSTVASGCIISGATICKS
FT                   LLYSSVHAHSYSYIEYSVLMRGSDVGEHCQLRRVIVDTKCFIPAGLSIGYDREKDIANG
FT                   FRVTEKGITLVTKDMLAALAQKQSG"
FT   gene            complement(391237..395031)
FT                   /locus_tag="Ping_0300"
FT   CDS_pept        complement(391237..395031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0300"
FT                   /product="L-proline dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: aldehyde dehydrogenase; Proline
FT                   dehydrogenase; KEGG: cps:CPS_4410 bifunctional PutA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02166"
FT                   /db_xref="GOA:A1SRQ1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ1"
FT                   /protein_id="ABM02166.1"
FT                   /translation="MLFDGNLVADSTIRQKIRDFHRIDENLAVDHILPEAEVNMRARSR
FT                   AWERARKMVLQIRREQEGTGVVEALLNEYSLSSAEGVVLMCLAEALLRVPDKKTQDELI
FT                   RDKLSKGKWSTHLGTSNSLFVNASSWGLLLTGSMVNFSDTRKSNQFGLLKKTLGRMGEP
FT                   VIRKAMNIAMKVMGEQFVIGETIVAAVKRAEQKERNGYVYSYDVLGEGARTEKDAERYF
FT                   QSYVKALVVIGEAAKGRGPRKSPGISVKLSAIHPRYEFSHRDRVLKELPQKLKSLCLLA
FT                   KKYDIGLTVDAEESERLDISLDIIEIVFSDPELSDWDGFGLAVQAYQKRAIFVIDWLRE
FT                   LTEKVGRKMMVRLVKGAYWDTEIKNAQKDGLEHYPVFTRKSSTDVSYHACANRLLDYRD
FT                   TIYPQFATHNAYTASVIIELAGDDKEGFEFQCLHGMGDSLYDQIVTTDNIQCRIYAPVG
FT                   QHEDLLAYLVRRLLENGANSSFVNAIVDETRPVESLLEDPVEKTQRLKVTYNEQILKPI
FT                   DLFGKERDNSKGLDLNDINQITPLRESLDRWFNDHLLTSDQVPDDCFAVKNPADHNEII
FT                   GFHRHDSREEMVAKLEKAHNSFATWSQTPIEERASLLRRTADILERHMDELIAICIKEA
FT                   GKIAQDGIDEVREAVDFCRYYAARAEELAEDDRLEPRGVVLCISPWNFPLAIFMGQVAA
FT                   AIVTGNTVIAKPAEQTSLIALRALELMESVGMPEGTVTAVIARGPAVGEALLEDERIKA
FT                   VVFTGSTTTGTHISRILANRGGDQIPLIAETGGQNCMVVDSTALPEQVIDDVISSGFQS
FT                   AGQRCSALRVLFLQEEIADGMTEMLIGALKELHIGDPAQLSTDVGPVIDSKALNSLEAH
FT                   VKDMENKAELLYECPVPENNGTFFAPRLYQIADISVLEREVFGPCVHIVRFKGDQLANT
FT                   IEKINATGFGLTMGIHTRIEERAIELAKLSRAGNVYINRNMIGAVVGVQPFGGTGLSGT
FT                   GPKAGGPNYLSRFMNEKATPAPHQDDSVLGDDKALISDKVSNLETLAFMKNAIKVEPEW
FT                   RVTNLNDRISAVRQLLAQIAKVTIVEELADDFNSTLAAARSQLISIEKKMRRPKALPGP
FT                   TGESNVLYLEPRGILVCFADKNVTFEYWTLAIVTALATGNTVISVVSDLFYEEALAFRD
FT                   KFNATGAPEGVLQVAKLCHLEALLEQDKLAGVVIDSHSPRRTFMVRKLAEREGAILPVI
FT                   TSEYTDHLIQRLLTEKSISIDITASGGNTSLMTLVEEED"
FT   gene            395445..395825
FT                   /locus_tag="Ping_0301"
FT   CDS_pept        395445..395825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0301"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: wsu:WS0716
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02167"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ2"
FT                   /protein_id="ABM02167.1"
FT                   /translation="MKDIVVPFLEHTGASLKNFSKGKAEVELHVQPYHLQHIGFVHGGV
FT                   ISTLMDNTGWYAAVSNLENGFTAVTMEIKINYLKPALGKYLVASASVKRQGRTTSFVTI
FT                   ELHDQGELIAYATGTYALIKED"
FT   gene            complement(395954..397510)
FT                   /locus_tag="Ping_0302"
FT   CDS_pept        complement(395954..397510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0302"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   shm:Shewmr7_3944 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02168"
FT                   /db_xref="GOA:A1SRQ3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR022055"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ3"
FT                   /protein_id="ABM02168.1"
FT                   /translation="MKNSKTLIRQSHFLGTKIRNLRKRNNLTLDDLSARCVKLEPECAP
FT                   SVSYLSMIERGKRVPGEDMLEVIAQVFQKNMHWFLDDASEQAEITPEKGSRGGINGMAL
FT                   EPSFLFSNEILQIAIPEMLSQTGTSGRQFAHLLIRAHQEHHQNHFPDLERAAEEVGKKR
FT                   MPLYVEDLMEIAEQKGLKIRWFSKLPGDRQSPANEKSKHMVTSYFQPPSTVYLNSILKK
FT                   NTPRLKYELAVHIGHRVLHNSDGEKSIMVAGDKTQYDVQNSVQNQSYSTSLDAQDILHA
FT                   WHDFECSFFAAALLCPKVAFRQLLDRHGYEVNVCKQIDVSESVVMRRMTAVSAYPNWHY
FT                   FDAYSPGQLKAVYRGNGIPLPWGNMRVVKDPCQHWSVFRMLGMNAKGTAAQISILNENG
FT                   APKIYCCESIKVQDSADVNHVLCAGIDLNPAIDAQGHDALALVRELKQICIANGGSATI
FT                   PAHIKKVLISVARILNINWIERGIAGEARLICSRGAVCPRQPSCYMDKTIESIFKTKQI
FT                   Q"
FT   gene            397705..399873
FT                   /locus_tag="Ping_0303"
FT   CDS_pept        397705..399873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0303"
FT                   /product="malate synthase"
FT                   /EC_number="2.3.3.9"
FT                   /note="PFAM: malate synthase; KEGG: pae:PA0482 malate
FT                   synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02169"
FT                   /db_xref="GOA:A1SRQ4"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ4"
FT                   /protein_id="ABM02169.1"
FT                   /translation="MNLPQQKQSEIESGFYNFINQEVLPHTNLNADDFWFDLMKLVNDF
FT                   SPLNSQLLATRKTMQKQIDDWHRSHQNFDQQDYLKFLEEIGYLVEQGESFNIETENVDS
FT                   EISTLAGPQLVVPVQNARFALNAANARWGSLYDAYYGTDLIQKTGALKPGSDFNVARGQ
FT                   RVITLAKDFLDEVFPLDSGSHHDVLSYLVYYQHLLAFFPDGSKTGLKTPAQFIALDGSK
FT                   SDPSYLLLKNNGLHIGIVIDRHGKIGCSDLSGIDDIQVESALTTIIDFEDSISAVDAED
FT                   KVEAYKNWLGLIKGDLSANFSKDGEQMTRQLNQDKAFIDKDGEKYVVHGRALLLVRNVG
FT                   HLMGSDLIQDSEGNNAPEGIIDAAITALIGSIDLQEKTNNNIRNSRSGSIYIVKPKMHG
FT                   PDEVAFTCDLFSRVEEMLKLQPNTIKLGIMDEERRTSANLKECIRVAKSRVVFINTGFL
FT                   DRTGDEIHTSKEAGAVYPKALIKTLPWFDAYENNNVDVGLACGFSGKAQIGKGMWAMPD
FT                   EMKKMMKEKIQHPLSGANTAWVPSPTAAILHALHYHQVDVFKEQLKIAKRPAAKQTDLL
FT                   TLPIMPSDYPLSLEEIEKELENNIQGILGYVVRWVEMGIGCSKVPDINNVGLMEDRATL
FT                   RISSQHIANWLKHNICSTEQVNRIMRNMAEIVDKQNAGVSGYQNMSPNYETNYAFQAAE
FT                   ALIFEGEDQPNGYTEPLLHEYRMFAKIS"
FT   gene            399941..401536
FT                   /locus_tag="Ping_0304"
FT   CDS_pept        399941..401536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0304"
FT                   /product="isocitrate lyase"
FT                   /EC_number="4.1.3.1"
FT                   /note="PFAM: isocitrate lyase and phosphorylmutase; KEGG:
FT                   nar:Saro_1029 isocitrate lyase and phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02170"
FT                   /db_xref="GOA:A1SRQ5"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ5"
FT                   /protein_id="ABM02170.1"
FT                   /translation="MNYNTEKTNASNVIAQQGDAWKAINPEYVARLRSQNRFKTGIDIA
FT                   KYTAKIMREDMDSYDIDSKNYTQSLGCWHGFVGQQKMISIKKHFTTTKGTYLYLSGWMV
FT                   AAMRSEFGPLPDQSMHEKTSVPLLIEELYTFLKQADARELGHVFQELDAANDKGDQVAA
FT                   QAALKKINEFETHVVPIIADIDAGFGNEEATYLLAKKMIEAGACCIQIENQVSDAKQCG
FT                   HQDGKVTVPHEDFLAKINAVRYAFMELGVDDGVIVARTDSLGAGLTQKIPVSQEPGDLA
FT                   DQYNNYIDGEVINSLDQLKSGDLVLSRGGELIIPNRLANGLVRFKPDTGEDRVVLDCIT
FT                   SLQNGADLLWIETEQPNVGQIAGMVNRIREAVPNAKLVYNNSPSFNWTLSFRQQIFDTW
FT                   NKDGIDVSAYNRADLMSPIYDETKLALEADQQIQNFQKDAAREAGIFHHLITLPTYHTA
FT                   ALSTDNLAKDYFGEMGMLAYVKNVQREEIRQGLACVKHQDMSGSNMGDDHKEYFSGEQA
FT                   LKASGENNTMSQFS"
FT   gene            401986..403926
FT                   /locus_tag="Ping_0305"
FT   CDS_pept        401986..403926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0305"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: pat:Patl_3820 alpha
FT                   amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02171"
FT                   /db_xref="GOA:A1SRQ6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032091"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ6"
FT                   /protein_id="ABM02171.1"
FT                   /translation="MSRINMDLTFESQRTLKRILELIDLSKLTKDDLDIFLARLDKNFP
FT                   ALFAKLYHLYGDKYDFFYHLQQLVAHLAAGIIARSGKLKKQDTLRLNKPDWYRDHKMLG
FT                   MAAYVDLFAGDLKKLKAKIPYLKSLGINYLHLMPLYKSPKGDSDGGYAVSDYREVDPKL
FT                   GTEKDLLALSDALSAEGISLVLDFVFNHTSDEHPWAEAAKVGAEEFTDFYYFFEKKQEI
FT                   DDYNQTCREIFPTVRRGSFTYLEAQKKWVWTTFNSFQWDLNYSNPAVFNAITDEMLFLA
FT                   NLGCEGLRLDALAFIWKEKWTQCENLPKAHTLIQAFNLCLQIVAPAVVFKSEAIVHPDE
FT                   VAKYIGKDECQLSYNPLMMALMWESLATRETKLLTASLKKSFAISPQCSWVNYIRCHDD
FT                   IGWTFDDSLAQQLGINGFDHRRFLNNFYTGRFEGSFAQGVPFQENPATGDCRVCGSLAS
FT                   LTGLEKGLEQNNQRDIDFALKRISLLNSINMSIGGIPLIYQGDELGMLNDYSYLDDHSK
FT                   KEDSRWVNRPVITEEDTKLAEKAGSAQFFVKQSLQAMINIRQQHQVFGIAETKILETYN
FT                   PHLFAYCRIHESGQKMLAICNFSEESQSVNSSITDILASNKMVDLLTATKVKKTAVLEL
FT                   GAYQVLWLVAE"
FT   gene            complement(404048..405133)
FT                   /locus_tag="Ping_0306"
FT   CDS_pept        complement(404048..405133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0306"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase, HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase, HD region;
FT                   KEGG: wsu:WS1630 response regulator protein-CheY-like and
FT                   an HD-GYP domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02172"
FT                   /db_xref="GOA:A1SRQ7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ7"
FT                   /protein_id="ABM02172.1"
FT                   /translation="MLINISKKESNLRVLLGVLSIAAGSHVLWFILLPLGIMLIHSGLT
FT                   SKCPISHLLGRQTEAAKKHFFINYLPKYNPQPVFIFKADNQLAFANDPAKKFFPDVHRY
FT                   QDLINTSIDQVIQKEQINHNTLTLPDKKVYSLITRGSTELNGVVVYGNDISEIMTLNQE
FT                   ILDTQKEIVYAMGEIGETRSKETGDHVRRVAKYSQLLASLAGIDKTEADLIKFASPMHD
FT                   IGKIGIPDAILNKPGKLDKDEFEIMKTHAEIGFNLLNHSTRPVLKAASLIAYHHHEKWN
FT                   GSGYPQQLSGEDIHIYGRITAVADVFDALGSARVYKKAWPLEEILALLKEQRGIHFDPS
FT                   LVDLLLENLPMFLEIREKHPN"
FT   gene            complement(405342..406508)
FT                   /locus_tag="Ping_0307"
FT   CDS_pept        complement(405342..406508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0307"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   xac:XAC3868 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02173"
FT                   /db_xref="GOA:A1SRQ8"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ8"
FT                   /protein_id="ABM02173.1"
FT                   /translation="MDIIMHLLFKSKLLLTSDFLLLLSLLSCNAFAEPAAQKIEGNAGS
FT                   ILLAESFATFNEPWAMTFLPSGELLITEKKGTLLLVDPNDSSKIVVKGVPKVAYGGQGG
FT                   LGDIILHPQYKENHWIYLSYAEKDRSGNTGAVVARAKLIHASAKPQLENLEVIWRQIPK
FT                   VSGSGHYSHRLAFSPNGKLFITSGERQKQAPAQSWMQNLGKVIRLNADGSVPSDNPFQD
FT                   KGELAKTFWSLGHRNLLGMAFDKKGQLWTHEMGPRHGDEFNLTIGGDNYGWPIVSWGDQ
FT                   YSGIPIPDHDSRPEFNPPEVYWVPTVAPSGLIIYSGVMFPKWQGNAFIGGLKSKSLLRI
FT                   KIEGFQAEEVERFTMEKRIREVEQGPNGAIWVLEDQKGGRLLRLSAYE"
FT   sig_peptide     complement(406410..406508)
FT                   /locus_tag="Ping_0307"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(406839..407258)
FT                   /locus_tag="Ping_0308"
FT   CDS_pept        complement(406839..407258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02174"
FT                   /db_xref="GOA:A1SRQ9"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRQ9"
FT                   /protein_id="ABM02174.1"
FT                   /translation="MMGTYANGYHFIIYDHHGKGDLTLFTWDGVSHLSYMVASVANFVT
FT                   KEMSYIGYQIDRDGKNQETQYLDAGIGVGIDFIEVLFGIIYGIVGIFVGTILNPMNTLI
FT                   NIPGGVALAIESIIEGVANTGSDVISLVTLRHIEF"
FT   gene            complement(407773..407985)
FT                   /locus_tag="Ping_0309"
FT   CDS_pept        complement(407773..407985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0309"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: sfr:Sfri_4031 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02175"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR0"
FT                   /protein_id="ABM02175.1"
FT                   /translation="MKKTMSFAVLHFTVAFTVTYLLTGSIVIGGTVALVEPAVNTVVFY
FT                   FHEKVWKKIEARKVEKKMTSVHSVC"
FT   sig_peptide     complement(407932..407985)
FT                   /locus_tag="Ping_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.699) with cleavage site probability 0.317 at
FT                   residue 18"
FT   gene            complement(409144..409220)
FT                   /locus_tag="Ping_R0019"
FT                   /note="tRNA-Met10"
FT   tRNA            complement(409144..409220)
FT                   /locus_tag="Ping_R0019"
FT                   /product="tRNA-Met"
FT   gene            complement(409447..411300)
FT                   /gene="rpoD"
FT                   /locus_tag="Ping_0310"
FT   CDS_pept        complement(409447..411300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="Ping_0310"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor RpoD domain protein; PFAM: sigma-70
FT                   1.1 domain protein; sigma-70 region 3 domain protein;
FT                   sigma-70 region 2 domain protein; sigma-70 region 4 domain
FT                   protein; sigma-70, non-essential domain protein; sigma-70
FT                   region 1.2; KEGG: pat:Patl_1038 RNA polymerase, sigma 70
FT                   subunit, RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02176"
FT                   /db_xref="GOA:A1SRR1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR1"
FT                   /protein_id="ABM02176.1"
FT                   /translation="MAQTPQSQLKELIIKGKEKGFLTYAEVNDHLPQDIVESEQIEDII
FT                   QMIGDMGIRVVETAPDADDMLIGADDSETPDEDAVEAAAQVLATVESEIGRTTDPVRMY
FT                   MREMGTVELLTREGEIVIAKRIEEGIKEVQTAVSEYPATISGLLDNWDSYEAEEMKLTD
FT                   LISGFVDPNDDMTQAVSATHIGSELSKKQLEDEDKADKDDSDEDDEEEGPKGPDPEEAA
FT                   EKFAELRKLNQVVEDSITKNGRAHAETRAAINEQAEFFQQFKLIPKQFDRMVKAIRFAM
FT                   NAVRVQERLALKICVEQCKMPKKEFIKLFKGNETNPAWLEVILSNGTDYATRISEFEED
FT                   LRRCLRKMLAVEVQSVLTITNMKGISRNMSIGEAKARRAKKEMVEANLRLVISIAKKYT
FT                   NRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPV
FT                   HMIETINKLNRVSRQMLQEMGREPQPEELAERMMMPEDKVRKVLKIAKEPISMETPIGD
FT                   DEDSHLGDFIEDTTIALPANCATSESLKNATNDVLEGLTAREAKVLRMRFGIDMNTDHT
FT                   LEEVGKQFDVTRERIRQIEAKALRKLRHPSRSEQLRSFLDE"
FT   gene            complement(411412..413163)
FT                   /locus_tag="Ping_0311"
FT   CDS_pept        complement(411412..413163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0311"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="KEGG: vvy:VV0562 DNA primase; TIGRFAM: DNA primase;
FT                   PFAM: zinc finger, CHC2-family protein; TOPRIM domain
FT                   protein; DNA primase DnaG, DnaB-binding; DNA primase
FT                   catalytic core, N-terminal domain; SMART: Toprim sub domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02177"
FT                   /db_xref="GOA:A1SRR2"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR2"
FT                   /protein_id="ABM02177.1"
FT                   /translation="MAGRIPRNFIDDLIARTDIVDFIDSRVKLKKQGKDYRACCPFHNG
FT                   NNNSSFSVSSDKQFYHCFNCGVSGNVLSFIMEYDGIEFVDAIETLAEQLSIEVPREESG
FT                   FGKAHQSSYVDRKDLYQLMADIAVFYQQQLRTHKNSQQVINYLKGRGLSGQTVKHFKIG
FT                   YAPDGWNEVRKRFAVSADLEKQLIEAGMLISKEKSGSYDRFRDRLMFPIHDRRGRVIGF
FT                   GGRVLGDNEPKYLNSPETPLFHKGKELYGLYQVKQAYKEIKRVLVVEGYMDVVALGQFG
FT                   IDYAVASLGTSTTPEHIQQLFRHTSEVICCFDGDKAGKAAAWRALENALPYIQDGRTLR
FT                   FMFLADGEDPDSYVQKEGKEAFEKLIEQALPLSDFLFQHLLNQVDMSTADSKAKLAQLA
FT                   IPLMSKLPDTVFRQMMEGRLIALLGIEKEGLNKLLPAAASNSRIDKRQKVTPMRLAISV
FT                   LLQHPNIAYGLPEFPEFKEMTLPGLSLLNSLLEICRTTPTITTGQLLEHWREKPESSQL
FT                   NKLAVWQNDIKEDYYEAFFLDTLENFLNFHLTSKIEFLKQKSRLGQALTSAETQQLALL
FT                   LAEQKQH"
FT   gene            complement(413377..413820)
FT                   /locus_tag="Ping_0312"
FT   CDS_pept        complement(413377..413820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0312"
FT                   /product="GatB/Yqey domain protein"
FT                   /note="PFAM: GatB/Yqey domain protein; KEGG: vpa:VP0406
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02178"
FT                   /db_xref="GOA:A1SRR3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR3"
FT                   /protein_id="ABM02178.1"
FT                   /translation="MSLKAKLKEQQILAMRAKDKVRLGTIRMLLAAIKQIEIDNKVELI
FT                   DDEVMAVVIKSVKQRKDSIAQFEKANRIDLADIEKAELEILQEFLPQALTSEEVKTLIK
FT                   QAIASSGANGMQDMGKVMGLLKKDIQGRADMGEVSALVRASLA"
FT   gene            complement(413854..414069)
FT                   /locus_tag="Ping_0313"
FT   CDS_pept        complement(413854..414069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0313"
FT                   /product="SSU ribosomal protein S21P"
FT                   /note="PFAM: ribosomal protein S21; KEGG: ppr:PBPRA0433
FT                   putative ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02179"
FT                   /db_xref="GOA:A1SRR4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRR4"
FT                   /protein_id="ABM02179.1"
FT                   /translation="MPVIKLRENEPFDVALRRFKRSCEKAGILAETRKREFFEKPTTVR
FT                   KRAKAAAVKRHLKKLSRENARRVRLY"
FT   gene            414336..415361
FT                   /gene="gcp"
FT                   /locus_tag="Ping_0314"
FT   CDS_pept        414336..415361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="Ping_0314"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: sfr:Sfri_2992 putative metalloendopeptidase,
FT                   glycoprotease family protein; TIGRFAM: putative
FT                   metalloendopeptidase, glycoprotease family; PFAM: peptidase
FT                   M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02180"
FT                   /db_xref="GOA:A1SRR5"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRR5"
FT                   /protein_id="ABM02180.1"
FT                   /translation="MRILGIETSCDETGIAIYDDQLGLLSHQLYSQVELHADYGGVVPE
FT                   LASRDHVRKTIPLIKEALVAANCTKESLDGIAYTAGPGLVGALLVGSCIGRSLAYAWNI
FT                   PAIAVHHMEGHLLAPMLEENRPEFPFLALLVSGGHTLMVEVENIGEYQVLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPRLAKLAEKGEPKRFIFPRPMTTKPGLDFSFSGLKTFAANTI
FT                   AKEGKDPQTQADIALAFQDAVIDTVAIKCKRALKQTGLKRLVVAGGVSANLSLRSQLAV
FT                   LMKSLGGEVFYPRNEFCTDNGAMIAYAGMQRLKAGHFEGLGIQAKPRWPLDQLLSVRSE
FT                   L"
FT   gene            415578..416621
FT                   /locus_tag="Ping_0315"
FT   CDS_pept        415578..416621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0315"
FT                   /product="Chain length determinant protein-like protein"
FT                   /note="KEGG: sec:SC0620 ferric enterobactin (enterochelin)
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02181"
FT                   /db_xref="GOA:A1SRR6"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR6"
FT                   /protein_id="ABM02181.1"
FT                   /translation="MICAVGIAGSVYYALNAQEWWVAKGKVIAPQVNDVAALYAQSNKV
FT                   SAILNSNDLLNSNSNNNGQDTKQVSKELVDLFEPSTLFRNFINAFNSTINKKHFLETNP
FT                   AFLAYLQVKQITVPSKGSAQESRQQYLIVLNNWMNKINASLNSQTSELALSFRSATKES
FT                   SAELLNEYILFIGENVRENQLEKFLLFIDSAKNELQVSLQMTEQKARRELAVLLQKTEY
FT                   AYQIASHSGLVEYQANLNKEGELFQINLGEKALKAKIDVLKSIQDLSVLEPSLAIMTIT
FT                   LDALNKLEFSDNSSFTPYRYLEVVEPPLNRSAPKRALIVILATLLAGMLSIFIALVHYF
FT                   MTKKEQN"
FT   gene            complement(416727..417734)
FT                   /locus_tag="Ping_0316"
FT   CDS_pept        complement(416727..417734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0316"
FT                   /product="porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   vch:VC0105 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02182"
FT                   /db_xref="GOA:A1SRR7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR7"
FT                   /protein_id="ABM02182.1"
FT                   /translation="MTISQHFPARRLRRLRKHDFSRRLVAENQLSASDLIYPMFVVEGK
FT                   NQREKIKSMPGIERLSIDLLVAEAKQLVALGIPAIALFPVTPDNIKTEMAEEAYNPEGL
FT                   AQRAVRSVKEACPELGVITDVALDPFTTHGQDGIIDKEGYVLNDITTEILVKQALSHAQ
FT                   AGADIVAPSDMMDGRIGAIREALENAGFINTQIMAYSAKYASNYYGPFRDAVGSAGNLK
FT                   GGNKSTYQMDPANSDEAIHEVALDIQEGADMVMVKPGMPYLDIVRRVKTELQVPTFAYQ
FT                   VSGEYAMHKAAIDNGWLKERETVLESLLCFKRAGANGILTYFAKQVAIWLQENK"
FT   gene            complement(417747..418544)
FT                   /locus_tag="Ping_0317"
FT   CDS_pept        complement(417747..418544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0317"
FT                   /product="Sec-independent protein translocase TatD"
FT                   /EC_number="3.1.21.-"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   cps:CPS_0167 deoxyribonuclease TatD"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02183"
FT                   /db_xref="GOA:A1SRR8"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR8"
FT                   /protein_id="ABM02183.1"
FT                   /translation="MIDIGVNLTNKRFQKDINEVIANAKQAGVSSMIITGTNLAESEAA
FT                   LQLAQNYPDYLFSTAGIHPHDADSFDKTSLNQLRSLAQDPSVKAIGECGLDFNRNYSTP
FT                   AEQEYAFIEQLELAVELQLPVFMHERDANQRFIELLSPYVKQLPNAVLHCFTGDQFDLQ
FT                   RCLEIDLHIGITGWICDERRGAHLLELVKLIPANRLMIETDSPYLLPRSMRPKPKSSRN
FT                   EPKYLPYIAQTIAHARQQNVEQFIEQTTQTSRAFFNIGRALTV"
FT   gene            complement(418551..419327)
FT                   /locus_tag="Ping_0318"
FT   CDS_pept        complement(418551..419327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0318"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: ppr:PBPRA0121 sec-independent protein
FT                   translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02184"
FT                   /db_xref="GOA:A1SRR9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRR9"
FT                   /protein_id="ABM02184.1"
FT                   /translation="MSSDQDNGTSSQHSLPLFSHLIELRDRILRIVAIVIIIFLSLVYF
FT                   ANDIYHYLSIPLTSQLPEGASMIATGVATPFFTPIKLTLVLSIFIAIPAILYQVWGFIA
FT                   PGLYKHERKLVAPLVISSALLFYLGMAFSYYVVFPLAFSFFTNTAPEGVLIATDISSYL
FT                   DFALKLFFAFGLAFEIPIATLVLCWTGATTPQKLKEKRPYIVVAAFVFAMLLTPPDVIS
FT                   QTLLAVPMLILFEIGLLFSRFYVQPAEDTDNSEQEN"
FT   gene            complement(419324..419734)
FT                   /locus_tag="Ping_0319"
FT   CDS_pept        complement(419324..419734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0319"
FT                   /product="Sec-independent protein translocase TatB"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; KEGG: ppr:PBPRA0120 sec-independent protein
FT                   translocase protein TatB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02185"
FT                   /db_xref="GOA:A1SRS0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRS0"
FT                   /protein_id="ABM02185.1"
FT                   /translation="MFDIGFWELVLISVIGLVVLGPERLPHAIRSVMHWITTAKNMANS
FT                   VKTEVTQELKLHEINENMIKASKQGLSDLDPELQKSIDEMKETAEQLSRPYKKDIDDIK
FT                   TSLDKNPSGTTQQENSILDSSKTTPPRQDKNE"
FT   gene            complement(419759..420025)
FT                   /locus_tag="Ping_0320"
FT   CDS_pept        complement(419759..420025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0320"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: cps:CPS_0163 Sec-independent protein
FT                   translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02186"
FT                   /db_xref="GOA:A1SRS1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRS1"
FT                   /protein_id="ABM02186.1"
FT                   /translation="MGGIGIWQLAIITVIVILLFGTKKLRGIGGDLGGAIKGFKKAIKE
FT                   DNDKDSTQVDDKDSTQVDDNAKQPSNKKVEENIKEQSKEKDRA"
FT   gene            complement(420083..421723)
FT                   /locus_tag="Ping_0321"
FT   CDS_pept        complement(420083..421723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0321"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: vvy:VV0179 putative ubiquinone
FT                   biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02187"
FT                   /db_xref="GOA:A1SRS2"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS2"
FT                   /protein_id="ABM02187.1"
FT                   /translation="MIKIKELTRLYQINKTVIEYGLIELLPKEHVPLAYRFMCACLFWI
FT                   SNKHQGMSLPERLRLSLQSLGPIYIKLGQMLSTRRDLLPPIYADQLAYLQDNVPPFCGE
FT                   QAIEQIEKSFNKPIDSIFDDFDKVALASASIAQVHTATLKEDGRAVVVKVTRPGIEKRI
FT                   QADLQLMKWLASLMQRFLKEAERLRPVEVIHEYEKTIIDEIDLMREGANTIQLRRNFLN
FT                   SKLLYVPEIYPNYCTKNALVMERIYGIPVSDTNALQAQNTNLKLLAERGVETFFTQVFR
FT                   DSFFHADMHPGNVFVSYEHPEDPLWIGIDCGIMGTLNKEDKRYLAENFLAFFNRDYRQV
FT                   AQLHVDSGWVPADTPVEEFEFSIRAVCEPIFEKPLAEISFAQVLINLFNTARRYNMKVQ
FT                   PQLVLLQKTLFYVEGLGRQLYPQLDLWDTAKPFLENWMKEQVSPKTLFKSISQKAPFWL
FT                   EKLPELPELVYYNLSQAKSQNKQLILLAESFNKQQKNNRKSYFYIAAAISLSLISALAY
FT                   LQTDKNLTLLAGIPGIFAWLLAWRYTNKV"
FT   gene            complement(421720..422352)
FT                   /locus_tag="Ping_0322"
FT   CDS_pept        complement(421720..422352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0322"
FT                   /product="hypothetical protein DUF1243"
FT                   /note="PFAM: protein of unknown function DUF1243; KEGG:
FT                   vpa:VP0096 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02188"
FT                   /db_xref="GOA:A1SRS3"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS3"
FT                   /protein_id="ABM02188.1"
FT                   /translation="MPLDKLVCGFLETTVNKLQQLDSSALQRRKQLNGTIIGVALKEIN
FT                   KPLYFVISTQQIDILSHYEGQADCFIRLNISALKELQNNHQLTHLIKTEQLEVEGDIKI
FT                   VQRFARLLTEMDIDWEEHLSAIIGDILAHKLCYQFKQCRQNASSQIKKIQKQSGEYLTE
FT                   ELKIAPGPLEVAYFCEQVNDIKKQTDTLEKRLQLCFASSNKLTRNIR"
FT   gene            complement(422433..423188)
FT                   /locus_tag="Ping_0323"
FT   CDS_pept        complement(422433..423188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0323"
FT                   /product="demethylmenaquinone methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferases; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   vfi:VF0046 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase UbiE"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02189"
FT                   /db_xref="GOA:A1SRS4"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRS4"
FT                   /protein_id="ABM02189.1"
FT                   /translation="MSNQAENTTHFGFKTVQEDTKADLVAGVFHSVAAKYDIMNDVLSM
FT                   GVHRIWKRFTVDCSGIRKGQKVLDLAGGTGDLTAKFSRIVGQTGQVTLADINDSMLKVG
FT                   RSKLRDLGIVGNVSYVQANAEELPFPDNHFDLITIAFGLRNVTDKDKALASMYRVLKPG
FT                   GRLLVLEFSTPLYEPLSKFYDFYSFNVLPKLGKLIANDSESYQYLAESIRMHPGQEILK
FT                   EMMNSANFEGCEYFNLSGGIVALHRGYKY"
FT   gene            423677..425329
FT                   /locus_tag="Ping_0324"
FT   CDS_pept        423677..425329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0324"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   vfi:VF0304 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02190"
FT                   /db_xref="GOA:A1SRS5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRS5"
FT                   /protein_id="ABM02190.1"
FT                   /translation="MLKNINPTKTVAWSELKTLFDANADLKISTLFANDPQRFKAFSRQ
FT                   FDDHLLVDFSKNLITEEIFTKLLALAEEVDLKGAIKAQFSGEKINVTENRAVLHSALRN
FT                   RSNTPVFVDGENVMPKVNAVLEKMKAFCTKVHSGEWKGYTGKAITDIVNIGIGGSDLGP
FT                   FMVTEALRPYKVEGIDAHFVSNVDGTHIVETLAKVDPETTLFLVASKTFTTQETMTNAH
FT                   SAREWFLNFAEDETFVAKHFAALSTNADAVAEFGIDVDNMFEFWDWVGGRYSIWSAIGL
FT                   SIALTIGFDNYEVLLGGAHEMDKHFEETDFENNIPVILAVIGVWYNNFHGAESEAILPY
FT                   DQYMHRFPAYFQQGNMESNGKCVDRNGESVDYQTGPIIWGEPGTNGQHAFYQLIHQGTK
FT                   LIPCDFIAPAVSHNPVGDHHAKLLSNFFAQTEALAFGKSKETVEAEFAAAGKTTEEVAH
FT                   LIPSKVFAGNNPTNSILVNKITPQTLGQLIAMYEQKIFVQGVIWNIFSFDQWGVELGKQ
FT                   LAGQILPELTTVNAVDSHDSSTNGLINAWKAWK"
FT   gene            complement(425409..426062)
FT                   /locus_tag="Ping_0325"
FT   CDS_pept        complement(425409..426062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0325"
FT                   /product="Exopolysaccharide biosynthesis protein-like
FT                   protein"
FT                   /note="KEGG: hin:HI1244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02191"
FT                   /db_xref="InterPro:IPR015037"
FT                   /db_xref="InterPro:IPR037226"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS6"
FT                   /protein_id="ABM02191.1"
FT                   /translation="MRIEIGRKVEKYIKSRLSRLKLKQNDFTIISNNCWGTFMYKKFAL
FT                   PYTTPFVNLLIFSPDYIELLENLTPELLTKISFIEHENSQHKEEMVRLNIYKKNYPIGI
FT                   LDNKYELHFLHYQSQQDAKDKWLKRLARMNFDKLIVKFSASLKFEDNMAERFDDLNFKN
FT                   KICFTATAFPNLKSIVSMQAFKGKETVIDEWKHTTKKEFDLINFINNIQREDKA"
FT   gene            complement(426043..426852)
FT                   /locus_tag="Ping_0326"
FT   CDS_pept        complement(426043..426852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0326"
FT                   /product="glycosyltransferase sugar-binding region
FT                   containing DXD motif"
FT                   /note="PFAM: glycosyltransferase sugar-binding region
FT                   containing DXD motif; KEGG: vch:VC0234 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02192"
FT                   /db_xref="GOA:A1SRS7"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS7"
FT                   /protein_id="ABM02192.1"
FT                   /translation="MNAFIFLSNRLSKIIGNICKIMSYPFHAVFPKKRFTIPEFSKAKI
FT                   SSTASKIPRVIWQTNYSNRSTLPVYLNYLFNRLMSLNYDYRYVSTEERIEYIKNNASAA
FT                   VYKSYMILNDGAAQADLWRLVVLNKEGGVYLDIDANFVWPLSKILKDDDQAVYIKIKNN
FT                   THFTNYFLACAPNNNELQQAITIICHKIQEKEVDRGVYFLTGPGVLNTVLAGKKVTSRT
FT                   HRATCIQGSFTNEHFQYLDKPRGKWTHKKPSELLIKEMDQKNENRNR"
FT   gene            427050..428069
FT                   /locus_tag="Ping_0327"
FT   CDS_pept        427050..428069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0327"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   vch:VC0223 ADP-heptose--LPS heptosyltransferase II,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02193"
FT                   /db_xref="GOA:A1SRS8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS8"
FT                   /protein_id="ABM02193.1"
FT                   /translation="MRKILVVRNDKIGDFMLAWPSFAMLKKSLPDAQIDALVPAYTKPL
FT                   AQLCPWIDNVIVDDPEQSQQARLVNEIKAENYSDYICLFSTTRNAQLGRKAKIAYRLAP
FT                   ATKWAQFLFNDRLKQRRSQSAKPESEYNLDLIRHFLQKNKITPVEVRPPFLNVDRKVKQ
FT                   TQRNLLQQKLGKSINKLCFIHAGSGGSANNLSIAQYAHLITLLNEHVANLGFILTAGPG
FT                   EEVQAKQLQALLPDNVCSYLYQSTKGLISFCQTISCADLFIAGSTGPLHIAGAADVPTA
FT                   GFFPAKRSATPLRWQPLNSTGRHIAFIPPNNNSQDDMTAIDINLVMQNLLSFLEKNNF"
FT   gene            complement(428118..428891)
FT                   /locus_tag="Ping_0328"
FT   CDS_pept        complement(428118..428891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0328"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   vch:VC0224 lipopolysaccharide biosynthesis
FT                   glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02194"
FT                   /db_xref="GOA:A1SRS9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRS9"
FT                   /protein_id="ABM02194.1"
FT                   /translation="MSKNSISAIIITKNEQNNLPACLDSLRWVDELIIVDSGSTDRTEA
FT                   VAKRYGAKFYSHTNWQGFGKQKQLAQNYATSKWIIAIDADEVVSPELQSAIEQKITTSD
FT                   ENTVFKIQRKTWVFGRFLAHSGWIDKIIRVYPKQLAHYNNALVHEKIVTENHVKISQLQ
FT                   GDLFHYSYGDMENYLVKSASYGKAWADEREKRGKKASLTQGFTHALGCFVKMYLVKRGF
FT                   LDGKQGLLIAILSAHSTFIKYADLWIRENDSRAKK"
FT   gene            complement(428896..429942)
FT                   /locus_tag="Ping_0329"
FT   CDS_pept        complement(428896..429942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0329"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   vvu:VV10816 ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02195"
FT                   /db_xref="GOA:A1SRT0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT0"
FT                   /protein_id="ABM02195.1"
FT                   /translation="MPLFTSAPNSICILRLSAIGDVCHAIACLQAIQRQWPSTKITWVT
FT                   GKLEAQLLQHISGIEVIIFDKKQGWKAYKQLRCRLKDRKFDVLLHMQAALRASIASLMI
FT                   KADIKLGFDRPRAKDGQWLFTNCKIEQGKSVHVLDGFMAFAKKLGISDLSVKWNINIPI
FT                   ASEEKATTLIDNKPTFIICPAASKAYKNWTIEGYSALANHAIKQGFQVLICGAPTEIEK
FT                   ALAKKIVASSNQQAKNLIGQTSLIDLLALIKQASIVLAPDTGPTHMATMVNTPVIGLYA
FT                   HHNPKRTGPYAQLSHVVSVYDTLITEQSGKTAEELPWRARVKDENAMQKIAIKVVITMF
FT                   DNLCQKQE"
FT   gene            430068..430763
FT                   /locus_tag="Ping_0330"
FT   CDS_pept        430068..430763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0330"
FT                   /product="Mn2+-dependent serine/threonine protein kinase"
FT                   /note="PFAM: lipopolysaccharide kinase; KEGG: pat:Patl_0055
FT                   lipopolysaccharide kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02196"
FT                   /db_xref="GOA:A1SRT1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT1"
FT                   /protein_id="ABM02196.1"
FT                   /translation="MKIIECNQQSFFFNAEKFSTLLFDLTFLQENNRVIGNSVGRGITW
FT                   FFEHQQKKYVLRHYFRGGFIGKINPDNFFYAGLKRTRAYNEFILLDKMAQLNLPVPLPY
FT                   AGRISRKGLFYQADLIIELIDGAHDLVAVLNKRKIGEAQWREIGRVIRLFHDNNIYHSD
FT                   LNSHNIMLDKHNKVWLIDFDKCAQIKTGVWKEKTLARLLRSLRKEKSKKNHLNWSEQDW
FT                   LSLIFGYQN"
FT   gene            complement(430809..431645)
FT                   /locus_tag="Ping_0331"
FT   CDS_pept        complement(430809..431645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0331"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   vvy:VV0299 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02197"
FT                   /db_xref="GOA:A1SRT2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT2"
FT                   /protein_id="ABM02197.1"
FT                   /translation="MANNQPENYKASIIIAFYNNIEALKLVFKALEKQTENNFEVIIAD
FT                   DGSKSEIVKELNTLSEQSTLTIQHLWQEDIGFRKNRCLNKAVQASRSNYLIFIDGDCIP
FT                   QCYFIEDHLSEAEQGVCLNGRRADLSHKMSQLLRECDNPACFISQHRTKLLFDYLFGNG
FT                   KNIEKGFRITNTPLRKAIQKKNKGLVGCNFSLFKQDLFNINGFDQRYEAPGIGEDSDID
FT                   FRLGIAGIMIKPLFYKANQVHLQHKELPRSDVNSALFKKIRKEKKAWTNFGIVQNK"
FT   gene            complement(431801..433045)
FT                   /locus_tag="Ping_0332"
FT   CDS_pept        complement(431801..433045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0332"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: ppr:PBPRA0211
FT                   hypothetical KDO transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02198"
FT                   /db_xref="GOA:A1SRT3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT3"
FT                   /protein_id="ABM02198.1"
FT                   /translation="MLFILYQLLQFLFFPFICFTLIKKAKGKLPLSKLLEYLGIAKKQP
FT                   FPVTCFHCVSVGEVLTALPLIKQYQVQYPEQKLLITTTTFTGYQEVKKAFGDNIEHRFL
FT                   PLDFILFSKLFFSCHNIQRINIIETELWPSLLQQAKRHNVQVSLINARLSKRSAKRYLK
FT                   FPRSACWLVSHLDKVLAQHQDDADRFIQLGVSKDKITITGSIKFDIKIDPEKQQKGELL
FT                   KKKCSHFPIILAASTHKGEDEIMLTAFKTLQQTEKNALLIIVPRHPERFDSVFHLAEKK
FT                   QFKTCRKTEYSQPPQDCQVYIGDTMGEMIIYLSLADLVIMGGSFVPVGGHNLLEPAALK
FT                   KPAITGPFNFNFTDITEQLINVKHTIKAENPQQLTQLLLKQCWDPDKLTEQGEQGLKVV
FT                   KNNQGALEKTLTLLI"
FT   gene            complement(433046..434296)
FT                   /locus_tag="Ping_0333"
FT   CDS_pept        complement(433046..434296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0333"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: msu:MS0243 RfaL
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02199"
FT                   /db_xref="GOA:A1SRT4"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT4"
FT                   /protein_id="ABM02199.1"
FT                   /translation="MLKKCLFTKAQYIQFFVFIFFSMTFAVRSGTGYGAFPLLFIALIS
FT                   LPSLYRYIKAHPLTLLEKSLLTALIVFALLPMLSAYFEGLSGSAYDKPSRYLLCALTFL
FT                   LLLRYNVSLLSIALGAWLGAIFAGTNALYDVFYLGMERAGGRFTVVIEFGDISLLLTAF
FT                   VLLSYQKLKNKIPQFLIITSILLGLTAVILSQSRGGWIFIPLLVIIIATHYRNICFDLS
FT                   KKKWLGTVFLLTTILVAGWLSAGELVSQRIKLAEDAIISYQKNDNVTPAVGVRFEMWKG
FT                   GIQSIKNAPLFGGGDKGIITGKQQLIDQNKIALSPGIIQWTSVHNQYLDTWGKYGFFTF
