(data stored in ACNUC7421 zone)

EMBL: CP000511

ID   CP000511; SV 1; circular; genomic DNA; STD; PRO; 6491865 BP.
XX
AC   CP000511; AAPF01000000-AAPF01000025;
XX
PR   Project:PRJNA15761;
XX
DT   28-DEC-2006 (Rel. 90, Created)
DT   09-SEP-2019 (Rel. 142, Last updated, Version 7)
XX
DE   Mycobacterium vanbaalenii PYR-1, complete genome.
XX
KW   .
XX
OS   Mycolicibacterium vanbaalenii PYR-1
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycolicibacterium.
XX
RN   [1]
RP   1-6491865
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Singan V., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Anderson I.J., Miller C., Richardson P.;
RT   "Complete sequence of Mycobacterium vanbaalenii PYR-1";
RL   Unpublished.
XX
RN   [2]
RP   1-6491865
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Singan V., Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Anderson I.J., Miller C., Richardson P.;
RT   ;
RL   Submitted (13-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 62739310011bc60d96ff3ff38f12c41b.
DR   BioSample; SAMN02598347.
DR   EnsemblGenomes-Gn; EBG00001075206.
DR   EnsemblGenomes-Gn; EBG00001075212.
DR   EnsemblGenomes-Gn; EBG00001075213.
DR   EnsemblGenomes-Gn; EBG00001075214.
DR   EnsemblGenomes-Gn; EBG00001075216.
DR   EnsemblGenomes-Gn; EBG00001075218.
DR   EnsemblGenomes-Gn; EBG00001075221.
DR   EnsemblGenomes-Gn; EBG00001075225.
DR   EnsemblGenomes-Gn; EBG00001075226.
DR   EnsemblGenomes-Gn; EBG00001075227.
DR   EnsemblGenomes-Gn; EBG00001075228.
DR   EnsemblGenomes-Gn; EBG00001075229.
DR   EnsemblGenomes-Gn; EBG00001075231.
DR   EnsemblGenomes-Gn; EBG00001075233.
DR   EnsemblGenomes-Gn; EBG00001075234.
DR   EnsemblGenomes-Gn; EBG00001075235.
DR   EnsemblGenomes-Gn; EBG00001075236.
DR   EnsemblGenomes-Gn; EBG00001075237.
DR   EnsemblGenomes-Gn; EBG00001075238.
DR   EnsemblGenomes-Gn; EBG00001075239.
DR   EnsemblGenomes-Gn; EBG00001075240.
DR   EnsemblGenomes-Gn; EBG00001075241.
DR   EnsemblGenomes-Gn; EBG00001075242.
DR   EnsemblGenomes-Gn; EBG00001075243.
DR   EnsemblGenomes-Gn; EBG00001075244.
DR   EnsemblGenomes-Gn; EBG00001075245.
DR   EnsemblGenomes-Gn; EBG00001075246.
DR   EnsemblGenomes-Gn; EBG00001075247.
DR   EnsemblGenomes-Gn; EBG00001075248.
DR   EnsemblGenomes-Gn; EBG00001075249.
DR   EnsemblGenomes-Gn; EBG00001075250.
DR   EnsemblGenomes-Gn; EBG00001075251.
DR   EnsemblGenomes-Gn; EBG00001075252.
DR   EnsemblGenomes-Gn; EBG00001075253.
DR   EnsemblGenomes-Gn; EBG00001075254.
DR   EnsemblGenomes-Gn; EBG00001075255.
DR   EnsemblGenomes-Gn; EBG00001075257.
DR   EnsemblGenomes-Gn; EBG00001075259.
DR   EnsemblGenomes-Gn; EBG00001075260.
DR   EnsemblGenomes-Gn; EBG00001075261.
DR   EnsemblGenomes-Gn; EBG00001075262.
DR   EnsemblGenomes-Gn; EBG00001075263.
DR   EnsemblGenomes-Gn; EBG00001075264.
DR   EnsemblGenomes-Gn; EBG00001075265.
DR   EnsemblGenomes-Gn; EBG00001075266.
DR   EnsemblGenomes-Gn; EBG00001075267.
DR   EnsemblGenomes-Gn; EBG00001075268.
DR   EnsemblGenomes-Gn; EBG00001075269.
DR   EnsemblGenomes-Gn; EBG00001075270.
DR   EnsemblGenomes-Gn; EBG00001075271.
DR   EnsemblGenomes-Gn; EBG00001075272.
DR   EnsemblGenomes-Gn; EBG00001075273.
DR   EnsemblGenomes-Gn; EBG00001075274.
DR   EnsemblGenomes-Gn; EBG00001075275.
DR   EnsemblGenomes-Gn; EBG00001075276.
DR   EnsemblGenomes-Gn; EBG00001075277.
DR   EnsemblGenomes-Gn; EBG00001075278.
DR   EnsemblGenomes-Gn; EBG00001075279.
DR   EnsemblGenomes-Gn; EBG00001075280.
DR   EnsemblGenomes-Gn; EBG00001075281.
DR   EnsemblGenomes-Gn; EBG00001075282.
DR   EnsemblGenomes-Gn; EBG00001075283.