FT                   MAFLAIFFIPLTFFITQRNKGDADTRCASYCGITLCTGYLFFALTESIFTINSTVMFYS
FT                   FSLIIFYSCAKTARDET"
FT   gene            complement(434303..435334)
FT                   /locus_tag="Ping_0334"
FT   CDS_pept        complement(434303..435334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0334"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase, family 9; KEGG: pfo:Pfl_0465
FT                   lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02200"
FT                   /db_xref="GOA:A1SRT5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT5"
FT                   /protein_id="ABM02200.1"
FT                   /translation="MKILVIGPSWVGDMVMSQCLYKLLKQQYPQAQLDVLAPNWCNALL
FT                   TRMPEVDNAIAMPIGHGALQIALRYKMGKQLAGVYDWAIIQPNSFKSAFIPFFAGIKKR
FT                   TAWKGESRYFIINDLRNNRDNFPLMIERYSALAFDKKEMTDSKALPVIPFPSLTVNQKN
FT                   LDNTLNKLTLSVDQKILGLCPGAEFGPSKRWPDSYYAKVAQERIEAGWQVWVFGGEKDH
FT                   QVGELIRSQLSPDLQKQCINLAGKTTLSEAVDLLSLPNIVVSNDSGLMHVAAAHNRPLV
FT                   AVYGSSSPKYTPPLSQHVRVLHTDIGCRPCFKKQCKFGHLKCLTELLPSRATAAVHSLI
FT                   KEQ"
FT   gene            complement(435349..436284)
FT                   /locus_tag="Ping_0335"
FT   CDS_pept        complement(435349..436284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0335"
FT                   /product="ADP-glyceromanno-heptose 6-epimerase precursor"
FT                   /EC_number="5.1.3.20"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KEGG: vch:VC0240
FT                   ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02201"
FT                   /db_xref="GOA:A1SRT6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRT6"
FT                   /protein_id="ABM02201.1"
FT                   /translation="MFIVTGGAGFIGSSIVKSLNERGITDILVVDDLTDGAKFVNLVDL
FT                   QIMDYMDKDEFITQIVSGQDFGDIEAIFHEGACSATTEWNGKFMMENNYEYSKDLLHYC
FT                   IERDIPFLYASSAATYGGNDTFKEELKYEKPLNVYGYSKFQFDQYVRRIWEDAAAHDET
FT                   LPQIVGFRYFNVYGPREQHKGSMASVAFHLNNQLNAGENAKLFEGEHKRDFVYIGDVCK
FT                   VNLWFFDNNVSGIYNLGTGQAESFLEVGQAVVAYHQKGEVERIPFPEHLKGRYQSFTEA
FT                   DLTNLRAAGYKDTFKSVAQGTAEYMAWLNR"
FT   gene            436339..437538
FT                   /locus_tag="Ping_0336"
FT   CDS_pept        436339..437538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0336"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   csa:Csal_0013 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02202"
FT                   /db_xref="GOA:A1SRT7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT7"
FT                   /protein_id="ABM02202.1"
FT                   /translation="MQLFKVGSQLRPVSSYIPKMFFQTGKVYVYTLIMSGLNMNILELC
FT                   LSDSLGGLELHFRDFSVWLDEQQSSEGRIFVATRSETPLASRMESDLCLTNRNLWHAAR
FT                   LSKFISANKIDVVHIHDKKDLPLLALVKSICSYPFKLAHTRHMSLPGGKRDFYHSWLYG
FT                   KVDAYFVITEWMKSQVINNLPLAPEKIHKINLGTAVVERCSETELSELKDNIFSEHQGL
FT                   WLANIARIQHGKGQHVFLDAIKQLKDKGIQVAGVIAGGTDDPQYVKQLEDYIELHQLKV
FT                   KIFGHRDDIPVLIQAMDAVVLTTECETFGLIMIEAMMAGVVAIGSNSGGVPEIIDHLEN
FT                   GLLFNVFDPQDLSKQIQLLDLSSELKEKLALKGQQKALQRFEKKKQFLAFKEKLLNLEE
FT                   "
FT   gene            438215..438517
FT                   /locus_tag="Ping_0337"
FT   CDS_pept        438215..438517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0337"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: ecp:ECP_3510
FT                   thiosulfate sulfurtransferase GlpE"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02203"
FT                   /db_xref="GOA:A1SRT8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT8"
FT                   /protein_id="ABM02203.1"
FT                   /translation="MSGYQLINAYDAKQRSLKENIQLVDIRDANSFEIAHAEGSFHLTN
FT                   DTIADFIEEVEVNTTVFVICYHGNSSKGVAQYLCTQGYLDVYSVNGGFEGWQLVE"
FT   gene            438671..439021
FT                   /locus_tag="Ping_0338"
FT   CDS_pept        438671..439021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_2737 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02204"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRT9"
FT                   /protein_id="ABM02204.1"
FT                   /translation="MSVVDTDVIDAIGLEKEAQRVFLSIIDALVWDAENVHLYTLQEKI
FT                   NTYLHFIESGELDKALPDGKGFDIAIELILKHMPSDPAITFFDKTTQILLDKGIIFVFG
FT                   PNRDSGYVEQQS"
FT   gene            439294..441297
FT                   /locus_tag="Ping_0339"
FT   CDS_pept        439294..441297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0339"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="KEGG: pha:PSHAa0671 transketolase 1 (TK 1); TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02205"
FT                   /db_xref="GOA:A1SRU0"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU0"
FT                   /protein_id="ABM02205.1"
FT                   /translation="MPPRKELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWRDFL
FT                   KHNPTNPQWADRDRFVLSNGHGSMLIYSLLHLTGYALSIEDLKSFRQLHSKTPGHPEYG
FT                   YAPGIETTTGPLGQGLTNAVGMAIAEKSLAAQFNRPAHDIVDHFTYTFLGDGCLMEGIS
FT                   HEASSLAGTLGLGKLIAFWDDNGISIDGNVDGWFTDDTPARFKAYGWQVISVDGHNSEE
FT                   IKAAIIAAQAETSKPTMICCKTIIGFGAPTKQGTHGCHGAPLGADEIIATRKALGWNYG
FT                   DFEIPADIYAGWDNKEQGQALENSWDEQFAAYASAYPELAAEYKRRINGDMPSDWEVKS
FT                   TQYIEELQASQANIATRKASQNCIEAFGTMLPELLGGSADLAPSNLTMWSGTKAITADD
FT                   ASGNYLHYGVREFAMSAIVNGIALHKGFVPFGATFLMFMEYARNGLRMSALMKQRAIQV
FT                   FTHDSIGLGEDGPTHQPVEQIASLRLTPNMNTWRPCDSVESAVAWKSAIERIDGPTSLV
FT                   FSRQNLQPQARDAQQLSDVAKGGYVLLESKEFDSANSASIMLIATGSEVQLAVEAYNEL
FT                   TAQGKAVRVVSLPCTDIFETQSAEYKESVLPALVTKRLAIEAGIADYWYKYVGLNGKVI
FT                   GMTTFGESAPAEQLFKMFGFTVENVVESAQTL"
FT   gene            441616..442032
FT                   /locus_tag="Ping_0340"
FT   CDS_pept        441616..442032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0340"
FT                   /product="ribose transport protein RbsD"
FT                   /note="PFAM: RbsD or FucU transport; KEGG: ppr:PBPRB1556
FT                   hypothetical ribose ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02206"
FT                   /db_xref="GOA:A1SRU1"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023064"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRU1"
FT                   /protein_id="ABM02206.1"
FT                   /translation="MKKTALLNAELSYLVASLGHFDEITICDAGLPIPNETQRIDLALT
FT                   HGVPAFIDTVRVILSEMQITGVLLASEFKQVSPDLHRALIELVEQEKLAGSRIELIYIS
FT                   HEAFKERTSNSKAVVRTGECTPYANVIFQSGVVF"
FT   gene            442059..443564
FT                   /locus_tag="Ping_0341"
FT   CDS_pept        442059..443564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0341"
FT                   /product="ribose ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ppr:PBPRB1557 putative ribose ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02207"
FT                   /db_xref="GOA:A1SRU2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU2"
FT                   /protein_id="ABM02207.1"
FT                   /translation="MNQPILELKDIHKSFPGVKALDNACLNVYPGKVMALLGENGAGKS
FT                   TLMKVLTGIYALDQGEVRYENNKVNFAGPRESQEAGIGIIHQELNLIPELTIAENIFLG
FT                   REITNAFGGIKWSVMFDEADALLQRLNVKHKSSQLLGDLSLGEQQMVEIAKALSFKSKV
FT                   IIMDEPTDALTDTETASLFKVINELRDAGYGIVYISHRLKEIFEICDDITVLRDGKFIV
FT                   ERKVSEIDEDTLIELMVGRRLDEQYPRIDSVNGTTCLEVKNLSAADIHNVNFSLNHGEI
FT                   LGVSGLMGAGRTELMKVIYGALKRDSGELLLEGQSIHAHTPQQGLDYGIAYISEDRKGD
FT                   GLVLGLSVKENMSLCALKQFSKGIQLDHQAETIAVEDFIGLFNIKTPSMDQIIGNLSGG
FT                   NQQKVAIAKGLMTKPKVLILDEPTRGVDVGAKKEIYQLINQFKAEGMSIILVSSEMPEV
FT                   LGMSDRIIVMHQGRISGEFNHADADQEKLMACAVGKVSNEVAA"
FT   gene            443561..444535
FT                   /locus_tag="Ping_0342"
FT   CDS_pept        443561..444535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0342"
FT                   /product="ribose ABC transporter membrane protein"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   ppr:PBPRB1558 putative ribose ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02208"
FT                   /db_xref="GOA:A1SRU3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU3"
FT                   /protein_id="ABM02208.1"
FT                   /translation="MNNKVSKTQANSKLFNKEWFIEQKSLIALILLIVVVAFMNEYFFT
FT                   VNNLLNILRQTSVIAIIAAGMTLVILTAGIDLSVGSVLALCGAFAASMISLEIPIAIAV
FT                   PISLLGGALLGCATGGIIAKGKVQAFIATLVMMTLLRGVTMVYTDGRPISAGYTDVADN
FT                   FAWFGTGYVFGIPVPVWIMIAVFAAIWYLLNHTRFGRYVYALGGNESATRLSGINVDRV
FT                   KIGVYAICGLLSALAGIIITSRLSSAQPTAGMGYELDAIAAVVVGGTSLAGGRGRITGT
FT                   LIGALIIGVLNNALNLMDVSSYFQMIVKALVILLAVLVDNKQK"
FT   gene            444606..445484
FT                   /locus_tag="Ping_0343"
FT   CDS_pept        444606..445484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0343"
FT                   /product="ribose-binding protein"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: ppr:PBPRB1559 putative
FT                   ribose ABC transporter, periplasmic D-ribose-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02209"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU4"
FT                   /protein_id="ABM02209.1"
FT                   /translation="MKIFTKLITAAVISASFSAGAMAQDTIAMVVSTLNNPFFVSMKEG
FT                   AEDKAKELGYELIVLDSQNDPSKELSNVEDLVVRGVKAILINPTDSDAVTNAIRIANQA
FT                   DIPVLTLDRGAAGGDVVTHIASDNIAGGEMAGKFINDKIGKNAKVVQLEGIAGTSAARE
FT                   RGEGFMKAVSTYNMDLLASQPADFDRTKGLNVMENLLASNPDTQAVFAQNDEMALGAIR
FT                   AVQASGKKILVVGFDGTEGGIAAVKRGSLGATIAQQPRMIGSLGVESAAKVLKGEAVEK
FT                   YIPVSLMMIVK"
FT   sig_peptide     444606..444677
FT                   /locus_tag="Ping_0343"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            445648..446574
FT                   /locus_tag="Ping_0344"
FT   CDS_pept        445648..446574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0344"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: vfi:VF1448
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02210"
FT                   /db_xref="GOA:A1SRU5"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU5"
FT                   /protein_id="ABM02210.1"
FT                   /translation="MNKLVVLGSVNADHVLQVPSFPRPGETLHGTGYAVIPGGKGANQA
FT                   VAAARLGADVAFIACLGDDSFGINIRDAFKSDGINVDGVMIEKNTPTGIAMIQVSATGE
FT                   NSICISAEANNHLTPERIKPFSSLISAAEILLMQLETPIETIQAAAETAKLAGTVVVLN
FT                   PAPAQSLSDELLKLVDIITPNETEAEQLTGVQVKDMPSAQQAAEKLHDKGIEMVMITLG
FT                   SEGVWLSQAGKGKQIKGFTVKAVDTTAAGDTFNGALLTRLLEKASVEESIRFAHAAAAI
FT                   TVTGKGAQTSIPDRQSVEKFLQQMDNK"
FT   gene            446599..447603
FT                   /locus_tag="Ping_0345"
FT   CDS_pept        446599..447603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0345"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: ppr:PBPRB1561
FT                   putative ribose operon repressor, rbsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02211"
FT                   /db_xref="GOA:A1SRU6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU6"
FT                   /protein_id="ABM02211.1"
FT                   /translation="MATIKDVAKHAGVSTSTVSHVLNQTRYVSEDITARVKKAVDELQY
FT                   APSALARSLKLKYTHTFGMLVTTSANPFFAEVVKGVERRCYEQGYNLLLCNTEGDLERL
FT                   RFNIDMLLQKRVDGLLLMSDEIVSQNLDIFARHKAVPTVVMDCGKTHFPADKIQDNSYL
FT                   GGYLATQYLIKKGHRKIGCITGPINKPMAEKRWAGYQKAMQDAGLIINPDWLVDGNFEC
FT                   EGGQQALDKMLSRGTLPSALFVCNDMMALGVINSASKHGISIPDDLSIIGYDDIKIARF
FT                   FTPSLTTIHQPKFNLGRKAFDTLLDKIQSKRENDLEIKLEPTLIERDSVKQIG"
FT   gene            complement(447662..449500)
FT                   /locus_tag="Ping_0346"
FT   CDS_pept        complement(447662..449500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0346"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: vfi:VF2559 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02212"
FT                   /db_xref="GOA:A1SRU7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRU7"
FT                   /protein_id="ABM02212.1"
FT                   /translation="MPQYRSKTSTHGRNMAGARALWRATGVKDDDFGKPIIAIANSFTQ
FT                   FVPGHVHLKDMGQLVAGAVEAAGGIAKEFNTIAIDDGIAMGHSGMLYSLPSRDLIADSI
FT                   EYMVNAHCADAIVCISNCDKITPGMLMAALRLNIPVIFVSGGPMEAGKTKLSDQIIKLD
FT                   LVDAMVMGPDKNVSDEDLAKVERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADREQLFLEAGERIVDITKRHYEQDDYSVLPRAIACREAFENAMALDIAMGGSTNT
FT                   ILHLLACAQEAELDYTVADMDEMSRRIPQLCKVAPSTPLYHMEDVHRAGGVMAILGELD
FT                   RAGLLNSDIPTILSPTMKEQLAKYDIMQTDDPKIIDFYRAGPAGIRTVKPFSQSCRWDT
FT                   VDNDRAAGCVRSLEHAFSTEGGLAVLFGNMAVDGAVVKTAGVDNDNLTFTGPAKIYESQ
FT                   DTAVAAILGGKVVEGDVVVIRYEGPQGGPGMQEMLYPTSYLKSMGLGKKCALVTDGRFS
FT                   GGTSGLSIGHASPEAAAGGVIGLIEDGDIIDINIPTRTMDLKVSDEILAERRIAMDIHG
FT                   WKPVSRERHVSTALKVYALMATSADKGAIRDISKLK"
FT   gene            complement(449659..449916)
FT                   /locus_tag="Ping_0347"
FT   CDS_pept        complement(449659..449916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0347"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   vfi:VF2557 acetolactate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02213"
FT                   /db_xref="GOA:A1SRU8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU8"
FT                   /protein_id="ABM02213.1"
FT                   /translation="MKYLMIIQGENSPELLERLLRVIRHRGFFVQKINAECTGNGKLLH
FT                   ITVTVSSDRPVSLLSKQIEKIFGITQVAVLGQAPPVKESA"
FT   gene            complement(449913..451559)
FT                   /locus_tag="Ping_0348"
FT   CDS_pept        complement(449913..451559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0348"
FT                   /product="acetolactate synthase, large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate enzyme
FT                   domain protein TPP-binding; thiamine pyrophosphate enzyme,
FT                   central region; thiamine pyrophosphate enzyme TPP binding
FT                   domain protein; KEGG: ecc:c4690 acetohydroxy acid synthase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02214"
FT                   /db_xref="GOA:A1SRU9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRU9"
FT                   /protein_id="ABM02214.1"
FT                   /translation="MNGAHSVVQALKQQNVTQVFGYPGGAIMPLYDALYDGGVEHLLCR
FT                   HEQGAAMAAIGYARATGKTGVCIATSGPGATNLITGLADALLDSIPIVAITGQVASHLI
FT                   GTDAFQEVDVLGLSLACTKHSFMVPSAEQLGPIIEQAFQIAQSGRPGPVLIDIPKDIQL
FT                   ADAVIHHLTQTESDSKPLDNSLLRKARSMIRAAAKPLVYVGGGVGMAGAVTELRSFLKK
FT                   SKIPSVCTLKGIGCIPYNSDYFLGMVGMHGSKAANIAIQECDLLIAVGARFDDRVTGKL
FT                   EEFAPHAKVIHLDVDAAEIDKLRVVELAMSDDLKLILPSIETTSSILNWRTHVAKMKVD
FT                   FANRYDHPGGAIFAPALLRQIAKIMPRDTVICSDVGQHQMWVAQHMFVDRPENHISSSG
FT                   LGTMGFGIPAAVGAQMARPDDTVIAVSGDGSFMMNVQELGTIKRGKLPIKIVLIDNQRL
FT                   GMVRQWQQLFFDGRYSETILSDNPDFVTLASAFDIPGETIVAKSQIHDALTRLLNSKGA
FT                   YLLHVSISETENVWPLVPPGAANHKMMESLE"
FT   gene            complement(451882..452485)
FT                   /pseudo
FT                   /locus_tag="Ping_0349"
FT   gene            complement(452767..453609)
FT                   /locus_tag="Ping_0350"
FT   CDS_pept        complement(452767..453609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0350"
FT                   /product="1,4-Dihydroxy-2-naphthoate synthase"
FT                   /EC_number="4.1.3.36"
FT                   /note="TIGRFAM: naphthoate synthase; PFAM: Enoyl-CoA
FT                   hydratase/isomerase; KEGG: yps:YPTB2558 naphthoate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02215"
FT                   /db_xref="GOA:A1SRV0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR010198"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV0"
FT                   /protein_id="ABM02215.1"
FT                   /translation="MPEKEGYAPIAWKKSALNFTDILYHKADGIAKITINRPHIRNAFR
FT                   PKTVNEMMQALQDARYDGDIGVIILTGQGPLSFCSGGDQSVRGDSGYKDESGGHHLNVL
FT                   DFQRQIRTCPKPVIAMVAGYAVGGGHVLHMMCDLTIAADNAQFGQTGPKVGSFDGGWGA
FT                   SYMARIVGQKKAREIWFLCRMYDAQEALDMGMVNTVVPLVYLENETVKWCREILQNSPM
FT                   ALRCLKAALNADCDGQAGLQELAGNATMLFYMSEEGQEGRNAFNEKRKPDFSKFGRNP"
FT   gene            complement(453637..454434)
FT                   /locus_tag="Ping_0351"
FT   CDS_pept        complement(453637..454434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0351"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: pmu:PM0055
FT                   hypothetical HI0282"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02216"
FT                   /db_xref="GOA:A1SRV1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV1"
FT                   /protein_id="ABM02216.1"
FT                   /translation="MPLFSQTQGSPQSPALVFLHGFLGSHQDWCETIKQLKKSFYCISI
FT                   DLPGHGDSASVTIPKDKGFETTHRLIKNVLNDLKIKEYILIGYSLGGRIALDYARTQQD
FT                   QHLKALVLESCHTGYQTQDEKDKRFAHDLSWAKRFATQSIRQSLNQWYEQDIFNDLSCE
FT                   QKNNLFNKRSRNYGVCLANMLLATSLAEQTDALPFLQKNTAQAKPLSIYYCFGEKDNKF
FT                   KTLGRALAKLKNIQPTEFAGAGHNIHQQSPVQYARFIKQHFSQ"
FT   gene            complement(454421..456166)
FT                   /locus_tag="Ping_0352"
FT   CDS_pept        complement(454421..456166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0352"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylate synthase"
FT                   /note="TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; KEGG: sfr:Sfri_0282
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02217"
FT                   /db_xref="GOA:A1SRV2"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRV2"
FT                   /protein_id="ABM02217.1"
FT                   /translation="MITTLYKEPASFAHEFSNINLLWASLFIEELVRNGISDFCIAPGS
FT                   RSTPLTLAADQHTEAHTHVHFDERGLGFLALGLSLFSHKPVVIITTSGTAVANLYPAVI
FT                   EAKLSAIPLIILSADRPVELIDCGANQAIDQYRIFSHYPVFFAQIPSATTHIKPNYLLT
FT                   TINQGLQQQRQTPAAIHFNIAFSEPLYPQTATLNYQGYLQSLKQWLIDKQPFSQYFQNK
FT                   DSFQAASNTQLRDKKVLVIAGRVTGINQAQAIAEFAALNNYPLLADLQSALTGNANNLH
FT                   YYDLLLVNKQFTENLQQADIIVQFGGKLISKRLSQFIEGFAGEYLLVDPGNTRIDPAHS
FT                   LRKRFVCSATQWIKSLQNKIPDIDKHWSQVLQQQNNYITKQIISPFLDNNLISEISVIS
FT                   ALDKLLPADNPVFIGNSMPVRLSDMFFRQNAALPFSNRGASGIDGLLATASGIAKSCAS
FT                   ITTLLIGDTSFLHDLNSLALLKQLQGPFVIIVFNNDGGAIFNLLPVPTQQKQDYYQLPH
FT                   GLTFADSCRQFSIDYYQPESLDQFVGDYQKSLQNRLSLIEICVKNDQTYNHLEYIKEQI
FT                   KYATF"
FT   gene            complement(456181..456429)
FT                   /pseudo
FT                   /locus_tag="Ping_0353"
FT   gene            complement(456483..456731)
FT                   /pseudo
FT                   /locus_tag="Ping_0354"
FT   gene            complement(456785..458083)
FT                   /locus_tag="Ping_0355"
FT   CDS_pept        complement(456785..458083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0355"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthases; PFAM: Anthranilate
FT                   synthase component I and chorismate binding protein; KEGG:
FT                   son:SO4713 menaquinone-specific isochorismate synthase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02218"
FT                   /db_xref="GOA:A1SRV3"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV3"
FT                   /protein_id="ABM02218.1"
FT                   /translation="MLTAEHNFNLMVIFIREQLQQFAIKQGDKPSCNLVIPLTPFDLLG
FT                   LLKGQSLDSDALYPRIYWEDIEHLQTIACFGAIDECTYIPEPIGEACYFGGLAFQQQGV
FT                   QWADFPEILFIRPALEFTLEQQKLRLTCHFNGANSIEKSLLLINCLQKPVSPDAVNNIV
FT                   VSREDLPNRQQWAELVESAIEYKALIPKVVLSRQTELICEQKVNQWDLINQWQEANPNS
FT                   FHFAFQFSTNHTFIGCSPERLFSRENNRLKTEALAGTVNRGREPREDAILRQSLLSDKK
FT                   IDRENYLVQEFIVSSLKRLKAEVTCSEPHVMQLLNVQHLRVEINAKLNAQTKDAHLLHN
FT                   LHPTPAVGGCPKLPALQFINDKEHYNRGWYAGTVGYLRVDKSDFSVAIRSALVSSNKIK
FT                   LFAGAGIVVGSIADQEWQELENKIHTILDILSV"
FT   gene            458186..459100
FT                   /locus_tag="Ping_0356"
FT   CDS_pept        458186..459100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0356"
FT                   /product="1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   spt:SPA3933 menaquinone biosynthetic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02219"
FT                   /db_xref="GOA:A1SRV4"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV4"
FT                   /protein_id="ABM02219.1"
FT                   /translation="MSNISVWLSELRLRTLPLAAASIILGAGIAIQAQIFDLLIFSLSL
FT                   ITALLLQILSNLANDYGDAISGVDNGKRVGPLRAMQSGAISQKSLKIAILLTTSLVVVS
FT                   GITLLVIALGSNSTSWVVFLLLGLLAIVAAITYTMGKLHYGYRAMGDLAVFLFFGLVGV
FT                   VGSYYLYGLTFSWSLLLPATSVGLLSAAVLNINNMRDIYTDKEAHKTTLVVLWGLKNAF
FT                   IYHLSLIVGAFICAVYYFSQLENVQAWQFIFLLSFSPLIKSCLILKEAISKDIRDGQVF
FT                   NDELKNTALSTFVFSLLFALVLI"
FT   sig_peptide     458186..458287
FT                   /locus_tag="Ping_0356"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.939) with cleavage site probability 0.700 at
FT                   residue 34"
FT   gene            459328..461424
FT                   /locus_tag="Ping_0357"
FT   CDS_pept        459328..461424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0357"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pat:Patl_0464 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02220"
FT                   /db_xref="GOA:A1SRV5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV5"
FT                   /protein_id="ABM02220.1"
FT                   /translation="MKDLSKYRNIGIFAHVDAGKTTTTERILKLTGTIHKTGEVHDGES
FT                   TTDFMEQEAERGITIQSAAVTCFWKDHRFNVIDTPGHVDFTVEVYRSLKVLDGGIGVFC
FT                   GSGGVEPQSETNWRYANDSKVARIIFVNKLDRMGADFYRVIEQTKKVLGANPLVMVLPI
FT                   GIEDEFSGVVDLLTRKAYIWDATGLPENYEITDIPADMLELTEEYREKLIETAVEQDDD
FT                   LMEAYLEEGVEPSMEELKRCIRKGTRTMEFFPAYCGSAFKNKGIQNILDAVVDYLPSPT
FT                   EVDPQPLTDEEGEPTGKFATVSTEETFKALAFKIMDDRFGALTFIRIYSGTLKKGDTIL
FT                   NSFTGKTERVGRMVEMQADDRKELSAAQAGDIMAIVGMKNNVQTGHTLCDPKDPIILEA
FT                   MVFPNPVISISVTPKDKGSTEKMGIAIGKMVAEDPTFKVETDVDSGETILSGMGELHLD
FT                   IKVDILKRTYGVDLAVGEPQVAYRETITEEIEDSYTHKKQSGGSGQFGKIDYRIKPGEP
FT                   GSGFVFTSKVVGGNVPKEFFPAIEKGFKGMMDTGVLAGFPVLDVEVEVYDGGFHAVDSS
FT                   AVAFELAARGAFRQSIPKAGAQLLEPIMAVDVFTPDDHVGDVIGDLNRRRGMIAGQEAG
FT                   TSGVRIKADVPLSEMFGYIGSLRTMTSGRGQFSMLFKNYMPCPNNVAEGVIEKVKADKA
FT                   AKKK"
FT   gene            461486..461647
FT                   /pseudo
FT                   /locus_tag="Ping_0358"
FT   gene            462003..462164
FT                   /locus_tag="Ping_0359"
FT   CDS_pept        462003..462164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_0875 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02221"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV6"
FT                   /protein_id="ABM02221.1"
FT                   /translation="MSACKNIWAHIFSSLRIMTLVSGQFSILFKNYMPCPNNVAEGVIE
FT                   KVKADKVI"
FT   misc_binding    462388..462531
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 61.16"
FT   gene            462610..464580
FT                   /locus_tag="Ping_0360"
FT   CDS_pept        462610..464580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0360"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   vfi:VF0032 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02222"
FT                   /db_xref="GOA:A1SRV7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV7"
FT                   /protein_id="ABM02222.1"
FT                   /translation="MSNQVNSNLKTSSRKGLSRKASRRAAQDYIQNLNNESYPNSEKIF
FT                   IKGELHPIKVAMRQIHQADTLLAGSGEQPVFEKNEAIPVYDTSGPYTDPKTKIDVHAGL
FT                   PKLRQSWIAARDDVETLEGVTSNFAKARLANDSLDDLRFANRPKPLRAKKGQCVTQMHY
FT                   ARRGIITPEMEYIAIRENMGRDRVKCEALHFQHAGHSFGANLQEKITPEFVRQEVARGR
FT                   AIIPSNINHPELEPMIIGRNFLVKVNSNIGNSSVSSSIEEEVEKLVWSTLWGGDTVMDL
FT                   STGRNIHETREWILRNSPVPIGTVPIYQALEKVKGVAEDLSWDVFRDTLIEQAEQGVDY
FT                   FTIHAGVLLRFVPMTAKRVTGIVSRGGSIFAKWCLSHHKENFAYEYFREICEICQLYDV
FT                   SLSLGDGLRPGSVADANDQAQFAELEVLGELTKVAWEYDVQVIIEGPGHVPMQMIKENM
FT                   DKQLDDCFEAPFYTLGPLTTDIAPGYDHITSGIGAAQIGWYGCAMLCYVTPKEHLGLPN
FT                   KDDVKVGLITYKIAAHAADLAKGHPGAQIRDNALSKSRFEFRWEDQFNLGLDPVTAREY
FT                   HDETLPQESGKVAHFCSMCGPKFCSMKITQDVRDFTAKLDSGEISIKILDETITMTAAE
FT                   GMALKAKEFNDSGAEIYQPVL"
FT   gene            464642..466144
FT                   /locus_tag="Ping_0361"
FT   CDS_pept        464642..466144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0361"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: pha:PSHAa0484 phosphomethylpyrimidine
FT                   kinase/thiamin-phosphate pyrophosphorylase; TIGRFAM:
FT                   thiamine-phosphate pyrophosphorylase; PFAM: thiamine
FT                   monophosphate synthase; Phosphomethylpyrimidine kinase
FT                   type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02223"
FT                   /db_xref="GOA:A1SRV8"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV8"
FT                   /protein_id="ABM02223.1"
FT                   /translation="MNKLVWSIGASDCTGGGGIQADLHTFKDLGADGCSVISAVTAQNS
FT                   ATVSLVESVSEQMFTDQLACLTADMQAKVIKIGLITSVKHVQILAEKLAEFKQTWAVPP
FT                   FVIYDPVAVALTGEKMAEEGLVELIRTALLPCIDLLTANAGEVLTLSGHALISGESLKP
FT                   AALKLISLGCQSVLIKGGDFELVDKIALDYWTDGKREIALSSARLTRMESHGTGGILAS
FT                   AIGATIALGYFIEDALVVAKAYLNQELKAAKKLGFYGIAHLGWPTNKTDFPEVVLPESK
FT                   IGYELDLPGTLEAGPGFASCGTLKLGLYPVLDSVEWLDKVLKLGVKTLQLRIKDKQPEQ
FT                   VEQQIIEAIALGRKYNARLFINDYWQLAIKHQAYGVHLGQEDMDVADLPMIADAGLRLG
FT                   LSTHGYYEILRAQQLKPSYIALGHIFPTQTKQMPSDPQGLSRLGKYAQLLSDIPTVAIG
FT                   GINLERATTVWKTGVGSIAVVSAITHADSPKIAIESFNQVIQ"
FT   gene            466213..466965
FT                   /locus_tag="Ping_0362"
FT   CDS_pept        466213..466965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0362"
FT                   /product="[sulfur carrier protein ThiS]
FT                   adenylyltransferase"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: plu:plu0484
FT                   4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate
FT                   synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02224"
FT                   /db_xref="GOA:A1SRV9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRV9"
FT                   /protein_id="ABM02224.1"
FT                   /translation="MLTDPEVLRYSRHLLLEDVGESGQSALKFSKVLIIGMGGLGSPAA
FT                   LYLAAAGVGTLVISDFDHLEVSNLQRQIAYQNSDLGAPKVTLMKQRLEALNPEVRVRVI
FT                   NTQMSQSQLSMELILADLVLDCTDNMASRQMINNACVQAKTPLIVGAAIRFEGQLMFFD
FT                   HSKADSACYHCLFPNSEEPALNCSNAGVLGPVVGTIGTLQALEALKYLLGLPSGINNKL
FT                   KLFDAKTLEWQTFVINKDPKCPVCGQIQ"
FT   gene            466962..467162
FT                   /locus_tag="Ping_0363"
FT   CDS_pept        466962..467162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0363"
FT                   /product="sulfur carrier protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: plu:plu0483 thiS protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02225"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW0"
FT                   /protein_id="ABM02225.1"
FT                   /translation="MNIFVNEQVITIPANCNIEQLLLLLESPLKGSAVAVNQHIISRSK
FT                   WAEYKLNEGDQISLFQAIAGG"
FT   gene            467169..467966
FT                   /locus_tag="Ping_0364"
FT   CDS_pept        467169..467966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0364"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   ppr:PBPRA0109 putative thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02226"
FT                   /db_xref="GOA:A1SRW1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW1"
FT                   /protein_id="ABM02226.1"
FT                   /translation="MLFNKMQGNDPLVIADKTFTSRLFTGTGKFNDQKTMIAALRASQS
FT                   ELVTMALKRIDMEHKDDDILAPLIKNGMNLLPNTSGARNAKEAIFAAQLAREALQTNWI
FT                   KLEIHPDPKYLLPDPIETLKAAEFLARDGFVVLPYVHADPVLCKHLEAAGCAAVMPLGA
FT                   PIGSNKGLKTIDFLEIIIEQANIPVIVDAGIGSPSHAALAMELGADAVLVNTAMAVAND
FT                   PVLMSEAFAKAVQAGRQAYLAGLAGQVNHAVASSPLTAFLQAG"
FT   gene            467974..469092
FT                   /locus_tag="Ping_0365"
FT   CDS_pept        467974..469092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0365"
FT                   /product="tyrosine lyase ThiH"
FT                   /note="TIGRFAM: thiazole biosynthesis protein ThiH; PFAM:
FT                   Radical SAM domain protein; biotin and thiamin synthesis
FT                   associated; KEGG: ppr:PBPRA0110 putative ThiH protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02227"
FT                   /db_xref="GOA:A1SRW2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW2"
FT                   /protein_id="ABM02227.1"
FT                   /translation="MSFSEQIKNYQWDDIRLSIYGKSENDVKRALSKERLDLEDFKALI
FT                   SPAAEPFLEQMAQKSQQLTQQRFGKTQQFFIPLYLSNMCSNICTYCGFSMHNAIRRKTL
FT                   DMKEIEDECLAIKKMGFAHILLVTGESERKVGVEYFKQALPIIKKHFSHISIEVQPLDQ
FT                   HEYEALIEYGVDAVLVYQETYNPVTYAEHHLKGKKSDFKYRLDTHDRLGKAGMLKMGLG
FT                   CLIGLEEWRTDCFYVAAHLNYLEKIYWQSRYAISFPRLRPCAGGMEIKSVMDDKELVQL
FT                   ICAYRLFSPEVELSLSTRESEHFRDHVLPLGITSLSAGSSTQPGGYAATSTKALEQFEI
FT                   SDDRSPAKMAKLVKSKGFEVVWKDWDHSLTGK"
FT   gene            469123..469509
FT                   /locus_tag="Ping_0366"
FT   CDS_pept        469123..469509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA1236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02228"
FT                   /db_xref="GOA:A1SRW3"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW3"
FT                   /protein_id="ABM02228.1"
FT                   /translation="MSEQEIYATLVEIKEEPTALYKILKFANLVSGGGEAKLAITEGYV
FT                   FLNGQVETQKRKKIYAGDVISFNEQHYQIALQGQTEGYEVLEPEVVEHKKEAKGRMPTK
FT                   PAAQPEKSKAVKKTRKPISFSLKG"
FT   gene            complement(469549..470196)
FT                   /locus_tag="Ping_0367"
FT   CDS_pept        complement(469549..470196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0367"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   mca:MCA2008 transglycosylase SLT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02229"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW4"
FT                   /protein_id="ABM02229.1"
FT                   /translation="MKQLKYIQKWKILLSLLVSLLLTNNVCADVYRMIDKEGNQHFAER
FT                   KVDSTYHLILKSDSNTSSNSFNTQKRKNVTVVRVPRNKTLQKKYHPLILQAANLYHLEP
FT                   SFIHAVITAESSYQYNAVSSAGAQGLMQLMPETALRFGVNDPFDPKQSIHAGTEYLYTL
FT                   LQEFKSKELALAAYNAGEGTVRRYNKTIPPYPETEHYINKVMGFYWYYRNSL"
FT   sig_peptide     complement(470110..470196)
FT                   /locus_tag="Ping_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(470242..471981)
FT                   /locus_tag="Ping_0368"
FT   CDS_pept        complement(470242..471981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0368"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: ppr:PBPRA3291
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02230"
FT                   /db_xref="GOA:A1SRW5"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW5"
FT                   /protein_id="ABM02230.1"
FT                   /translation="MDLQQKLTCVFIIIFALLMGIGAHYFQHNQGGSGLELAQNNVVWI
FT                   FFSVLISLGLWKITVQQKIFYSRFTVVLLSAFILFYIPLFYPNNELADQSYTRLIGLFA
FT                   GILLFISLQQFQFDKKNLEKLLLLIVLAGFIQACYSLMQDYLLPANNIFGYDVGYGRPY
FT                   GIFQQPNVLASFMATTLILAGYLLQQIKDKKLQIFLLLSALLNMWVITITVSRTGYLGL
FT                   LIAFVLFIPWAWQSSKRKFGIFILAIFLGLGLASTKGGDILGKRNIANMTEGGGRLTHY
FT                   SNSWDMIKKHPLIGYGYGGFEKNYLINTAERVKNSKSKPEHQHLTHPHNEILFWAIEGG
FT                   VVPIVAILLLVIAFIHLLGKFRLTHAMALSTLVIPIAVHTQTEYPFYHSALHWLVLLVL
FT                   VFYIDSQSENSRQKMFRPTFALRAVALLTPLFTTLFMLSNLHTISKITAYERNEKPNIQ
FT                   LLLDVVNPLVFADRFEFHLNNFRLRLASQMDQPEDLQKIIDSTEKTIESKPKAFFYTIL
FT                   YFAYLNNQQPEKAQKTLDYALYLYPEDHQLANIDKQTSQAAASSSAQASPVNVNEEKKI
FT                   TEQ"
FT   gene            complement(472044..474881)
FT                   /locus_tag="Ping_0369"
FT   CDS_pept        complement(472044..474881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0369"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: vch:VC0394 excinuclease ABC,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02231"
FT                   /db_xref="GOA:A1SRW6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW6"
FT                   /protein_id="ABM02231.1"
FT                   /translation="MNSIEIRGAKTHNLKNIDISIPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVEHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   HDYLRLLFARIGDPRCPTHNVTLNAQTVSQMVDSILSNPSGSKMMLLAPIVKERKGEHV
FT                   KTFASLAAQGFLRARIDGEICDLSDPPALELHKKHTIEVVVDRFKVRDDLKQRLAESVE
FT                   TTLNLSNGSAVVAFMDNDQPEQLFSANFACPHCGYSIAELEPRIFSFNNPAGACTTCEG
FT                   LGIEQYFDPELVVSNPSLSLADGAIDGWSSKSNYYFQMLLAVCDHYGFSAEIPFQNLSK
FT                   KQQQIVLSGSGKEKILFSYSNDKGDIVSRLHVFEGVIPNRTRRYHETESSAMREHLAKY
FT                   MNRQPCSSCRGSRLKESSRHVFINEVNLPYISQLSIADAESFFADIKLQGQKATIAEKI
FT                   LKEILERLSFLVNVGLNYLSLERSAETLSGGEAQRIRLASQIGAGLMGVMYVLDEPSIG
FT                   LHQRDNARLLKTLTHLRDLGNTVIVVEHDEEAIRLADHIIDIGPGAGIHGGFVIAEGNY
FT                   KTILKAKNSLTADYLSGRKSIAIPSKRTALSDKWIKLSGATGNNLKSVNLEIPIGVLTC
FT                   ITGVSGSGKSTLINDTLYPLAQTRLNKATILKASPYQKITGLSHLDKVVDINQSPIGRT
FT                   PRSNPATYTGIFTPIRELFAATAESRARGYKPGRFSFNVKGGRCEACQGDGVIKVEMNF
FT                   LPDVYVPCDICQGQRYNRETLAVKYKGKNIHETLDMTVEDAFKFYQPVPVIARKLQTLM
FT                   DVGLSYIRLGQAATTLSGGEAQRVKLAKELSKRDTGKTLYILDEPTTGLHFHDIAQLLK
FT                   VIQALRDHGNTIVIIEHNLDVIKTADWIVDLGPEGGNGGGEIIAAGTPEEVIKVSASYT
FT                   GQFLKEMLNKKIISA"
FT   gene            475087..475624
FT                   /pseudo
FT                   /locus_tag="Ping_0370"
FT   gene            476362..477534
FT                   /locus_tag="Ping_0371"
FT   CDS_pept        476362..477534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0371"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: ppr:PBPRA3131
FT                   putative phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02232"
FT                   /db_xref="GOA:A1SRW7"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW7"
FT                   /protein_id="ABM02232.1"
FT                   /translation="MSVKKMVDQDLAGKRVFIRQDLNVPIKNGKVTSDARIRASIPTIK
FT                   LALEKGAKLMITSHLGRPVEGGTAEENAAFSLQPVVDYLNEALDVPVRLVTDYLNGLEV
FT                   NPGEVVVLENVRFNKGEKKDEEGLAKQLAALCDVYVMDAFGTAHRAQASTHGIAKFAPV
FT                   ACAGPLLAAELEALGKAMDNPARPLVAIVGGSKVSTKLTVLESLSKIADQLVVGGGIAN
FT                   TFIAAQGHNVGKSLYEADLVETAKKLMVDCAIPVATDVACAKAFDENAEAVIKNVADVQ
FT                   DDDMIFDLGPDSTAVLAAILKDAKTILWNGPVGVFEFKNFEAGTAGIAKAIAESDAFSV
FT                   AGGGDTLAAIDKFGITADVSYISTGGGAFLEFVEGKVLPAVAMLESRANA"
FT   gene            477695..478771
FT                   /locus_tag="Ping_0372"
FT   CDS_pept        477695..478771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0372"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: vpa:VP2599 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02233"
FT                   /db_xref="GOA:A1SRW8"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW8"
FT                   /protein_id="ABM02233.1"
FT                   /translation="MTKILDVVKPGVLTGDDLQKVFKVAKENKFALPAVNVVGSDSINA
FT                   VLEAAAKVKAPVVIQFSNGGAAFNAGKGLKLPGHEAAILGAVSGAKHVHAMAEAYGVPV
FT                   ILHTDHAARKLLPWIDGLLTASEAHFAETGKPLFSSHMIDLSEEPLEENIATCAEYLTR
FT                   MSKMGMTLEIELGCTGGEEDGVDNSGMDDSLLYTQPSEVDYANTELSKISPNFTIAASF
FT                   GNVHGVYKPGNVKLTPAILRESQAFVSEKHGLPTNSLNFVFHGGSGSSEAEIQESIGYG
FT                   VIKMNIDTDTQWACWDGVRGYEAKNHDFLQGQIGNPTGEDAPNKKYYDPRAWLRAAQES
FT                   MVARLEKAFSDLNAVDVL"
FT   gene            478921..479610
FT                   /locus_tag="Ping_0373"
FT   CDS_pept        478921..479610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0373"
FT                   /product="hypothetical protein DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   yps:YPTB3192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02234"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRW9"
FT                   /protein_id="ABM02234.1"
FT                   /translation="MRYFLTTMLLIATLPLSTLVNAGALPDGPHVAVTGSAQIEVQPDQ
FT                   VMVQFQATSLEKSAVLAKQNVDQQVSALLVNLKSASFDTNILERGQINTREQYQYIKDQ
FT                   RTLQGIIATRDLSYLLTDLDKVNQFLELVVAANIESIGQMHYGLQSPQEWQLKVRQLAI
FT                   QDSKEQAENLASAYQAKLGKIYAINYQHSYVQPLMMRAKSEQTDESTYQVNKIKISDQV
FT                   EAVFTLE"
FT   sig_peptide     478921..478989
FT                   /locus_tag="Ping_0373"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(479611..480441)
FT                   /locus_tag="Ping_0374"
FT   CDS_pept        complement(479611..480441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0374"
FT                   /product="S-adenosylmethionine decarboxylase"
FT                   /note="PFAM: S-adenosylmethionine decarboxylase; KEGG:
FT                   sdn:Sden_2279 adenosylmethionine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02235"
FT                   /db_xref="GOA:A1SRX0"
FT                   /db_xref="InterPro:IPR001985"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR018166"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX0"
FT                   /protein_id="ABM02235.1"
FT                   /translation="MFYEGTEKRLEIITTEMNLLQLPDSFWQQMVEQADAFIISKIENS
FT                   QLKAYLLSESSLFVWHNKLLLITCGNTHLVKAAQFFQKQFDKRVIQSLLFHRHQAHLPE
FT                   LQKSSFSQDTVLLKTHLQGKTKHWHGNYRGDLFLFGETPTGAVKTKQILMLHGLCGDFS
FT                   CSLQSGSASQQLIASRLAVLGFFPCLRIDQFTFSPKGYSLNALAGDQYLTLHITPEKLS
FT                   TYLSVESSFEAQVMQPFNEHLHALFRPQKSNLMSFIDDSDQGLKITVSSAMRNP"
FT   gene            complement(481020..481095)
FT                   /locus_tag="Ping_R0020"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(481020..481095)
FT                   /locus_tag="Ping_R0020"
FT                   /product="tRNA-Phe"
FT   gene            complement(481150..481225)
FT                   /locus_tag="Ping_R0021"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(481150..481225)
FT                   /locus_tag="Ping_R0021"
FT                   /product="tRNA-Thr"
FT   gene            complement(481307..481382)
FT                   /locus_tag="Ping_R0022"
FT                   /note="tRNA-Phe1"
FT   tRNA            complement(481307..481382)
FT                   /locus_tag="Ping_R0022"
FT                   /product="tRNA-Phe"
FT   gene            complement(481571..481840)
FT                   /locus_tag="Ping_0375"
FT   CDS_pept        complement(481571..481840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0375"
FT                   /product="Fe(II) trafficking protein YggX"
FT                   /note="PFAM: Fe(II) trafficking protein YggX; KEGG:
FT                   msu:MS0316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02236"
FT                   /db_xref="GOA:A1SRX1"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRX1"
FT                   /protein_id="ABM02236.1"
FT                   /translation="MTRTVFCSYLKKEAPGLAFQLIPGALGKRIFDNISQEAWSEWQKK
FT                   QTMLINEKKLKLMNAEDRKIIEDAMIGYLFENKEVDIEGYTPEK"
FT   gene            complement(481833..482909)
FT                   /locus_tag="Ping_0376"
FT   CDS_pept        complement(481833..482909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0376"
FT                   /product="A/G-specific DNA-adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; KEGG: son:SO3368 A/G-specific
FT                   adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02237"
FT                   /db_xref="GOA:A1SRX2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX2"
FT                   /protein_id="ABM02237.1"
FT                   /translation="MNHEDFSQRIIAWHQKFGRKTLPWQQDKSLYRTWVSEVMLQQTQV
FT                   ATVIPYFNKFMRAFPTISYLANAPLDEVLHHWTGLGYYARARNLHKSAQFIRDNYAGDF
FT                   PEEFQQVLDLPGIGRSTAGAILSLTLNQNFAILDGNVKRVLTRHQTIEGWTGGKSVENT
FT                   LWQLAEKLTPAKQTNIFNQAMMDMGAMVCTRSKANCVECPVQDDCLALADGTVKAYPTP
FT                   KAKKKIPIKTAVMLVLCKDGKTLHLKKRPPVGIWGGLWCFPEYESEALCLAAIQAQGIE
FT                   QFNSTLLPAFRHTFSHFHFDITPLKIDVSIIDTKQVMEENDTLWYNLHHPQKIGLAAAT
FT                   TKIITAVNKNLSKEKIDD"
FT   gene            483088..483819
FT                   /locus_tag="Ping_0377"
FT   CDS_pept        483088..483819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0377"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: pat:Patl_0078 tRNA
FT                   (guanine-N(7)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02238"
FT                   /db_xref="GOA:A1SRX3"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRX3"
FT                   /protein_id="ABM02238.1"
FT                   /translation="MTDQEHSASEENADSVEKHKYMRKIRSFVKREGRMTNRQQTAIDT
FT                   LWDTMGIDFEEKLIDFNALFGRQAPIVLEIGFGMGKSLIEMAKNAPEKNFIGIEVHGPG
FT                   VGACLADAGEAGVTNLRVINHDAVEVLDKMIPDNSLAVFQLYFPDPWHKARHHKRRIVQ
FT                   PHFIENMRHKLAIGGVIHMATDWENYAEHMLAVLQASPDFKNTSESDYAPRPEWRPLTK
FT                   FENRGNNLGHGVWDLLFERIS"
FT   gene            484338..485624
FT                   /locus_tag="Ping_0378"
FT   CDS_pept        484338..485624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0378"
FT                   /product="stress protein, tellurium resistance TerD"
FT                   /note="PFAM: stress protein; protein of unknown function
FT                   DUF450; KEGG: bur:Bcep18194_B0270 stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02239"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX4"
FT                   /protein_id="ABM02239.1"
FT                   /translation="MEKTMQKGSNIQLDNVMRGDINQLFVGVGWNDKDKEQSHKIDISA
FT                   FFLTENNKVRNNDDFIFYNQPNDKNNSIDLLTDPLNNNDQQGFNISFSLIPSEVSKIVF
FT                   CVTIDEVESQDSIFNSISNLYIRLLDGTFLGQELLNYQISDTGLVKALMCAELYRHNEN
FT                   WKFRAVGQGFNGGLEALANHFNVAVNSVSEEVEQQTVGLKHKRRSSQDILDKHAVKMRS
FT                   EVVRIIPQVDSATKNKINESNTRMLVDRILMDVLGYNIDEIKAEQNIEGRRADYVLSVG
FT                   NKESLVVEVKRAGLPLKDQHIFQATSYGVFSGIEWVLLTNLREWRLFKIISGSKVKADH
FT                   LFTVTINDGFDKSMNDNFALISKVGMERPSLLLKAWNKVNALSDSNVINAILSPDVLAK
FT                   IRSNIKRESSTSVEIESIQNVVEKLLHVD"
FT   gene            complement(485881..486351)
FT                   /locus_tag="Ping_0379"
FT   CDS_pept        complement(485881..486351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0379"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: pca:Pcar_2748 17
FT                   kD surface antigen precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02240"
FT                   /db_xref="GOA:A1SRX5"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="InterPro:IPR016364"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX5"
FT                   /protein_id="ABM02240.1"
FT                   /translation="MKQVTVLLIIIAFLLVGCTQPIGSKEGAGTLLGATTGAILGSNVG
FT                   KGKGNVVAIAIGTLAGALFGQEIGRSLDRADRIAMGQNAQYSLEHTRSNETTRWNNPDS
FT                   GNSGSIMPTRTYQQTTGQYCREYRQTVVVGGKKQDAYGTACRQPDGSWIINN"
FT   sig_peptide     complement(486277..486351)
FT                   /locus_tag="Ping_0379"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.717) with cleavage site probability 0.473 at
FT                   residue 25"
FT   gene            486812..487135
FT                   /locus_tag="Ping_0380"
FT   CDS_pept        486812..487135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_3092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02241"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX6"
FT                   /protein_id="ABM02241.1"
FT                   /translation="MKSKLKNLSEIVSSANDLFHSKFNNINLLMGIMDKTLRNQGMEAD
FT                   AITIDCISQDKRIVILIHDHKPHVVDIALGNKEGDIYSSSEYEINKISQAVIVGMMEAN
FT                   FIS"
FT   gene            487639..487956
FT                   /locus_tag="Ping_0381"
FT   CDS_pept        487639..487956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0381"
FT                   /product="hypothetical protein DUF74"
FT                   /note="PFAM: protein of unknown function DUF74; KEGG:
FT                   cps:CPS_2458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02242"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRX7"
FT                   /protein_id="ABM02242.1"
FT                   /translation="MIYSTTETIPGKEITEIVGVVTGNVVQAKHIGRDIMAGLKSIVGG
FT                   EIRGYTEMLTEARDLAIQRLVASANEKGADAVVGIRFTTSAIMDGSSEIMAFGTAVKLK
FT                   K"
FT   gene            487982..488350
FT                   /locus_tag="Ping_0382"
FT   CDS_pept        487982..488350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02243"
FT                   /db_xref="GOA:A1SRX8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX8"
FT                   /protein_id="ABM02243.1"
FT                   /translation="MILLLAVIRTYWIIITIFTLTLITLLSLYPLENLPSVPGSDKTHH
FT                   FIAYGALMFPIALRKPKYWQFICLFFICWSGVIELLQPYVNRYGEWLDMAANTTGIVCS
FT                   LLIATLINWILPIKVKCE"
FT   gene            488626..489060
FT                   /locus_tag="Ping_0383"
FT   CDS_pept        488626..489060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr7544 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02244"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRX9"
FT                   /protein_id="ABM02244.1"
FT                   /translation="MRILMEKKQQRIDFQGKIFGSLFVIERASSDRHLVPDNFNYWLCI
FT                   CKCGDHLLVENKQFLNRIDPPLRSCGCHRKVNNSLVNNQYGCLTVLCKTLNQGQTVKRI
FT                   RGHIAYLCLCRCGSKYIAIGQALLKEKVKSCGCDFEDKAE"
FT   gene            489368..490276
FT                   /locus_tag="Ping_0384"
FT   CDS_pept        489368..490276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0384"
FT                   /product="hypothetical transmembrane protein DUF6"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: vpa:VP0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02245"
FT                   /db_xref="GOA:A1SRY0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY0"
FT                   /protein_id="ABM02245.1"
FT                   /translation="MKNEKRALVLGLAAVLLWSTVAVAFKLTLQEFTPIQMLTVASFVS
FT                   AIVLTGICYMQGKLNQLRTTFFSNPLNYLILGLINPLAYYLILFKAYDLLPASQAQPLN
FT                   YSWAITLTLMAALFLGQKIRKQDWIACALGYAGVIVIATKGDLFALEFDSPLGVILALL
FT                   STVLWAGYWILNAKNKADPVVGVLLGFIVALPFAVALSIYEGAIWEQSFQGWLAVTYVG
FT                   LFEMGITFVLWLSALKATDNTGRISTLIFISPFISLLLLAYIIGETIPPSTLIGLVMIV
FT                   SGLIFQQVMKPSNIDIETCKQ"
FT   sig_peptide     489368..489442
FT                   /locus_tag="Ping_0384"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 25"
FT   misc_binding    490685..490779
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 77.15"
FT   gene            490823..491821
FT                   /locus_tag="Ping_0385"
FT   CDS_pept        490823..491821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0385"
FT                   /product="thiamine ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: ABC transporter, periplasmic binding
FT                   protein, thiB subfamily; thiamine ABC transporter,
FT                   periplasmic binding protein; KEGG: vfi:VF0267
FT                   thiamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02246"
FT                   /db_xref="GOA:A1SRY1"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY1"
FT                   /protein_id="ABM02246.1"
FT                   /translation="MERIVKKIIPLMAFSVIISMPVLADKLVVYTYDSFASDWGPGPKI
FT                   KQAFEKNCACSLEFVALDDGVSILNRLRLEGKNTKADILLGLDNNLMTEAKKTGLLAKH
FT                   KVDTSNVILANGWSDNTFVPFDYGYFSFVYNKETLLNPPASLKELIEQRQDINVIYQDP
FT                   RTSTPGLGLMLWIKWVYGDQADDAWKKLAKKTVTVTKGWSEAYSMFLKGEADMVLSYST
FT                   SPAYHIIAEGKNQYAAANFSEGHYTQVEVAAKVKSSKNEKLADKFMAFIVSDEFQSLMP
FT                   TGNWMYPVTDVALPEGFKNLTIPSTSFSFSADKVDNNRKVWIREWQSSLIY"
FT   sig_peptide     490823..490897
FT                   /locus_tag="Ping_0385"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            491835..493439
FT                   /locus_tag="Ping_0386"
FT   CDS_pept        491835..493439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0386"
FT                   /product="thiamine ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: thiamine ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vpa:VP0317 putative
FT                   thiamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02247"
FT                   /db_xref="GOA:A1SRY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005947"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY2"
FT                   /protein_id="ABM02247.1"
FT                   /translation="MSANMSAKSYTLPGLIIAGFICLFVAASVSALLFYSPGFNPALLW
FT                   QDAYYRHITKFSFYQAFLSTILSVGLAIPVAHALSRRHFFAKSFLLKLFATTLVLPVLV
FT                   GVFGLLSVYGNSGQIAQLLAMVDQKLPFSIYGLNGILLAHVFFNLPFAARLLLQSLHSI
FT                   PSEHHQLSSHLGISHWNKFKLVEWPCLRQQLPHVCGLVFMLCFTSFATVMALGGGPKST
FT                   TIELAIYQAIKFDFDLQAGALLALWQILLCGSLAIGIQRFSRPIPLTNTTGKQSFYLFN
FT                   DNRAAKIWDSLWISLVLFLVIPPLLMIVINGLNAKFISVISSPSFWDALQNSFLVAIFA
FT                   AFIALFAGFFMLLTSRSWRLVGIDFKADKLELIATIILVTPGLVISTGLFLLLRNITDV
FT                   FGFAIVIVIAVNALMALPYVIKTLAQPMLQVAQQYDQLCASLGLFGFSRFYLIEWRAIK
FT                   RPIIHAFSISFVLSMGDLSAIALFGSQDLRTLPLYLLQLLGSYQMESAAVVSLFLFILS
FT                   IGIFSAVEQISSQNNAH"
FT   sig_peptide     491835..491930
FT                   /locus_tag="Ping_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.621 at
FT                   residue 32"
FT   gene            493572..494282
FT                   /locus_tag="Ping_0387"
FT   CDS_pept        493572..494282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0387"
FT                   /product="ABC transporter for thiamin ATP-binding protein"
FT                   /note="KEGG: vvy:VV0439 thiamine ABC transporter,
FT                   ATP-binding protein; TIGRFAM: ABC transporter, ATPase
FT                   subunit, ThiQ subfamily; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02248"
FT                   /db_xref="GOA:A1SRY3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005968"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY3"
FT                   /protein_id="ABM02248.1"
FT                   /translation="MINFVNVKYHYRQEEFSFDVEIPAGSIVAILGESGAGKSTLLNLA
FT                   AGFIRPRSGDILMGGKSVLDVEPHLRPMAILFQENNLFAHLSVADNIGLGLHPGLKLSS
FT                   IDREQVQNIAKQVGVDKLLSRFPDQISGGQKQRVALARCFVQNKPLLLLDEPFSALDPV
FT                   LREEMLTIVKDLSATKNVTVLMVTHHISDAINVGSHYLFVNNGVISSIDTISKLTDSHQ
FT                   NDSLKKFLQAGLPS"
FT   gene            complement(494356..494994)
FT                   /locus_tag="Ping_0388"
FT   CDS_pept        complement(494356..494994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0388"
FT                   /product="cyclic nucleotide-binding transcriptional
FT                   regulator"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein,
FT                   Crp; KEGG: vfi:VF2280 catabolite gene activator Vfr"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02249"
FT                   /db_xref="GOA:A1SRY4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY4"
FT                   /protein_id="ABM02249.1"
FT                   /translation="MIITKPQTDPTLEWFLSHCHTHKYPAKSILIHAGEKADTLYFIVK
FT                   GSVAVVIKDEEGKEMILSYLNQGDFIGELGLFDKQENPIRSASIKAKTPCEVAEISYKK
FT                   FNQLITVNPEILMRLSKQMADRLQITSQKVGNLAFLDVTGRIANTLLDLAKQPDAMTHP
FT                   DGMQIKITRQEIGQIVGCSRETVGRILKMLEEQGLISAHGKTIVVFGTR"
FT   gene            complement(495244..495471)
FT                   /locus_tag="Ping_0389"
FT   CDS_pept        complement(495244..495471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0389"
FT                   /product="hypothetical protein UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   pha:PSHAa2909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02250"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY5"
FT                   /protein_id="ABM02250.1"
FT                   /translation="MLIPYQDLDSDTLHSLIEHFVLREGTDYGEQEVSLAEKTAQVFNL
FT                   LKRGSIVILYSELSESVTLIHKEQLSQQQQ"
FT   gene            495945..496574
FT                   /locus_tag="Ping_0390"
FT   CDS_pept        495945..496574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0390"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pst:PSPTO_0994
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02251"
FT                   /db_xref="GOA:A1SRY6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY6"
FT                   /protein_id="ABM02251.1"
FT                   /translation="MSLLEALLKNNEEWAAKINEEDPTFFPRLANRQSPEYLWIGCSDS
FT                   RVPANQLLGLFPGDIFVHRNIANLVVHTDLNCMSVIKYAVDVLKVKHIIVTGHYDCGGI
FT                   HAAMQKQSFDLIDGWLRNIKDIYVKFSDSFTAEMTYKQRLDYLTELNVIEQAKNVCHTT
FT                   CVQEAWANGQDLTVHGFIYSVVDGRLKDLNVNFDNLEKINDLYHIR"
FT   gene            496655..496960
FT                   /locus_tag="Ping_0391"
FT   CDS_pept        496655..496960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0391"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: vfi:VF1943
FT                   cytochrome c-554(548)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02252"
FT                   /db_xref="GOA:A1SRY7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY7"
FT                   /protein_id="ABM02252.1"
FT                   /translation="MKKLLLASLFLIAPTLVSAADLEAAKAKAVVCAACHGADGISVAA
FT                   IYPNLKGQKEAYLLSSLKAYKAGERKGGMSMLMTPQAMALSDADMVNMAAYYSSLK"
FT   sig_peptide     496655..496714
FT                   /locus_tag="Ping_0391"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 20"
FT   gene            497259..498773
FT                   /locus_tag="Ping_0392"
FT   CDS_pept        497259..498773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0392"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: vvy:VV3239 ComM-related protein; TIGRFAM: Mg
FT                   chelatase, subunit ChlI; PFAM: magnesium chelatase, ChlI
FT                   subunit; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02253"
FT                   /db_xref="GOA:A1SRY8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY8"
FT                   /protein_id="ABM02253.1"
FT                   /translation="MALASLYCRALLGVDAPEVLVEVHLGTGLPSFSLVGLPETSVKEA
FT                   KERVRSAILNSNFKFPSKRITVNLGPANLPKEGGRFDLAIALGILIASEQIRGDGIDQF
FT                   ECFAELALSGELRPIDGLIPCALAAKEKGRYLIICPENQNESALTGAKAYVARNLIGVC
FT                   AFLQKQKTLPEAQAAPKTAAINQTDMSDVLGQEQAKRVLEIAAVGGHNLLLVGPPGTGK
FT                   SMLAERFMTLLPRLTEKHALQTAAIYSVCGKQRDDWFEPPYRCPHHSASAVALVGGGGK
FT                   PKPGEISLSHRGVLFLDELAEFPRSVLDSLRQPLESHKVTISRAANQVTFPAHFQLIAA
FT                   MNPSPCGHISGDLRRSTPDQILRYLGRLSGPFLDRFSLSIMVPLLPQGTLASSQVGHTL
FT                   KGESSEIIKTRVLKARDKQQQRQGKLNNALSTKEIASYCQLSLEDAQFLEQAINQMGLS
FT                   IRAWHSLLKVARSIADLAGSVRVERHHLTESLAYRAMDRLLKNLSL"
FT   gene            complement(498911..501769)
FT                   /locus_tag="Ping_0393"
FT   CDS_pept        complement(498911..501769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0393"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: vch:VC2503
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02254"
FT                   /db_xref="GOA:A1SRY9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRY9"
FT                   /protein_id="ABM02254.1"
FT                   /translation="MEKIYNPSAIEQKNYQNWEEKGYFKPHGDTSKESYCIMIPPPNVT
FT                   GSLHMGHAFQDTIMDTLVRYQRMQGKNTLWQMGTDHAGIATQMVVERKIFAETGQTRKE
FT                   LGRETFIEKIWDWKAESGSKISQQMRRLGTSVDWDRERFTMDDGLSEAVKKVFVDLYND
FT                   NLIYRGKRLVNWDPKLHTAISDLEVENKDVKGFMWHFRYPLADGVQTADGKNYLVVATT
FT                   RPETLLGDTAVAVNAEDPRYKDLIGKEILLPFVNRRIPVIADQHADMEKGTGCVKITPA
FT                   HDFNDYEVGKRNKLPMINVLTFDACIRSEAEIFNSNGEKSNDYASDLPSQFQGLTREEA
FT                   RKLIVSSLDDLGLLDEIKPHDLTVPYGDRGGVVIEPMLTDQWYVRVAPLAEVANEAVNN
FT                   GDIEFVPKQYKNMYNSWMNDVQDWCVSRQLWWGHRIPAWYDQAGKIYVGRDEAEVRAKH
FT                   DLSDDFILTQDEDVLDTWFSSGLWTFSTLGWPEKTSDLKTFHSTDVLVTGFDIIFFWVA
FT                   RMIMMTMHFMKDENNKPQVPFKKVYFTGLIRDEHGDKMSKSKGNVLDPLDIIDGIDLES
FT                   LVAKRCGNMMQPQLAAKIEKDTRKTFANGIEAHGTDALRFTLAAMASTGRDINWDMNRL
FT                   EGYRNFCNKLWNASRYVLMSTEEHDCGFSGNTEMEFSLADRWIQGQLQTTIKDFRQALD
FT                   TFRFDIAANILYEFTWDQFCGWYLELTKPILFKGSEAQQRGTRHTLITVLETLLRVAHP
FT                   MLPFMTEEIWLRVKGITGQGGDTIMLEPYPEYDSSLVDEKAVEDLEWVKKVIVAVRNIR
FT                   GEMDISPKTPLNLLIKNASATDQRRFTENQAFLAALAKLESVTVLEDGQETPVCATALV
FT                   GELELLIPMAGLIDTEAELTRLNKQLEKAGKELAKISAKLGNEKFVANAPEAVIVKERV
FT                   KQTELQTTCDKLSAQIDTIKAL"
FT   gene            complement(501773..502255)
FT                   /locus_tag="Ping_0394"
FT   CDS_pept        complement(501773..502255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0394"
FT                   /product="DNA polymerase III chi subunit, HolC"
FT                   /note="PFAM: DNA polymerase III chi subunit, HolC; KEGG:
FT                   cps:CPS_0739 DNA polymerase III, chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02255"
FT                   /db_xref="GOA:A1SRZ0"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ0"
FT                   /protein_id="ABM02255.1"
FT                   /translation="MSQVVFYVFTTEEKSSSVAISAHFAYACRIAAFFYAQNKKVFIYT
FT                   DSKEDAFAVDEYLWQFDGDSFVPHNLLGEGPKFGTPVEISWQVPLHPRPILINLSQKTP
FT                   DFAINFQKIIDFVPFPEPQKIAARIRYSTYRKMGLTLSTQTVESNSTVESTNKTED"
FT   gene            complement(502270..503784)
FT                   /locus_tag="Ping_0395"
FT   CDS_pept        complement(502270..503784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0395"
FT                   /product="aminopeptidase A, Metallo peptidase, MEROPS
FT                   family M17"
FT                   /note="PFAM: peptidase M17, leucyl aminopeptidase domain
FT                   protein; KEGG: vvy:VV2907 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02256"
FT                   /db_xref="GOA:A1SRZ1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SRZ1"
FT                   /protein_id="ABM02256.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSRAGEQLDEISEGYLST
FT                   LLRRGDIEGKIGQVLFLHNVPNVLSERVLLVGCGKERELTETQYKQIIAKTITTLNDTG
FT                   ALEAICFLSELHIKGRDTYWAVRQATEATQDCLYNFDKFKTNKENTRRPLRKLTFNVTS
FT                   RKELARAELGLQHALAVASGAKACKDLANMPPNICTPLYLSEQAIALGQRFEKITTEIV
FT                   DSEQMAELKMDSYLAVAKGSANPAYMSLMHYNGGNADQKPIVLVGKGLTFDSGGISLKP
FT                   GEAMDEMKYDMGGAASVFGAMKALAKLNLPINVIGILAGAENMPAGNAYRPGDILTTMS
FT                   GQTVEVLNTDAEGRLVLCDVLTYVERFEPDCVVDIATLTGACIMALGHHISGLMTPHKG
FT                   LANELLSASNQSSDKAWQLPMDDEFQKQLESPFADMANIGGRPAGSITAACFLSRFTKS
FT                   YTWAHLDVAGTAWRSGANKGSTGRPVSLLTQFLINRSENETTAVNS"
FT   gene            504058..505134
FT                   /locus_tag="Ping_0396"
FT   CDS_pept        504058..505134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0396"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   vch:VC2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02257"
FT                   /db_xref="GOA:A1SRZ2"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ2"
FT                   /protein_id="ABM02257.1"
FT                   /translation="MILLRYLMLETFKSQIGILFVLVLIFVSQKFITILAQAINGVIPA
FT                   DLVMTLLYLNLPQLGTLMLPISFYLAVLFAHGRLHGESEMIAMSSCGYSPNNVLKATLL
FT                   LSFLTFAFAAYNSLYLAPLSEDKMISVIEEAQANTSSATLIEGRFHKTSGNGSVVYIEK
FT                   SADKKLDKIFAAHWPEDRKQAPSVLTAAEGYLESKKDGTWLTLTDGQRYAGIVGQHEFD
FT                   HSEFKTYEVHIANREVQKQVRGVQALPTAALFSVDNPKYQAELQWRIGIPVSILLMTFM
FT                   AVPLAKVNPRQGRYSKLLPALALYLTFFLLLSTAKSLIEDGSLPVFSIWIVQISFLLLG
FT                   IILHLQSLGKFTKVTLRR"
FT   gene            505166..506230
FT                   /locus_tag="Ping_0397"
FT   CDS_pept        505166..506230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0397"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   sgl:SG2107 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02258"
FT                   /db_xref="GOA:A1SRZ3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ3"
FT                   /protein_id="ABM02258.1"
FT                   /translation="MGILDRYIGKTIFAATFLSLFVLIGLSSIIKFVEQMGSIGVGSYD
FT                   AWNAAYFVILKIPIELSVFFPMAALIGALIGLGSLANSSELVVMQAAGISKLRIAGAVL
FT                   KTAIPMVIVVMVLTEFVVPITDKEAYSMRYMAKRGEVQVSNQYGVWVKDADSFVSIERM
FT                   NSKNELFHVQLYFFDENLKLDHAILARKAAFKEGSWFFGDVSQTNFLEDRTEVKRMSNY
FT                   IWETKLTPKKLEVILGEPDKMSMRDIYNYIIYLENNEQDAKRFWLIFWRKAVLPFTIVV
FT                   MMLLSVSFIFGGLRSVTMGTRLIFGIAAGFTFYVSGELFGPFSLVFNWPPILGALLPSF
FT                   LVLSLALYLLKRQS"
FT   gene            complement(506338..506892)
FT                   /locus_tag="Ping_0398"
FT   CDS_pept        complement(506338..506892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0398"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   ppr:PBPRA0490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02259"
FT                   /db_xref="GOA:A1SRZ4"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ4"
FT                   /protein_id="ABM02259.1"
FT                   /translation="MVKHNHNNEQIKILQQQYQSCPRANFLKRTGAYIYDLFAVSALLM
FT                   LAGILAIIVVIIASNTGLINIDAYQDVADFLASSQLFALYLAIIIIGFYSYFWTRGGQT
FT                   IGMKAWRLRVQNSDGSNISFTQSLIRMATSAFGLGNFLVFFGNKSAFQDQWAECEMVVL
FT                   TKELSDWKGFKGMGFMDQDKK"
FT   gene            507130..507214
FT                   /locus_tag="Ping_R0023"
FT                   /note="tRNA-Leu1"
FT   tRNA            507130..507214
FT                   /locus_tag="Ping_R0023"
FT                   /product="tRNA-Leu"
FT   gene            507325..508338
FT                   /locus_tag="Ping_0399"
FT   CDS_pept        507325..508338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0399"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   lpp:lpp2123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02260"
FT                   /db_xref="GOA:A1SRZ5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ5"
FT                   /protein_id="ABM02260.1"
FT                   /translation="MATLQVRKGKKSITYRVEFMRDGKRISKSFKLKKEAQTFMALLLV
FT                   DNDLANSLTNHILTTLNFSDAVKKLLDQDNGRDPSKHQRLRYWVSVFGSLKVGKVTRQQ
FT                   VKAELKRLSNDKAPATLNRYKAALGSLYRYLSDEFDIDYNPVKGIRQYTENDARTRFLS
FT                   DEELSILFAMVKQSKWDQLFLLVLMAITTGARRSEMLTLEWDDINFKTKTAHLPNTKNG
FT                   EQRILTLTGDVITELMKYRCIGGYVFPHPDDPTIYFRNFDIHWQSALREGEITDFRFHD
FT                   LRHTCASLLAMNGASLLEIAQVLGHKSITMTQRYSHLCIEHKAKLTDRVFGGIING"
FT   gene            508331..509032
FT                   /locus_tag="Ping_0400"
FT   CDS_pept        508331..509032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0400"
FT                   /product="predicted carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02261"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ6"
FT                   /protein_id="ABM02261.1"
FT                   /translation="MGDVKYSKIKNGKDGLYELDFNELTEDLINNFENDSQSEINILKK
FT                   MATESPEVLKNSKPGSPWAAIFIQLVKFDISTKIINLYEYQGYHYSLANYLKVRGNVEE
FT                   NMELIITGQLVHIALAIGHHKLSQNFEAALEASELLFGCGMLIGNALNEKYTVAGFGRY
FT                   GEREDEGQAVERREKLNKIVTFVTPIIKNNPSIHMTTLSDKILKNKIVYQSPSVVYDYL
FT                   KQLKKDGEIYN"
FT   gene            509521..509814
FT                   /locus_tag="Ping_0401"
FT   CDS_pept        509521..509814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02262"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ7"
FT                   /protein_id="ABM02262.1"
FT                   /translation="MKGLKMNHFDTPANCKQEMKADQNFNFYMTDLENWQPMKKVAEVF
FT                   PQFTQQQLKRLFWQRKKHPGLSTCYRQVGKRGYVCLPLFGLWLAGQLPEQRS"
FT   gene            509817..510254
FT                   /locus_tag="Ping_0402"
FT   CDS_pept        509817..510254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgl:SG0932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02263"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ8"
FT                   /protein_id="ABM02263.1"
FT                   /translation="MKHLNNTNTAFNVEKSALRLIVALINEQQEMGNLVQKVVENDSIS
FT                   LFSGLTPPDCCSQLNGVNTQQVNAWFVEKNILMKVERGHKVKGHARDKYLRQKCDKSKD
FT                   GLPYYYSILTVKGAKYLYKAYLENRLPMKKDWDGLFTYIEC"
FT   gene            510574..511599
FT                   /locus_tag="Ping_0403"
FT   CDS_pept        510574..511599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02264"
FT                   /db_xref="UniProtKB/TrEMBL:A1SRZ9"
FT                   /protein_id="ABM02264.1"
FT                   /translation="MLKFLYASLVTMTNNFNYLDWAELTGLIKNPPQASSFSLKEIKAR
FT                   CAVIAAHDATDKTKQTVMLHNNFTLLRLDLDDSPFDIAAIKDLLDQVDIKSYIVHTTAS
FT                   HMQDGCSHRYRIYIELVAALSFDIWSLLEKYLCHFFSADDCSTRPQQIMYLPSLFPGVI
FT                   YDSYISEGNALQVNGSLLLEQAVTFNNILMTDYAPVVEVKKKKVLPQYCESLIAGQVSI
FT                   IDLVNQSYTWDYVLAQYGYKQQGRSYLPPESKSKMAGVHLLKGNDGQLRYYSHHASDPC
FT                   ATGKCLDIFEFIVVREFNGDAKRAVKALSSAFPEHNKHNLKLYLNDQQQKQIQVVMGDL
FT                   K"
FT   gene            511596..512891
FT                   /locus_tag="Ping_0404"
FT   CDS_pept        511596..512891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0404"
FT                   /product="P-loop ATPase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: mxa:MXAN_1209 virulence-associated protein E
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02265"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS00"
FT                   /protein_id="ABM02265.1"
FT                   /translation="MRHLPEPNQPSNIDGELENETLIDRFPHFKLNNKREKYLLNTGPN
FT                   LSVLLDYTGIKAAINKMTYEPELSVKGKAFPSVEAARSCLITNAAIIALPKVAIDDHLV
FT                   ALAEKNSYHPIAELLNAGQWDGNERVELVLACLNAKDPEFAIAIMKKWLVGCVASLYEK
FT                   TFSSKLVPVLQGDQSYMKTAFISRIANIIEGAFLEGAELNPDNKDSVLSCIKSWIVELG
FT                   ELERTSKNSQGSLKAFITKPIDTIRPPYARGDIKKPRQTHFIATVNKTDFLKDETGSSR
FT                   YAVIELTGAVDIDATNSLLGYEYNNGSKQVHPELLLQFWLEIKAMYEANYGWMLSKDEL
FT                   SLAAKVADKYTDKGNWYEMLSDHIARAKGAEAKMTATEICNYLGVNTAQIKWVGKALTQ
FT                   LVKEGLIKKGRTGQGRYYLFPTCCSEGCPSCK"
FT   gene            513326..514534
FT                   /locus_tag="Ping_0405"
FT   CDS_pept        513326..514534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0405"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   son:SO2978 prophage LambdaSo, site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02266"
FT                   /db_xref="GOA:A1SS01"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS01"
FT                   /protein_id="ABM02266.1"
FT                   /translation="MTTKVIKFSAAALKSAEQDIAFNEFRDARYPLRLRLHKCRSKGSW
FT                   YLVRSTHGKSKHEKIGSYPNIKLKDILANLSRNLIADTAEPESEFQTLGQLLKWYLART
FT                   EQNSQITKQRKTTIRWAITRHLLPLIDELPLNQITYAALDKHFFQPIQQKYAMTTAKNI
FT                   WIILKQSVAQAVKLVLIKPDPISSFEFSDFIKVGKTAERPGLKYYQVAKLFIDAQAASV
FT                   PARALVAIMLLHGTRLGETRQTKWSDICFKTDLWSIPGPITKTRTELNLPITPLVKKIL
FT                   TDYRNWQEQNGYTGVFVFPAPKGRSAISAYAANELIQEVSLNNWTSHQLRKFARTTWVD
FT                   LKIDFLIAELLLNHKLTKVTAAYIHTDAVEAKSEALTVYHVWLAAEFSALNDIINDAIP
FT                   ARP"
FT   gene            514689..515459
FT                   /locus_tag="Ping_0406"
FT   CDS_pept        514689..515459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB1810 putative small subunit
FT                   bacteriophage terminase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02267"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS02"
FT                   /protein_id="ABM02267.1"
FT                   /translation="MATDWDVLNQQFIKENLRTEISVKAWCEKKKLNYATARRHIKPSA
FT                   HVAQPSVRKVRSAEQTENPRKPDLPNTDNKQIQSVKEIHEDEVMHNDSEKRSASKKRVL
FT                   SLGNQNARTFGHYSEFITTDEDALRYSSASMASLRDELCLIRMQLSNLMVAIKQTEADL
FT                   NGDITVEQKISLNNTYDKFQTNANVKVARIESLEISLVGLEKTKADTERSIVLTRKAQL
FT                   EADKLSRESGGSETPLSKIYDEILAMGSDGMLNH"
FT   gene            516310..516822
FT                   /locus_tag="Ping_0407"
FT   CDS_pept        516310..516822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02268"
FT                   /db_xref="GOA:A1SS03"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS03"
FT                   /protein_id="ABM02268.1"
FT                   /translation="MNNKIDNKYTRINLPPIIKNNPVLFTQSLEINNRVAYHIMLTRRR
FT                   SAIYHWLHRILAWGVPILSAFVTVLSSGNLESDFTKESEIINVVFYLSAVMTILTSIYS
FT                   TVQPYERRIRAIKYANKLWHFHTEFPLGMEKLGKSISDETNVIKACTKYLCEKNDELTI
FT                   IINDFNG"
FT   gene            complement(516904..517845)
FT                   /locus_tag="Ping_0408"
FT   CDS_pept        complement(516904..517845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02269"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS04"
FT                   /protein_id="ABM02269.1"
FT                   /translation="MIYTNSQATTVAISTGDHKKAALYFDKLVPTHSSGDVPNILREPV
FT                   HFADYKLSELFSATSAVDIEEDRSSEVQTATIRHVWREAPMSVRYSKDYLENVFANVVK
FT                   SSQEAWADSKFVTSLVLRNGMVDKGHFLIPTFDDDTREQSFARLGNDEVVQLTLSNLDL
FT                   IDTSKLEWPQILELKSDSDSDKKLRNLLLFLYKNYSNKSVDFIRDDLLRQIDEYQQVCK
FT                   KHGFKLVTSTLSTLLSSKSLLATTGLSTLALLSGLPLQALTPVAISAAGLEIGKIAINY
FT                   VEKKRDLIDYKETHPLSYILQLPLRDTLVSAR"
FT   gene            complement(518486..519268)
FT                   /locus_tag="Ping_0409"
FT   CDS_pept        complement(518486..519268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0409"
FT                   /product="dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02270"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS05"
FT                   /protein_id="ABM02270.1"
FT                   /translation="MIDWYYSRNDIAADILERDKIIALIKTRLNATVPFLHQDLVNVCE
FT                   RRNITPVILSLFPEQSLTTIFTHKIWMMFKNDPQLINEFTGQQPNFRRRKLHQEIKNID
FT                   KSGNMPDIGLYDAYQLIKLSKIKITLILDRIDSAIFQKRKSVISLFSDLQNIRDNTLNA
FT                   QIIFAVEEDVNSAFIKEKQVTTIELRSVEPDTLVNHALDTASQVSPHFKISKDEAMNFF
FT                   LKSDSAENYIEKLQKMVLHQNSDFKKDSIQGDAYSPFN"
FT   gene            520183..522501
FT                   /locus_tag="Ping_0410"
FT   CDS_pept        520183..522501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0410"
FT                   /product="peptidase domain protein"
FT                   /note="PFAM: peptidase domain protein; PGAP1 family
FT                   protein; KEGG: sfr:Sfri_3642 peptidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02271"
FT                   /db_xref="GOA:A1SS06"
FT                   /db_xref="InterPro:IPR012908"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS06"
FT                   /protein_id="ABM02271.1"
FT                   /translation="MPSKNYLRFIFLLFSLSTLFACGGGDSPDDSEKSTEQLQPTTKSY
FT                   SITVIDGYLKFASAWLDLNNDGKQDADEPTTTTQENGKGIFTLSSDIDPKKYSVLVFAE
FT                   AGKTFDESLNGFVENDYILASPEGEQVITPITTLVYLKSRNQEDKKSSASQLRLQLNLS
FT                   SQNLHEDFIASGNIEQTTLAADLVRLSLMPESRSDIPNLIKDPQVILDDLTEYMTIRKQ
FT                   GNNQRVVRDTAGNFASDTDKDDIADPDDTDIDGDNTLNTQDKFPYDSMEWVDLDDDNVG
FT                   DNSDNDIDGDGILNDEDENPLLAEFYTAQNPGDLTIPGTISDDIFQNKWQYFVVNSPAE
FT                   IMLNISLEYLSGDVDLYVQQNKIPTKFDYQCRSNLSNTQAEKCIERVTEGGVYYIALFA
FT                   REDSNFKLSVITEEVKKNKAMLLLHGLASDPGTWKDMIDDDSFFNGKCQILTVDNIPLS
FT                   TVETNQDGISCFNLEFGSFDRGSNFSAAGLDNKRCIPISGCNGDYTTFEGLGYEVKGAI
FT                   KRIVEHLGQDTEIFIFGHSRGGLAARAYLQNQQDVNKSLVKGFATTGTPHQGSPLGRFY
FT                   AYMAENCVPKNTYRQDGSKCEDNWEMVEMLYGTRTFFLYNYSKDYQMDLQAPGIDFLSP
FT                   DSSSIKNLNENLSGMMNLTTGALVYEGTEFGLLGEDVKFLFDYDLYDYHSGVGDHPHPD
FT                   TLTYIENGQTRASFIGDGIVPVYSQKLSLLLENKGLVVTKEGVNKTSNILHTEETSQVT
FT                   DIDWLFEGLYPTLGWGLKE"
FT   sig_peptide     520183..520254
FT                   /locus_tag="Ping_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.483 at
FT                   residue 24"
FT   gene            522498..523562
FT                   /locus_tag="Ping_0411"
FT   CDS_pept        522498..523562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02272"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS07"
FT                   /protein_id="ABM02272.1"
FT                   /translation="MKYFAIAVFIVLIGAVIGTWSNASSTLPAEQLAMKVKAASADLDI
FT                   AKSQEQSIPLSPVEEEVEDSAFKSAPKEAESILISQKQALQIIDDNLYNAINNQVVDVT
FT                   AERELLDYLRKTNNEQVYLFIMEKLESTNKGNKSDDRLIEYALSLLAAVDSPRASELFF
FT                   NVVRQDDWSGSNAIYSVRSSISRLARNNNNNYNSLIQQTFTQVNDENPFLNELAVAIAE
FT                   DAEIEQVDYLISYVDSPLKNKSAVINQAMHSINKESLVPHITTYISDSSSSSVQNVALN
FT                   TLANMGQYEAASALIAWSSTQRIEAKKQVESLFTIALARSPSTQRAIEKEILFYEFTSE
FT                   ELKQTIINLSSFFK"
FT   sig_peptide     522498..522569
FT                   /locus_tag="Ping_0411"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.920) with cleavage site probability 0.409 at
FT                   residue 24"
FT   gene            complement(524283..525062)
FT                   /locus_tag="Ping_0412"
FT   CDS_pept        complement(524283..525062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0412"
FT                   /product="L-arginine ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1463 polar amino acid transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02273"
FT                   /db_xref="GOA:A1SS08"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS08"
FT                   /protein_id="ABM02273.1"
FT                   /translation="MDDQSIVISVKNLNKDFDGVEVLRDINIDILSGTTTCILGPSGSG
FT                   KSTFLRCLNWLEHPSSGEIRIDGVVIGQSSKKANGKRASSRALNKVRTNICMVFQHFAL
FT                   WPHLTVLENVTIAPINVLGRSKIEAEQMGKTLLKRVGLEDKLHVYPHTLSGGQKQRVAI
FT                   SRALAMEPKVLLFDEPTSALDPEMVNEVLSVMRELAKDGMTMVVVTHEMNFASDVADSI
FT                   VFMDRGLIREVSPPEVFFNNPQTERARQFIAPGCHTP"
FT   gene            complement(525055..525708)
FT                   /locus_tag="Ping_0413"
FT   CDS_pept        complement(525055..525708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0413"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1062 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02274"
FT                   /db_xref="GOA:A1SS09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS09"
FT                   /protein_id="ABM02274.1"
FT                   /translation="MDQWQIIWEARELISSGLMNTLYLVLISMALSIPLGALAAIVVIE
FT                   SPGWRKIFQEFFDLLRCVPFLLLAYVMYYGLPSLGVRLSPWESGIVTLVLYNMAYFVEI
FT                   FVTAYKAISRADVEAADAYGFSSLQKYRHVIFPQIVLISAPLVGNQIITAMRDSALLMI
FT                   ITVQELTFAANFISVNHFIPFLPFVVAVALYTLITLVVERGVASISNVRKRCYG"
FT   gene            complement(525708..526358)
FT                   /locus_tag="Ping_0414"
FT   CDS_pept        complement(525708..526358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0414"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: bxe:Bxe_B1063 ABC
FT                   polar amino acid family transporter, inner membrane
FT                   subunit; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02275"
FT                   /db_xref="GOA:A1SS10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS10"
FT                   /protein_id="ABM02275.1"
FT                   /translation="MDWSAWLTLIGGAGVTVSLSLAAILLSLPLGLLFGVFRWQKIAVL
FT                   NGLLAVYVTLIRSTPFVTLALFVFFGLPEIGIDMNPIPAAILVLTLNLTAFSSEIWRAA
FT                   LDNFSSEQLEAAEAYGMSRIKTFWLIIFPQLWRANLGPLTSEITILIKGTPAVAVIGVV
FT                   EITRAASRIGAQTYDPLPPFLMAMILYTLFVVIIVKSQRLLEKKMTKKYKGGK"
FT   sig_peptide     complement(526290..526358)
FT                   /locus_tag="Ping_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.964) with cleavage site probability 0.938 at
FT                   residue 23"
FT   gene            complement(526404..527234)
FT                   /locus_tag="Ping_0415"
FT   CDS_pept        complement(526404..527234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0415"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bxe:Bxe_B1064 ABC polar amino acid family
FT                   transporter, periplasmic ligand binding protein; TC
FT                   3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02276"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS11"
FT                   /protein_id="ABM02276.1"
FT                   /translation="MILNKILKITGGAFILSCSTLFSFSSQAASLEEIQAKGVMVVATE
FT                   DSYKPFEYVENGTPKGLNHALLALLRAKAPFEIKQQIIPWTGLLAGLSTGKYDVALTAA
FT                   VVTPTRLQSLDFTMPIAEATQYYVIRADEERIKVVSDLDELTVGVQTGGASYAALSELE
FT                   NKLAISGGKLGNTIQYTSLPDAYQDLVLGRLDYVINGVVNLTSLTQEKPDLFKIGQAVG
FT                   VPAYAAWAVDKGNKDLLNYLNSFMAEIRKNGQLYQLQKKWLGRSFEGMPTSTIN"
FT   sig_peptide     complement(527148..527234)
FT                   /locus_tag="Ping_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 29"
FT   gene            complement(527278..527709)
FT                   /locus_tag="Ping_0416"
FT   CDS_pept        complement(527278..527709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0416"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bja:blr4467
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02277"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS12"
FT                   /protein_id="ABM02277.1"
FT                   /translation="MKSNKNADMQEPKNKVSPIFHLIEAGPKPVAPFSHAVEVGETIFV
FT                   TGQMPDTPTNPGVLPEGVEAQTDNVMNNLNIILKALDLGLENIVSVRVFLKEFKRDYQA
FT                   FNDTYRSYFPEHRLPARTCIGTTGLAYDALVEIDLIACR"
FT   gene            complement(527757..529070)
FT                   /locus_tag="Ping_0417"
FT   CDS_pept        complement(527757..529070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0417"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: mlo:mlr7070 glutamyl-tRNA(Gln)
FT                   amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02278"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS13"
FT                   /protein_id="ABM02278.1"
FT                   /translation="MHHVTAKPTAYSIAINWLTSHIVYYRIVIMLTNLPFTIDALHEVC
FT                   RQGVSPDEVIQESLARLTNIADEGIYFYVASSSQLSKAITDLGPFDLELKPLWGIPFAV
FT                   KDNIDAANMPTTAACYEFHYITKQDAYVVSLLKLAGAIVIGKTNLDQFATGLVGLRTPY
FT                   PAPKNAIDSKLVPDRSSLRSALAVAHGEVYFSLGTDTAGSGRITSALNNIVGLKPTLGS
FT                   ISSRGVIPTCRSLDTVSILALTVEDASLVYACCRSYDKKDPFSKPYHGDAKQNMPTDFT
FT                   VAVPDSTSLILDEPAQKKAYEQALNCWRQKRAKLVEIDFNPFYEVPKLLYEGLWVAERL
FT                   AALEHFIAKHQSALYSITHVIIESAHKFSASDAFNARYHLQALPWKTTSILTKIDVIGV
FT                   PPMPGLVYKSDIGSNAIGPNSRLGTYTNLLDDDHKKYH"
FT   gene            529139..529501
FT                   /locus_tag="Ping_0418"
FT   CDS_pept        529139..529501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0418"
FT                   /product="transcriptional regulator of LysR family protein"
FT                   /note="PFAM: regulatory protein, LysR; KEGG:
FT                   gbe:GbCGDNIH1_1637 transcriptional regulators, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02279"
FT                   /db_xref="GOA:A1SS14"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS14"
FT                   /protein_id="ABM02279.1"
FT                   /translation="MKQLMDFNYFQVVAKGGSIRKPADQLSITSTALNRRILSMEDELG
FT                   EKIFERQASGLRLSAAGELFLHHVQRQLADLERVKSQISDLSGVRRGHVNIACSQALLT
FT                   SFFLNKSHVFGTNILR"
FT   gene            529498..530031
FT                   /locus_tag="Ping_0419"
FT   CDS_pept        529498..530031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0419"
FT                   /product="transcriptional regulator, LysR family protein"
FT                   /note="KEGG: gbe:GbCGDNIH1_1637 transcriptional regulators,
FT                   LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02280"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS15"
FT                   /protein_id="ABM02280.1"
FT                   /translation="MTFSLYLRDRKAAESTLLDNSVDLAMVFEPVYMNELQILICKEQQ
FT                   LYAIMPSGHPSAGISELKLSECMAYPLALPTSEYGVRHILDFKANRSMLDMYAAVESDS
FT                   FEFLRNYAINESCITFQIEIGLPQIVEELRLTARPISKADMAVGSMYLIQKKGRTLPVA
FT                   AVRFAEQLIQTLSQ"
FT   gene            complement(530800..531135)
FT                   /pseudo
FT                   /locus_tag="Ping_0420"
FT   gene            complement(531327..532346)
FT                   /locus_tag="Ping_0421"
FT   CDS_pept        complement(531327..532346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: chu:CHU_2783 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02281"
FT                   /db_xref="GOA:A1SS16"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS16"
FT                   /protein_id="ABM02281.1"
FT                   /translation="MKNNQIQLLLSLDYEIFFGKNCGSVEKCIFDPTQQLLTLLNKYDY
FT                   KVSLFVDAGFLVKLKKYAVDFPVLEQQYAAIKKQLQALSSQGHDIQLHIHPHWEDSYYD
FT                   GNAWVINTGRYRLHDFSPQEIDDIVTSYKQELESCSEQSIFAFRAGGWCLQPFDKIKQA
FT                   LQNNNIWLDSTVFAQGHSDDPTRWFEFNQIPAKAYWHFDNDPLTAQQDGYFTEIPISAT
FT                   KTSPLFFWKLALRKKLSSHLFTPFGDGQAMLASRSYYIERLTRTTYGPVMLDSSKAGQL
FT                   EKAFKEHLKLADKNSIFNVMGHPKSLSPYSLIKLEDFIRKHKELISITYQDLKHLKNA"
FT   gene            complement(532509..533069)
FT                   /locus_tag="Ping_0422"
FT   CDS_pept        complement(532509..533069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0422"
FT                   /product="2-deoxy-D-gluconate-3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02282"
FT                   /db_xref="GOA:A1SS17"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS17"
FT                   /protein_id="ABM02282.1"
FT                   /translation="MKKAISLLTTSLVLLLATSTASAIPINGIISLAGNAATTYNSSTT
FT                   EIKAVDFDSSYVGIANGDFAANGVTVLDMSVSAFGSNVIINDIADPITLPISPLWLVEG
FT                   FTFNLENIISNTVASGGAIINGNGTMSHAGYDDTLFTWVFTTQVGSDKTTFSARSVPAP
FT                   AGAALLGLGLLGFGFARRNKKAS"
FT   sig_peptide     complement(532998..533069)
FT                   /locus_tag="Ping_0422"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.761 at
FT                   residue 24"
FT   gene            complement(533703..536345)
FT                   /locus_tag="Ping_0423"
FT   CDS_pept        complement(533703..536345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0423"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sde:Sde_0178
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02283"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS18"
FT                   /protein_id="ABM02283.1"
FT                   /translation="MKLKFFNLQIDKALTISMLVTTIFLSACGESKEVQKSTNKDAYLA
FT                   QGQSYLDAYQFKAAFSAANDAIKIDPTSIDGYLIITKINQESGQPLESVKLLESFTGIK
FT                   DVEYYFALLDAYQQSGKVISAQSLIEHQTEILQNKPQHLQFVKAQQLLLSNNLQQAKIA
FT                   FTESLKNPDYKIKSMLALAKIEAVSDNHSAALTTLDEIIKSEPKNTEALFLKSMIYIKT
FT                   GDLTNAEKSLSEALSVLPTSDIFTYQRIQIIQSLANVLTQQGRGSEALIYTRILSEEFP
FT                   LAESVSMQYTRALELFENQQFSTAKKVLLEILDNNPGHKKSATLLALIFYNEGNSESAG
FT                   KYLTDIIDPEISPIKLTELYMATQLQQNKSEEVLNLLKNIPEKNRNVDTWVLYANAAIQ
FT                   QKEFTKAKMALDKAKLLAPQSIRLALTENFYYNSLPEPQAEKALASIYVVLSSHPENNT
FT                   LQMLYLRQLLTFKKFTEADKYVANLKSMYSENTDTQLIVANYYIYQNKSGEARKIIEKI
FT                   LALENNHLQALYSLVQINKIEKKWLSTLDNYKQIISYYPTEITSYTGIVRSLIDQQKDP
FT                   LKAANYLPKNYEASLLALTLATLTLQQNKLDLATGYAKEAGNELPQKYQASLNQLTVQL
FT                   NLLKASKAFAENDYPKAKEILIAALKQEPENITLLSLLTDIEIRSEQYIEARKITDKIA
FT                   KILPKSSLATRLYAGIFVAQEKPQQAINLLTAYWQKTKDEQVADQLYLLLGNNNSEKAA
FT                   AFLNEWQQAFPKSLTAIRYQAIYLQNNGKKEQALQVYQAQLKQTPNDVVSLNNSAWLYF
FT                   EQGNPIAITLAEKAYKLMPENAAILDTYGWILYKNGERQQGKKLIEEAMRLSPNEPEIK
FT                   SHLLEINNQ"
FT   sig_peptide     complement(536256..536345)
FT                   /locus_tag="Ping_0423"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.963) with cleavage site probability 0.685 at
FT                   residue 30"
FT   gene            complement(536389..537744)
FT                   /locus_tag="Ping_0424"
FT   CDS_pept        complement(536389..537744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0424"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family protein"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; SMART: AAA ATPase; KEGG: sde:Sde_0749 response
FT                   regulator receiver domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02284"
FT                   /db_xref="GOA:A1SS19"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014264"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS19"
FT                   /protein_id="ABM02284.1"
FT                   /translation="MSKNETKTLLIVEDDIGLQTQLKWHFSDYSVVVAASLDNAIAAIR
FT                   LHEPQVMVQDLGLPPDPDGVTQGFSLVQQALSINPHMKLIVMTGNDCNEHALKAVSLGA
FT                   YDFYSKPVNPDTLALIVQRAFHMHQLETKNRIFNLSKSSHLEGLITADERMLTICKLIE
FT                   KVAPTSAACLLLGESGTGKEVLAKSLHALSTRNEHPFVAINCAALPENLFESELFGYEK
FT                   GAYTGAIKSTLGKLELANGGTVFLDEIGEMPLLLQAKLLRFLQEKVIERIGGRKLIHLD
FT                   TRIVCATNRNLEEMMASGEFREDLYYRIAEIQIDIPPLRERGSDKVLLARYLLQKYTQK
FT                   ENLKVTGFTKDAINAIEAYSWPGNIRELNNKITRAAIMCEQKNITAEDIGLKSSDSSPL
FT                   SLKVIRESAEINALKTTLNATDNNISAAAKSLGITRPTLYDLMKKHHLNTPL"
FT   gene            complement(537770..539167)
FT                   /locus_tag="Ping_0425"
FT   CDS_pept        complement(537770..539167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_0134 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02285"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS20"
FT                   /protein_id="ABM02285.1"
FT                   /translation="MKINKISTQSCPSIFFFALLFQTHAAASTTDKQSSFVELGAGYIV
FT                   SDNIYKSTDNKQTARSATADMALGYKKKFTTTDIALTYDAEYTKENKEELQENNYWTGN
FT                   ALISQQVFSKNLLLNLAHKRRRYLIDPSQANDENNQNENDFLKAGLQWSLPYSDRTTFI
FT                   VGADHTETWFAGDGAKSDSNSNEALISWQYALSEKSQVQVSYSGSKKKFDDLNEEYRQQ
FT                   KLDTKLTRSYLLGTYSLNIGKTWVDSLSAKNNGEQYGFTINAQMRKHLFTFNASKTLTD
FT                   SSREFETDQPIAFVENSFFWYTSLSLEHQYIILNDKLVSNLRFDFERSDQLTAIDEIDI
FT                   KDKYGAFGGLTWSLTEYLRSDLSVSYRRTDLTSSAIKKVTEAGALGKLTWSLTENLSSS
FT                   LLVSYLRTDLTSSAIKKVTEAEVSAKYNVTHSLYIQLSAAFEKQENIQKTSGYEEQHYT
FT                   SRIAYKY"
FT   sig_peptide     complement(539090..539167)
FT                   /locus_tag="Ping_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.682 at
FT                   residue 26"
FT   gene            complement(539175..539927)
FT                   /locus_tag="Ping_0426"
FT   CDS_pept        complement(539175..539927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0426"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /note="KEGG: hch:HCH_02717 putative polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02286"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS21"
FT                   /protein_id="ABM02286.1"
FT                   /translation="MTVMPLEKQITERNHNALNISDDSRKQIREMNDDWLLTSDELDAL
FT                   KIIYPGCGDEKSLNNYRELRTKILKKANNKNFVCMLSSTNQGSGTTHVAVNLAASIALD
FT                   HRKTALIIDCNNYTPSLDNYLKEKPKFGLSNFLEEDTQEIEDIIYPSGIRRIRIIPAGS
FT                   KTEHAAENFSSEKMEKFIEMAKKRYPDRFIILDTPPIGYYAESQILASICDMAILVVRY
FT                   GQTSESQIQTGIELISNDKLAGIILNNK"
FT   gene            complement(539924..541489)
FT                   /locus_tag="Ping_0427"
FT   CDS_pept        complement(539924..541489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0427"
FT                   /product="uncharacterized protein involved in
FT                   exopolysaccharide biosynthesis-like protein"
FT                   /note="KEGG: sde:Sde_0133 uncharacterized protein involved
FT                   in exopolysaccharide biosynthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02287"
FT                   /db_xref="GOA:A1SS22"
FT                   /db_xref="InterPro:IPR014345"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS22"
FT                   /protein_id="ABM02287.1"
FT                   /translation="MEINEIFKYIAAAWQEVCLRKFKAALLVTVISFSILAIGIYKPSV
FT                   FRSETTIFADTQNIIKPLLSQQTSITNVKQSKTAQVRDVIFSPRQLNKVIDAVYGKNAF
FT                   PTPQLLADKWASLRHSINVEGMSDNYLKISYQDATPDITFRLLNEVVSLFVEDSANTKK
FT                   NESRSAYNFIEKQVESYKDQLLLAEKKLKIFKSSHLDGTESEVESRISELRNNIEDMKI
FT                   YQMEILTQISSLKNQLKSQDKFSSNDYEAAIYHRRLKELRQYLDHLLLSYKDDYPEVLE
FT                   VRYQISDMEKNVTNLTFKEKDKSQVGAEFNPLYQEISSKLSTAQVSYNTEVNRLNAFNV
FT                   LLEKASERRKRIANNQAELSELNRDYGVIKGLYEDMLANKEKARLSMVLDIEGQGVNYK
FT                   VQEPASYPTLPSGPRFLHFFIAGPVLGFLLLVSLFLVKILLENKIRFASQLAQFTNVPL
FT                   LVSIDHKLNSSERNKKRSENIAFLFALLFVVTVYVGIAISHRYDYPISELFTPLYSLLM
FT                   ERIR"
FT   gene            complement(541492..542100)
FT                   /locus_tag="Ping_0428"
FT   CDS_pept        complement(541492..542100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0428"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   sde:Sde_0132 putative polysaccharide export protein, outer
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02288"
FT                   /db_xref="GOA:A1SS23"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS23"
FT                   /protein_id="ABM02288.1"
FT                   /translation="MIKTLLLTFAIYMLASCSSTELLQQMDSKEIITAPEYKIGVGDQL
FT                   SINVWKNPELSLSVTVRPDGKISVPLVGDAQAVGLSAEALAAELNNNLKKFIRSPEVTV
FT                   IVSSAMSAEFLSRVRITGAVQTPLSIPYREGMTVLDLVLQAGGLNPFSNGDNAILYRKT
FT                   DSGIKRYSIKLKRIIKQGDISTNYELRPSDILIVPESIF"
FT   sig_peptide     complement(542038..542100)
FT                   /locus_tag="Ping_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.312 at
FT                   residue 21"
FT   gene            complement(542150..544222)
FT                   /locus_tag="Ping_0429"
FT   CDS_pept        complement(542150..544222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0429"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="TIGRFAM: histidine kinase; PFAM: ATP-binding region,
FT                   ATPase domain protein domain protein; KEGG: sde:Sde_0750
FT                   sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02289"
FT                   /db_xref="GOA:A1SS24"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014265"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS24"
FT                   /protein_id="ABM02289.1"
FT                   /translation="MSGYPTLTIFDYFTASVEIALALTALVKIKNLKIKLSFFLFAMLT
FT                   AIWHITFADNPFDRFPSSYQFQLIETLRYIGWSLILINLLMYSQKKRLPVNWLASIYIT
FT                   IVVILALLIQSLNNPLTSFMQMTLWLYIKIILCLAGIVIAEQLLRHDNSSRVSKLVALV
FT                   AITQLAYDMLVFLNLLLFINENNNLWYARGIINSATSLILALAIIIYPFQQQQDSQFQL
FT                   SRSIIIFNTSFILAGIFLVFMALLGLAVNIFNVEWAEVSRILLYVMSIFAIAALSCLEK
FT                   FRSHTTVWISKNFFINKYDYQKQWIELDSQLSQKRDDNNGYEIALATMTSLFNCSGGGI
FT                   WLKGQQFYSPVALKNFELPSSRAIEANNSHFIQLMTKDEWVFQTPKNTGDHDKKNNKYL
FT                   PKWFINTNDAWTIIPLNTHQGLIGFAVLCKKSANTTLTWEDLDILKLTGRQIGSYINSH
FT                   QASEKLIQNQQFDLFNKITAFAIHDIKNLIAQQGLMLNNAEKFRHQPEFIDDVILTIGN
FT                   SVEKMNQLLVKLQGDSQSKIESINIIKLLENAIEMNSSSLPTPILSVVKGNNALVMADK
FT                   DKLQMALYHLIKNAQDATDDSGTIAIKLTTENDDLWLEVTDTGCGMDESFIKEQLFKPF
FT                   SSTKKNQGMGIGAYQIRELIHSLQGEIFVESTVKKGTQFSIYLPLNGTKKEMNYA"
FT   gene            complement(544307..545557)
FT                   /locus_tag="Ping_0430"
FT   CDS_pept        complement(544307..545557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0430"
FT                   /product="UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   vch:VC0918 UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02290"
FT                   /db_xref="GOA:A1SS25"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS25"
FT                   /protein_id="ABM02290.1"
FT                   /translation="MDFEKVSVIGLGYIGLPTAAIIASRGMTVIGVEVNQNAVDLINAG
FT                   KIHIVEPDLDIVVRSVVSTGNLRAVTIAEPANVFMIAVPTPFIHRDDDSHQPDLSYIES
FT                   AANTIAPVLEKGNLVILESTSPVGTTEKLATWLAKARPDLSFPQDKGNAADINIAHCPE
FT                   RVLPGYVLQELVSNDRVIGGMSKTCSEKAVALYRTFVRGECIITNARTAEMAKLTENSF
FT                   RDVNIAFANELSIICDKLKINVWELIKLANRHPRVDILNPGPGVGGHCIAVDPWFIVDS
FT                   CPEEANLIRQARLTNDHKPHYVIEQITHAADEFKRPVIACLGLAFKADIDDLRESPALQ
FT                   IVKQLADKKVGQIMAVEPNIKFLPEHLLKENIQLTSLEHALEVANIIVILVDHQEFKLT
FT                   DKTLLATKVVIDTRGIL"
FT   gene            complement(545606..546790)
FT                   /locus_tag="Ping_0431"
FT   CDS_pept        complement(545606..546790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0431"
FT                   /product="UDP-N-Acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="PFAM: UDP-N-acetylglucosamine 2-epimerase; KEGG:
FT                   ypn:YPN_0099 UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02291"
FT                   /db_xref="GOA:A1SS26"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS26"
FT                   /protein_id="ABM02291.1"
FT                   /translation="MVMSIKILTVFGTRPEAIKMAPLVDALKKQPGIDAKVCVTAQHRE
FT                   MLDQVLNLFAITPDYDLNIMKPGQSLSDVTTNILLGLEPILKEFKPHLILVHGDTSTTL
FT                   STSLAAFYQQIPIGHVEAGLRTGDLNSPWPEEGNRRLTSAITKLHFAPTESAKENLLRE
FT                   WISADSIEVTGNTVIDALMQVIYKLKNNTQLSNTLAKQFPQLDANKKLILVTGHRRENF
FT                   GSGFERICEALAEIARRHSNVQIIYPVHLNPNVREPVNRILRNLDNIHLIEPQDYLPFV
FT                   YLMDKAHIILTDSGGIQEEAPSLGKPVLVMRDVTERPEALSAGTVQLVGTDKNNIINAV
FT                   EKLLQDEITYNRMSRAHNPYGDGQSCQKIINRIMHYFVTQKVEAVTAASEPITV"
FT   gene            547858..548982
FT                   /locus_tag="Ping_0432"
FT   CDS_pept        547858..548982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0432"
FT                   /product="Protein involved in cellulose biosynthesis
FT                   (CelD)-like protein"
FT                   /note="KEGG: mxa:MXAN_3233 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02292"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS27"
FT                   /protein_id="ABM02292.1"
FT                   /translation="MLVSNTESFEIRVIKNWDNFATLKEDWQNLLVQSDADNLFLTWEW
FT                   MDCWRIAQGELITPFIIVIQDSQGILAIAPFYIQEYRLAQLVTYQALRFIGDKGSGSEY
FT                   SNFIVKKEDGIVLKSRLWEHLLSPEVKPCWDFIWFTNVKAWAEGGQTLLQSLASVKGLN
FT                   CNQRTVEFAQIPLRKYSTDILPELSKSLRADIRRPSRRLDKFGSWQMLTCKGDDDINEL
FT                   LEQLFSLHNKHWLNAGLGTFQRRPELADFYRLFVPLALKKGWLRLLRLESNGEIQAMQL
FT                   GYVYNNQFLAIQEGFNPDFIPGVGQVLRYYSFTNCQQEGLSCYDFLGIYTDHKRRWLAE
FT                   KKLGANLFIWRTKMKNIPFSIKKIWPTGRYLKPL"
FT   gene            complement(548990..550996)
FT                   /locus_tag="Ping_0433"
FT   CDS_pept        complement(548990..550996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0433"
FT                   /product="Heparinase II/III family protein"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   aba:Acid345_3793 heparinase II/III-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02293"
FT                   /db_xref="GOA:A1SS28"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="InterPro:IPR031680"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS28"
FT                   /protein_id="ABM02293.1"
FT                   /translation="MQSLSWYVKRIKTMSTQEITWRVRSLSAALLEHTRVKMNIIASPA
FT                   FQAGYQEQAPFSPPFRVFVGDIKQFNTQWRPALLTKADHILQHKLSYFNLHDLDLETPI
FT                   NWHKDHATGQQTSRAAIMTVNYRDIKKNGDCKLVWEPNRHHQFVVLARAYQVTGDLKYA
FT                   QGVISQITSWLDANPYGYGMNWKNPLELGIRIINWVWAIDLILDSGLFTGEFKARLLHS
FT                   VYLHCRDVSGKFSQGSSANNHLVGEAAGVYIAASYFSILKDAPTWQKKSKAVLENEIQA
FT                   QTFSDGGSKEHGFSYQFFVFQLYLFSSQIAHWQNNNFSSGYQHTLNKLAEFIAIIAQGG
FT                   QDYPMLGDQDDGYALDLGNYVHDINALCDLASHLYDNEIFRINAQEASEAAFWLFNQRG
FT                   RDKNLAFSLQPTPLASHKFVESGYYLLQAGSLKTNDQVSVLFDCAELGYTSIAAHGHAD
FT                   ALSLVMRLNGQDLLADSGTYDYYSFPHWRDHFRKTQAHNTIEVDGLDQSVMTGPFMWEK
FT                   HAQAQCTVWEPNNTGGIVTGTHNGYLRLTSPVTHQRSLNLNTQQKKLQITDQIQSQGDH
FT                   NIALYFHLSEYCADIKVDGQFCSLILGTSKVIITLPDNLMLEAIQGEWHQDPNHVSLGW
FT                   ISRGYHQRTPITTLIARGKTTTSQQFTTSIQWL"
FT   gene            complement(551005..552495)
FT                   /locus_tag="Ping_0434"
FT   CDS_pept        complement(551005..552495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0434"
FT                   /product="eight transmembrane protein EpsH"
FT                   /note="TIGRFAM: eight transmembrane protein EpsH; Eight
FT                   transmembrane protein EpsH; KEGG: net:Neut_0899 eight
FT                   transmembrane protein EpsH"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02294"
FT                   /db_xref="GOA:A1SS29"
FT                   /db_xref="InterPro:IPR013426"
FT                   /db_xref="InterPro:IPR014263"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS29"
FT                   /protein_id="ABM02294.1"
FT                   /translation="MWTQNRRNLTLFFLFSFSIIITANSSVVFDLIDEWLSTGPYNHGL
FT                   LGFALALYVFWIKKEELAFPHSRFLNLLPLFAASLLLLVANLASIGQLQILGLFLVIVA
FT                   LLLSLYGIKIINTLFLPLLMIFLILPVWNVLQIPLRDISTWVSFNSVDLLGFEIIRDGY
FT                   YLLTPEGTFIVEEACSGLGFFLASALYAVFVAQINHLSRKSAALFFILAVLVAIIANWI
FT                   RITVIIIVGSQTAMQHFIVQDHLTFGWLVFAACFIPLIFIGNIYFGEQIAAKTNEKNAQ
FT                   KKEQRLNISYLSSVVAIVICFSAGTFILSSRYDPEYKFMLPSIPNYTKVGASRTTSHNW
FT                   KVVSKGATNEEYAHFLQEKELIQVYLANYVRQYQGAEMIFIENSLFDKNRWFKDEQQTI
FT                   KLAPTSTLKQINLLTLHRNSINSRLIAYWYLIDGHYITDKKMAKWYEVQATLKGQPGAT
FT                   LIAIEFSYNHGNKEQAVKTLTDFVTAFSTQPIHIKKSI"
FT   sig_peptide     complement(552409..552495)
FT                   /locus_tag="Ping_0434"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.484 at
FT                   residue 29"
FT   gene            complement(552468..552719)
FT                   /pseudo
FT                   /locus_tag="Ping_0435"
FT   gene            553083..553886
FT                   /locus_tag="Ping_0436"
FT   CDS_pept        553083..553886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0436"
FT                   /product="N-acetylmannosaminyltransferase"
FT                   /EC_number="2.4.1.187"
FT                   /note="KEGG: rru:Rru_A1484 glycosyl transferase
FT                   WecB/TagA/CpsF; TIGRFAM: glycosyl transferase,
FT                   WecB/TagA/CpsF family; PFAM: glycosyl transferase
FT                   WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02295"
FT                   /db_xref="GOA:A1SS30"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS30"
FT                   /protein_id="ABM02295.1"
FT                   /translation="MSASQNIGDLSSLSTLEVTQRDVCLFGITVHALTSSQALDNIDSA
FT                   IKNKQSLHIGMLNAAKIVNMKRNPTLGEDVRSSNMILADGSSVVMASKILRKTLPERVT
FT                   GIDLMHGILSRGNKEGYRVFCLGATPEILARTEAEIRKQYPGVVIAGTQHGYFSDSEEA
FT                   AVAQKITDSDADVLFVAITSPKKEQFMARWNTAMRVPVVHGVGGSFDVLAGKVQRAPLI
FT                   WQKYGMEWLYRVVQEPGRLWKRYLVTNTLFLGMLAKELFLPSKPL"
FT   gene            553911..554900
FT                   /locus_tag="Ping_0437"
FT   CDS_pept        553911..554900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sme:SMb21237 putative enzyme, C-terminal
FT                   domain similar to sulfotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02296"
FT                   /db_xref="GOA:A1SS31"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS31"
FT                   /protein_id="ABM02296.1"
FT                   /translation="MSRKKQQLIYLAAASHSGSTMTAMLLGAHPDLCSVGELKAVHLGD
FT                   KASYLCSCKTLVSECAFWQGVSEKMAQRGQDFCISAAGMDIRSGATPYILKLLKPLVRT
FT                   PFMELIRDCLLSLSPIWRKQLPILQKRNADYISAIAEKAGVEIVVDSSKVGIRLKYLLK
FT                   NKDLDIKVIWLVRDGRGVSLAYKNPSEYADAKDARLRGGGSDVGITQEQGRAIKEGAHE
FT                   WVRCNQETEAVLATMPKEKWMQVHYEDICNNTEQTLDSIFEFIGVDSTKKRLDFKTVDH
FT                   HVVGNGMRLDDAEVIELDDRWKEQLSKTELKCFYDVVGEYHNSLGYTE"
FT   sig_peptide     553911..553979
FT                   /locus_tag="Ping_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.954) with cleavage site probability 0.618 at
FT                   residue 23"
FT   gene            554907..556457
FT                   /locus_tag="Ping_0438"
FT   CDS_pept        554907..556457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0438"
FT                   /product="transporter of NadC family protein"
FT                   /note="KEGG: mba:Mbar_B3744 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02297"
FT                   /db_xref="GOA:A1SS32"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS32"
FT                   /protein_id="ABM02297.1"
FT                   /translation="MTTDSLGKTKEDLTGQDRFAWNLMVSWVSQLVLVFSGFIMPRLVD
FT                   DKVGQDLLGIWDFGWSFVSYLSLVGLGMGACFNRYIAKHRSSGDFFSLNKVANSAVFVQ
FT                   LIFSTVTALCTISFYLLLPIYFSDVLQENIATAQWVVLFLGLSVSVQMIAGSASGLLTG
FT                   YHRWDIHNALHAGDSFFSLILMVIALYFTDLNVAGMAIGYLLSTILFETLRFVFVNKLC
FT                   KEFKFDLRMANFISCKEMLVFGIKSMLSNVPPILLLQTISIMLVSAIGPAALAVFARPM
FT                   ALTKQVKTFMTKFTLMLTPTTSSMQGSGDIKAIQSLFISTTKLSFAFTLPSLGFLFIYG
FT                   DVVLYYWMGSEYALSSLVMILALGQVLPMGQDTSIRILMGMNQHGRISLFAFISVFAFF
FT                   AVGLLFSGVNDWELTTAALLFVVPMNIVYGLIVPIYTCRELELSWFSYVQSSFIRPVIY
FT                   VIPFLALLYWSRQAFEAKDIITASVTFFFAGIVTIIIYFVYLVPNKMQQKLLLRCKFQ"
FT   gene            556497..557720
FT                   /locus_tag="Ping_0439"
FT   CDS_pept        556497..557720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02298"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS33"
FT                   /protein_id="ABM02298.1"
FT                   /translation="MDVSLRKYPYPYSAMLAICSDLDETPNKKIYFETARYLNTTEETL
FT                   LGKGVGLEVGNTIYFDMPAHNFSYTNTDDDGREKVQKLIQSGHIDCLHSFGDFVNSRGK
FT                   IEQYWDEIRQSERKIEVWVDHAQAPTNLDNDIMQGQGAEIGKPAYHSDLTVKSGGLPFI
FT                   WKGRVTSCVAQNSNRSYASIFNIKQIKASSKTILLEVIKGWLARLGNQKYAMHKDNKVL
FT                   RKTQLVDGTPVIEFLRCNPSWGGVSSNDKARGIHNVLTKNVLDTLVAKQGSSILYSHLG
FT                   KVFSVDRPFNNETRHSFELLASYQKRGDILTATTRRLLGYFRTLEALSFTVESVEDETN
FT                   INLSTEYTGEDLNGLTWYVEEPEKISLYINKKKYSDLQINPPDKSGKASVSIKWSALIF
FT                   PDFKINYL"
FT   gene            557733..558944
FT                   /locus_tag="Ping_0440"
FT   CDS_pept        557733..558944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0440"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pat:Patl_4007 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02299"
FT                   /db_xref="GOA:A1SS34"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS34"
FT                   /protein_id="ABM02299.1"
FT                   /translation="MYRVKIFLGRTVIFSLYFLIRLFSLLPKKKKKKSGNIIVLTGTFY
FT                   SKNWIDAHLRPLVTCKSVKHVYIVCNELDYDLQGLSVVAPSKISTKLIGSTLARLIAFA
FT                   VCVVKKNPDYIGGFHILFNGTLSILFANILRCRSIYFSVGGITETLVVGKTENNFFKFL
FT                   NGKDDFLTAYICKIAANATQIITMGNGAKLFFVENGVNNHIVHVISGAINKNIFYPSVQ
FT                   AGDKKYDLVLTARLSKVKQVELLLKILAYLQQQNFLCNALIIGDGPLLESLKKQAEELT
FT                   ISEQVDFVGHQNDIVSWLHQAKIYILTSRSEGLSLSMLEGLKSGLPAIVPNVGDLSDVL
FT                   IHGYNGALIENHSIDDFAHQITSLLSNPQKLDEYSQNAIASTHRFDLECVRRQWEAVFM
FT                   VEDR"
FT   gene            558946..560352
FT                   /locus_tag="Ping_0441"
FT   CDS_pept        558946..560352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0441"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="KEGG: mac:MA1063 capsular polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02300"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS35"
FT                   /protein_id="ABM02300.1"
FT                   /translation="MKKSFSKKNVWEAMPAVLKNISGMVLSYIPLEYLIGRKFREMRKE
FT                   ILNADHWTKKQVDAYQLQQLKKQLKSGYENCPAYRKLYDQAKIDINSINTLDDFRKLPL
FT                   VDKAFINENRHDLLLVDKDSPGVDYVTTGGTSGVPLAFYINASRSQIEYAYLVDGWRKA
FT                   GFKLGNTKAVLRGRVTGLKKGVHQSYDPIFKEYYYSNFHMSNDDMRSYITHIKTLKNCF
FT                   LHVYPSSIYQLARFIKKENIKVDNIKAILAESENVYPEQRAFVESVFNCRYYSSYGHSE
FT                   KLVAAGECEHSTDYHVWPTYGFLELLDERGRVITERGQIGEIVGTGFINTVMPFIRYKT
FT                   GDYAEYVGDLCEACQRHHLIIKNIRGHNIQEHLVAFDHSLIPWSAINMHDDTFDDVLQY
FT                   QFYQDTAGVAVIKIKTAEGFTAEKKQRIISNISRKLDHRIAVSVTQVDDIRLTERGKSV
FT                   FVDQRINISN"
FT   gene            560363..561781
FT                   /locus_tag="Ping_0442"
FT   CDS_pept        560363..561781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0442"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02301"
FT                   /db_xref="GOA:A1SS36"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS36"
FT                   /protein_id="ABM02301.1"
FT                   /translation="MIRITLLTLLVAYLSAYAWKDWFRAACWLVLLMAIFEHPDMPKSI
FT                   GGVPGLNHWNFLFINTVLSWYSNRKKEKLTWEMPQIVNTLFFLYAFFIFISLIRYLYDH
FT                   SGVIELFATIGAPPPGAINDINEYLINCFKWVLPGMIIFDGCRNRKQYDFAIGTLALML
FT                   ILLALQVIKAMKLGSLTIGGDALQHKAAKIISNSVGYHRVNISMMMSGAFWVIFCLKEL
FT                   VSTKHYWLLILPSCFIVFLAMALTGGRTGYVTWAILGIFYCLFKWRKYILLAPLMFLAI
FT                   TMFVPSAIERLGFGFSSEQSAGTQDIEFENEEVNLYEITSGRNLMWPLVWKSIKDAPFF
FT                   GSGREAMQNLGITLKIKRDYGEAENFPHPHNAYLQWLQDNGFVGAAPVFLLYLLLLKYS
FT                   LSLFRDNSEKIYVVTGGVSLALLLAFLIASSGSQTFYPREGAVAMWVGIGLLLRVYIER
FT                   SKKRSGKNSPLIDG"
FT   sig_peptide     560363..560425
FT                   /locus_tag="Ping_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.495 at
FT                   residue 21"
FT   gene            561904..563781
FT                   /locus_tag="Ping_0443"
FT   CDS_pept        561904..563781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0443"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: pat:Patl_1096
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02302"
FT                   /db_xref="GOA:A1SS37"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS37"
FT                   /protein_id="ABM02302.1"
FT                   /translation="MVGVFLKFKKDINGLRGIAVIAVVLFHFNESWLPGGFAGVDVFFV
FT                   ISGFLMTGIIFRGIEQESFSVLKFYIARANRIIPALAFLCLVLLIWGLIYLEPLDFRVL
FT                   GKHVGSSIGFLSNIVYWSEDGYFDVASHEKWLLHTWSLSVEWQFYIIYPLVLVTARKFL
FT                   PVAVIKSMILGGTILGFIFCVIATYKWPSSSYYFLTTRAWEMMVGGVCYLYPFSFSNIQ
FT                   KKQKVLLEWFGLSLIIASYIFINKEVAWPGYLAVFPVLGSFLMIQAQRSDSFITCNIVF
FT                   QKLGTWSYSIYLWHWPIVVAIYFYSLNDVFIYVGILLSVFLGFISNKYIEKINFKNNFN
FT                   SLINYVNCKPLYMVWGIGVIGSVIFLTNGLNFRSIEEKQLLNSNALSAISDWNYPEPNL
FT                   QIGSHNIRFIKGSSDKNILFIGASHIEQTFPYVSGINTEYNIYYLTEGGCFLTPSYTSK
FT                   VNLDCSNIKNYKDVIAEVDFERIVTSLFVLDVNLPKAEAEKKEQLDLRISEFNEFLYFV
FT                   KNKSKKVFVILGEPKGDEFNPTLSVRHNLKGYIAIEEARKAYATHYGAMQSITKMDNLL
FT                   IIDPIEYLCSDICMVRNEHFKYYYKDSEHMRPWYAKKSLGYLDQIFNNG"
FT   gene            complement(564194..564402)
FT                   /pseudo
FT                   /locus_tag="Ping_0444"
FT   gene            complement(564538..567300)
FT                   /locus_tag="Ping_0445"
FT   CDS_pept        complement(564538..567300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0445"
FT                   /product="Membrane protein involved in colicin uptake-like
FT                   protein"
FT                   /note="KEGG: gme:Gmet_3227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02303"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS38"
FT                   /protein_id="ABM02303.1"
FT                   /translation="MNRLITHIKYLLLILLISTSNYVSAYTMPVGIPEASIDFTQDAPD
FT                   RPVDWSSEVAGYYYINTQTGSTAQTYGTPTAPRKYWPANIKPGSYIEIAGAFSNGFSSG
FT                   GRMFTINGTDDTWVANTSGPVWITGAKNAEGYIEKIGFQITGSNVYISDLNFKNGGALQ
FT                   ISSATVGYPAKNIVVRNVDIVGGMAIEGNSPTSGSDNIIVYNSTFHDAGDINAVGDEDA
FT                   HLMTVGAGCSNIWLLNNTAHTASGAGLQVLGGPTRGNTHNVYAAGNEIYNVRQAGMWVK
FT                   YGSNVVFSSNYIHDIISTPWSVSKGMGAQYEPDELWMINNHVHGAEYGVRVPSTNGTAW
FT                   RQKVYVIGNVIHDIRPVQSDTFPGPIESTSSWQSAAIHVNGAHDHYIYNNLVFDAPNGI
FT                   DSSSAGITRIRNNIVLDVTKAHVNEPTGYHILAEIQDLNEEVFIDNNYIGSGMYAQVRH
FT                   GIYQTSAALNAVSGASDNIEGTNIITVANIDAIMNAQTIDSQGFTALEDAGINVDNILV
FT                   TAFRSNFTDTVGIDRDIFGVQRKLGSMDIGPFVINGLPPTAAELAAAELAAAEAAAAEL
FT                   AAAEAAAAELAAAEAAAAELAAAEAAAAELAAAEAAAAEAAAAEAAAAELAAAEAAAAE
FT                   LAAAEAAAAEAAAAEAAAAEAAAAEAAAAELAAAEAAAAELAAAAAELAAAEAAAAELA
FT                   AAEAAAAELAAAEAAAAELAAAEAAAAELAAAELAAAELAAAEAAAAELAAAEAAAAEL
FT                   AAAELAAAEAAAAELAAAELAAAELAAAELAAAELAAAELAAAELAAAEAAAAELAAAE
FT                   AAAAELAAAEAAAAELAAAEAAAAELAAAEAAAAELAAAELAAAELAAAEAAAAELAVA
FT                   EAAEAAAAEAAAAEAAAIIPEKPANITLTLTSDSYFPTKPGNVNVIQTP"
FT   sig_peptide     complement(567223..567300)
FT                   /locus_tag="Ping_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            complement(567551..568975)
FT                   /locus_tag="Ping_0446"
FT   CDS_pept        complement(567551..568975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0446"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02304"
FT                   /db_xref="GOA:A1SS39"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS39"
FT                   /protein_id="ABM02304.1"
FT                   /translation="MLNRANLEHKTFQLMIIPCLLLLFSFLSYQENLFRVISDPSFNRF
FT                   QYASEILVIDGLNYTKNTGKDLSLGHYERLKKTIYPDSYLLAKKSFNGKLNEKETKFDP
FT                   YTSQIGLQLYFYSFLSNNINMSIQNLKQITSLLMSFVVLLFYFPIKKEFGFLSAIGFSV
FT                   IFIFSPWVVTFSNNLYWAMFTWFIPILITFYLSHSAFKSSKRLLIMSCLLIISFLIKFL
FT                   CGYEYITTIAITSCLPIFYWGFKTKVTNVKIIYVLSSVIFSFLAAFIISLVLYSSVYGS
FT                   SNLEKIVTKRVLYSDIQKQINDYCKDNKTQDCKDEFIKDYAPSLNANPIKVVATYFKFR
FT                   SFLPWSGPQDGEVISADKIKIKKWIKQPYLYENIINLEKQSYKYMLETVLNMILFLIFN
FT                   ILICRKAMKSQDKKDIILIATAFLAPISWYALAKGHSYLHTHINYILWYILYVPLGMAY
FT                   LLKNDSPCVNRTVNQA"
FT   sig_peptide     complement(568883..568975)
FT                   /locus_tag="Ping_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.755) with cleavage site probability 0.735 at
FT                   residue 31"
FT   gene            complement(568965..569753)
FT                   /locus_tag="Ping_0447"
FT   CDS_pept        complement(568965..569753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0447"
FT                   /product="dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /note="KEGG: cgb:cg1672 polyprenol-phosphate-mannose
FT                   synthase domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02305"
FT                   /db_xref="GOA:A1SS40"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS40"
FT                   /protein_id="ABM02305.1"
FT                   /translation="MVNKPKYYEIPKYEQLFTSEKQHDYCVAIFVINEGEKLHKQLQRM
FT                   KNSNLNVDVIISDGGSTDGSTDNQTLKDLGVNTLLVKKENGKLGSQMRIAFAWAIEKGY
FT                   QGIITIDGNNKDSVESINNFVGKLKLGYDHIQGSRFIPGGKAINTPRSRLLGLKLLHVP
FT                   MMRLASGFKYTDTTNGFRAYSKKLLLANSMAVFRDVFTSYEFHYYLAIEAVKQGYKCIE
FT                   IPVTRTYPKGKVPTKISPIKGNLNIIKTLIFTSMGGYNVK"
FT   gene            complement(569828..571756)
FT                   /locus_tag="Ping_0448"
FT   CDS_pept        complement(569828..571756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02306"
FT                   /db_xref="GOA:A1SS41"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS41"
FT                   /protein_id="ABM02306.1"
FT                   /translation="MKLKITIILLGFYCIFINALTGSILVPTFHLDGAFQTASGLFRLD
FT                   SGQLPGKDFFPYLGIGPILIIFPVFKLAGSDLIASSFSTLFVTRVLAWVSVSLVVHLIL
FT                   RSKSFISSLCIGIILLIILIGIDKSGFFINKPFSFLIDPGTSLRPVRASAPYLLGILSY
FT                   FIVTTSIPYSLKKYLAGVSAGIFLLWSNDYALPTVATFSLFFCIYFYKNSATNWLKDAL
FT                   VFSLILISTWLVLLLLITAGHPLELLKYNFRDVATDQWWYFSPYYDRIFHLSDLGKLIN
FT                   ADLLILLVFSIYAYKTKYIESIILCIIGFALFFGGVLASIGGHFTKIYFNAYHAWAIII
FT                   AIIFTINLIVKLISKNIQSNQILFLRNLVSPSIIICLLMVASAGSYKYYRNLNSVQNNK
FT                   YFYYIDEFGGYLNVKWKDYIEFIKLNKHKPIIEEYWGLASALNRTFSPWPVDSVIHALG
FT                   DVRKKAQDSLVKADYIITSKNGNFSIWQPWSVSQNFWFYKTLFSEWEPIFHSPATTIWK
FT                   KLPHKRTEQNVECEITKNRDAFTIKTDKTGLINVKLNYSITAKGRYLSMVKNNLSYASD
FT                   AAGYVSINPKSDNAFFPVLSKGDENEIYDAKIVGSDNGEIIIESCEASRFIIDLDDEDE
FT                   IYPSVFK"
FT   sig_peptide     complement(571691..571756)
FT                   /locus_tag="Ping_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.628) with cleavage site probability 0.318 at
FT                   residue 22"
FT   gene            complement(571753..572757)
FT                   /locus_tag="Ping_0449"
FT   CDS_pept        complement(571753..572757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0449"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mca:MCA2193 glycosyl transferase, group 2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02307"
FT                   /db_xref="GOA:A1SS42"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS42"
FT                   /protein_id="ABM02307.1"
FT                   /translation="MKSEIFVSVVLIVKNQTDKLINYLDKLSPYLNEQYNDYEVVIIDE
FT                   KSTDDIEHKLRKSLETHQSIRHIRLSQEVSTDVALAAGIENAIGDFVVNLNILTDHPEL
FT                   VNALLESGLAGNDVVVGVSQKINSFIYRHLRKLSTWLLKSIGYSLPSNSTGTFCFSRRA
FT                   VNAITESGRFYCKLHLKIANTGYTLSPFLCDDFISNTHKKSLTHGIKETLHHMVFNSTK
FT                   PLRWMSALGIFGSLMAMLFSFYSLIVHFINDQVAPGWTTTILFMSFLFAMMFTMLSFFG
FT                   EYLARLLNDRSEHKEYNIVYERNSSVMLDEDRSNVLFTSLGESVNNSQTGRNR"
FT   gene            complement(572757..573893)
FT                   /locus_tag="Ping_0450"
FT   CDS_pept        complement(572757..573893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0450"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pub:SAR11_0547 D amino acid oxidase (DAO) family"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02308"
FT                   /db_xref="GOA:A1SS43"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS43"
FT                   /protein_id="ABM02308.1"
FT                   /translation="MDINVDINVDITIIGGGFFGLYLAEYFSRLNKKVLVIEKENDAMQ
FT                   RASYNNQARVHNGYHYPRSVLTALRSRISFPRFVDEFKPCIDNDFDKYYMISNRLGKIT
FT                   PNQFQKFCDRIGATHESAPPEIQRLIQPNMIDGIFKVKEFAFDSVLLKKTMLDRIQNSG
FT                   VDILFNHNVKTIKQHQSTSRLELKIDSDTETINISSKQVYNCTYSLLNSVLNGSNIELI
FT                   PLRHEMTEMCVVDVPDELKKVGITVMCGPFFSVMPFPSKQAHSFSHVRYTPHYEWDDNN
FT                   QSPYVDAHKLYSESFKRSAWKKMKLDAQRYIPILADVKYKESLWEVKTILPRSETDDSR
FT                   PILFKANYGLPGLHCVMGGKIDNIYDVIQTINNLGLDV"
FT   gene            complement(573897..574247)
FT                   /locus_tag="Ping_0451"
FT   CDS_pept        complement(573897..574247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0451"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   dsy:DSY2566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02309"
FT                   /db_xref="GOA:A1SS44"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS44"
FT                   /protein_id="ABM02309.1"
FT                   /translation="MKWLILILGILSNASASVLIKVAMSSKEAPIQLSNPLSIIGNLPL
FT                   VSGIALYGMAFILYALALTYLPLNIAHPILTSGSIALVSSASVLLFGENLSIINVAGIF
FT                   FIIIGVWALTVN"
FT   sig_peptide     complement(574197..574247)
FT                   /locus_tag="Ping_0451"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.866) with cleavage site probability 0.703 at
FT                   residue 17"
FT   gene            complement(574249..575064)
FT                   /locus_tag="Ping_0452"
FT   CDS_pept        complement(574249..575064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0452"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: rba:RB3239 probable D-tagatose 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02310"
FT                   /db_xref="GOA:A1SS45"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS45"
FT                   /protein_id="ABM02310.1"
FT                   /translation="MLSISNIAWDVSLDQDVSEILVHHGMSHIDIAPPKYFPSPSQATN
FT                   DDILKVRNYWLEKGIEPLGMQSLLFGTKDLNVFGSIDIRDKLLAHLSDICHIGNILGAK
FT                   KLVFGSPKNRDRAHLNDKETLETAVDFFNRLGDIAKSENVVVCLEPNPVCYQANFMTNS
FT                   PETAEVVEAVNHEHIRMQLDIGAMHINQESANEIIERFAHLIGHIHISEPQLAPLNIKN
FT                   LFHRQAAESIHHYLPEMPMTIEMLTTNRSMTLTEIEQSIHVIKEVYQDD"
FT   gene            complement(575064..575846)
FT                   /locus_tag="Ping_0453"
FT   CDS_pept        complement(575064..575846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02311"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS46"
FT                   /protein_id="ABM02311.1"
FT                   /translation="MDVNNALIGYSGFVGSILLKQSDFKSLYRSTNISEIKNKTFDTVV
FT                   CAAAPAVKWLANKEPEQDKQSINSLIAHLSTIKCKTFILISTVDVFKDSSEVVESTPVN
FT                   IAGLHPYGLHRYQLEEFVKKNFPHHLIVRLPGLVGPGLKKNVIYDFLNNNNLEAIDSRG
FT                   VFQFYPMVNLWSDIQVAISNNCSLIHLTSEPISVQEIAEQCFNFHFKNQLANEPAIYDF
FT                   RTEFAYLYSRTGEYQYAKKEAFLAIRSYAQSENKKECS"
FT   gene            576328..577482
FT                   /locus_tag="Ping_0454"
FT   CDS_pept        576328..577482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0454"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   bce:BC1535 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02312"
FT                   /db_xref="GOA:A1SS47"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS47"
FT                   /protein_id="ABM02312.1"
FT                   /translation="MQKKINIVHYWGGCPNVATSKELSFLMLIKKCAEHGWNNWLVLSK
FT                   YPENSELIDPILQTGCEIIYQPRSKGNFDPASIYCNFKLLWGIKCHVFHCYNDHTSPII
FT                   AAMFARVPIRVWSKLAMSSYYEQGITPKGLQRLMPSTWITCLFSNRILAISDAAGKEIY
FT                   EQVGFKNKVATVQVPVSLERFMTITGAGIRDEFNLQQSDIVITAVGHFIEVKGWDIAIK
FT                   AFARVYKEIPNAKLLLVGKKTSVEFYQKICLQIERYDLQKHVFFAGNRSDIPEILKASN
FT                   IFILPSRSEGTPAALIEAMAAGLPCIAAETGGIPEVIVHGNNGLMFRREDAEDLADKIV
FT                   CLLSDSELRLQLTKMAQKNLEKFSIENYVDSVFSHYQNLLKYYD"
FT   gene            577536..578555
FT                   /locus_tag="Ping_0455"
FT   CDS_pept        577536..578555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0455"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: mca:MCA0187
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02313"
FT                   /db_xref="GOA:A1SS48"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS48"
FT                   /protein_id="ABM02313.1"
FT                   /translation="MKRIFKKLILSCLDKLGFLYFLHYKNRHKISVLMLHGVMTPHDNT
FT                   IWNPLRPQLSPGELQRVLGILSSYYQFITVKQCIDMLEGKIPLIDNALLITFDDGYRNN
FT                   IDYALPICEQFAIKPVLFVTTGYIDSGLPFWFDRLDYALQQNMGGVISFEYQGAKYCFD
FT                   ATSRQALKTSYQAFRDHCKQVFTEDIEMNQLFNALSEMLEIRAGKALREISTDDDWSAM
FT                   VSWPQLREAVKTGRLDVSSHTVDHLRVDRLPEEQILIQLQQSKMRIEQELAGKCHYFCY
FT                   PNGNYNDLAISLLKKTGYRAAFSTDVGLCEVKDSLMTLKRFNFPANKTKNEILYQLNR"
FT   gene            578687..579808
FT                   /locus_tag="Ping_0456"
FT   CDS_pept        578687..579808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0456"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   son:SO4681 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02314"
FT                   /db_xref="GOA:A1SS49"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS49"
FT                   /protein_id="ABM02314.1"
FT                   /translation="MVNICLVAHFAYGALTGGSQGAVGGVERQTSLMAKWLVAKGHKVS
FT                   LLTWAEGGDDDEVIDGVQVIKICRRDSGLPGIRFFHPRWTGLISAMKRANADVYYQNCG
FT                   EYITGQVAMWCKENNKKFLYSVASDADADPRFPVMHTLRERWLYKYGLLNADKVIVQTK
FT                   TQMKLLKKGFDLDSSIMPMPCLGPDQTQYQPLEWNTDKATILWAARIHECKRLELFLQV
FT                   ATELPEYNFVVAGSSGKEDAYSQGLMDKMKQLENVTYLGMVARADMPALYRASTVFCCS
FT                   SEYEGFPNTFLEAWSQGLPVVSTFDPDHLIQERKLGISATNKDELVLGISEICTNRELW
FT                   QLHSSNARRYYQENHSVDKVMERFEKIFINLVR"
FT   gene            579826..580971
FT                   /locus_tag="Ping_0457"
FT   CDS_pept        579826..580971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0457"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   pfu:PF0788 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02315"
FT                   /db_xref="GOA:A1SS50"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS50"
FT                   /protein_id="ABM02315.1"
FT                   /translation="MKPIKLAFVTQFPIDINRPLGGVEAVSVNLLRSLSAYAELDIQVV
FT                   TLCPNITQVTQESWERVTVHRLPKPRGSELINAITKSKALVADYVRKLQPDLIHAHDTY
FT                   GIMVNDLAIPKVFTVHGFIYGDTLFANGRFKWLRSKLWEYIEKRSWAKQPNIISISPYV
FT                   RENVSSVTSANIYDIDNPISDKFFVLERNEKVGTIFTSAVICPRKNSLLLVKAVGLLVA
FT                   AGYNVQLRIAGSVGDERYAQEQQRWILENNLEKHVHLLGRISTEDVMKELSSASIYALT
FT                   SLEENSPMGIEEAMAVGVPVVTSNRCGMPYMVKHSETGYLVNPFDENNIADKFKKILGN
FT                   SELQLAMSIKSKALALDLYHSDNVARRTYAVYRELQSNAKS"
FT   gene            581170..581916
FT                   /locus_tag="Ping_0458"
FT   CDS_pept        581170..581916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0458"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02316"
FT                   /db_xref="GOA:A1SS51"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS51"
FT                   /protein_id="ABM02316.1"
FT                   /translation="MTFILIILFFSRVPVVISDRLTDTLWPIGHIVSFACWAWWLLSCN
FT                   VYIKSESSKRQLLFLLLITLTIGGGIELLQPFFSRRAQLSDLYYDLFGTFFAYLFFGNF
FT                   NKNNKLLIVSRFLYITLLLYITSPAMLAVKDEYDLRMDFPIIAKFDSYSELTRWKADLP
FT                   LSMVNTSELSETRVADTNLMKVTFAAKKDSAQYYVFLPAIGKGISRLSFHFLILTKLHL
FT                   RLGLLSQTKFITNRNPIIMIDLENGY"
FT   gene            582221..583657
FT                   /locus_tag="Ping_0459"
FT   CDS_pept        582221..583657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0459"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2469 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02317"
FT                   /db_xref="GOA:A1SS52"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS52"
FT                   /protein_id="ABM02317.1"
FT                   /translation="MFNKTPRSIAIKTLMVAAIFLSVLIGYQLWQEYRMNVLINIDTSA
FT                   GSIVAVDITWQDDSDDEDGFVVERKESGDFVEVARLNSNVTAYTDYSLVAGTAYCYRIG
FT                   AFNQVGTAYSDEYCIDIPEADIVVDTTLPPLTGSETITSEFITQPNVIELAGRELYSFK
FT                   SSATYNVDFSKDEVENIQYNIADGNLSYEDSALFTFQDEGSYVESGFVSMRYNEVNNVS
FT                   FSLNGNGDPQVASLYMSVGVWSSVPAAFLVIAGDTSDIISIPRGYGWHYLKIDIAFDES
FT                   MEVKINPIGVFGGYSALNVAGVVLNEKSISTSFASLTDISLADSANIDVSNVKYMTSYF
FT                   ISGNEKLSSGEVIGIDYLGTSQYQDAIYSFIDNGQVVATGYTEMAWKKANVISIDLKNS
FT                   SEQPVYTSLFLRAGAWVAGTSQLEMKLNGETYPIELSYGYGWFFIRVDFEFSGNAHVEI
FT                   KPVDNIGGYSQIMFAGLTMQ"
FT   gene            complement(584012..584650)
FT                   /pseudo
FT                   /locus_tag="Ping_0460"
FT   gene            585001..586401
FT                   /locus_tag="Ping_0461"
FT   CDS_pept        585001..586401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0461"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: pha:PSHAa1783
FT                   UDP-glucose lipid carrier transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02318"
FT                   /db_xref="GOA:A1SS53"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017473"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS53"
FT                   /protein_id="ABM02318.1"
FT                   /translation="MTSQKFLASKSNSYSFLYRLIDLSILFLSLPLAAYLYGVSLGPEH
FT                   LVAVLIISIFFLYFSESFELYRSRRIDRFSEMFLRVGLCVSIAFLVAVTLAFLLKESDF
FT                   FSRVTIVLWFMLSLFFSLFWRVLQRQCIKACLKSGIFVKKVAIVGATDSAVNLFKEIQN
FT                   NNELGYELVGVYDDRSLDRVHKVLNLNVIGRVEDAIKQARDGNIDILFLALPLQAEKRI
FT                   GDILLLLGDTTVDVHYLPNFFVSNLIHSRVEHVGAVDTLSVYESPYLGPKRWLKRTEDI
FT                   VGSLIILCVIAIPLLLISLAIKVTSSGPILFKQRRYGLRGEEILVWKFRSMYVMESDGK
FT                   VIQATKNDPRITPLGAFLRCSSLDELPQFFNVLRGDMSLVGPRPHAVAHNEEYRRKVQF
FT                   YMLRHKVKPGITGWAQINGWRGETDTLEKMEKRVEFDLQYIKTWSLWFDLKIIWLTIFK
FT                   GFVGKNAY"
FT   sig_peptide     585001..585117
FT                   /locus_tag="Ping_0461"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.631) with cleavage site probability 0.432 at
FT                   residue 39"
FT   gene            complement(586501..586809)
FT                   /locus_tag="Ping_0462"
FT   CDS_pept        complement(586501..586809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02319"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS54"
FT                   /protein_id="ABM02319.1"
FT                   /translation="MFMLATNECNKALTMKNMFALYKPQESVEKGFNFKKIRTPSADFR
FT                   YLKYKTKTDSPLGVFGFQGLLALSITQEESLVVNLKERNRVLINYMEPIYKKSTSGN"
FT   gene            587411..588868
FT                   /locus_tag="Ping_0463"
FT   CDS_pept        587411..588868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0463"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: rfr:Rfer_1161 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02320"
FT                   /db_xref="GOA:A1SS55"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR017691"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS55"
FT                   /protein_id="ABM02320.1"
FT                   /translation="MLKDPKQVHAPNFGVVVSVRGSVVDIRFDESLPPIHRLLRVVGIF
FT                   IVIEVLAQRDARVVRGIALTPTQGLARGMRVEDSGGPLTAPVGKAIISRMFDVFGNTID
FT                   NGPLLNNVQWRSVHRAPPTLSQRSTQSEIFVTGIKVIDVLVPLERGGKAGLFGGAGVGK
FT                   TVLLTEMIHNMVSHHNGISIFCGIGERSREGEELYREMKEAGVLPNMVMIFGQMNEPPG
FT                   ARFRVGHAALTMAEYFRDDESRDVLLLIDNIFRFIQAGSEISGLMGQMPSRLGYQPTMG
FT                   SELSSLEERIANTEDGAITSIQAVYVPADDFTDPAAVHTFSHLSASIVLSRQRASEGLY
FT                   PSIDPLQSSSKMATAGIIGERHYNLAQEVRRTLAKYDDLKDIIAMLGLEQLNVDDRKLV
FT                   GRARRLERFFTQPFFSTEQFSTMEGKLVSLDDALDGCERILADEFADYPESALYMIGAV
FT                   DEVKINNKAAQHTKQQKEKNNGSTDVN"
FT   gene            589450..589851
FT                   /locus_tag="Ping_0464"
FT   CDS_pept        589450..589851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0464"
FT                   /product="ATP synthase F1, H+-transporting two-sector
FT                   ATPase delta/epsilon subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase,
FT                   delta/epsilon subunit; KEGG: sfr:Sfri_3050 H+transporting
FT                   two-sector ATPase, delta/epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02321"
FT                   /db_xref="GOA:A1SS56"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR024037"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS56"
FT                   /protein_id="ABM02321.1"
FT                   /translation="MAAQIQLKILLPYATFAEKLDVERIVAETNLGFIGILPNRLDCSA
FT                   VLTAGIFCYQCKNKAEVFIAVDQGILVKTGFNVLVSVRRAIGQADLSRLHALVKKEFLV
FT                   VDENEKRLQATMVKLETGFLRQLGNFQHQ"
FT   gene            589874..590257
FT                   /locus_tag="Ping_0465"
FT   CDS_pept        589874..590257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0465"
FT                   /product="F0F1-ATPase subunit, putative"
FT                   /note="TIGRFAM: F0F1-ATPase subunit, putative; KEGG:
FT                   rfr:Rfer_1163 F0F1-ATPase subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02322"
FT                   /db_xref="GOA:A1SS57"
FT                   /db_xref="InterPro:IPR011744"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS57"
FT                   /protein_id="ABM02322.1"
FT                   /translation="MKLKSGKKSARKVENKGLNNEEKKSDFVGMIGLKTARKLHARRNS
FT                   SPGMWFGLGMIGIIGWSVVIPTLLGAALGIWLDNHYADQRSWTLALLIAGLTLGCFNAW
FT                   YWVDKEQQTMSNEQEQEKKDEGE"
FT   gene            590259..590591
FT                   /locus_tag="Ping_0466"
FT   CDS_pept        590259..590591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02323"
FT                   /db_xref="GOA:A1SS58"
FT                   /db_xref="InterPro:IPR017581"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS58"
FT                   /protein_id="ABM02323.1"
FT                   /translation="MIDQIFYRDIQILPLLPLLLAGAVLGVIFFAGLCWTVQRGIKSAH
FT                   PGRWFFGSFLLRTAVALSGIYLLTDGQWPKLLACMLGFIGARIVVITITGSATNIANKQ
FT                   KPNHAP"
FT   gene            590581..591282
FT                   /locus_tag="Ping_0467"
FT   CDS_pept        590581..591282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0467"
FT                   /product="ATP synthase F0 subcomplex A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   rfr:Rfer_1165 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02324"
FT                   /db_xref="GOA:A1SS59"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR017692"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS59"
FT                   /protein_id="ABM02324.1"
FT                   /translation="MRLSPDQIIFWQMGFIKLNATIVFTWLLMLFLVIGSILITRRLSK
FT                   DLARSRGQNLLEIIITNIEQQLKEVGLQSPRDYLGFLGTLFLFIAFASLSTIIPGYEPP
FT                   TGSLSTTVALALCVFVAVPLYGIVRLGIVGYLRSYMEPTFIMLPFNLIGEISRTIALAV
FT                   RLFGNMMSGALIIAILLAITPLIFPIVMTLLGLLTGMVQAYIFFILAAVYIAAATGSNK
FT                   HQIKQSSHLKQ"
FT   gene            591305..591586
FT                   /locus_tag="Ping_0468"
FT   CDS_pept        591305..591586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0468"
FT                   /product="ATP synthase F0 subcomplex C subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, C subunit;
FT                   KEGG: rfr:Rfer_1166 H+-transporting two-sector ATPase, C
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02325"
FT                   /db_xref="GOA:A1SS60"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR017708"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS60"
FT                   /protein_id="ABM02325.1"
FT                   /translation="MDSMTYIAMISIIIAGLTTGFGTMGPALAEGRAVAAAMASLAQQP
FT                   DASSTITRTLFVGLAMIESTAIYCFVVSMIILFANPFWDFAVTQAAGK"
FT   sig_peptide     591305..591394
FT                   /locus_tag="Ping_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.997 at
FT                   residue 30"
FT   gene            591590..592456
FT                   /locus_tag="Ping_0469"
FT   CDS_pept        591590..592456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0469"
FT                   /product="ATP synthase F0 subcomplex B subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, B/B'
FT                   subunit; KEGG: rfr:Rfer_1167 H+-transporting two-sector
FT                   ATPase, B/B' subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02326"
FT                   /db_xref="GOA:A1SS61"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR017707"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS61"
FT                   /protein_id="ABM02326.1"
FT                   /translation="MLIDWFTVMAQVINFLILVWLLKRFLYRPILDAIDARELRIEKTL
FT                   ADAANKEKQAQQERDLFLHKNNQLEKQSDKLLQMATTAANEEAQRLLAKARQVAADLCV
FT                   QQQATFQKQQQSLSVELTQKTQQEVFAITRQALKDLAESTLEEQILKVFLRRLCELDEE
FT                   TKLAFSSAIEANHKPVRVRTTFALQPDLQKRLSDALNATFATEIEIDFETTPDIISGIE
FT                   LNINGQKLAWSITQYIDSLEQHFQQIVEQSAQHAISRQSGSDDSLPAGATSLATQFTEK
FT                   QENLPND"
FT   gene            592449..594008
FT                   /locus_tag="Ping_0470"
FT   CDS_pept        592449..594008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0470"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: rfr:Rfer_1168 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02327"
FT                   /db_xref="GOA:A1SS62"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR017710"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS62"
FT                   /protein_id="ABM02327.1"
FT                   /translation="MTDLQQVVAHSFAALAASRTTFRAQLKAREIGIISSVSFGVAQVS
FT                   GLANVASEEVLKFSGDIYGIAFNVDQDSIGVVLLGDYWQLQSGDEVERTGRVMDVAVGL
FT                   GLLGRVIDPLGRPLDDKGPIESSERLPVERPAAPIMDRAPVTVPLQTGLKVIDALIPIG
FT                   RGQRELILGDRQTGKTTIAIDTILNQHDQNVLCVYCAIGQRASAVAKTIAILKAKGALD
FT                   YTLVMVSEGNAPPGFAYIAPYAATSIAEYFMEKGRDVLIVYDDLTQHARAYRELSLLLR
FT                   RPPGREAFPGDIFYIHSRLLERATCLKQRHKGGSLTALPIIETEAQNISAYIPTNLISI
FT                   TDGQIYLSPTLFELGILPAVDVGRSVSRVGGKAQRPMYRAVAANLKLTYAQFEELETFA
FT                   RFGARLDQNSQDIITNGRRIRASLKQPQSSPMTVLEQITVLIALTEKLFDTVPLLKMRE
FT                   AEQALCLATTELPEDFLSRFNSAKILSDDDRNRIIDIARITLAPFQSPPDEDNGITSTP
FT                   SN"
FT   gene            594044..594931
FT                   /locus_tag="Ping_0471"
FT   CDS_pept        594044..594931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0471"
FT                   /product="ATP synthase F1, H+-transporting two-sector
FT                   ATPase gamma subunit"
FT                   /note="PFAM: H+-transporting two-sector ATPase, gamma
FT                   subunit; KEGG: rfr:Rfer_1169 H+-transporting two-sector
FT                   ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02328"
FT                   /db_xref="GOA:A1SS63"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR017709"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS63"
FT                   /protein_id="ABM02328.1"
FT                   /translation="MSDSIDSSDVLKRKINSASDLHSVVRSMKAMAAANVGQYENAVEA
FT                   LNDYYRTVQLGLFTCFHQYQPVPDLQPRKACIGVLVFGSDQGLVGQFNDLLADFVLATL
FT                   GKRPEQKIVYCIGERLQSRLSESTLNLAAGFILPKSINAIPPLIGEMLLKMESLRAQGQ
FT                   ISEVIIFHNKPVSRTIYQPFSHRLLPLDDIWQKDLQSITWPSNSLPEVINASEETLLAF
FT                   IHEYLFVSLYRACAESLASENASRLSTMLRAEKTINELVEVMKGRFHLLRQNSIDEELF
FT                   DLIAGFELFKKSDY"
FT   gene            595092..596171
FT                   /gene="hlyD"
FT                   /locus_tag="Ping_0472"
FT   CDS_pept        595092..596171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyD"
FT                   /locus_tag="Ping_0472"
FT                   /product="Secretion protein HlyD"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   son:SO3483 HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02329"
FT                   /db_xref="GOA:A1SS64"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS64"
FT                   /protein_id="ABM02329.1"
FT                   /translation="MNKQILRAALITIITIGTSYHSLLSAQEREMPAVSVYTESVAYHQ
FT                   VAQSLSLIGKLQSDQSVNVATEVDGKVKSINVQANQQVKTGQLLFQLDDTKAQAAMLEA
FT                   QAYFFDEQRKLREFTKLVKSNAITQTAVEGQIASVDIARARLKAAQAEVDRHALSAPFA
FT                   GTIGLIDFSLGKMVGTGSELMTLDNLTQMTLDLQVPERYLSMLSKGMPVSATSRSWPET
FT                   IFNGQLTATNSRINPDTLNLRVRVLFNNPDNKLKPGMMMSAKIVFPAINAPVIPVQALE
FT                   YSGTKRYVYIVNKQGMASRQEVILGARIKNQILIEKGVKIGDKIVVQGLVNMRDGLKVE
FT                   DLSSIEKPDESSKKMQESK"
FT   sig_peptide     595092..595172
FT                   /gene="hlyD"
FT                   /locus_tag="Ping_0472"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.921) with cleavage site probability 0.725 at
FT                   residue 27"
FT   gene            596591..599692
FT                   /locus_tag="Ping_0473"
FT   CDS_pept        596591..599692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0473"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   vfi:VF1581 acriflavin resistance plasma membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02330"
FT                   /db_xref="GOA:A1SS65"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS65"
FT                   /protein_id="ABM02330.1"
FT                   /translation="MWLSDTAVKRPVMAIVLSLLLCVFGSLSFSKLSIREMPDVESPVV
FT                   TVMTRYEGAAATIMESQVTSVIENQITGISGIEDLRSVTRNGMSRISITFALDWNLTEG
FT                   VSDVRDAVEKAKRFLPDEATDPIVSKNNGSGEAAMYVNINSTTMDRTQLTDYVKRVLED
FT                   RFSLISGVSSITLSGGLNQVMYVKLDPALMAGRGVTSSDIVDALKRENMESPAGEVRND
FT                   TTVMSVRTARLYQEPQDFDYLVVRTANDGSAVYLKEVAEVYIGAENESSSFKNNGIVNI
FT                   SLGIIPQSDVNPLAVAQAVYREVDKIQPFLPEGARLAVNYDATVFVDRSISEVYYTLFI
FT                   TAALVILVLYIFIGQVRATLIPAITVPVSLISSFIAAYYFGFSINLITLMAMILAIGLV
FT                   VDDAIVVVENIFHHIEKGEPPLLAAFKGTREVGFAVVATTLVLVMVFLPISFMGGMVGL
FT                   LFTEFAVLLAMAVIFSSIVALTLTPVLASKILTSKTKANRFNRLTERLFESMEARYRKI
FT                   VFTTMQFRYAAPLVILACVGGSFFLFQQVPAQLTPSEDRGVLFAFIKGAEGTSYNRMTT
FT                   NMDIVEARLLPLLGKGVIKSFSTQAPAYGGNAGDQTGFVIMILEDWQERDKTAQQALAI
FT                   VSNALKEIPDVRVRAMMPGFRGRSSSAVQFVLGGSDYQELQKWAELLQQQADQSGIIVG
FT                   ADLDYSQKTPELLVSLDKQRAAELGISVTEVADTLEIMLGGRGATTYIDRGEEYDVYLR
FT                   GDENSFNNASDLSQIYMRSTKGDLLSLDTISTVEEIASASRLSHYNKQKSITLSGNLAA
FT                   GHTLGEALDFLDAKAITLLPSDISISYSGESKDYKENKSSILLVFALALLVAYLVLAAQ
FT                   FESFINPLVVMFTVPMGVLGGFLGLYFMDQGLNVYSQIGMIMLIGMVTKNGILIVEFAN
FT                   QLRDRGIEFEQAIIDASARRLRPILMTAFTTLAGSVPLILSTGAGSESRIAVGTVVFFG
FT                   MAFATLVTLIIIPAMYRLICVTTHSPGYVADLLNDAISRDSQRK"
FT   sig_peptide     596591..596683
FT                   /locus_tag="Ping_0473"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.970) with cleavage site probability 0.899 at
FT                   residue 31"
FT   gene            599980..601422
FT                   /locus_tag="Ping_0474"
FT   CDS_pept        599980..601422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0474"
FT                   /product="sodium/proton antiporter, NhaD family"
FT                   /note="PFAM: Citrate transporter; KEGG: shm:Shewmr7_3245
FT                   Na+/H+ antiporter; TC 2.A.62"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02331"
FT                   /db_xref="GOA:A1SS66"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS66"
FT                   /protein_id="ABM02331.1"
FT                   /translation="MLQKSNPLAVFLTLLAIFFSPSLFASTGENIDLTSHFIGYAAVFC
FT                   FTLAYIVVMLEDLLHMRKSKPVLVAAGIIWAMIGYYYMQHGMPHQAEAAFRHNLLEYAE
FT                   LFFFLLVAMTYINAMEERQLFDALRAWMVNKGFTLRFIFWLTGILAFFISPIADNLTTA
FT                   LLMCAIVMKVGGSNKKFIALACINIVVAANAGGAFSPFGDITTLMVWQKGMVNFGEFFA
FT                   LFLPSAVNFLVPAFIMSFFISNEVAKGDGEVIVTKRGGLRIVGLFLLTIALAVSAHSFL
FT                   GMPPVLGMMSGLGLLQFFAFFLRRTHKSYYAHAIHSSKDELEHERLRGLGDGAPFDIFN
FT                   KVAKAEWDTLLFFYGVVICVGGLGFIGYLGLVSEAMYTNWDPTYANVTIGVLSAVVDNI
FT                   PVMFAVLSMEPDMSHGQWLLVTLTAGVGGSLLSIGSAAGVALMGQARGIYTFGAHLKWT
FT                   PVIALGYVASILVHLWINKSLF"
FT   sig_peptide     599980..600057
FT                   /locus_tag="Ping_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            601668..602087
FT                   /locus_tag="Ping_0475"
FT   CDS_pept        601668..602087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0475"
FT                   /product="Fimbrial protein pilin"
FT                   /note="PFAM: Fimbrial protein pilin; KEGG: neu:NE1308
FT                   fimbrial protein pilin:bacterial general secretion pathway
FT                   protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02332"
FT                   /db_xref="GOA:A1SS67"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS67"
FT                   /protein_id="ABM02332.1"
FT                   /translation="MVKSQYMKKAQQGFTLIELLIVIAIIGILAAVALPAYQNYVQKSE
FT                   VSAGLAEITGGKPGIVLQVSGGNGASISAATIGLSTPTQTCTITADNTGVTCTYLNTAI
FT                   NTGTSALKLEYSAASGTFSCDATNIDDNLLPKGCS"
FT   gene            602675..603100
FT                   /locus_tag="Ping_0476"
FT   CDS_pept        602675..603100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0476"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: shm:Shewmr7_3604 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02333"
FT                   /db_xref="GOA:A1SS68"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS68"
FT                   /protein_id="ABM02333.1"
FT                   /translation="MKKVQQGFTLIELLIVIAIIGILAAVAIPSYNAYTQKAKFSELIL
FT                   ATGATKSALEVCAQFNASAVGCTAATVAGVAAAAANAKITTVAVTLTALAPVIVATATP
FT                   AVTGMGFAGVYTLSGVLNATYGTIAWTSTCVPETLCN"
FT   sig_peptide     602675..602776
FT                   /locus_tag="Ping_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.818) with cleavage site probability 0.553 at
FT                   residue 34"
FT   gene            603758..604204
FT                   /locus_tag="Ping_0477"
FT   CDS_pept        603758..604204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0477"
FT                   /product="prepilin-type cleavage/methylation"
FT                   /note="KEGG: pat:Patl_3344 prepilin-type
FT                   cleavage/methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02334"
FT                   /db_xref="GOA:A1SS69"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS69"
FT                   /protein_id="ABM02334.1"
FT                   /translation="MKKIQSGFTLIELLIVIAIIGILAAVALPTYNTYTKKAQFSQLIA
FT                   AVGPMKTAVEICAQLNATTDANFSTNCIQNIDDVPNTYTIKGAAVTATVAKHANATAVA
FT                   DSDLYVSASNANAIGSLGAASLYSLAAEWEPDGSVTWTAEEVIN"
FT   sig_peptide     603758..603841
FT                   /locus_tag="Ping_0477"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.892) with cleavage site probability 0.866 at
FT                   residue 28"
FT   gene            605080..605484
FT                   /locus_tag="Ping_0478"
FT   CDS_pept        605080..605484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0478"
FT                   /product="prepilin peptidase dependent protein D"
FT                   /note="KEGG: pha:PSHAa0384 prepilin peptidase dependent
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02335"
FT                   /db_xref="GOA:A1SS70"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS70"
FT                   /protein_id="ABM02335.1"
FT                   /translation="MKKIQQGFTLIELLIVIAIIGILAAVALPAYNTYTQKAKYTEVVL
FT                   ATAGYKTAIETCAQTEGSVGACDTILKIGMPTFVAYGEVASMAITAATAVITATGTAAV
FT                   GSYTYILTPTYANGRVTWVATGTCFANGVC"
FT   sig_peptide     605080..605163
FT                   /locus_tag="Ping_0478"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.822) with cleavage site probability 0.630 at
FT                   residue 28"
FT   gene            606497..606886
FT                   /locus_tag="Ping_0479"
FT   CDS_pept        606497..606886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: par:Psyc_0240 probable pilus assembly protein
FT                   major pilin PilA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02336"
FT                   /db_xref="GOA:A1SS71"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS71"
FT                   /protein_id="ABM02336.1"
FT                   /translation="MKKGQQGFRLTALLIIRAALALLSYKTYTAKVRFSEVVFATSAIK
FT                   SAAKICRVQKVSAGLCGGLSDADSESDTYGELKSLALIVTGTTFVITALATTLKILTGI
FT                   QRQVKMVTLLLLRMVFVPLPLFVNT"
FT   gene            606886..608574
FT                   /locus_tag="Ping_0480"
FT   CDS_pept        606886..608574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0480"
FT                   /product="type IV-A pilus assembly ATPase PilB"
FT                   /note="TIGRFAM: type IV-A pilus assembly ATPase PilB; PFAM:
FT                   type II secretion system protein E; General secretory
FT                   system II, protein E domain protein; KEGG: she:Shewmr4_0420
FT                   type IV-A pilus assembly ATPase PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02337"
FT                   /db_xref="GOA:A1SS72"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR013374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS72"
FT                   /protein_id="ABM02337.1"
FT                   /translation="MATNNISGLASSLATRGLLPFDKLQQITSAAQQDKKSLVSYLVDN
FT                   KFIDSLTLAEFFEIEYGLPLLDASILDLDEIPEKFLNNKLIEKHHALPVYVQDKTLYIA
FT                   MSDPTNIAALEDFAFSFAIHTDALLVEEQYLAKAIETVLEDDVASLGEMSDIEDIEVDD
FT                   SDSRLDEAQGNGSDDAPIVKYINSILLDAVRKGASDLHFEPYEKTYRIRFRVDGILHQV
FT                   ATPPVNLANRFSARLKVMSKLDIAERRLPQDGRIKLKITNKRSVDLRVSTLPTMWGEKV
FT                   VMRILDSSGANLNIDSLGYNDKQKESYLSALAKPQGMILITGPTGSGKTVSLYSGLNIL
FT                   NTVQRNISTAEDPVEINLSGINQVQINTKAGLTFASALRSFLRQDPDILMVGEIRDLET
FT                   AEIAIKAAQTGHMVLSTLHTNSAAETLTRLLNMGVPAFNVASSVSLIIAQRLARRLCPE
FT                   CKTEEVFETPELKTIGFTETQIAAGITLYKPVGCSKCTEGYKGRVGIYEVMQMSETIGH
FT                   LILNNGNAPEIAKLAEAEGMDTLRQSALQQVLKGITSLTEVTRVT"
FT   gene            609052..610284
FT                   /gene="pilC"
FT                   /locus_tag="Ping_0481"
FT   CDS_pept        609052..610284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="Ping_0481"
FT                   /product="type II secretion system protein, type IV pilus
FT                   biogenesis protein PilC"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   shm:Shewmr7_3606 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02338"
FT                   /db_xref="GOA:A1SS73"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS73"
FT                   /protein_id="ABM02338.1"
FT                   /translation="MAVKKKTKGPVIDTFKWKGLNRKGAAVSGEIQAESVAEVKIELRK
FT                   QKINVTKIQKKSKPLFSFGNKIKPMDIAIISRQIATMLGAGVPLVQGLQLIAKSSEKPA
FT                   SRKLMSTISQEVATGTPLSQTLRGHSLYFDDLYCDLVYAGEQSGALDTIYDRISIYKEK
FT                   SEILKSKIKKAMFYPAAVLTVAGLVTLLLLLFVIPQFKDIFEGFGAELPAFTLFVLGIS
FT                   DFVQSYWYMIVGVVIVFLYLFKKAYRRSQKVRDNTDRFVLKIPVISTILDKAAVARFAR
FT                   TLSTTFAAGIPLVDGLVSAAGASGNYIYRTAILNVRAEVIAGMQMHIAMKTTTVFPDMI
FT                   TQMVMIGEEAGNLDGMLSKVADIYEQQVDDAVDSLTSLLEPMIMVVLGVVVGGLIVAMY
FT                   LPIFALGTVVG"
FT   gene            complement(610507..610790)
FT                   /pseudo
FT                   /locus_tag="Ping_0482"
FT   gene            complement(610888..612108)
FT                   /locus_tag="Ping_0483"
FT   CDS_pept        complement(610888..612108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0483"
FT                   /product="regulatory protein for cyclic-di-GMP, EAL domain
FT                   protein"
FT                   /note="PFAM: EAL domain protein; response regulator
FT                   receiver; KEGG: nmu:Nmul_A1555 response regulator receiver
FT                   (CheY-like) modulated diguanylate phosphodiesterase (EAL
FT                   domain)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02339"
FT                   /db_xref="GOA:A1SS74"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS74"
FT                   /protein_id="ABM02339.1"
FT                   /translation="MVSKSSLNILIIDDQPFMLKLLEHMLISLGFNQPTIYDNGKKALA
FT                   SLDSASSQTNLILLDLNMPEMDGIEVVRHLAGKSYSGSIILVSGEDARMLQSVERLVRA
FT                   HNIPLLGSLQKPINPKDLSILIDSWEPPSYVNPPAVKKIYGADDVRAAIVNHQLVNYYQ
FT                   PKVDVANGKVMGVETLVRWRHPQDGLVFPDQFIGVAEDNGLINDLTREVISDAFSQTKI
FT                   WLDAGLSLRVAVNLSMENLDSLEFTDYVTTAAATAGIIPDDIVLEVTESRLIKSLTTPM
FT                   EVLTRLRLKRFHLSIDDFGTGHSSLMQLLDLPFNELKVDQGFVHGAASNEKLCSIYNAS
FT                   LSLAQQLGMKSVAEGVEDQADWDFIRSSGCDLAQGYYIAKPMPADEIHDWIIKWEANRV
FT                   NLITPYD"
FT   gene            complement(612158..615925)
FT                   /locus_tag="Ping_0484"
FT   CDS_pept        complement(612158..615925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0484"
FT                   /product="multi-sensor histidine kinase with CHASE and
FT                   PAS/PAC sensory domains"
FT                   /note="KEGG: neu:NE0049 sensory transduction histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; CHASE domain protein; Hpt domain protein;
FT                   PAS fold-3 domain protein; PAS fold domain protein; SMART:
FT                   PAS domain containing protein; PAC repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02340"
FT                   /db_xref="GOA:A1SS75"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006189"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS75"
FT                   /protein_id="ABM02340.1"
FT                   /translation="MKITKYFHFNLAAAMPLLTLLITFFMTYVAFNTAKIELKKNTQTY
FT                   FDFRVREAISLINNRMHIYQQVLYGASGLFIASNNIEREEFKKYIATLNLTKNYPGIQG
FT                   VGFSLIIPSTITQHVASIRSEGFPEYTIWPKGQGDISTAIIYLEPLVDRNLRAFGYDMF
FT                   SESVRHAAMQKAIDTGLPQLSGKIKLVQETGKQDQAGFLMYVPIYQNGTNNDTLAERQA
FT                   HILGWVYSPFRMNDLMEGLFGERANDMDIQIFDGETMSNEALLYDSSAVNVATTNEFEA
FT                   TRILHIADHPWTVQIRPLDSMTSRIRAVSPNLVASIGIILSVFFTVLIWFLVSGRERAI
FT                   NTARYINKELSIERQRLSDIIDATNSGTWQWNIQTGEAFFNDHWPRVLGYELSELGPTS
FT                   FETWLKFIHPEDKELSIKRLQKHLSGELDYYEYETRMRHKKGGWVWVLARGKVTTWTAD
FT                   GKPLLMCGTHQDITKQKFATEQLQDSAALIEAILNTVVDGIITINEYGIVESINPAAEH
FT                   IFGYSATEVIGHNITMLMPESYRSQHDGYIEHFNITGEAKIVGIDRIIEGKRKNGSIFP
FT                   MELGVSKVLLGEKKLFASVVRDITEQKRAKQALISAKTEAEKANLAKSQFLAAMSHEIR
FT                   TPMNGVIGMVDVLQQSSLKGFQVDMVDTIRDSAFSLLSIIEDILDFSKIEAGKLDIEYA
FT                   PMAVAEVVEKACFMLAHLAEKKKVELTLFTDPAIPDITLGDANRLRQIVVNLTNNAIKF
FT                   SSGSDRPGRVSVQALMTDPTMLEIRVIDNGIGMNESALSKLFMPFYQADVTTTRRFGGT
FT                   GLGITIARNLVQLMGGEITVQSTLNKGSIFSVHLPLEAITDIDLEQPQPEAWTGITPDL
FT                   FTGLSCLVIGDSEGLADHLAAYLSAAGAVVNQSPSLAVAQKQAVTTTSGLSVWLVDASN
FT                   NPPSSEELRLIASAQPEQAIRFVIIGRGKRRCPRWQDIDLSVVVDGNVLMRQTVLQAVA
FT                   IAAGLAEPEVERLHVGKGEQSFVAPLRSDALAQGRLILVADDNQINQKVIVQQLALLGF
FT                   AADITSNGIEALAHSHSGDYALLLTDLHMPKMDGYELTAAIRAEENDHRHLPIIAITAN
FT                   ALKGEAQHCLDVGMDDYISKPVPLESLMVILEKWLPLAAAKPVDVSVLTALVGDDPEII
FT                   KDFLQHFNDSATMIATELTTACANGEVVQAQAAAHKLKSSSRAVGAMVLGELCEEIELA
FT                   AKANQLEALTVLKLRFEVEMATVKKYLDKL"
FT   sig_peptide     complement(615833..615925)
FT                   /locus_tag="Ping_0484"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.554 at
FT                   residue 31"
FT   gene            617024..617272
FT                   /locus_tag="Ping_0485"
FT   CDS_pept        617024..617272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_2512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02341"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS76"
FT                   /protein_id="ABM02341.1"
FT                   /translation="MNDTKSLPALPDRLSVNPRSRHHVEEICEHGIGIMLNGKERFDVE
FT                   EYCISEGWVKIPSLKALDRRGQPLLMTRKGTVEAFYR"
FT   gene            618427..618660
FT                   /locus_tag="Ping_0486"
FT   CDS_pept        618427..618660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02342"
FT                   /db_xref="GOA:A1SS77"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS77"
FT                   /protein_id="ABM02342.1"
FT                   /translation="MKHFDLGSILIIMITFVLFVAALFFTGFTHDLLLEAGVFLVSVKL
FT                   IIMAYKNSISNEKIELELKEIKELIVQNKDRI"
FT   sig_peptide     618427..618516
FT                   /locus_tag="Ping_0486"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.777) with cleavage site probability 0.467 at
FT                   residue 30"
FT   gene            618783..619382
FT                   /locus_tag="Ping_0487"
FT   CDS_pept        618783..619382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0487"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: dvu:DVU1638
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02343"
FT                   /db_xref="GOA:A1SS78"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS78"
FT                   /protein_id="ABM02343.1"
FT                   /translation="MNKILAINGSYRDDGITDQAVAALVKAVESAGAEVEVILLREYPI
FT                   EFCRNCRECTQQPGESPGNCVQHDGMEELIKKIEQADGYILAAPTNFGSVTAIFKRFME
FT                   RLIVYAYWPWDKNSPEFRKTNAQKKKAILVSSCAAPGILGRLIYGTHKQLKMTAQTIGA
FT                   KTVGTVFVGLIAKDSQQKLANNIHRKVQKLSAKLLE"
FT   gene            complement(619437..620663)
FT                   /locus_tag="Ping_0488"
FT   CDS_pept        complement(619437..620663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0488"
FT                   /product="N-acetylglucosamine repressor, NagC"
FT                   /note="PFAM: ROK family protein; KEGG: plu:plu1315
FT                   N-acetylglucosamine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02344"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS79"
FT                   /protein_id="ABM02344.1"
FT                   /translation="MVRNNQQADSVIASVDHIKQLNSATIYKVIEKYAPISRVKIANVS
FT                   KLAPASVTKITRQLLQQGIICETARQASTGGRCAISLAPNTDNIHVLAIKIGQKTLSLS
FT                   CYNLAAEQLTTKKIKIKSEDEQQLLAFLISEIDNFIKKQQKNMGKISAIAISLSGLINP
FT                   KKGVVLYSPYHPLVNFPLANKIEQHFQLPTFIGNHTRSLALAEHYFGASKECLDSILIS
FT                   IHHGVGSGIIIEGKALLGQNFNIGEIGHIQANPAGRQCHCGNFGCLETEVSDRVIVEKV
FT                   AIAIKQGSFTRLSLDSLNIEKIYQAAEDNDPLCQKIVEDAATYLGKAIAILINLLNPQK
FT                   IIIAGKIIRAKTSLLSTIEQCIAHQVLPNFQHKVQIETSLLEPDTTLAAFALIKQAIYE
FT                   GDLLQQIHG"
FT   gene            complement(620898..622031)
FT                   /locus_tag="Ping_0489"
FT   CDS_pept        complement(620898..622031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0489"
FT                   /product="N-acetylglucosamine 6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="KEGG: vfi:VF0807 N-acetylglucosamine-6-phosphate
FT                   deacetylase; TIGRFAM: N-acetylglucosamine-6-phosphate
FT                   deacetylase; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02345"
FT                   /db_xref="GOA:A1SS80"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS80"
FT                   /protein_id="ABM02345.1"
FT                   /translation="MYALTNCKIYTTDAVLLEHAVIVKNNKIDSVIPIAELSSTIKKID
FT                   LLGANLSPGFIDLQLNGCGGVMFNNEITEKTLAIMQSTNLKSGCTSYLPTLITSSDEDM
FT                   RTALKVTRDYINKKPNEVLGLHLEGPYLSIERKGIHRSEYIRKADISMLDLICQNADIV
FT                   SKVTIAPEKNSVEVIQRLSKAGIVVAIGHTNATYAQAAVAIDNGATFATHLFNAMTPMT
FT                   GREPGVIGAIYDKNIYAGIIVDGFHVAYENVRISKKIMAEKLILVTDATAPAGADIEQF
FT                   DFVGTTVYYKDGKCFAADGTLGGSALTMIEAIEKSVKFVGIELAEAVRMATLYPARAMS
FT                   IANKIGSIKSGNIANLAIFSSDYKVTGTVLNGVYKAS"
FT   gene            complement(622256..623056)
FT                   /locus_tag="Ping_0490"
FT   CDS_pept        complement(622256..623056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0490"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="TIGRFAM: glucosamine-6-phosphate isomerase; PFAM:
FT                   glucosamine/galactosamine-6-phosphate isomerase; KEGG:
FT                   ppr:PBPRA1031 putative glucosamine-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02346"
FT                   /db_xref="GOA:A1SS81"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS81"
FT                   /protein_id="ABM02346.1"
FT                   /translation="MRLIPLETTSDVAFWSARYISDAINKYSPTKERPFVLGLPTGGTP
FT                   LETYKRLIALYNKGEVSFENVVTFNMDEYVGLEQEHPQSYYRFMHQNFFSQIDIQIENT
FT                   HLLNGLADDLEAECLRYEKKIKSYGKINLFIGGVGADGHIAFNEPASSLASRTRVKTLA
FT                   SNTRRANSRFFNNDINQVPKLALTIGVGTLLEAAEILILVTGHHKAQALEAAIQGNVNH
FT                   LWTVTALQLHPKTIIACDAASTMELKVKTLKYFSELESDNIGYL"
FT   gene            623506..624963
FT                   /locus_tag="Ping_0491"
FT   CDS_pept        623506..624963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0491"
FT                   /product="PTS system N-acetylglucosamine-specific IIB
FT                   component, Glc family / PTS system
FT                   N-acetylglucosamine-specific IIC component, Glc family"
FT                   /note="TIGRFAM: PTS system, N-acetylglucosamine-specific
FT                   IIBC subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS, EIIB protein;
FT                   phosphotransferase system, EIIC; KEGG: vfi:VF0808 PTS
FT                   system, N-acetylglucosamine-specific IIB component / PTS
FT                   system, N-acetylglucosamine-specific IIC component; TC
FT                   4.A.1.1.2; TC 4.A.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02347"
FT                   /db_xref="GOA:A1SS82"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS82"
FT                   /protein_id="ABM02347.1"
FT                   /translation="MNILGYLQKVGRALMVPVAVLPAAAILMGLGYWIDPNGWGGDSAL
FT                   AAFLIKAGAAVIDNMSMLFAVGVAYGLSKDKDGAAALSGLVGFLVVTTLLSPAAVAQIQ
FT                   GIALADVPFAFNKINNQFVGILVGIFSAELYNKFSNVELHSALAFFSGRRLVPIVVSVV
FT                   MIFVSFVLMFIWPIIFSGLQNFGETISGMGEIGAGIYGFFNRLLIPVGLHHALNSVFWF
FT                   DVAGINDIPNFLGGQSSLDAGTAILGKTGMYQAGFFPIMMFGLPGAALAIYKAAKPENK
FT                   AKTASLMLAAALASFFTGVTEPLEFSFMFAAPILYVIHALLTGFSLYIAASMEWMAGFG
FT                   FSAGLVDMVLSSQNPLAKKWYMLLVQGVAFFAIYYFVFLALIKGLNLKTPGREDDEVNA
FT                   STASASEDSGELAAQYVIALGGRDNLVVIDACITRLRLTLKDRSLICEADLKALGAMGV
FT                   VKIGDDNLQVIIGPQAESIADRIKAVK"
FT   gene            625231..626892
FT                   /locus_tag="Ping_0492"
FT   CDS_pept        625231..626892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0492"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /EC_number="6.1.1.18"
FT                   /note="KEGG: she:Shewmr4_2503 glutaminyl-tRNA synthetase;
FT                   TIGRFAM: glutaminyl-tRNA synthetase; PFAM: glutamyl-tRNA
FT                   synthetase, class Ic"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02348"
FT                   /db_xref="GOA:A1SS83"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS83"
FT                   /protein_id="ABM02348.1"
FT                   /translation="MTQVDTAPSNFIRNIIDSDLQSGKHQVIHTRFPPEPNGYLHIGHA
FT                   KSICLNFGLAEDYPNALCNLRFDDTNPVKEDADYVAAIEKDVRWLGFKWAGDIHYSSDY
FT                   FEQLYDFAIELIKKDKAYVCALDAQQTREYRGSLMTVGKDSPFRNRPISESLDLFARMR
FT                   AGEFAEGSMMLRAKIDMASPNMKMRDPVLYRIRFAHHHQTGDKWCIYPMYDFTHCISDA
FT                   LEGITHSLCTLEFEDHRPLYDWVLANISIACKPRQIEFSRLNLQYTLTSKRKLHTLIEE
FT                   KIISAWDDPRMPTISGMRRRGYPAASIREFCKRIGVTKQENTVELASLEACVRENLEAN
FT                   APRAMAVIDPVKVIISNYDENKTEKLIAAIHPKDESMGTRTVTFSREIFIDRADFREEA
FT                   NKKYKRLVLGKEVRLRNAYVIKADQVIKNDAGEITEIHCSYDPETLGNNPTDGRKVKGV
FT                   IHWVSAVENQAAEFRIYEPLFLVENPAAAENIDEVLNPNALVIKHGFVESGLSDALAEK
FT                   AYQFEREGYFCADNKDSSPERLVFNRTVALRDSWGG"
FT   gene            complement(626982..627220)
FT                   /pseudo
FT                   /locus_tag="Ping_0493"
FT   gene            627570..628697
FT                   /locus_tag="Ping_0494"
FT   CDS_pept        627570..628697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0494"
FT                   /product="type II secretion system protein (twitching
FT                   motility protein)"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: psb:Psyr_2906 pilus
FT                   retraction protein PilT"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02349"
FT                   /db_xref="GOA:A1SS84"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS84"
FT                   /protein_id="ABM02349.1"
FT                   /translation="MEFEEMLNILSSKDGSDLYLSTGAPPSAKFQGTLEPLTDIPFRAG
FT                   EVAEIAASIMDSEQKVAFEQELEMNLAISISKVGRFRVNIFKQRNEVSIVARNIKIEIP
FT                   SLDELGLPEILKSVITAKRGLVLFIGATGSGKSTSLAALIDHRNTNLSGHIITIEDPIE
FT                   FVHQHKKSIVNQREVGVDTRSFHAALKNTLRQAPDVILIGEIRDRETMEHALAFAETGH
FT                   LAISTLHANNANQALDRIINFFPEDRRIQLLSDLGNNLKSFISQRLIPTIDGKRCAAIE
FT                   VMMGSLTIRDMIKRGDFGLLKEVMEKSEGLGMKTFDGALFDLTIAGKISEEEAIKNSDS
FT                   ATNLTLKFKLYHGNTTEEAGQDDKKSGGLTLSMMD"
FT   gene            complement(629300..629376)
FT                   /locus_tag="Ping_R0024"
FT                   /note="tRNA-Asp5"
FT   tRNA            complement(629300..629376)
FT                   /locus_tag="Ping_R0024"
FT                   /product="tRNA-Asp"
FT   gene            complement(629459..629535)
FT                   /locus_tag="Ping_R0025"
FT                   /note="tRNA-Asp4"
FT   tRNA            complement(629459..629535)
FT                   /locus_tag="Ping_R0025"
FT                   /product="tRNA-Asp"
FT   gene            complement(629795..629871)
FT                   /locus_tag="Ping_R0026"
FT                   /note="tRNA-Asp3"
FT   tRNA            complement(629795..629871)
FT                   /locus_tag="Ping_R0026"
FT                   /product="tRNA-Asp"
FT   gene            complement(629980..630056)
FT                   /locus_tag="Ping_R0027"
FT                   /note="tRNA-Asp2"
FT   tRNA            complement(629980..630056)
FT                   /locus_tag="Ping_R0027"
FT                   /product="tRNA-Asp"
FT   gene            complement(630198..630274)
FT                   /locus_tag="Ping_R0028"
FT                   /note="tRNA-Asp1"
FT   tRNA            complement(630198..630274)
FT                   /locus_tag="Ping_R0028"
FT                   /product="tRNA-Asp"
FT   gene            complement(630552..631271)
FT                   /locus_tag="Ping_0495"
FT   CDS_pept        complement(630552..631271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0495"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: vch:VC2233 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease, RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02350"
FT                   /db_xref="GOA:A1SS85"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS85"
FT                   /protein_id="ABM02350.1"
FT                   /translation="MNTEKMIRQVVLDTETTGMNKGGTIYVGHRIIEIGCVEVINRRLT
FT                   GRHFHVYVKPDREIDPEAIAVHGITDEFLHDKPAFSDIADEFIEFIKGAELVIHNAPFD
FT                   VGFMDQEFRFLNKRTKPTAEISTITDTLVMARKMYPGKRASLDALCRELGIDNKHRVLH
FT                   GALLDAEILADVYLLMTGGQKKLNLSSSGQNDTNTGKRVRKTQSPLTIISASEDEQQAH
FT                   EKRLDLIEKSASCLWRE"
FT   gene            631349..631870
FT                   /locus_tag="Ping_0496"
FT   CDS_pept        631349..631870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0496"
FT                   /product="RNase HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="PFAM: ribonuclease H; KEGG: stm:STM0263 RNase HI,
FT                   degrades RNA of DNA-RNA hybrids"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02351"
FT                   /db_xref="GOA:A1SS86"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS86"
FT                   /protein_id="ABM02351.1"
FT                   /translation="MQVLHNEVGGFIIINQFGIRMKKIQLFTDGSCLGNPGPGGYGAVM
FT                   IYNEHCKELSEGFLLTTNNRMEMLACIKALQSLTEPCEVELTTDSQYVRQGITLWIHNW
FT                   KKRGWKTAAKAPVKNVDLWKALDAAQEKHKVAWHWVKGHSGHPENERCDDLARRAAENN
FT                   PTQEDIGYEG"
FT   gene            complement(631839..632579)
FT                   /locus_tag="Ping_0497"
FT   CDS_pept        complement(631839..632579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0497"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: pha:PSHAa1965
FT                   S-adenosyl-L-methionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02352"
FT                   /db_xref="GOA:A1SS87"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS87"
FT                   /protein_id="ABM02352.1"
FT                   /translation="MRSAKTSRILPPLRSWQQLPNGELLHQQTQQRVDDCLEQCFGYNL
FT                   LKLGQLSCQINTSNSIITHQINCASSGDNLSLQADINQLPLQDSTIDLCILTHELDFSS
FT                   DPHQLLREIDRVLALDGTLIISGYNPISLLGLRTALNPKNPKNARLFLPNRVIDWLHLL
FT                   GFKIQQKQHFDFLSRNLNSTCSLFIEDFGQNYLPYFCSVYFIIAKKSTIPMTPVKYPFQ
FT                   FKGKMITGQAAATRTSPRNQYPLG"
FT   gene            632621..633391
FT                   /locus_tag="Ping_0498"
FT   CDS_pept        632621..633391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0498"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   neu:NE0138 metallo-beta-lactamase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02353"
FT                   /db_xref="GOA:A1SS88"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS88"
FT                   /protein_id="ABM02353.1"
FT                   /translation="MENVITIKAFEDNYIWLIKDSQSQHCIIVDPGDAAPVLTILEDQK
FT                   LIVDAILLTHHHYDHIGGVDALLSARDEKISIYSKKKLFDRCRLVNESDTLSFFDGKLS
FT                   LQVMEVPGHTLDHVAFYNDELLFCGDTLFSGGCGRVFEGSFEQMFKAVSRLALLPENTK
FT                   VYCAHEYTQNNLIFAHQIEPKNKALLNYIQQVSKKRQQGQPTIPSTIGLEKEINPFLRC
FT                   QQQTVINKLQSHLGKELNDPLSCFSALRQYKDNF"
FT   gene            633551..635125
FT                   /locus_tag="Ping_0499"
FT   CDS_pept        633551..635125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0499"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Peptidoglycan-binding LysM; Lytic
FT                   transglycosylase, catalytic; MLTD_N domain protein; KEGG:
FT                   pha:PSHAa1967 lytic murein transglycosylase C,
FT                   membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02354"
FT                   /db_xref="GOA:A1SS89"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS89"
FT                   /protein_id="ABM02354.1"
FT                   /translation="MKFFLSVFILFFVTACTSTGELAGPEPSRKNIEELQQEMFSRSAE
FT                   WRTAPFMDEKSLPESYDNLWLKLAEGFEFEVPQNARVAKQRDYFLKHPNHLAEVSKRAE
FT                   PFLYLIIEQIEAKNLPLELALLPVVESTFNPFAYSQSHASGLWQFMPATGVRFGLTQDW
FT                   WYDGRRDVYASTDAALTYMDILHNYLNEDWLHALAAYNSGEGRVERAVRANKKYNKPTD
FT                   YWHLSLPIETQEYVPKLLALVDILRNHKKYGIELPVIANKQVLTYVDTGSQLDLAYAAE
FT                   LAELSPDDLQLLNPAYNRWVTSPNGPHRLLIPTKIAQQFSQKLANTAQNKRTRWSRYTV
FT                   QSGDNLGFIARENYTTINILKQVNNLDSAFIKIGQPLLIPFASEAQKDDFSRQARRFEG
FT                   QQASANKTKKKVIYTVSEADTLWDISRDFNVRVKEIAKWNTINSTEPLQLGQKLTVWKA
FT                   IKSTPNKNDTHRMTYQVRAGDSLHLIASKFNVKLVDLVRWNELNKGEYIQPGQKLELYV
FT                   AVQKSRT"
FT   sig_peptide     633551..633622
FT                   /locus_tag="Ping_0499"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.784 at
FT                   residue 24"
FT   gene            complement(635193..635522)
FT                   /locus_tag="Ping_0500"
FT   CDS_pept        complement(635193..635522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pat:Patl_2143 glycoside hydrolase, family
FT                   13-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02355"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS90"
FT                   /protein_id="ABM02355.1"
FT                   /translation="MPIKKQYLKSKPLLKVTFEIEKEEALGAKSIILLSEHNNWSAIEL
FT                   KKFKNGKFKVTENIPTAGNNSFQFIYIATADEGHEFSILPSDADALVDNGMNNGGKNAL
FT                   LQITQ"
FT   gene            complement(635596..636270)
FT                   /locus_tag="Ping_0501"
FT   CDS_pept        complement(635596..636270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0501"
FT                   /product="DNA mismatch repair protein MutH"
FT                   /note="TIGRFAM: DNA mismatch repair endonuclease mutH;
FT                   PFAM: DNA mismatch repair enzyme MutH; KEGG: vch:VC0668 DNA
FT                   mismatch repair protein MutH"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02356"
FT                   /db_xref="GOA:A1SS91"
FT                   /db_xref="InterPro:IPR004230"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011337"
FT                   /db_xref="InterPro:IPR037057"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS91"
FT                   /protein_id="ABM02356.1"
FT                   /translation="MDFNSPRSTAELLSRCEQIAGHSLEELAEMAGQPMAKDLRSNKGW
FT                   VGQLIEWHLGATAGSKPEQDFKHLGIELKTIPIDQNGKVLETTFVCSAPILNTRQLNWE
FT                   NSNVRNKISKVLWVPVQGERTVPLCDRIVGNSFLWSANQQQTQLLKLDWNEIMEKIALG
FT                   QIESITARNGQVMQLRPKAANGKCLTNAVGEDGQLIKVRPRGFYLKKTFTQSIISQYFN
FT                   IK"
FT   gene            636881..637426
FT                   /locus_tag="Ping_0502"
FT   CDS_pept        636881..637426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0502"
FT                   /product="nucleotide phosphate derivative
FT                   pyrophosphohydrolase, MutT/nudix family protein"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: vpa:VP0520 MutT/nudix
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02357"
FT                   /db_xref="GOA:A1SS92"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS92"
FT                   /protein_id="ABM02357.1"
FT                   /translation="MIDTDGYRPNVGIIICNNNAQVLWAKRFGQHSWQFPQGGIKEGET
FT                   PEQAMYRELYEEVGLKPEHVKLLATSRHWLRYKLPKRLVRWDSPDPVCIGQKQRWFLLQ
FT                   LISDEQQIEFEACGNPEFDAWRWVTYWYPVRQVVSFKCEVYRCALKEFSAVAFSLMKKS
FT                   SDKKRNKRPRRASFYKKR"
FT   gene            637456..639738
FT                   /locus_tag="Ping_0503"
FT   CDS_pept        637456..639738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0503"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme; GAF domain
FT                   protein; PEP-utilising enzyme, mobile region; PEP-utilising
FT                   enzyme domain protein; KEGG: vpa:VP0521
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02358"
FT                   /db_xref="GOA:A1SS93"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS93"
FT                   /protein_id="ABM02358.1"
FT                   /translation="MLSQLRNIVEQVGNAKNLTEAMDILVRQTKLAMEVDCCSIYITDQ
FT                   STSQLNLIASEGLASQVVGFSYLKFGEGIIGLIHQKGEPLNIANITEHPNYKYLPSSGE
FT                   ESFNSLLGTPIIHRRKALGVLVVQQKEPRLFSELEESFLLTLAMHLASVLDQPFSLDVE
FT                   RLNQPRASIYLQGSPASPGIAIADAYVVRSIMTLAEVIIGKSHSVVKELLLFEIIVKKC
FT                   IDEFSNLALTLKEQVSKDAFILFDIYSHILKDKTFLNAIRSQINESHLNAPSAVKVVAE
FT                   SYIKQFEAMSDPYLSQRSSDIRDVAQRLLYHLTHQVEDDLKLPDKLILVANEVTLSMVA
FT                   SIPNDKLQGIVSVHGGIGSHVAILARTLGIPAVMGVQFSLDNINQKSLIIDGYEGGVIL
FT                   LPEQSLVSHYQSVLDEENELKKLVESDPHEKAVTLDGHAISILLNTGLNAKQHGTILGH
FT                   FDGIGLYRSELPFILTDSFPTEQEQVQVYQRLLDQYPKLPVTMRTLDIGGDKSLSYFPI
FT                   VEDNPFLGWRGIRLTLDHPEIFLVQIRAMLRASVKHQNLRIMLPMVTSIEEVDEAHKLI
FT                   TQAWNEIKFELNYSSEAFPMPAIGAMVEVPAAVFLIPALAKKVDFVSVGSNDLIQYLLA
FT                   VDRNNSRVASLYDSYHPAVLQALKMIIDNSKRFDLEVSICGELASDPIGALILIGLGYT
FT                   KLSMNSYNMGRIKYLINALPRYELESCVEQALKANKGTDIRAIFVDYLNIKELGGFIRA
FT                   GNSKKNN"
FT   gene            complement(639893..641170)
FT                   /locus_tag="Ping_0504"
FT   CDS_pept        complement(639893..641170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0504"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   ppr:PBPRB1848 putative sodium/dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02359"
FT                   /db_xref="GOA:A1SS94"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS94"
FT                   /protein_id="ABM02359.1"
FT                   /translation="MTPTPTLIQRFLNGSLVLQIVIGIVAGLILASFSPTSALSVSFLG
FT                   SLFVSALKAVAPILVFVLVASSIANQQKETRTNLKPIIKLYLLGTLFAASTAVMVSYFF
FT                   PTTLVLVATDIQATPPNGILEVLNTLLFKIVDNPVNALVSGNFIGILAWAAGLGFALQR
FT                   ANQSTKQALHDISNAVTRIVHLVIRFAPLGIFGLVAGTIAETGFDALFGYTHLLAVLLG
FT                   CMILIALVINPIIVYGKTKKNPYPLIFRCLRESGVTAFFTRSSAANIPVNMALCEKLEL
FT                   HKDTYSVSIPLGATINMAGASITITVLTLAAVHTLGIEFDIATAILLSVVAAVSACGAS
FT                   GVAGGSLLLIPLACGLFGVPNEVAMQVVAIGFIIGVVQDSAETALNSSTDVIFTAAACY
FT                   AAEELPAADTIETLETLETLETTAKA"
FT   sig_peptide     complement(641048..641170)
FT                   /locus_tag="Ping_0504"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.916) with cleavage site probability 0.682 at
FT                   residue 41"
FT   gene            641466..642329
FT                   /locus_tag="Ping_0505"
FT   CDS_pept        641466..642329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0505"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: vpa:VP0523 prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02360"
FT                   /db_xref="GOA:A1SS95"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS95"
FT                   /protein_id="ABM02360.1"
FT                   /translation="MSVSNFVLPKIDPVAVSIGPVDIHWYGLMYLLGFTFALWMANRQC
FT                   DKSNGIWTREQASDLLFYGFMGVILGGRIGYVLFYQFPLFLDSPLYLFKIWEGGMSFHG
FT                   GVLGVTTAIIFYAKKNKRSILSVGDFIVPLLPVGLGAGRIGNFINSELWGRVTDSPFGI
FT                   IFQNAGPLPRHPSQLYEFALEGVVLFIILILYIRKARPAGSVAGLFLLAYGVFRFIVEF
FT                   AREPDAHLGLLSLGLSMGQLLSLPMIFAGMAFIAYAYRAKAQAPSQADNVKPPKAKTNK
FT                   AKKKHG"
FT   gene            642363..643214
FT                   /locus_tag="Ping_0506"
FT   CDS_pept        642363..643214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0506"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="PFAM: thymidylate synthase; KEGG: cps:CPS_3621
FT                   thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02361"
FT                   /db_xref="GOA:A1SS96"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SS96"
FT                   /protein_id="ABM02361.1"
FT                   /translation="MKQYLGLCQRIVDKGIWIENQRTGKRCLTVINADLEYDVGNNQFP
FT                   MITTRKSFYKSAIAELIGYLRGYDNAADFRKLGTKTWDANSNLNNAWLNNPYRKGEDDM
FT                   GRVYGIQGRSWAKPDGGFIDQLKKVVDDLSNGIDDRGEIVTFYNPGEFEMGCLRPCMHT
FT                   HTFSLLGDTLHLTSYQRSCDVPLGLNFNQVQVFALLALMAQITGKKAGMAYHKIVNAHI
FT                   YEDQLALMRDVQLPRLPFASPQLKINPKIKSLQDLETWVTMDDFEVEGYQCHDAIKYPF
FT                   SV"
FT   gene            complement(643291..644649)
FT                   /locus_tag="Ping_0507"
FT   CDS_pept        complement(643291..644649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0507"
FT                   /product="NADPH-glutathione reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: pat:Patl_4206
FT                   glutathione-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02362"
FT                   /db_xref="GOA:A1SS97"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS97"
FT                   /protein_id="ABM02362.1"
FT                   /translation="MNNNKFDFDYICIGGGSGGIASANRASKYGQKVAIIEAKALGGTC
FT                   VNVGCVPKKAMWYAGQIADALRYAPDYGFDAPLKNFSWAKLIESREAYIARIHQSYERV
FT                   LGNNNITVIDGFAKFIDNHTVEVNGKTYTAPHITVATGGAPTVPAIEGAEHGITSDGFF
FT                   ALNEQPKRVAVVGAGYIAVEIAGVFNALGSETHLLCRRHTFLRDFDHMLSSTLVEVMQE
FT                   EGPTLHTHSTPKSVHKNEDGSLTLHLENEKSLTVDCLVWAIGRNPANTDIGLENTDIEL
FT                   NKHKFINVDKYQNTTAQGIYAVGDNTGEIQLTPVAIKAGRFLSERLFNGQLDAHLDAKL
FT                   VPTVVFSHPPIGTIGLTELEAEEKYGKSKLKVYTSQFTSMYTAMTTMRQPTRMKLVCAG
FT                   ENQKVVGLHCIGLASDEILQGFAVAMKMGATKADFDSCVAIHPTSAEEFVTMT"
FT   gene            complement(644676..645800)
FT                   /locus_tag="Ping_0508"
FT   CDS_pept        complement(644676..645800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0508"
FT                   /product="phosphoserine aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.52"
FT                   /note="KEGG: sde:Sde_1332 phosphoserine transaminase;
FT                   TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02363"
FT                   /db_xref="GOA:A1SS98"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS98"
FT                   /protein_id="ABM02363.1"
FT                   /translation="MSTPQPSIKPAVPNFSSGPCAKRPGYDVSQLDLCALGRSHRSSLG
FT                   KKALEKVISDTAEILQLPKGYRVGIVPASDTGAMEMILWSMLGPRPVDVCYWESFGEGW
FT                   YADIIKQLKLDKVNKISADYGQLPDLSKVNPENDIVFTWNGTTSGVKVENGDFIKDDRQ
FT                   GLTICDATSAVFAMPLPWEKLDVTTFSWQKVLGGEGAHGIIILSPRAVERLESYTPSWP
FT                   LPKIFRLTAGGKLIEGIFNGATINTPSMLCIADYQDALNWVKEMGGVQASIQKSLDNLA
FT                   VLETFVANNSWINFLAEKANTRSNTSVCLSLDLSDSQIKALVNLLAEEQVAYDIAAYKD
FT                   APSGLRIWCGSTVEKHDLQALLPWLTWAYQEVTV"
FT   gene            646011..646086
FT                   /locus_tag="Ping_R0029"
FT                   /note="tRNA-Trp1"
FT   tRNA            646011..646086
FT                   /locus_tag="Ping_R0029"
FT                   /product="tRNA-Trp"
FT   gene            complement(646514..648457)
FT                   /locus_tag="Ping_0509"
FT   CDS_pept        complement(646514..648457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0509"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_3395 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02364"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1SS99"
FT                   /protein_id="ABM02364.1"
FT                   /translation="MIVVFLKLRTSCNIAFKNITTLVSATVKIKERFNILNLDANEKLL
FT                   FQSEEKEKLAAELIIAEEEKEKLAAELVIAKEEKEKLAAELVIALEFRIAATAFESQEG
FT                   MFITDANNRILRVNKAYIRISGYSAEEVIGQKPKLFSSGRQEKVFYKAMWDSINSTDAW
FT                   EGEIWNSRKNGDIYPGHMTITAVKDTNGMVSNYVAMIIDITLDKAASEEINNLAYFDPL
FT                   TKLPNRRLLLDELNLALTINARTHQYGALLFIDLDHLKTLNNTRGHDVGNLLLKQVTTR
FT                   LTESVREGDTIARLGCNEFVVVLENLSPQAIKATAQTKQMAKKILFTLTQPYSLNAIKY
FT                   HCTLSIGATIFNGHELGSEELLKQADIAMYQSKDAGRNSLCFFNQTMLEAITIRAEMEN
FT                   ELHKAIKQNQFQLYYQIQVNGSGQALGAEALIRWQHPERGQISPFNFIPLAEETGLILP
FT                   IGQWVLDTACAQLKKWQQNPLTQDLVLAVNVSAKQFHQEDFIEQVKTTLQRHQIIPDRL
FT                   KLELTESMLVENISDIIIKMNTLRKIGILFSLDDFGTGYSSLQYLKRLPINQLKIDQSF
FT                   VRDLITDAHDRIIVRTIIAMSHSLGIDVIAEGVETVEEKQFLLNKGCTHYQGYLFSKPV
FT                   PIDEFEALLKSG"
FT   gene            complement(648790..649251)
FT                   /locus_tag="Ping_0510"
FT   CDS_pept        complement(648790..649251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02365"
FT                   /db_xref="GOA:A1SSA0"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA0"
FT                   /protein_id="ABM02365.1"
FT                   /translation="MRTFIVGIFILVWSLQVNATLIDITKTFDVKNDTGHFATDFHVEI
FT                   IFDKSSAFSGPLLGELSATNTPDWDYSWGFQGTAGNSKDARLRVDFVGDIKDHVPIDGT
FT                   ATFKFTFKADPTDIKSITHYWTVPEPNISILLGFGLLGIRLFSRRRKQH"
FT   sig_peptide     complement(649192..649251)
FT                   /locus_tag="Ping_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.947) with cleavage site probability 0.946 at
FT                   residue 20"
FT   gene            complement(649350..649742)
FT                   /locus_tag="Ping_0511"
FT   CDS_pept        complement(649350..649742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0511"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02366"
FT                   /db_xref="GOA:A1SSA1"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA1"
FT                   /protein_id="ABM02366.1"
FT                   /translation="MKKLLLFFAAGCLGALGNSITVWQFGQLGITSTWGVSIDPSFSPA
FT                   WLYPRIVWGGLWGFLFILPILQSRLLLKGTILSLFPTAVMLFIVFPYQANKGIAGIELG
FT                   LMTPVFVIFFNWVWGIITAITIKYAK"
FT   sig_peptide     complement(649689..649742)
FT                   /locus_tag="Ping_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.595 at
FT                   residue 18"
FT   gene            650250..652370
FT                   /locus_tag="Ping_0512"
FT   CDS_pept        650250..652370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0512"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; SMART: Integrin
FT                   alpha beta-propellor repeat protein; KEGG: sat:SYN_00845
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02367"
FT                   /db_xref="InterPro:IPR013517"
FT                   /db_xref="InterPro:IPR013519"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA2"
FT                   /protein_id="ABM02367.1"
FT                   /translation="MFHLYLSGLRLVAITFLSLIASASWAALTPVEVAKILASDGAAYD
FT                   YFGYSVALSGDTAVIGAGVSYTVPASGPGAAYVYTRNGTSWSEQAKLTASDGSTADNFG
FT                   YSVAIDGDTIVVGARFADGVVTDAGAVYVYTRSGTVWSEQAKITASDGQFRDFFGNSLA
FT                   IYGDNLAIGAYGDDNPDADAGSVYIYTRSGTTWNEQAKLRDSDGLTNDRFGWAVDLFDD
FT                   TALIGTVYDDDNGTRSGSAFVFTRSGTTWSEQAKLQPDDSKSYHFFGVSVALSADTALI
FT                   GTNGDADKGLEAGAAYVFVRSGALWSQQAKLIGSDVETDDESGWSVALSGDTALVSAIR
FT                   DDDNGTDSGAVYIFARNGTIWSEQAKIKPGDGAYRDFFSFSMGLSGDTALIAANLEDDN
FT                   GADAGAAYIFTGVTGNTAPVAEAGLNQSIHVGQNVALDGSGSTDDKTASEDLLYDWTFD
FT                   AKPPGSPVVLTNADTVTPSFIVDLPGDYLISLVVTDQGALSSLPDIVTVSSLNTPPVAN
FT                   AGFDRGSYVGETVVLDGSASFDSDSDALTFLWTLTAPTGSSATLSDNAGVTPELIPDLA
FT                   GAYTAELVVSDGYADSTPDEVNIAVITTEQYVQQQAMESLNIITVLSLSSVTTSGNQTA
FT                   MENFLLQAIDSLQKSKVDQTRQKLEKAIARTDGCALRGSPDTAGGATKDYISNCVDQNK
FT                   IYPLLVSALAQL"
FT   sig_peptide     650250..650330
FT                   /locus_tag="Ping_0512"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.989 at
FT                   residue 27"
FT   gene            653336..654337
FT                   /locus_tag="Ping_0513"
FT   CDS_pept        653336..654337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0513"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mxa:MXAN_5094
FT                   luciferase-like monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02368"
FT                   /db_xref="GOA:A1SSA3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA3"
FT                   /protein_id="ABM02368.1"
FT                   /translation="MNFKNIPFSILELATVSSHSTPEETFKKSLDLAQKAEEFGYKRFW
FT                   LAEHHNMISIASSATAVLIGYIAGGTNKIRVGSGGIMLPNHSPLIVSEQFGTLGSIYPN
FT                   RIDLGLGRAPGTDQITAHAIRSDRMQAVHKFPEEIGEIQQYFSPKNSGAQVRTSIAEGI
FT                   NVPLYILGSSTDSAHLAAKKGLPYVFASHFAPAQLFEALNIYNNNFKPSELLQEPYTIA
FT                   CINVIAADSDQEAEKMSTSMIRMMFGVLTGNIDYLQKPTNMTDELRELSENPTFQRMLK
FT                   YSFVGSKETLKQNTTDFLQKTGVNELMVASHIFDHEDRVKSYRIFSEVMKEF"
FT   gene            complement(654765..655757)
FT                   /locus_tag="Ping_0514"
FT   CDS_pept        complement(654765..655757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0514"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: dde:Dde_1891
FT                   conserved hypothetical integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02369"
FT                   /db_xref="GOA:A1SSA4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA4"
FT                   /protein_id="ABM02369.1"
FT                   /translation="MFGFTLILNLIASLMHGYLTWRIASLNCFKPVHLRRRLWLLSLTL
FT                   WLLYLVGIHAGDDVSGSLLSLLNQLALNWLGALFLATTIQLMLELLSGFGFWAKPYLNQ
FT                   LRSSALLLSLLLIVVALVQGMRAPIVSRHEVTLTALPVSLDGTRIVVLSDLHLGSQLGA
FT                   QWLNARVAQVEGLKPDLIVLLGDIFEGHGRIDSGLQAVFARLKAPMGVYAVTGNHEFHG
FT                   DSTAAIAISEKASVVWLRNCWQEVAPGLLLAGVDNLSRQQLNNNNGDRVLSLLDGNYKG
FT                   AIVLLSHSPLQVKKAKNRGVGLMLSGHTHGGQIWPFGLLVKQYYPYFDG"
FT   gene            656041..657354
FT                   /locus_tag="Ping_0515"
FT   CDS_pept        656041..657354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0515"
FT                   /product="putative heat shock protein 70 family protein"
FT                   /note="KEGG: pat:Patl_2983 putative heat shock protein 70
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02370"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA5"
FT                   /protein_id="ABM02370.1"
FT                   /translation="MTADFIGIDFGTSNCAVAAWLNNKPTLIVVDKESENPFKIRSAIY
FT                   LTHNESGAASNNAKTNEQTLNEMLNSGEILFGEQGFKTFLLTPDEGRYVNSPKNFLGAK
FT                   IPKRLLDNFELLVVRFLSYLKQCAEKQLNITINKAVIARPVNYHSTMGELGNQQAEALM
FT                   LRAATKAGFTQVDFIHEPLAAAYHFEQQIKKPTKAMVVDLGGGTSDVTFCLLSKEKADK
FT                   LERDADIYATKGIRQGGIVSDKYLASSIVSPLFGRGGRTAGGRSIPNMLYFGVYAIDNI
FT                   PEMSDFYSPARAKSITEYISDSKDPAPLMRLQQVQKQRLTHQLMHAIELAKIDLSDQQQ
FT                   TDLPLAFIDKSLDVTIKRDQVAQTMTKWLEKMFVMIDSAVDEAKQQPEIIYLTGGMGLS
FT                   PLVQQAIKARYPEVNITVADAFSSVVLGALLKAKRLFS"
FT   gene            complement(657430..660372)
FT                   /locus_tag="Ping_0516"
FT   CDS_pept        complement(657430..660372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0516"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: rfr:Rfer_0458 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02371"
FT                   /db_xref="GOA:A1SSA6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA6"
FT                   /protein_id="ABM02371.1"
FT                   /translation="MFSRILSSLCKYFTYIHSSHSPSLGKAIFFTGLMAAGLVTAILVQ
FT                   PLIEIGGWQNYLPLHTALETISIIIAALIFAVGWTGRKRKLPGNIVLLASVFLGVGILD
FT                   FSHILSYPGMPDYVTPSNPNKTIGFWLAARILSTIGLLLFVILPIRLSSFRFFRYLILS
FT                   IILAATGIVHWLILMNPDFLSHLFFTPQAGLSALKINTEYIIIGLTLITVLLLLQQMHR
FT                   PQTYHASSLLTGLCIIAMSEFFFTLYADLTDIYNISGHLYKVIAYLFIYRAIFITVIER
FT                   PYHNLELAKTQLREKKRLLDDIIENIPTAIFLKDVNNLRLSLINKSTEKLFGHSRETIL
FT                   GQSDYDFFPKEQADFFTNKDRETIERRTLLEIPEEIIDTPFGSRTLYTKKIIITDEHNN
FT                   PKFLLGISEDITERNAAKKALEESEHSLRESQRIARLGSYLFDLRSNQWSGSEILDNLL
FT                   GIDADYQRTMEGWAQLIHPDDRSRIDHYFKEDVLNQKKSFNQEYRMKRQNDQAVRWVHG
FT                   LGELEFDNQGSPILMKGTIQDITERKLAEAHLQALANFDQLTGLPNRFMLKDKITYLFT
FT                   LARRNNESLTMMFLDLDHFKNVNDTLGHVIGDRLLIEIAKRLKSAIREVDLVSRIGSDE
FT                   FILLFPNTDADSALNIATKLIETVSLPTVFEHHELFITATIGIAIYPNDGEEFETLIKN
FT                   ADTAMSQAKRYSRNTFHFFTEEMQVHLQRKLKIVNAMRHALLRNEMQVHYQPQISAVKG
FT                   HIIGAEALLRWRHPELGDISPGEFIPIAESSGQIVAIGEWVLRTAIDQMKVWQNEGLAP
FT                   MVVAVNLSALQFKQANLIGMIISMLNKAQLAHQYLELELTEAITMDDPQQAINIMNQLH
FT                   AKGIRMSIDDFGTGYSSLSYLKQFKVYKLKIDQSFICNLARDSDDRAMVHAIIDMAKNL
FT                   GMQTIAEGVETAEQLEFLRLHGCNEIQGYYFSKAIPADEFSRFAKQGPHH"
FT   gene            660830..661090
FT                   /locus_tag="Ping_0517"
FT   CDS_pept        660830..661090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0517"
FT                   /product="conserved hypothetical alkylhydroperoxidase AhpD
FT                   domain protein"
FT                   /note="KEGG: ppr:PBPRB1658 hypothetical
FT                   alkylhydroperoxidase AhpD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02372"
FT                   /db_xref="GOA:A1SSA7"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA7"
FT                   /protein_id="ABM02372.1"
FT                   /translation="MAVNVKNNDGYYVPDHRRMIKSAKSRIMLLQHRVKEKILQVWYDF
FT                   SRALLAERGHIGNEKRTDFINAAYKKDQVLEVLTGLAAKLI"
FT   gene            661190..661792
FT                   /locus_tag="Ping_0518"
FT   CDS_pept        661190..661792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0518"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number="3.5.4.25"
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: vpa:VP1921 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02373"
FT                   /db_xref="GOA:A1SSA8"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSA8"
FT                   /protein_id="ABM02373.1"
FT                   /translation="MTKVRTKISLKIGANSRIPAQIASFNGLTSDKEHIAIIFGKADEC
FT                   SSSPIVRIHSECLTGDVFHSSRCDCGEQLDEAIELMEKEGGIIIYLRQEGRGIGLYNKI
FT                   DAYKLQSEGMDTYQANNQLGFEDDLRDFTEAGQMLAALNIRKLQLLTNNPLKVKALREY
FT                   GITVDKVISTSTFIKDDNESYLRTKAKNAGHAIRFPF"
FT   gene            complement(661934..662285)
FT                   /pseudo
FT                   /locus_tag="Ping_0519"
FT   gene            662484..663221
FT                   /locus_tag="Ping_0520"
FT   CDS_pept        662484..663221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0520"
FT                   /product="Pirin domain-containing protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   bca:BCE5184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02374"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSA9"
FT                   /protein_id="ABM02374.1"
FT                   /translation="MKASHQKISASELYYLPSSSMHPANTRFHFSFANYYNPTRMNFGA
FT                   LRVLNDDDVTPHSGFGRHPHRDMEIVSYIVKGQLTHWDSVTNVEETIGRGHVQAISAGS
FT                   GISHSELNKQNDWCRFLQIWIMPSKKGGPVRYHHQQFELQERENKLLHIVGNPKNKNTS
FT                   PLYLNSDVNLYVSELTDSRAIVEFELQPGRQAYINCIEGSINIEGYPLLNERDSLELSA
FT                   AGKINFSLQGSHAHFIIIEMESH"
FT   gene            663442..664425
FT                   /locus_tag="Ping_0521"
FT   CDS_pept        663442..664425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0521"
FT                   /product="putative glutathione S-transferase"
FT                   /note="KEGG: cps:CPS_1775 putative glutathione
FT                   S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02375"
FT                   /db_xref="GOA:A1SSB0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB0"
FT                   /protein_id="ABM02375.1"
FT                   /translation="MKSVKSSWNSSINEGEYRRKDSQFRNWITPDGSAGITGLSGFQAE
FT                   AGRYHLYVSLACPWAHRALIFRKLKGLEEMITVSVVHPEMFEKGWSFKHDKGSQELYGT
FT                   TGDDLYGGEYLSEKYFAQVPDYTGVISVPVLWDKQQKVIVNNESSEIIRIFNSAFNGIT
FT                   GNELDFYPEYLQDQIDQVNELVYHNINNGVYKTGFATSQQAYDNNAKDLFSALQQLDNK
FT                   LATQRYLTGNELTEADWRLWPTLVRFDSVYHTHFKCNLNLIKEFTHLYNYMLELYQIPG
FT                   IAETVNMAHIKRHYYASHLAINPYGIVPLGHQQDWSAAHNRDRLFN"
FT   gene            664871..666331
FT                   /locus_tag="Ping_0522"
FT   CDS_pept        664871..666331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0522"
FT                   /product="PTS system trehalose-specific IIB component, Glc
FT                   family / PTS system trehalose-specific IIC component, Glc
FT                   family"
FT                   /note="TIGRFAM: PTS system, trehalose-specific IIBC
FT                   subunit; PTS system, glucose-like IIB subunint; PFAM:
FT                   phosphotransferase system PTS, EIIB protein;
FT                   phosphotransferase system, EIIC; KEGG: ppr:PBPRA1224
FT                   putative PTS system, trehalose-specific IIBCcomponent; TC
FT                   4.A.1.2.4; TC 4.A.1.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02376"
FT                   /db_xref="GOA:A1SSB1"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011296"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB1"
FT                   /protein_id="ABM02376.1"
FT                   /translation="MSKIDQKQVERLVELIGGKGNIASVSHCLTRLRFALGDPELANIK
FT                   EIEKIPMVKGAFTTAGQFQIVIGTEVDDVYKILTKITGGGGADKEATKAAARQNMNFLE
FT                   RGISHMAEIFVPLLPAIITGGLILGFRNVIGDIPMFDGKTLVETSQFWTGVHSFLWLLG
FT                   EAIFHFLPVGVCWATVKKLGGTPILGIVLGITLVSPQLMNAYGIGSGTPDVWDFGFFVM
FT                   EKVGYQAQVIPAILAGLALAIIETNLKRIIPAYLYLVIVPFVSLLVAVVLAHSIIGPIG
FT                   REIGNAVGYAAKVAMTGDFAVLGSMIFGFFYAPLVITGIHHTTNAVDLQLMQDIGGTPI
FT                   WPLIALSNIAQASAVVGIIWISKKHNEREISIPAAISAFLGVTEPAMYGINLKYKFPML
FT                   CAMIGSAVAAGICGIAGVMANGIGVGGLPGILSIQPQYWGVYALAMLTAIVVPIALTLI
FT                   LYKRAEKKGNLDQDELIEDEAEPALATH"
FT   gene            666467..668149
FT                   /locus_tag="Ping_0523"
FT   CDS_pept        666467..668149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0523"
FT                   /product="trehalose-6-phosphate hydrolase"
FT                   /note="KEGG: ppr:PBPRA1225 putative trehalose-6-phosphate
FT                   hydrolase; TIGRFAM: alpha,alpha-phosphotrehalase; PFAM:
FT                   alpha amylase, catalytic region; SMART: alpha amylase,
FT                   catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02377"
FT                   /db_xref="GOA:A1SSB2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012769"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB2"
FT                   /protein_id="ABM02377.1"
FT                   /translation="MNKIEREWWRTATVYQIYPKSFCDSGSKGTGDLKGIISKLDYLKT
FT                   LGIDAIWLTPIYASPMIDNGYDISDYYTINPDFGCMEDFEQLLDSAHQKGIRIILDIVV
FT                   NHTSTEHQWFQSALGNKDSEYRDYYIWKDPVNGQAPNNWVSKFGGNAWQLDEKTQQYYL
FT                   HLFAPEQADLNWENPKVRDQVKNIIEFWAEKGVDGFRLDVINLISKQQDYANDYQGDGR
FT                   RFYTDGPRVHQYLRELSDAVFNQYGAVTVGEMSSTSLDECQQYSALDGKELSMVFNFHH
FT                   LKVDYINGEKWTQAPFDFIELKTIFNHWQQGMFGKGWSALFWCNHDQPRIVSRLGNDQE
FT                   YRVESAKMLATSLHMMQGTPYIYQGEEIAMTNPGYTSIEQYRDLESLNMYDIMLNHQGK
FT                   SEQQVLAILAQKSRDNSRTPIQWNSDQNAGFTKGVPWLDVAKNYKQINVERALKDQNSV
FT                   FYYYQHLIALRKEVEVITTGDYTDLAAEHAQLFCYQRRSDKQTLICINNYYGKPLEYEL
FT                   PAHLELHNGQYIIGNYPELLTLQPTRTVKLKPYESRVLLINHH"
FT   gene            complement(668382..669377)
FT                   /locus_tag="Ping_0524"
FT   CDS_pept        complement(668382..669377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0524"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.30"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: vch:VC0434
FT                   octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02378"
FT                   /db_xref="GOA:A1SSB3"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB3"
FT                   /protein_id="ABM02378.1"
FT                   /translation="MAIWTFRTMDIKTIQRISATEMNQVNKLITEQLSSDVALINQLGF
FT                   YIINSGGKRIRPLITVLAAKALGIHDQNTTKLAAIIEFIHTATLLHDDVVDDSDLRRGK
FT                   KTANAVFGSAASVLVGDFLYTRSFQMMTQLRNLKVMDILSSATNIIAEGEVLQLMNCND
FT                   PDTTEKKYMDIIYFKTAKLFEAATQLVAVLGEQSEEIETALLNYGKYLGTAFQLTDDVM
FT                   DYNSDASEMGKNTGDDLAEGKPTLPLLYAIQHGNKKQATLIKEAIKKGNGMDHFDEIMQ
FT                   ALHDTNALEYAKKRALEEADKAIKALVIIPDSEYKQALISLAHIAADRKS"
FT   gene            669823..670134
FT                   /locus_tag="Ping_0525"
FT   CDS_pept        669823..670134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0525"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="PFAM: ribosomal protein L21; KEGG: vvy:VV0470
FT                   ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02379"
FT                   /db_xref="GOA:A1SSB4"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSB4"
FT                   /protein_id="ABM02379.1"
FT                   /translation="MYAVIQSGGKQHRVAVEQTLRLEKLDVEAGETIEFDKVLLVANAE
FT                   DVKVGIPYVEGSKVTAEVVAHGRGNKIKIVKFRRRKHSRTTAGHRQWFTEVKITAINA"
FT   gene            670151..670408
FT                   /locus_tag="Ping_0526"
FT   CDS_pept        670151..670408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0526"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="PFAM: ribosomal protein L27; KEGG: ppr:PBPRA0395
FT                   putative Ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02380"
FT                   /db_xref="GOA:A1SSB5"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSB5"
FT                   /protein_id="ABM02380.1"
FT                   /translation="MAHKKAGGSTNNGRDSESKRLGVKRFGGESVLAGNILVRQRGTKF
FT                   HAGINVGIGKDHTLFAKATGVVKFEKKGPKMRSFITIVAE"
FT   gene            670826..671986
FT                   /locus_tag="Ping_0527"
FT   CDS_pept        670826..671986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0527"
FT                   /product="GTP1/OBG sub domain protein"
FT                   /note="PFAM: GTP-binding protein, HSR1-related; GTP1/OBG
FT                   sub domain protein; KEGG: ilo:IL0477 GTPase Obg"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02381"
FT                   /db_xref="GOA:A1SSB6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSB6"
FT                   /protein_id="ABM02381.1"
FT                   /translation="MKFVDEAKIKVDAGDGGNGCIGFRTEKYIPRGGPNGGDGGDGGDV
FT                   YLQADENLNTLVDFRFVRFYDAERGENGQTRDCTGSRGKDKIIQVPVGTRCRDADTGEV
FT                   LGDLTRDGQQLMVAKGGFHGLGNARFKSSTNRAPRQKTDGTPGEVRNLLLELLLLADVG
FT                   MLGLPNAGKSTFIRSVSAAKPKVADYPFTTLVPNLGVVSMGYGRSFVIADIPGLIEGAS
FT                   DGAGLGARFLRHLERCRVLLHTIDLLPADGSDPAENALVIIAELKKHSPKLASKPRWLV
FT                   FNKTDLLLEDEAELVIERVKEALEWDGPVYKVAAISKTGTDTLCRDVVEYLEELPAEFT
FT                   PEEERQQVEFQWDDYHKTAIEELDDDSDDDDWSEDDEMMEVIYTKE"
FT   gene            complement(672080..674860)
FT                   /locus_tag="Ping_0528"
FT   CDS_pept        complement(672080..674860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0528"
FT                   /product="Hpt sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; Hpt domain protein; KEGG:
FT                   vch:VC2453 sensor histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02382"
FT                   /db_xref="GOA:A1SSB7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR019247"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB7"
FT                   /protein_id="ABM02382.1"
FT                   /translation="MTKYGLRAQVIAFTILPTILIGGILASYFSFHRYYQANDFLIDRA
FT                   INISEPLAIASEYGIQDQTRTILRRLIGSTHRKNSPMIKSIAIFDTNNQLFVTSNYHRN
FT                   FDILRLKDDQKIPLLTEVTHEQDSIIIRSPIVDESRFLEYQSTFEQTPKIMGYVALEVN
FT                   TDEIVLLLYRDTALSFGVVLLGILGSLLLAFAQAKRITGPICAMVSVVEKISLGRLNSR
FT                   VEGNYSGEIASLQLGINEMAVAMSKHHEEMQDSIDLATSELRETLDQMEVQNIELDITK
FT                   KKAQQAALVKSEFLANMSHELRTPLNGVIGFARQLLKTQLTTNQIDYLQTIERSAGNLL
FT                   KIINDILDFSKLEAGKFTLEHIPFDLRDCIDETMHLLAPSAHEKNLELSLIVDPEVPYE
FT                   VFGDAMRLQQILTNLIGNAIKFTEKGDIKIQIQRIEEQTNRDNKVTLKIMISDSGIGIS
FT                   KKQQAQLFKAFGQADTSITRQYGGTGLGLVITQKLVKEMQGRIELISIPEQGSTFGFTI
FT                   VIEKSARAALSNIALSRLQKQKVLVFETNEYAALACTQLLRQWKTEPLLAKTEQQWQQF
FT                   LNTRYDSIVIGYSHVKNLQPLFKYIKQAKSFSGNVIILVNSSDPGIYDTLMAAGVTHCL
FT                   SKPINHKSFANALISDKTDFNTITYHKALPIFMRKDINVMAVDDNPANLKLISVMLADR
FT                   TNHVTTCINGQQAVEQAKNHHFDLIFMDIQMPVLDGINACLQIKKGKINYKTPVIAVTA
FT                   HVLSGEKEQFLQLGMDDCLAKPIDEIALQKMINKWTPNAKVMDGKSLQPRLAPRVKFTQ
FT                   KNLSIDWPLALQQSAGKEELAKELLGMLLTEFVEIKIEVNKALHCDINTLHFAQIIHKF
FT                   HGGCSYSGVPKLKKVTGLIENELKRGITLELLEPELLELLDELENVAQQAKKHLA"
FT   gene            675332..676666
FT                   /locus_tag="Ping_0529"
FT   CDS_pept        675332..676666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0529"
FT                   /product="23S rRNA m(5)U-1939 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmA family; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM;
FT                   (Uracil-5)-methyltransferase; KEGG: ppr:PBPRA3083 putative
FT                   TrmA family RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02383"
FT                   /db_xref="GOA:A1SSB8"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSB8"
FT                   /protein_id="ABM02383.1"
FT                   /translation="MAQFFKAAPTNSIKNHILKNIKVEKLDHRGRGLAYFQNKPLFIDG
FT                   ALAGELLEVQIVESKKRYSKGKIKKIIKASELRITAACPHYQECGGCDLQHLNQAAQIQ
FT                   IKSDGLLSLFQRFAKKVPQQLEKPIIDKAWEYRRTARFGLQFDKKNKQLKMGLRRAQSN
FT                   ELIDQKVCPVLLPELECLIPPLKILLNSLQCKAHLGHVELLYADQGAVVLLRHMKTLTS
FT                   PDLQLITAFSALQKVNFFGQASSNQSVCLAGEANLSYRLPEWDCSLSFTPTDFLQVNSD
FT                   INKKMVSQAMQWLALEKNDSVLDLFCGLGNFTLPIARQVESVVGIEGVQQMVDRATANA
FT                   QLNNLQNARFYQADLSGENLIEQEWANQNFNKVLLDPARAGALDCLAFIAQKKPSHILY
FT                   VSCDPLTLARDSQVLLDKGYKLDKLGLLDMFPQTAHMESMALFTG"
FT   gene            676697..678910
FT                   /locus_tag="Ping_0530"
FT   CDS_pept        676697..678910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0530"
FT                   /product="(p)ppGpp synthetase I and guanosine-3',5'-bis
FT                   pyrophosphate 3'-pyrophosphohydrolase"
FT                   /EC_number="2.7.6.5"
FT                   /note="KEGG: sec:SC2896 (p)ppGpp synthetase I (GTP
FT                   pyrophosphokinase); TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: amino acid-binding ACT domain protein; TGS domain
FT                   protein; RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02384"
FT                   /db_xref="GOA:A1SSB9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSB9"
FT                   /protein_id="ABM02384.1"
FT                   /translation="MVSVRDTHFYQTAQKNPKKWVTTLGLSSSDQSKLLDNYEKIIALC
FT                   LNSEQHTLLELGTEMVEILVTLNMDMDTLNAALIFPLLDHQIISQEQVNEWWSKRVAKL
FT                   VKGATDMEGIRALQNQGGSNNNAAQVDNLRNMLLAMVDDVRAVVIKLAERICYLRQIKG
FT                   ADKDKRLLVASEISSIYAPLANRLGIGQLKWELEDLSFRYLEPEIYKKIAKQLDEKRID
FT                   REHYIENFVNTVKDSLQEMNVDGTAYGRPKHIYSIYRKMQKKNLQFEDLYDVRAVRVVV
FT                   EKLQDCYAALGAIHTQWRHIPSEFDDYIANPKANGYQSIHTVVLGPEGKAVEVQIRTRK
FT                   MHEDSELGVAAHWKYKEGSAGGKASSGYEEKIAWLRKILAWQEDIADSEDLVDEVRSQV
FT                   FDDRVYVFTPKGEVIDLPAGATPLDFAYYIHSQVGHRCIGAKVANHIVPFTYHLKTGDQ
FT                   VEILTQKEPNPSRDWLNPNLGYINAPRARNKVSSWFRKQDRDKNVQAGRELLENELAKL
FT                   KLKLSDLPPAITRFNVSCVEDIFAGVGNGDLRINQLLNFLNDYHHQQTLAEQDQAALES
FT                   LAKRSSSFVAKPIGDNITIQGESNLLHSIARCCQPIPGEPIEGYITQGRGISVHRKACE
FT                   QLADLREANPERLVEASWGDANSSGYSLTLRLEALDRSGLLRDVSTLLSNEKVNVLGVN
FT                   SMTNVKTQTAIIDLDLEIHTSDNIAKIQNKIKQLKDVLQVRRL"
FT   gene            complement(679164..680738)
FT                   /locus_tag="Ping_0531"
FT   CDS_pept        complement(679164..680738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0531"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: vfi:VF0755 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02385"
FT                   /db_xref="GOA:A1SSC0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC0"
FT                   /protein_id="ABM02385.1"
FT                   /translation="MIKKIDNLTKHLYGQLFVACILGAVQVFAFAPFEQWWVIYPTFVG
FT                   FFLLQKQLQKSTRRYFLVSFIFSISSLIATLCWIYVSMDLYGGMPKIVSALLIVLLCAY
FT                   LAIYPSLALWASTRLSGVSDTQRYLLLIPVFWLISDWFRGYVLTGFPWAYLGYSHADTP
FT                   LVGFAPVLGVQGITLAVMVICGALTLLIQKQKIGLSLSVISALLISGFILQQQQYTIAQ
FT                   PSINVSLVQGNIDQNEKWKKEQLSPSLQKYSALSETGLDDQTELIIWPESAIAALDVNV
FT                   QAFLQPLSADLAAKNKTLMTGIIGYESKTDSYYNSIVTLGKLPNQQLPQRQGYSLQSEN
FT                   RYQKHHLLPIGEFVPFEKLLRPLAPYFNLPMSSFQRGTQLQNNLQTEQVSIAAAICYEI
FT                   AFPELLRKNIGEKTGVLLTVSNDAWFGNSIGPDQHLQIARMRAIEFARPLLRSTNNGVT
FT                   AIFDASGNELGRLPVNVAAVLSKKIQPTFGQTPYQYAGSYPLYLYCLLVLLGLFLSSKY
FT                   KKHKTKS"
FT   sig_peptide     complement(680649..680738)
FT                   /locus_tag="Ping_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.927) with cleavage site probability 0.912 at
FT                   residue 30"
FT   gene            complement(680746..681606)
FT                   /locus_tag="Ping_0532"
FT   CDS_pept        complement(680746..681606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0532"
FT                   /product="Mg/Co transporter CBS domain-containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: sdn:Sden_0812
FT                   CBS:transporter associated"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02386"
FT                   /db_xref="GOA:A1SSC1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC1"
FT                   /protein_id="ABM02386.1"
FT                   /translation="MPDDKAQTSSDKIGLFDKISNLFQGEPQTQQELLDVIQGAKSRQI
FT                   IDQQTREMIKGVLDVSKLRVRDIMIPRSQMTTLGLHQSVNEFLPKIIDSAHSRFPVITE
FT                   DKDHIVGLLLAKDLIRFGFSSEANEFKIEDILREAVVVPESKRLGTLLKEFRSQRYHMA
FT                   IVVDEYGGVSGLVTIEDILEVIVGEIEDEFDDQEEDDIRQIGKRTYVVNAMTSIEKFNN
FT                   FFSTSFDIEGQDTVAGFIIHELGHLPRRGERITIDEHQFKVTISEKRRLIQLQVLIPKE
FT                   LSSIE"
FT   gene            complement(681616..682092)
FT                   /locus_tag="Ping_0533"
FT   CDS_pept        complement(681616..682092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0533"
FT                   /product="hypothetical protein UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   vvy:VV0915 predicted metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02387"
FT                   /db_xref="GOA:A1SSC2"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSC2"
FT                   /protein_id="ABM02387.1"
FT                   /translation="MQLYVDLQIACSDPNDLPMPASFEKWIEAAILGGSESHREEAELT
FT                   VRIVDQDEIMQLNHQYRNISKTTNVLAFPFQNPPGLTLPLLGDLIICKEVVESEAKLQG
FT                   KSLTAHWAHMSIHSTLHLLGYDHIEQAEAVEMESLETKLLTELGFTDPYLSEKE"
FT   gene            complement(682092..683120)
FT                   /locus_tag="Ping_0534"
FT   CDS_pept        complement(682092..683120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0534"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: sdn:Sden_0814
FT                   PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02388"
FT                   /db_xref="GOA:A1SSC3"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC3"
FT                   /protein_id="ABM02388.1"
FT                   /translation="MTTKLTTVYIDLVPADIKRLAILCGAFDDNIKQVERRLGLEIIYK
FT                   NENFQIIGEHRYAQACSELLQELYLETLPVKGKIPSLSADDVHLALQNLISTHRLLEVK
FT                   SIDQTSTQSLSIKTKRGIIKPRSENQTNYVSNILKSDISFGVGPAGTGKTYLAVACAIE
FT                   ALERQEVRRILLTRPAVEAGEKLGFLPGDLSQKVDPYLRPLYDALFEMLGFEKVEKLIE
FT                   KKVIEIAPLAYMRGRTLNDAFIILDESQNTTIEQMKMFLTRIGFNSTAVITGDITQIDL
FT                   PRHQKSGLRHAIEVLANVEEVSFNFFLADDIVRHPVVARIVKAYEAFEHTAEIKAAKVE
FT                   KK"
FT   gene            complement(683291..684712)
FT                   /locus_tag="Ping_0535"
FT   CDS_pept        complement(683291..684712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0535"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="KEGG: son:SO1181 tRNA-i(6)A37 modification enzyme
FT                   MiaB; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; PFAM:
FT                   deoxyribonuclease/rho motif-related TRAM; Radical SAM
FT                   domain protein; Protein of unknown function UPF0004-like;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02389"
FT                   /db_xref="GOA:A1SSC4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSC4"
FT                   /protein_id="ABM02389.1"
FT                   /translation="MSMKLHVKTWGCQMNEYDSSKMADLLNSTNGYISVEHAEDADVVL
FT                   LNTCSIREKAQEKVFHQLGRWKKLKVNKPNLVIGVGGCVASQEGKAIRSRAPFVDIVFG
FT                   PQTLHRLPEMIKEVQENKGTVVDVSFPEIEKFDSLPEPKADGATAFVSIMEGCSKYCSF
FT                   CVVPYTRGEEVSRPLDDVLLEVAQLAEQGVREVTLLGQNVNSYLGATYDGDTCSFAELL
FT                   RFVASIDGIDRLRYVTSNPIDFSDEIIAVYEDTPELVNFLHLPVQAGSDRILAAMKRGH
FT                   TVAQYKDQIARLLQVRPELTVSSDFIIGFPNETDHDFEQTMDLIKYINFDTSYSFIYSQ
FT                   RPGTPAADMPDDVTLETKKQRLAILQDRIQQQSQGIGRKMVGSVQRILVEGPSRKNIME
FT                   LCGRTENNRIVNFEGDHRSIGGFVDVEITEVHTNSIRGKFIRGEAEMNLRESIRPSDIV
FT                   NKHENKSAVNSYIPA"
FT   gene            684895..686052
FT                   /gene="ubiF"
FT                   /locus_tag="Ping_0536"
FT   CDS_pept        684895..686052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="Ping_0536"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: vpa:VP0735 VisC-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02390"
FT                   /db_xref="GOA:A1SSC5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC5"
FT                   /protein_id="ABM02390.1"
FT                   /translation="MQRREIIVVGGGMVGALSALLLANQGFFIHIVEKSPCITPAANAP
FT                   FDLRVSAFSAQSKRLLELAGVWQNLPPNRLCAYQGLQTWEKGSQKLKFDSQEIGINALG
FT                   YIAENNWVQAVLWQALKKLSNVTCYENREVKRIINSDKSVLISLDNEEQIKAELLIACD
FT                   GANSAVRQLLDIGITAWDYRQECMLVTIKTDCPQQNITWQEFRETGPCAFLPLAENNAS
FT                   LVWYHNPQKIGHLKSLSNAQLKEVIKDEFPPLDFDFEIVDKGSFPLTRRHAQSYFKGSC
FT                   VLLGDAAHTINPLAGQGVNLGFKDVECLVDLLLNCSDLPMQTLLKRYQWQRKPANLLMQ
FT                   SAMDVFYKVSKSDLGPVRFMRRGVLGLAQKSGPLKNKVMKYAMGL"
FT   sig_peptide     684895..684966
FT                   /gene="ubiF"
FT                   /locus_tag="Ping_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.898) with cleavage site probability 0.869 at
FT                   residue 24"
FT   gene            complement(686245..687927)
FT                   /locus_tag="Ping_0537"
FT   CDS_pept        complement(686245..687927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0537"
FT                   /product="NAD-dependent malic enzyme"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic enzyme domain protein; malic enzyme,
FT                   NAD-binding; KEGG: pcr:Pcryo_0982 Malate dehydrogenase
FT                   (oxaloacetate decarboxylating) (NADP+)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02391"
FT                   /db_xref="GOA:A1SSC6"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR023667"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1SSC6"
FT                   /protein_id="ABM02391.1"
FT                   /translation="MTFQRPLYIPFAGPALLESPLLNKGSAFSQEERNNFNLTGLLPHN
FT                   IETIESQSTRAYQQLSSFKSDLDKHIYLRNIQDTNETLFHHLIENHLEEVMPLIYTPTV
FT                   GLACEQFSKIYRRKRGLFVSYPERHKIDDMLQNATKQNVKVIVVTDGERILGLGDQGIG
FT                   GMGIPIGKLALYTACGGISPAYCLPIVLDVGTNNSQLLADPMYMGWRNPRITGEEYNEF
FT                   VDLFIQAVKRRWPEVLLQFEDFAQTNATPLLNKYRDQICCFNDDIQGTAAVSVGTLIAA
FT                   CQNKGEKLSDQRIAFLGSGSAGCGIAQHIVRQMQREGLTQEQARQRVFMVDRYGLLTDQ
FT                   MTNLQAFQQPLIQYTKDLSHWDISSHIGLEQVIKQGNISVLFGVSGQPGLFTQEVVESL
FT                   CANVDHPIVLPLSNPTSRVEATPKDITTWSHGQAIVATGSPFPPTLYENEYIEVSQCNN
FT                   SYIFPGIGLGVLAARATAISDNMLMAASQALADASMQYEKVKGALLPPLGEIRPISKSI
FT                   AYAVAKQAIADGLALPVSEETMQRRLVDNFWAPKYRTYRRTSF"
FT   gene            complement(688039..689412)
FT                   /locus_tag="Ping_0538"
FT   CDS_pept        complement(688039..689412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0538"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: vpa:VP0912 C4-dicarboxylate
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02392"
FT                   /db_xref="GOA:A1SSC7"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC7"
FT                   /protein_id="ABM02392.1"
FT                   /translation="MAMLTLFLMVIVFMTVGVPIAVSLGLSSMIFLLIHSDASLASVAQ
FT                   TLFNAFAGHYTLLAIPFFVLASSFMATGGVAKRIIRFAIAIVGSLRGGLAMASVVACMM
FT                   FAALSGSSPATVVAIGGIVIAGMVKNGYSKDFAAGVICNAGTLGILIPPSIVMVVYAAA
FT                   TDVSVGRMFLGGVIPGLLAGLMLMIAIYIYARIKNIPAQPFVGWKEVFDSAKEAGWGLL
FT                   LIVIILGGIYGGIFTPTEAAAVAAVYAFFISNFIYKDMGPLSDKEPEEKRAKAYWRKAS
FT                   HVFFHEDTRKTLYEAGKLTIMLMFIVANALILKHVLTEEQIPQMITASMLDAGLGPITF
FT                   LIVVNIILLIGGQFMEPSGLLIIVAPLVFPIATSLGIDPIHLGIMMVVNMEIGMITPPV
FT                   GLNLFVTAGVAQMSVMKVVKASLPLVCVMFVFLMIVTYVPWVSTWLPTLMMGPEIITH"
FT   sig_peptide     complement(689347..689412)
FT                   /locus_tag="Ping_0538"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.397 at
FT                   residue 22"
FT   gene            complement(689415..690038)
FT                   /gene="dctQ-2"
FT                   /locus_tag="Ping_0539"
FT   CDS_pept        complement(689415..690038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ-2"
FT                   /locus_tag="Ping_0539"
FT                   /product="tripartite ATP-independent periplasmic (TRAP)
FT                   C4-dicarboxylate transporter subunit DctQ"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: vpa:VP0911 putative
FT                   C4-dicarboxylate transport protein DctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02393"
FT                   /db_xref="GOA:A1SSC8"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC8"
FT                   /protein_id="ABM02393.1"
FT                   /translation="MKRGFFTRLGEITDYMEETLIALFLGLMTLLTFANVVVRYIFNDN
FT                   ILWALELTVFMFAWMVLVGASYLVKKHFHIGVDVIINLAPAGLKKVFALIAVASCLTFS
FT                   ILLLIGSWDYWLPFITDQAWYETQDIPMPDFLQFLSGWFNEGERYEKLPRFIPYFALPL
FT                   SMAMMTYRFLQIAWLVATNKIDKMIASHEAEEDLDSLHNSEKGE"
FT   gene            complement(690210..691208)
FT                   /locus_tag="Ping_0540"
FT   CDS_pept        complement(690210..691208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0540"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: vvy:VV1096 TRAP-type C4-dicarboxylate
FT                   transport system, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02394"
FT                   /db_xref="GOA:A1SSC9"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSC9"
FT                   /protein_id="ABM02394.1"
FT                   /translation="MLKKLMTLSLGTVAVLASFNASASCEPGEIVIKFSHVTNETSHPK
FT                   GIAASLLSERVNKEMDGKACMEVFPNTTLYNDDQALEAILSGDLQLAAPSLSKFEKITK
FT                   KFRIFDLPFLFADVAAVDRFQNSASGDILKESMTRRGIKGLEFWHNGMKQMSASKPLLL
FT                   PSDAEGLKFRVQASDVLVAQFEQLGANPQKMSFSEVYGGLQTKVIDGQENTWSNTYGKK
FT                   FFEVQDGVTETNHGILDYLLVTSDDWWKGLPTDVREQLATIMSEVTQTRNGESMRVNEE
FT                   NKQKIIDAGGVVRTLTAEQRQAWVDALKPVWKKFEKDIGSDLLEAAIASNK"
FT   sig_peptide     complement(691137..691208)
FT                   /locus_tag="Ping_0540"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 24"
FT   gene            complement(691807..692628)
FT                   /locus_tag="Ping_0541"
FT   CDS_pept        complement(691807..692628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0541"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pca:Pcar_0812 putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02395"
FT                   /db_xref="GOA:A1SSD0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD0"
FT                   /protein_id="ABM02395.1"
FT                   /translation="MMTPDQMITLVTVNAIEYGPKLIAAIVLWVIGSWVIKLLVSGLNK
FT                   AMEKGKVDPSLKPFLCSISGIVLKVMLGITVLGMLSIEMTSFVAILAAAGLAVGMALSG
FT                   TLQNFAGGVMILLFKPFKVGDFIDAQGHMGTVKEIQIFNSILTTPDNKTIIIPNGGLST
FT                   SSMVNFSTEKKRRVDWTISVAYGDDLDKARAVIKQLCDADQRIFTDPAVVIVVSALADS
FT                   SVNFSVRAWVNAPDFFPVFWAMNENIYKTFPKEGLNIPFPQMDVHLHKESA"
FT   gene            692869..693513
FT                   /locus_tag="Ping_0542"
FT   CDS_pept        692869..693513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0542"
FT                   /product="hydrolase with alpha/beta-hydrolase fold"
FT                   /note="KEGG: vvy:VV0879 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02396"
FT                   /db_xref="GOA:A1SSD1"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD1"
FT                   /protein_id="ABM02396.1"
FT                   /translation="MNLIYNGPTQGPLFVFAHGAGAPANADFMEKIAVGLALRGIRVAR
FT                   FNFAYMQQRIDNGTRRPPERAEKLVVQFGQLIAKLNQPMVIGGKSMGGRIASLLAAELA
FT                   DDKVKGIVCLGYPFHPVGKPETLRTAHLPSIQQKMLIIQGERDKLGTREEVQSYGLPKE
FT                   IQWLWLEDGDHDLKPRVKSGFTHQAHLQKALDKMALFIISALDVKTLDNPL"
FT   gene            complement(693556..694758)
FT                   /locus_tag="Ping_0543"
FT   CDS_pept        complement(693556..694758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0543"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily
FT                   protein"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   son:SO4555 drug resistance transporter, Bcr/CflA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02397"
FT                   /db_xref="GOA:A1SSD2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD2"
FT                   /protein_id="ABM02397.1"
FT                   /translation="MRKNILPMLMSMVVLSPLAIDIYLPSMPAMAAEFNVSSSEIQSTL
FT                   VLFLFAMGVGQILIGPLADRFGRRPIALAGMVLYVASSLLAANVIEFHWLQFARVLQGL
FT                   AACATSIVVFSAVRDSYTAKQGAYYYSYLNGVICVIPALAPTLGGLLALQFGWRSTFVF
FT                   MALYALLILFISLLHLPETRPKNTDSDGLLYSWARFKPVLQDAHFIFYALTCMVGMASI
FT                   LTYVSYAPDWLIRHLGVSELTFSALFAVNAVVNISACFVAPLVIKRFGNRATVLIALLT
FT                   LITSAALQFVAQHLGLDSGISAAFAFMLPMMLLCVGFALLLGPATSMALSAFDERAGTA
FT                   AAILGCIQMSGAALLAGLIQQTNLTAPYALIVLMGGLSSSLLLVMLMPRFNHWHQEPLL
FT                   Q"
FT   sig_peptide     complement(694663..694758)
FT                   /locus_tag="Ping_0543"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.966 at
FT                   residue 32"
FT   gene            695046..695903
FT                   /locus_tag="Ping_0544"
FT   CDS_pept        695046..695903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0544"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sdn:Sden_3495 regulatory protein,
FT                   LysR"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02398"
FT                   /db_xref="GOA:A1SSD3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD3"
FT                   /protein_id="ABM02398.1"
FT                   /translation="MSPSALSKSLQRLRETLGDPLFVRNAHGLKPTAHALQFKSQLPAI
FT                   LQGLYQITLPPVFTPHTSHRQFSFAILESAYQTLLPSYIGPLLKQAPLITLDIYGWAEK
FT                   SMQALLQGQIDFGITARDLHPTSDLRLNNLPEGINQSTLFTDQQICLVRVGHPILNTLE
FT                   VGGWNMESYLQMSHVQVRCEGNDWWALDYHLAESGRHRHISSTLPDFYGAASVCAHSDL
FT                   IFTLPSSFVAHAKKLYPLVQLPLPLTFSPLAYVLLWHKRNDDEPGHKWIRETICASIAQ
FT                   AMKA"
FT   gene            696206..697843
FT                   /locus_tag="Ping_0545"
FT   CDS_pept        696206..697843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0545"
FT                   /product="ABC peptide transporter extracellular
FT                   solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: vvy:VVA0132 ABC-type dipeptide transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02399"
FT                   /db_xref="GOA:A1SSD4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD4"
FT                   /protein_id="ABM02399.1"
FT                   /translation="MHNKKILASIICGLLISSNSVASEDFKQGGTLTVPIIGTGFVDNY
FT                   NPYTTKDLLHGVMFEPLLVFNNMTGKTEYRLAKSAEYSDDLKTITVKLRDNLKWSDGSA
FT                   LTATDVAFSFTMTKDTPAFDQKGIWTAGNLASVTATNATTIVFALNEADSTFIWNLERY
FT                   HIVPEQVWSKAENLTTFTNPDPIGSGPMTEVTYLKAQQMEICRNPEYYLANRPYLDCIT
FT                   FRSYNDNSQIQPALMKGEIDWGSNFIADVENTFVAENPKNHHFWYPANDAIHLYVNTKV
FT                   KPFDDLNVRKALSMALDRDEIVDIAAYGYPTANFNVGGIGELYDSYIDKEVTAKYKDIT
FT                   EFNPEKAKQLLDAAGYTDLNDDGFRDMPDGTPIEFDIEVVNGWTDWIQVVQMVTEYYEE
FT                   VGIKANVKTVDWAVYDSSLKDGKYKMAINWSLVATNPILAYQEYFDTARIGKTWHAGHG
FT                   VHSAKIDTLINSFGSTNDPKKQQAILNQLQEFSAANLAFIPLFSNPTWFQYNSSKIVGW
FT                   PSKENPYVQPVWYDGGKRNLIINNLHLK"
FT   sig_peptide     696206..696274
FT                   /locus_tag="Ping_0545"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.933 at
FT                   residue 23"
FT   gene            697897..698871
FT                   /locus_tag="Ping_0546"
FT   CDS_pept        697897..698871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0546"
FT                   /product="peptide ABC transporter, protein inner membrane
FT                   binding component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vvy:VVA0133 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02400"
FT                   /db_xref="GOA:A1SSD5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD5"
FT                   /protein_id="ABM02400.1"
FT                   /translation="MSFLLRRLGFYFTAFLIAISFNFALPRMMPGDPIDALFAAAQGRM
FT                   DPAQMDAVRAMYGFMDGTLFEQYISYIKSVFTLDLGPSVLMFPIDVIDVVGMALPWTMF
FT                   LALGSLIVALILGVTIGTYSSYHRDGLFGQIVPPVLAFVSNFPYVVTALLLFFFFGLQL
FT                   ELLPLAYTYDPSIEKAFTLEFISSVAEHAILPMGSMILVGIATWVFNMRNAMINVLGED
FT                   YVTMAEAKGLSGPRVMYRYAGRNAILPVATAIAMAIGFSFAGSIMTEVVFNYQGLGNIL
FT                   LKGIVARDYPLIQAILLILVSAVLTANFIADLLYVWLDPRISN"
FT   gene            698882..699865
FT                   /locus_tag="Ping_0547"
FT   CDS_pept        698882..699865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0547"
FT                   /product="peptide ABC transporter, protein inner membrane
FT                   binding component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vvy:VVA0134 peptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02401"
FT                   /db_xref="GOA:A1SSD6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD6"
FT                   /protein_id="ABM02401.1"
FT                   /translation="MNINKTINTDAPVSAAHTSEFRKKFKSIIKKTKAFFDGNPPAIIG
FT                   GFLITVILLGALFAPLFASHNPEKRVARPHVAPNAEHIMGTTRSGRDVYSQVLYGARKT
FT                   LSVAFFAGLIAMSIAVAVGVTSGYLGGKIDEWMNFVTNVFLVFPQLPLLIVLAAFLGQV
FT                   GSMVITILLGLTSWPWGARVIRSQTMALRNKEFILSAEVMGESKIRIILVEILPNLISI
FT                   VFGGFLGTVIYAMGAEAGLGILGLGDATEVSWGSMLYWAQVSSSLYTGAWWEMIVPAAA
FT                   LALTGGALALLNMSIDQVSNPKLKTGPHMKLWKKLNKEANQRRGLL"
FT   gene            699862..700818
FT                   /locus_tag="Ping_0548"
FT   CDS_pept        699862..700818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0548"
FT                   /product="ABC oligopeptide/dipeptide transporter
FT                   ATP-binding protein"
FT                   /note="KEGG: vvu:VV21294 ABC-type
FT                   dipeptide/oligopeptide/nickel transport system, ATPase
FT                   component; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02402"
FT                   /db_xref="GOA:A1SSD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD7"
FT                   /protein_id="ABM02402.1"
FT                   /translation="MKEALLEINNLCVDYVSPNGIARAVNNVSLSIAPGETVGIAGESG
FT                   CGKSTLAFAITRLHKAPGLIPHGEILYQGRDVLKMSPKELRDFRWNDVSIVFQSAMNSL
FT                   NPVITIGEQLTDVLLAHKKISIKDATAKAAELLSIVGMHGDRLKSFPHQLSGGMRQRVV
FT                   IAIALALEPKLIIMDEPTTALDVVVEREILNELYDLKERFGFSILFISHDLSLMGEIAD
FT                   RIGVMYAGNLIELGDSKTVFNNPSHPYTKGLISSFPTIHGPKERLYGIPGDPVNLLSLP
FT                   TGCNFQTRCPDCMDICKTDEPPLIELSAGYQAACHKL"
FT   gene            700826..701812
FT                   /locus_tag="Ping_0549"
FT   CDS_pept        700826..701812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0549"
FT                   /product="ABC oligopeptide/dipeptide transporter
FT                   ATP-binding protein"
FT                   /note="KEGG: vvy:VVA0136 ABC-type oligopeptide transport
FT                   system, ATPase component; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter, C-terminal
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02403"
FT                   /db_xref="GOA:A1SSD8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD8"
FT                   /protein_id="ABM02403.1"
FT                   /translation="MMDTLKSPEVILSVKNMVKDFPTGQSNSKKKMMRAVNEVSFDLCK
FT                   GEALAIVGESGSGKSTGARILSRIYDKTAGEIMFKGQPLDEYVKEHGSLDYARQVQMIF
FT                   QDPFGSLNPVHSIFHHIARPLLIHKRANKENLEKVVYGLLELVGLQPAVETAEKYPHEL
FT                   SGGQRQRVAIARALAVDPEVILADEPISMLDVSVRLGILNLMSDLKDKHGISFMYITHD
FT                   IATARYFAEKTAVMYVGHMVEWGSSDNVTQTPQHPYTQLLLSAVPEAGKSGRRELDAKK
FT                   GEIPLWKPDSKGCPFAMRCPRVLDKCSDSFPAITQIADDHFIRCFNI"
FT   gene            701886..705425
FT                   /locus_tag="Ping_0550"
FT   CDS_pept        701886..705425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvu:VV21296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02404"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSD9"
FT                   /protein_id="ABM02404.1"
FT                   /translation="MTVKNISTLVDKVPEQFLSPEGDKSYQSKKVDQMENLSNSVSGKF
FT                   IAIDGDKYYQIKNVDQMAPFFISVVSASDHWLFISSTGCLSAGRIRPENALFPYKSVDY
FT                   IHESAENTGSKTIVKVQTKNGCRTWEPFNLQHNSLYEVQRNLYKNIAGDKIIFEEINLD
FT                   LGLTFKYQWATSDQFGFVRSSTVTNNDQKAVVFELLDGIQNILPPNAPLSLMQTSSALI
FT                   DAYKWNELLPESTLATYSLYAKLSDRAEPAESLLATSVFSIIDNCQSVLLSSRQLGAFR
FT                   RGQQINNEELCRGLRGAYFIHKKCQLSAGQQDSWQIVANIDQSHADIAALKQHIQADDL
FT                   IKTAVIGSVEANHQDLIMLMAGSDAYQKTAEEETTVHHYANVLFNNMRGGVVVDQYWVE
FT                   KPDFVKTLTSANKVVAANNRDFFATLPERIAYQALLASAAEQNDPQLLRLCHEYLPLTF
FT                   GRRHGDPSRPWNHFEIKLKDTNGDRLLSYQGNWRDIFQNWEALGLSYPHFIKSFISKFV
FT                   NASTIDGYNPYRITKAGVDWEQLEEDDLWGNIGYWGDHQIIYLLKFLELSKKFQPQELK
FT                   ALLNADIFSYANVPYEIKDVDQLFADPKNTVIFNNEKQAVIEAKVAQLGSDGRLLLKAD
FT                   DSVYLVNLTEKLLIPLLAKLGNLVVDGGIWLNTQRPEWNDANNAIVGTGLSMVTLYYMR
FT                   RYIAFLQALLIDHSGTVALSAELAKWVSSTGEILQQAAVLIDDNKINSEARNDLLRKLA
FT                   GAAGDYRAVVYKNGFSGKIAFDCSVINGMLNASLQVIDQSIQTNLRQDGLYNAYNIINC
FT                   TPDNINVDVLYPMLEGQVAVLSSGVLTPEQAVTLIDNLYASDMFRADQQTFMLYPDRDL
FT                   SCFAAKNCIDGTRVNDNRLLKLMAEKGDRRLIEVDAEGVYHFNANFENATFLKNALQEV
FT                   KADYLSIESATFADVLICYEEVFNHQAFTGRSGTMFGYEGLGSIYWHMVSKLLLAVQEN
FT                   YFTAWNNNADSEATGKLAEYYYKVRAGIGFNKTPDVYGAFPTDPYSHTPKQAGAQQPGM
FT                   TGQVKEEILTRFGELGLLVKNGQIYFQPTLLKETEFLSVDDEFEFIDINSEYKKISLAP
FT                   RMLAFTYCQVPFVYEVVGAEEAGVTVEHENGSTLQFNTLALSNLISSQIFSRCAEIEQV
FT                   KVSIPETMLLKTY"
FT   gene            705434..705865
FT                   /locus_tag="Ping_0551"
FT   CDS_pept        705434..705865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bth:BT2954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02405"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE0"
FT                   /protein_id="ABM02405.1"
FT                   /translation="MNSHLLEVSEYNTAGYAPVVDFQAWRVAILNYIDELEPDQIDNFQ
FT                   CHNETDEVFVLLSGKCILFCAEVDDKNNIIDIISWDMKIHKTYNIKRGVYHTHTLSKDA
FT                   KVLIVENSDTGDHNSPKIMIDDTVGYKLKKITSQLWPSS"
FT   gene            complement(706053..707057)
FT                   /locus_tag="Ping_0552"
FT   CDS_pept        complement(706053..707057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0552"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: vvy:VVA0138
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02406"
FT                   /db_xref="GOA:A1SSE1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE1"
FT                   /protein_id="ABM02406.1"
FT                   /translation="MTLITIKEVSDLAQVSQATVSRAINGHPTVKESNKLKVFEAIKKL
FT                   GYKPNSFAQALASNRSNSIGMLVGTLDGPFFGPLMHNAENIIRQKNMHLIVTSGQESRT
FT                   KEVDSIAFLQSKQVDGMIIHSDKLTDQELITIAQKNPAMVILNRYIPELDKQCICIDNE
FT                   LGGYLATKYLLENGHTKVGCITGQMSKIDSRDRFQGYRNALAEFSIPYDTNLVIEGRFD
FT                   HQGNHEVVRRLLSRDNGITAIFCENDNIALAAYDICNEKNLSVGDDISIVGFDNDTYSQ
FT                   HIRPRLSTVNFPVVDMGLEAAHAVLAMIDKKSYPFKKRLVPELVIRDSVKKIK"
FT   gene            707551..708903
FT                   /locus_tag="Ping_0553"
FT   CDS_pept        707551..708903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0553"
FT                   /product="maltoporin"
FT                   /note="KEGG: vvy:VVA0142 maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02407"
FT                   /db_xref="GOA:A1SSE2"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE2"
FT                   /protein_id="ABM02407.1"
FT                   /translation="MKLSKITLACLLATSGLSVSGAANAGETEGFEFHGYFRAGVLTSA
FT                   EHDFKQSNFSGQKETLGRLGIEADNDVSVTLAKTWAFDDDKKIKIVVSASGTDSENSLG
FT                   TSADATHMGIGQTYVEFEGVSPSGTFWGGTRDYGKANYIFMTDFFYTDMSGTGIGVMDY
FT                   QLGDTSLDFAYIASDRNDDVIDRWATDDSGNLANLNNLMHAFHLSATFGAFELSALLKA
FT                   MPDNWDEDGTEYAETGFDLTAIYNLDSFFFMPGNGFSKIIAQGGVGLGSGNLLGGTITE
FT                   YNAFRPGSLTQGQHDDYAAWHPSGGEATRLLTYVGKDDVSARVLLWGGYFFDNGIKLFP
FT                   SIQGQWNDHEQWVGNPGFTEYWLSAMVRPIFPVSNNFFVATEFGAMYTNWNGASGNQAK
FT                   ATIAPTWIIGTGAGPAPEIRLLASYVNNAWNVDDVDSKSDIIVGLQADMWW"
FT   sig_peptide     707551..707628
FT                   /locus_tag="Ping_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            complement(709989..711587)
FT                   /locus_tag="Ping_0554"
FT   CDS_pept        complement(709989..711587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0554"
FT                   /product="Glucan endo-1,3-beta-D-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   vvy:VVA0140 beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02408"
FT                   /db_xref="GOA:A1SSE3"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE3"
FT                   /protein_id="ABM02408.1"
FT                   /translation="MKTILHLAAKMTAIALAVSLAGCSSTAKEANGDTTLVQTKKPVVL
FT                   TDAPITPSEKWKLVWSDEFDGDSIDKRKWDFEENCWGGGNNEQQCYTKRESNSFVEDGK
FT                   LNIVAKKGSFTGPDNPDGRTETTKTLPYTSARLRTLNKKDWKYGRFEVRAKLPQGQGTW
FT                   PAIWMLPTDFVYSGWAASGEIDIMEAVNLKVQSDAPNAAAGEEESRVYGSLHYGKEWPD
FT                   NAYTGQGAALPKGINPADDFHTYAIEWEEGEIRWYVDNIHFATQRQDGWYSQYEKDGTL
FT                   INAEESAPFNQKFHLLLNLAVGGSWAANANNKGIDESVFPQTLAVDYVRVYRCSVDRWK
FT                   GKGCASTSETDKLVKGHAVPAILAADDSYAEGPLLDIYTDALNTSLAFDSYNPVDVVSY
FT                   QEIEEAGRGKVLQVTKKNGAGNIYIRAPKTDLTHWLDGGQLVFDINVESQEEGAELLVK
FT                   LDSGWPASSDYTVTTPPVGTWGEVKIDIADILAGGNRFENGKANIAAITNLLVFEPLAS
FT                   MTFKLDNIRFEYAPK"
FT   sig_peptide     complement(711504..711587)
FT                   /locus_tag="Ping_0554"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.777 at
FT                   residue 28"
FT   gene            712575..716855
FT                   /locus_tag="Ping_0555"
FT   CDS_pept        712575..716855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0555"
FT                   /product="carbohydrate-binding CenC domain protein"
FT                   /note="PFAM: Carbohydrate-binding, CenC domain protein
FT                   domain protein; KEGG: cps:CPS_3716 glycosyl hydrolase,
FT                   family 16"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02409"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE4"
FT                   /protein_id="ABM02409.1"
FT                   /translation="MKVIKGFKLANVVLASAMALALAGCNGDDLLSHKPDAPAAPKDTT
FT                   DLSGKAADGYLSGAIVCLDVNDDKICGIDEPTATTSAGGGFSITGVAQSLIDAHPLLVQ
FT                   ITADTIDEDYPEKTLTPYTLSAPVGFTFVSPITTMIQNAIESDSSISAKDAEDLVKAQL
FT                   GTTLDLSQDYIAGKSDSANQAEFEKLHKVAQVVARIIAAKVDQFNGAATAFTAKEISTA
FT                   IMAEVFKATGGIAGQVDAAIEAGSAFDPDTIATEIGDKIVVAVKSDAKEYVLISSTGTA
FT                   SEINDATVVGEWSTGSVINAAGNYDGLDAWTVTSGAGGDNNWGTVLALSDGFVGDFSAF
FT                   DKLTLKIATSGGYADGYFIKIGAGGVETEIPLSVTDGSTSWQDVEVDLANYDLSSIEYI
FT                   AVFAKTGTAGVSKIHIADLALGQQPDAVPDTVIQEYTLISSAGTASEINANTEVGEWST
FT                   GSVINAEASYEGLNAWSVTSGAGGDNNWGTVLALTGGFVGDFTAFDKLKLKVATSGGYA
FT                   DGYFIKIGAGGVETEIPLSVSDGTTGWQDVEVNLATYDLSSIEFIAIFAKTGTAGVSQI
FT                   HIADLSLVQLADTGTSTEDAALEVQKTAAAILVDTSYTTSTWATLTTALAMPETTQAEV
FT                   TAKTEAITTATAGLEQKAPVGVDKTSLSAAITASEGDNLRQTGIGEAEGQASQTDWQAF
FT                   YDAILAAGVIRDAAADQAAVDQAVSDLAAAQVVFNGAKVGTIIDQVVDSSPRAPVFTVF
FT                   NDQINPKWAAWGCCDNASTQHIYDASDAYANVTQFSIFGEAVAGFTSRSNAQDPSHTAV
FT                   DGIPFDASAIAATGTIEFDLKMTTPADAGDTTWKFKVESSGGGAIELDLANAPTAEWQH
FT                   YSFSLAGLGTVNTSAIDLLMVFPAWGTGTGAVYSVDNVQFFDAPAAGDRTPGASGDSAT
FT                   TTVAAGIDFEGSQLTWESFDTAALQFVANPDSSGTNSSATVAKLTNLTSDGEWVGAFTR
FT                   GGLETFTLDASNNVVKIWVYKNTISPVHIKFEKQHGDGWGAHPSRSVSNTLINQWEELT
FT                   IDFAADIGLPENDAIGGFVVMPDVTNARSEESVIYFDNISFSGDGDSTNSVDPVGSVVE
FT                   EGVALVTDGGFESATLGDWADESQNSAIAQVSSEDSQSGTYSAKLSADTAQVAMIRLID
FT                   PAPGTVVAGQSVIVSFDLKGSIDGPGGVFFAELMSNLAGDGTSKSELLSGGPLFPNATW
FT                   TNYRYETTLGNDVDGGLSLLLKADPGAAVNITAYIDNIVINALAAVDAPVELTAAAPAP
FT                   TASAADVISIFSDSYTSVAGVNTNPDWGQSTVTTEVDIAGNNTLKMAALTYQGLDLSAQ
FT                   DLSSKTYLHLDYWTADATGFDVYLIGGGETAHAITPVTGSWQSIEIPLSVYTGVNLTAV
FT                   NQFKFDAQAYDTSATIHFDNMYFY"
FT   sig_peptide     712575..712658
FT                   /locus_tag="Ping_0555"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.730 at
FT                   residue 28"
FT   gene            717103..718965
FT                   /locus_tag="Ping_0556"
FT   CDS_pept        717103..718965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02410"
FT                   /db_xref="GOA:A1SSE5"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE5"
FT                   /protein_id="ABM02410.1"
FT                   /translation="MKKSSYKIFLIAFLSIFMFACGDEPLTTLLNNTSSAGDTGTLQPQ
FT                   AIVSDAPLSKSGEQILGNPDYQAISYGAFRAPTREEATVPSVADLKEDMLLLQAMDIKV
FT                   LRTYNTQIFSDTANLLEAIDQLMAADPNFEMYVMLGVWVQAQGSYTANVDNTTGDAALN
FT                   RAEMDKAIEMAQNYPEIIKVIAVGNEAMVDWQAHDIPVSVVLGYVNELQGLKADSTISA
FT                   DIWITSSDNQAVWSGSDPRVSGQLNDLNALIAAVDYISLHTYPFHDTHHIPDFWQVPAD
FT                   QAGLTDQQKIDAAMVRAQARVVEQYTAAQAYMLKLGINKPIHIGETGWATVGSPGGEDF
FT                   TQSGSAAADEYKQKMAYDALRTWSNEFGASLFFFEAFDEQWKAGTENPATHPEKHFGLI
FT                   NMQGEAKYLLWDLVDAGAFNGLERDGLQITKTYGGNVAAMMDEVFVPPAAPVTNEPVAG
FT                   EFIVLGISLYSNALAYGWDSPETAWAGVNDDTGVLTVATDPDTAATWGWGAGVGIPNET
FT                   SNLSTSTQITFEIKGDAAFGFYLGFQTTKGAGTNHWVRFNTGSYTLTDQWAKYTISLSD
FT                   FSDFASGNLEVVNSPFTIADIYETSGGSAPTLSTIEVKNISWLE"
FT   sig_peptide     717103..717171
FT                   /locus_tag="Ping_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(720182..720823)
FT                   /locus_tag="Ping_0557"
FT   CDS_pept        complement(720182..720823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0557"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /note="KEGG: nmu:Nmul_A2454 DsbA oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02411"
FT                   /db_xref="GOA:A1SSE6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE6"
FT                   /protein_id="ABM02411.1"
FT                   /translation="MNLIKQLFLTLILLCASQAFAKPELGKDYSILNPAMPTHSGKKIE
FT                   VLEFFSYDCIHCYNFNPLMQAWTKRMPDDVSLTYVPVVYRADMEIPARAFYAVEYLGLH
FT                   NKLHDTLFDIWHSSNPPYDKASLINALTPYGVDVTKFQNAYNAYSISQALERARGLAYT
FT                   LDIHMQKNDYHIRSTPTLIIGGKYVISGESAHTIKLLYALIEKVRKEKKH"
FT   sig_peptide     complement(720758..720823)
FT                   /locus_tag="Ping_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(721285..722634)
FT                   /locus_tag="Ping_0558"
FT   CDS_pept        complement(721285..722634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0558"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   sde:Sde_3021 beta-glucanase/beta-glucan synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02412"
FT                   /db_xref="GOA:A1SSE7"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE7"
FT                   /protein_id="ABM02412.1"
FT                   /translation="MTLQLQKMYFCIGQKLQKSRTTLLAALLMLSFSSSAMAGWELQWI
FT                   DKFDGTSVNWDNWTAQTQANYNNEVQCYTNDDSSVNKNYDVSDGTLKIIARKQNINCPG
FT                   LGGTQKSWTSGRLNSKDKNEFLYGRIESRIKFHNLEGGTWPAFWMLENRIAEQPVKGDG
FT                   DSINWPNAGAGEIDVWEWFSNAPNTYITNFFNTESCAGETLYSYPNGGPDVQNWHNYAL
FT                   EWSKDNTSFYIDDILVVSQDMSSCNQYQEPMFVLLNVAMGGNLGGNINPSLTQATMEID
FT                   YVAHCQPSAANNATYCNQALAEQNNGLPEVSIKITQNGYTITDINPDNGLVTLSAQTGN
FT                   INADSSYSYDWYTSGLASPIITGNQINFDPSSMVNGYYYVSVILTDDQNPTQTDRDAQT
FT                   LKVISESISTSNTINANSTGGSISAGILLFLGLLGLFRARHSLPHQSAGK"
FT   sig_peptide     complement(722518..722634)
FT                   /locus_tag="Ping_0558"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 39"
FT   gene            723084..725177
FT                   /locus_tag="Ping_0559"
FT   CDS_pept        723084..725177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02413"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE8"
FT                   /protein_id="ABM02413.1"
FT                   /translation="MFKNIKIFMLLLLSVLFFGCADEELEAVVSARGDDTPPITYSVTV
FT                   KVSDDINGASISNAQVVLAGKTKITNALGAASFELAKASYSLSIAATGYKSYTHVFDLT
FT                   ADNQQVLAAMAETLPVPEVSYLFHSENEDSNFMQYWGDNWGSGATITNIDDDPDFIKVL
FT                   KVSSGTNWGNKGAVAWGNEDQNAINISTYTHVKFKVKATNLTDVEVIVNSATKVESNIG
FT                   YLINNGTLLENGWVEITAVLPDFSDMTWFALAFNGEQSGLVLLADVHFVTQTMIIQGPH
FT                   EAAALPPQLSDAQAIVLYSDSLKQDKYISVWSSNWWNAPIYSQGNIDGNYYAKYEITEL
FT                   GTVGGAVGLEFGIENGFVDASAKTMMNFDMYVESGITQIQLKLVSDGGDSLYKTINPPT
FT                   GEWVSHQAVFSELEVLSGTLEPSTLKLAGFIVFGEAGKSFYVDNIYFSGESIFSDLVVT
FT                   VEDNNNVVIAGAIVSIGDLSVTADANGVATLNLQEGEHSVKVSADGFGLRQQIQSNVGG
FT                   GAITLTMQPLNPGPFLPAPAPIHSDAEAFVLYSDSLLVDKNISFWEDNWYNAPVYSQVN
FT                   LAGNNMAKFQITPDGRDGGVVGIQYGVEGGVVDASNKIGMRFDIYATSGVTQAVIQIVA
FT                   SNGARIQTIKPVTTGEWVSLELVFDDLVDSNQSFSSEELTQLGLQLWGTSSDSVYLDNI
FT                   YFY"
FT   sig_peptide     723084..723149
FT                   /locus_tag="Ping_0559"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.842 at
FT                   residue 22"
FT   gene            complement(725425..726369)
FT                   /locus_tag="Ping_0560"
FT   CDS_pept        complement(725425..726369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yps:YPTB3641 maltose operon periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02414"
FT                   /db_xref="GOA:A1SSE9"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSE9"
FT                   /protein_id="ABM02414.1"
FT                   /translation="MKKILVIGLAILATGCSNNKMIIADNGKKNIQNMQEADLSSGFQT
FT                   LKKAPLCCDSLSELNYQIITEAGKFDFVITPQNEAFNFTTGKSFVKGIALPVVDGTIKM
FT                   TLSSPIAAGVFVPTLLILDEQHKALQRYSEETIKYDSASLLKADRLFADIEFPAVFADG
FT                   RRAKYLLVLTTEEAMQSTTKLAPQKQLAAEVGRADLFYKTQPIAHTATGVVRLTFDYTP
FT                   GSRNLATRIVTEAPNGSQKAQVKVAAQSITATVATEAGAVINNSIQPESEAMFLTLIEQ
FT                   AVKDGDYEKALRLVKQAERAGSAKALNTLLKYQ"
FT   sig_peptide     complement(726310..726369)
FT                   /locus_tag="Ping_0560"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.775) with cleavage site probability 0.595 at
FT                   residue 20"
FT   gene            727392..729092
FT                   /locus_tag="Ping_0561"
FT   CDS_pept        727392..729092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0561"
FT                   /product="ABC transporter for peptide ATP-binding protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter, C-terminal domain
FT                   protein; SMART: AAA ATPase; KEGG: ppr:PBPRA0098 putative
FT                   peptide ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02415"
FT                   /db_xref="GOA:A1SSF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF0"
FT                   /protein_id="ABM02415.1"
FT                   /translation="MSLLEVKNLRIEYPSRHGVHAAVKSLSFSIERGEIVGVVGESGAG
FT                   KSTVGNGIIDLLSPPGVIASGDIYLDGEKISGLTDEQMRLVRGSKIGFIFQDPMTSLNP
FT                   LFTVEKQLTETIRANLKVTGKEAYQRALNLMDQVGIPDAHLRIKQYPHQFSGGMRQRVV
FT                   IAIALSGEPDLIIADEPTTALDVSIQDQILTLIRNLCIEKNVGCMLVTHDMGVVSNVTD
FT                   KVAVMYRGDLVEFGPTEKVLGNPDHDYTRSLISAVPRSDIKLDRFPLVNYIEEAGEMKK
FT                   LDIKTHWLGQSEDQREYSGPLLNVENVSLRFTTKDSMFESRREYVQANDNISFHINEGE
FT                   TFGLVGESGSGKSTVARVIAGLYKPNAGKISFEGIDLTAIKSEKQRRPIRRQMQMVFQN
FT                   PYTSMNPRMRIFDIIAEPIRFHKLAQSEAQTRQIVHDLLDHVGLGRMAGVKYPHEFSGG
FT                   QRQRISIARALATRPRLLICDEPTSALDVSVQGQILNLLKDLQDELNLTMLFISHDLPV
FT                   IRQVCDRVGVMQKGKLLEIAPTEQLFNTPQHQYSQHLVSLMPEFKGLRV"
FT   gene            729220..730776
FT                   /locus_tag="Ping_0562"
FT   CDS_pept        729220..730776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0562"
FT                   /product="ABC peptide transporter extracellular
FT                   solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: vfi:VF2518 dipeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02416"
FT                   /db_xref="GOA:A1SSF1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF1"
FT                   /protein_id="ABM02416.1"
FT                   /translation="MKFFKTKLTVALLAAGLSFSVAAADITVAYDADPVSLDPHEQLSG
FT                   GTLQMSHMLFDPLIRFTQEMDFEPRLASKWERIDATTFRFNLRKGVKFHSGNTMTADDV
FT                   IWTFNRLKNSADFKGVFSPYEKMIKIDDYTVEIKSTEPYPLVLQTATYIFPMDRKFYTG
FT                   EMDGKDKSEILKHGGSFASTHVSGTGPYTITTREQGIKVVFDRFDDYWDTNSPGNVDKL
FT                   TLVPIKEDATRVAALLSGDVDMIYPVAPNDQKRVADTEGLKLTTVPGSRIITFQMNQKS
FT                   NPALKDVRVRQAIVHAINNDGIVKKIMKDFATTAGQQGPAGYAGYDEALVPRFDVAKAK
FT                   KLMEEAGYSKDKPLQISMMAPNNRYVKDAQIAQATAGMLAKIYINVDLKTLPKAQYWPE
FT                   FDVCASDMMMIGWHSDTEDSANFSEFLMMTRDADAGKGAYNCGNYSNPEVDRLVNAANA
FT                   ETDPAKRATMLQKVEQILYKDAAFVPLHWQNLAWGSKSNLQIEPIVNSMNFPYFGDLIV
FT                   K"
FT   sig_peptide     729220..729291
FT                   /locus_tag="Ping_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.966 at
FT                   residue 24"
FT   gene            731012..731989
FT                   /locus_tag="Ping_0563"
FT   CDS_pept        731012..731989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0563"
FT                   /product="peptide ABC transporter, protein inner membrane
FT                   binding component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vfi:VF2517 dipeptide
FT                   transport system permease protein DppB"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02417"
FT                   /db_xref="GOA:A1SSF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF2"
FT                   /protein_id="ABM02417.1"
FT                   /translation="MFTFLIKRLFQALVVMFVISLVAFSIQDNLGDPLRELVGQSVSEE
FT                   ERQILRDELGLNDPFPVKYTRFIVNAAHGDLGTSYFFKKPVVEVIFDKLEATLELVFGA
FT                   ALIILFVAIPLGVYCAIHPKSAWTKMIMAFSSLGISVPVFLTAIMLMYVFSIELQWLPS
FT                   YGRGETFNVLGWETGYLTKDGLLHLILPCVSLASIMLPLFIRLVRSEMLEALGSEYVKF
FT                   AMAKGLAVNKVHYQHALKNTMLPVLTVGGVQIGTMVAYTILTETVFQWPGTGFLFLEAV
FT                   NRVDTPLITAYVIFVGLIFVVTNTVVDLLYGVVDPTVNITGKGA"
FT   sig_peptide     731012..731089
FT                   /locus_tag="Ping_0563"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.680 at
FT                   residue 26"
FT   gene            731992..732936
FT                   /locus_tag="Ping_0564"
FT   CDS_pept        731992..732936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0564"
FT                   /product="peptide ABC transporter, protein inner membrane
FT                   binding component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vfi:VF2516 dipeptide
FT                   transport system permease protein DppC"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02418"
FT                   /db_xref="GOA:A1SSF3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF3"
FT                   /protein_id="ABM02418.1"
FT                   /translation="MNTITSSHVPTRWERLKNSDLIYYFLKDKVAMFSFAIFLTCLLMS
FT                   LFAPLIAPTDPYDLTSISLMDSELPPAWMAEGDENFLLGTDDQGRDIFSTILYGSRLSL
FT                   TIGFLAVGLQLILGIVIGLSSGYFGGRIDSFLMRFADVQLSFSTLMVAIIVSAIFKASF
FT                   GNEFYSEYAVIMLVVIIGIAEWPQYARTIRASVLAEKEKEYVEAAQVMGFKAGRIMFRH
FT                   ILPNCLSPILVISTVQVANAIMSEAALSFLGLGLPVDQPSLGALISIGFKYIFSGAWWI
FT                   TLFPGIVLVTLVLVINLLGDWLRDAFNPKIYKG"
FT   gene            complement(733069..734445)
FT                   /locus_tag="Ping_0565"
FT   CDS_pept        complement(733069..734445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0565"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   son:SO3741 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02419"
FT                   /db_xref="GOA:A1SSF4"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF4"
FT                   /protein_id="ABM02419.1"
FT                   /translation="MSQGLITAAYMIAAILFIASLNGLSSQESAKRGNTFGIIGMIVAI
FT                   IATIASAQVAGMGYITVAMAIGAGIGVRLALKVEMTSMPELIAVLHSFVGLAAVFIGFN
FT                   SYLEHGLLTGIEQSIHDVEVFLGIFIGSVTFTGSIVAYGKLSGKINSTPLNLPGKNWIN
FT                   LAVLASSAFLLVGFVSSGLGLTALIIMTIIALAFGWHLVASIGGADMPVVVSMLNSYSG
FT                   WAAAATGFMLSNDLLIITGALVGSSGAILSYIMCKAMNRSFISVILGGFGNEVTVQSGD
FT                   EEQGEHFETSAQEVADSLAAAKNVVIVPGYGMAVAQAQYPVAELTKYLRSKGKKVRFGI
FT                   HPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFAKTDVVLVIGANDTVNPAANEPGT
FT                   PISGMPVLHVWEAEKVVVFKRSMASGYAGVQNPLFFKENSEMLFGDAKASVNAILQNLN
FT                   "
FT   sig_peptide     complement(734368..734445)
FT                   /locus_tag="Ping_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.798) with cleavage site probability 0.292 at
FT                   residue 26"
FT   gene            complement(734448..735992)
FT                   /locus_tag="Ping_0566"
FT   CDS_pept        complement(734448..735992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0566"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   plu:plu2167 NAD(P) transhydrogenase subunit alpha (pyridine
FT                   nucleotide transhydrogenase subunit alpha) (nicotinamide
FT                   nucleotide transhydrogenase subunit alpha)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02420"
FT                   /db_xref="GOA:A1SSF5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF5"
FT                   /protein_id="ABM02420.1"
FT                   /translation="MQIGIPREIQENENRVAATPNTVELLIKQGFTFLVEKNAGIAASF
FT                   SDQAYQNSGAEIGTDKNLVWQSDIIFKVNAPTDTEITLMKEGATLVSFIWPAQNPELLE
FT                   KLTSKKISVIAMDSVPRTSRAQALDALSSMANIAGYRAVIEAANQFGRFFTGQITAAGK
FT                   VPPAKVLIIGAGVAGLSALGTAGSLGAIVRAFDTRPEVKEQVESMGAEFLVVEYEEENE
FT                   VSSSGYAKTMSEGYQKAQAAMMAEQAKDVDIIITTALIPGKPAPLLVTKEMIASMKAGS
FT                   VIVDLAAQAGGNAALTVKDEVFLTDNGVKIVGYTDLPSRLPTQSSQLYSTNLVNLMKLL
FT                   CKDKDGIINIDFNDEVIRGATVVKEGEISWPPPAINVSAAPAPKAEAAKSATVVEKKPE
FT                   NKWIKPAAAVVAAILFGWLASVAPANFLAHFTVFILACIVGYGVVWNVAHSLHTPLMSV
FT                   TNAISGIIIIGALLQVGQGNGFVTTLSTIAILIATINIVGGFTVTQRMLKMFQKDK"
FT   gene            complement(736503..737171)
FT                   /locus_tag="Ping_0567"
FT   CDS_pept        complement(736503..737171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0567"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /EC_number="5.4.99.-"
FT                   /note="PFAM: pseudouridine synthase; KEGG: ppr:PBPRA0408
FT                   putative ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02421"
FT                   /db_xref="GOA:A1SSF6"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF6"
FT                   /protein_id="ABM02421.1"
FT                   /translation="MPNFVYYPPTTPYLDILYQDDDIVVLNKPYGLLSVPGRAKKNRDS
FT                   LALRILRVWPNASVVHRLDMATSGLLILTMRKSAQSHIGRQFQQKIIDKTYYARVEGII
FT                   KEDNGVIDLPIRCDWENRPRQIVDFAEGKSSQTEWSVVKREKLTTLVCLKPLTGRTHQL
FT                   RVHLQAIGHAIVGDEFYSTEFGKKLSPQRLALHAASITLTHPSTQQRITFNCPPPFMNI
FT                   "
FT   gene            complement(737324..740236)
FT                   /gene="hepA"
FT                   /locus_tag="Ping_0568"
FT   CDS_pept        complement(737324..740236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="Ping_0568"
FT                   /product="RNA polymerase-associated protein HepA"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   type III restriction enzyme, res subunit; SMART: DEAD-like
FT                   helicases-like; KEGG: vpa:VP2682 RNA polymerase-associated
FT                   protein HepA"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02422"
FT                   /db_xref="GOA:A1SSF7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF7"
FT                   /protein_id="ABM02422.1"
FT                   /translation="MIFSLGQRWISDTESELGLGTIVALEGRMLTVLFAASGEQRLYAI
FT                   EEAPITRVRFNVGDEILSHDDSKLLVSEVVEKDNLITYIGTRVDNGSASELRETFLNNF
FT                   IKFNKPQDKLFAGQIDKFDRFVLRYKSLTNQHQQQKSKLRGLLGPRVDLIPHQFYIAEE
FT                   VGKRHAPRVLLADEVGLGKTIEAGLIIHQQLVTGRAKRILIVLPENLQHQWLVEMMRRF
FT                   NLHFSIFDDARCNEAYLDSINPFETEQLVLCSIDLLRKRTHFENALEADWDLLIVDEAH
FT                   HLIWDKEKPSRDYQVVEALSKSIPGILLLTATPEQLGHESHFARLRLLDPNRFFDYQKF
FT                   IQEEEGYKPVATAINELLDNNQLSNESKNSITELLREQDVQPLFNIIDDISLENDERQS
FT                   AQHELISNLLDRHGTGRLLFRNTRSAIQGFPKRHLKTIALPLPEQYKTAIKVSKMLPSG
FT                   TLQEQAFRALYPEQIYQAFEGGESNSWCSFDPRINWLIDLIQQLKGEKILIIAAQAETA
FT                   LALEEALRTREAIKSAVFHEGLSLIERDKAAAYFAQTEEGAQVMICSEIGSEGRNFQFA
FT                   HHLVLFDLPINPDLLEQRIGRLDRIGQRCDIQIYTPYLKGTSQENLQKWYEQGLQAFTQ
FT                   TTPTGHTIFELVEEDLINLLATGENDNGEVDKLIKLTRSHNDKLKKQLEQGRDKLLEIN
FT                   SSGILHNSDLLDDITEIDQKPDFTQFALQLFDVVGVQQEDRGNHCLALRPTEHMLTSDF
FT                   PGLPEEGTTITFNRKTALSRDDVQYLTWEHPMISGGMEMILSSDTGTTAVAILKNNSLP
FT                   AATTFLELIYVVETINTENAQLKRFLPTTPIRLLLDKNAKDLGQNVTFDSFNRQLTPIN
FT                   RHISRKVANTSQPLIHQLIKDSRPTAQKLMAEIIDQAKHNMQQTLQQEQDRLQALKAVN
FT                   PNIREEEIQHLRDQQSNFEKILDQTQLKLDAIRFIVSTQS"
FT   gene            740891..742429
FT                   /locus_tag="Ping_R0030"
FT   rRNA            740891..742429
FT                   /locus_tag="Ping_R0030"
FT                   /product="16S ribosomal RNA"
FT   gene            742633..742709
FT                   /locus_tag="Ping_R0031"
FT                   /note="tRNA-Ile3"
FT   tRNA            742633..742709
FT                   /locus_tag="Ping_R0031"
FT                   /product="tRNA-Ile"
FT   gene            742760..742835
FT                   /locus_tag="Ping_R0032"
FT                   /note="tRNA-Ala3"
FT   tRNA            742760..742835
FT                   /locus_tag="Ping_R0032"
FT                   /product="tRNA-Ala"
FT   gene            743315..746206
FT                   /locus_tag="Ping_R0033"
FT   rRNA            743315..746206
FT                   /locus_tag="Ping_R0033"
FT                   /product="23S ribosomal RNA"
FT   gene            746513..746628
FT                   /locus_tag="Ping_R0034"
FT   rRNA            746513..746628
FT                   /locus_tag="Ping_R0034"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(747679..749178)
FT                   /locus_tag="Ping_0569"
FT   CDS_pept        complement(747679..749178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0569"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: aci:ACIAD3447
FT                   putative transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02423"
FT                   /db_xref="GOA:A1SSF8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF8"
FT                   /protein_id="ABM02423.1"
FT                   /translation="MESLSSDLLLQRFAEQSDEKLYKRLYNAIRSTILEGSLLPSSRLP
FT                   ATRDLAKVLQLSRNTVLTVYDQLQAEGYLLTRAGSGTFVAETLPDSYLSSESVPDQLSI
FT                   SSRQIKLSQRGCTLLGDASASPEQWGAFIPGVPDVTAFPHHLFSKIQARINRRPPPQEL
FT                   SYSNQGGHPELRHALVDYLRVARSVRCSADQILITEGIHQAIDLVTRLLCDPGDTVWLE
FT                   EPGYWGIRNILHMNEVNIHPLPVDKSGLVLPKKIEKKPSLTFVTPSHQYPLGSVMSLRR
FT                   RQRLLLMAAKTGSWIIEDDYDSEFRFSGQPIPALQGLQSDAPVIYIGTFSKTLYPALRI
FT                   GYVVIPKSLMKPLKTAHSELYRGGHLLIQKALGQFIQEGHYAAHIRRMRLLYAKRRAFL
FT                   VELIESHLGKTALSEFNSNAGLHLILNLPDNSNDVAISEAANAQGVLVRPLSRYYMLDN
FT                   VRQGLLMGFACVPEEQMAKAFTLLLDCIRNASSKFEINTTH"
FT   gene            749993..751009
FT                   /locus_tag="Ping_0570"
FT   CDS_pept        749993..751009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0570"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: vch:VC1273 extracellular solute-binding protein,
FT                   family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02424"
FT                   /db_xref="GOA:A1SSF9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSF9"
FT                   /protein_id="ABM02424.1"
FT                   /translation="MINFKKHKLINGLLALSLGFGSLASSAMANAAEHNWRFANLYGRG
FT                   TAYGTLYENLGKNIETMSNGRISVQVLYSGEGVNTTGILSAVKTGLITMGAPFQSMHAG
FT                   ELPAGIVEIGLPGGTSDVGALSTLFHETQWSEILDKAYGELGMVRLEPYIQPPVYVITK
FT                   KEITSIDDFEGLKIRAPGAYGKFLRNLGASPVSLAWSEIYTSMATGVIDGSIGSNMIDH
FT                   RDGNHVEVAKYMYALPLAGAQVLPIVVNQKAWSKLTPDLQAIVRGASAIHAQEQMTKSV
FT                   LWESQAVAEMEAAGLKWSPEPSAADKKAWKEAGMSLAKEYSEEDKYSKQLVDILNAQ"
FT   sig_peptide     749993..750082
FT                   /locus_tag="Ping_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.517 at
FT                   residue 30"
FT   gene            751060..751596
FT                   /gene="dctQ-3"
FT                   /locus_tag="Ping_0571"
FT   CDS_pept        751060..751596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctQ-3"
FT                   /locus_tag="Ping_0571"
FT                   /product="tripartite ATP-independent periplasmic (TRAP)
FT                   C4-dicarboxylate transporter subunit DctQ"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: rde:RD1_0678 TRAP
FT                   dicarboxylate transporter, DctQ subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02425"
FT                   /db_xref="GOA:A1SSG0"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG0"
FT                   /protein_id="ABM02425.1"
FT                   /translation="MIVPVLQGYCRLVRYIVKGIGHTVPFLLPLLAGIVAFEVFSRYIL
FT                   NSPTIWVYDTSLFLFGYISALGGAYAQQRNAHINVDIIYLKVPLYLRRVFNVITIILAV
FT                   GFLILLAKMSFEKFQESLKFTYRTPSEWAPEVYHFWLMMTVSAVIFIAEYSAELIENIY
FT                   YLFTRKELSSKISSQ"
FT   gene            751679..752998
FT                   /locus_tag="Ping_0572"
FT   CDS_pept        751679..752998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0572"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: rde:RD1_0848 TRAP
FT                   dicarboxylate transporter, DctM subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02426"
FT                   /db_xref="GOA:A1SSG1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG1"
FT                   /protein_id="ABM02426.1"
FT                   /translation="MEIELLTGILLLCILVAFALGAQVGLALAGIAMGVGYLVWGEALF
FT                   NVIPSTVEGTFFNFILLAIPLYIYMGQILTRSGIGDAMFNASQLVIGRLRGSLAISVIG
FT                   VCSMIGAMVGIIGAGIMTSSSIALQPMLDRGYDKRLALGVIMAGGSLGILIPPSIPMIM
FT                   FAAATQNSVGRMFLAAMVPALITIVLLISYVLITCKLNPEKAPLDKENDIQIPKGYELF
FT                   RTIRDGFSSLLLIVAVLGSIIIGIATPTESGAIGVVGAIILAILFKRFKPAIMIKAGLQ
FT                   TSILVSVAMWIILGASVFSNFHLLMGVQTMVAGFATSLDLPPIYIIIMFQLIMLLLGFI
FT                   IDEFIIVLMCAPIFTPIAVSLGYDPIWFGVLMILNIVIAVQTPPYGFALFYLKGIAPKG
FT                   ITMMDIYKSVTPFILVQLVVLIICMVFPELVLWLPNKMMD"
FT   sig_peptide     751679..751768
FT                   /locus_tag="Ping_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.339 at
FT                   residue 30"
FT   gene            753546..754469
FT                   /locus_tag="Ping_0573"
FT   CDS_pept        753546..754469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0573"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ilo:IL2259 ABC-type multidrug transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02427"
FT                   /db_xref="GOA:A1SSG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG2"
FT                   /protein_id="ABM02427.1"
FT                   /translation="MHAIELENIRKVYKGGVEALKGISLRVEEGDFYALLGPNGAGKST
FT                   TIGIISSLVNKTEGKVKVFGYDLDTQLESVKAQIGLVPQEFNFNQFEPPIQILVNQAGY
FT                   YGIKRKDAFIRAEKYLRQLDLWGKRNAPSRELSGGMKRRLMIARALIHGPRLLILDEPT
FT                   AGVDIEVRRSMWEFLKKINAEGVTIVLTTHYLEEAEMLCRHIGIIDKGILVENTSMKEL
FT                   LARLDSEIFILDVDSLEKSPTSEHFIITKIDDITLEIEVKKGQSLNNIFAELTTQGVRV
FT                   HSLRNKSNRLEELFVGLVEKGNLNDE"
FT   gene            754459..755232
FT                   /locus_tag="Ping_0574"
FT   CDS_pept        754459..755232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0574"
FT                   /product="ABC-2 type transporter permease protein"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: vfi:VF2171 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02428"
FT                   /db_xref="GOA:A1SSG3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG3"
FT                   /protein_id="ABM02428.1"
FT                   /translation="MMNSNYLTALKSLCIKEVNRFLRIWVQTLIPPAITMTLYFVIFGN
FT                   LIGKRIGEMSGFSYMSFIVPGIIMMAVITNSYSNVASSFFSAKFQRNVEELLVAPVPNY
FT                   IIIWGYVGGGVIRGLLVGFIVTCVSLFFVELQIFNIFALLLSVLCTSILFSLAGLLNAI
FT                   FARTFDDISIIPTFVLTPLTYLGGVFYSIDLLPDFWQTVSHFNPVFYMINAFRYGFLGI
FT                   ADVSLLWSFSMIGSFIVLLYGLITLLLRKGVGIRS"
FT   gene            755229..755891
FT                   /locus_tag="Ping_0575"
FT   CDS_pept        755229..755891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0575"
FT                   /product="putative methyltransferase"
FT                   /note="PFAM: putative methyltransferase; KEGG:
FT                   pha:PSHAa2295 methyltransferase SAM dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02429"
FT                   /db_xref="GOA:A1SSG4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG4"
FT                   /protein_id="ABM02429.1"
FT                   /translation="MNESGNSRVISSNQSGLHEQLDEVVLKHLSHQFRKPYQKHTLDAF
FT                   TACEKWVEQQGKPIIFDSCCGVGESTYHLAERHPEAIVLGMDKSADRLSKHPQSSADNY
FT                   RLLQVNLNDFWRLAVEANWQLSHHYLLYPNPWPKAKHLQRRWHGSAVFPAIIQLGGELE
FT                   VRSNWFTYIHEFSRALQLAGQTCQLEEFQNKTPITPFERKYWTSGQKSLRLIADLNR"
FT   gene            755996..757021
FT                   /locus_tag="Ping_0576"
FT   CDS_pept        755996..757021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ping_0576"
FT                   /product="oxidoreductase, molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase, molybdopterin binding; KEGG:
FT                   ppr:PBPRB0739 putative reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ping_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM02430"
FT                   /db_xref="GOA:A1SSG5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A1SSG5"
FT                   /protein_id="ABM02430.1"
FT                   /translation="MLIKTRKKSDIKESQLTDEKVYKNRRVVLKALGLSALSIPLASSV
FT                   QAGLFDIFSDKEKTDNSDLIFKRSELIHTKNSRFQSLTPLTPEDKILQYNNFYEFGTGK
FT                   GDPFSFAQQFKVDPWQLVIDGLVDKPITLNYEELLTRFAIEERLYRMRCVEAWSMNIPW
FT                   LGFSLATLLKMASPKSNAKYVRFETLEDPKQMRGQSSRFIGGGLDYPYVEGLRLDEAMN
FT                   PLVLLSVGLYGKTLAPQNGAPIRLVVPWKYGFKSIKSIVKITLTDKAPVNTWQKIAANE
FT                   YGFFANVNPQVDHPRWSQASERFIGPGNLFAASRKPTLPFNGYQEEVASLYKGLDLTRY
FT                   Y"
FT   sig_peptide     755996..756139
FT                   /locus_tag="Ping_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.988 at
FT                   residue 48"
FT   gene            757034..757654
FT                   /locus_tag="Ping_0577"
FT