DR   EnsemblGenomes-Gn; EBG00001075284.
DR   EnsemblGenomes-Gn; EBG00001075285.
DR   EnsemblGenomes-Gn; EBG00001075286.
DR   EnsemblGenomes-Gn; EBG00001075287.
DR   EnsemblGenomes-Gn; EBG00001075288.
DR   EnsemblGenomes-Gn; EBG00001075289.
DR   EnsemblGenomes-Gn; EBG00001075290.
DR   EnsemblGenomes-Gn; EBG00001075291.
DR   EnsemblGenomes-Gn; EBG00001075292.
DR   EnsemblGenomes-Gn; EBG00001075293.
DR   EnsemblGenomes-Gn; EBG00001075294.
DR   EnsemblGenomes-Gn; EBG00001075295.
DR   EnsemblGenomes-Gn; EBG00001075296.
DR   EnsemblGenomes-Gn; EBG00001075297.
DR   EnsemblGenomes-Gn; EBG00001075298.
DR   EnsemblGenomes-Gn; Mvan_R0001.
DR   EnsemblGenomes-Gn; Mvan_R0002.
DR   EnsemblGenomes-Gn; Mvan_R0003.
DR   EnsemblGenomes-Gn; Mvan_R0006.
DR   EnsemblGenomes-Gn; Mvan_R0007.
DR   EnsemblGenomes-Gn; Mvan_R0009.
DR   EnsemblGenomes-Gn; Mvan_R0010.
DR   EnsemblGenomes-Gn; Mvan_R0011.
DR   EnsemblGenomes-Gn; Mvan_R0012.
DR   EnsemblGenomes-Gn; Mvan_R0013.
DR   EnsemblGenomes-Gn; Mvan_R0014.
DR   EnsemblGenomes-Gn; Mvan_R0015.
DR   EnsemblGenomes-Gn; Mvan_R0016.
DR   EnsemblGenomes-Gn; Mvan_R0017.
DR   EnsemblGenomes-Gn; Mvan_R0018.
DR   EnsemblGenomes-Gn; Mvan_R0019.
DR   EnsemblGenomes-Gn; Mvan_R0020.
DR   EnsemblGenomes-Gn; Mvan_R0021.
DR   EnsemblGenomes-Gn; Mvan_R0022.
DR   EnsemblGenomes-Gn; Mvan_R0023.
DR   EnsemblGenomes-Gn; Mvan_R0024.
DR   EnsemblGenomes-Gn; Mvan_R0025.
DR   EnsemblGenomes-Gn; Mvan_R0026.
DR   EnsemblGenomes-Gn; Mvan_R0027.
DR   EnsemblGenomes-Gn; Mvan_R0028.
DR   EnsemblGenomes-Gn; Mvan_R0029.
DR   EnsemblGenomes-Gn; Mvan_R0031.
DR   EnsemblGenomes-Gn; Mvan_R0032.
DR   EnsemblGenomes-Gn; Mvan_R0033.
DR   EnsemblGenomes-Gn; Mvan_R0034.
DR   EnsemblGenomes-Gn; Mvan_R0035.
DR   EnsemblGenomes-Gn; Mvan_R0036.
DR   EnsemblGenomes-Gn; Mvan_R0037.
DR   EnsemblGenomes-Gn; Mvan_R0038.
DR   EnsemblGenomes-Gn; Mvan_R0039.
DR   EnsemblGenomes-Gn; Mvan_R0040.
DR   EnsemblGenomes-Gn; Mvan_R0041.
DR   EnsemblGenomes-Gn; Mvan_R0042.
DR   EnsemblGenomes-Gn; Mvan_R0043.
DR   EnsemblGenomes-Gn; Mvan_R0045.
DR   EnsemblGenomes-Gn; Mvan_R0046.
DR   EnsemblGenomes-Gn; Mvan_R0047.
DR   EnsemblGenomes-Gn; Mvan_R0048.
DR   EnsemblGenomes-Gn; Mvan_R0050.
DR   EnsemblGenomes-Gn; Mvan_R0051.
DR   EnsemblGenomes-Gn; Mvan_R0052.
DR   EnsemblGenomes-Gn; Mvan_R0053.
DR   EnsemblGenomes-Gn; Mvan_R0054.
DR   EnsemblGenomes-Gn; Mvan_R0056.
DR   EnsemblGenomes-Gn; Mvan_R0057.
DR   EnsemblGenomes-Gn; Mvan_R0059.
DR   EnsemblGenomes-Gn; Mvan_R0060.
DR   EnsemblGenomes-Gn; Mvan_R0061.
DR   EnsemblGenomes-Gn; Mvan_R0062.
DR   EnsemblGenomes-Gn; Mvan_R0063.
DR   EnsemblGenomes-Gn; Mvan_R0064.
DR   EnsemblGenomes-Tr; EBT00001677527.
DR   EnsemblGenomes-Tr; EBT00001677528.
DR   EnsemblGenomes-Tr; EBT00001677529.
DR   EnsemblGenomes-Tr; EBT00001677530.
DR   EnsemblGenomes-Tr; EBT00001677531.
DR   EnsemblGenomes-Tr; EBT00001677532.
DR   EnsemblGenomes-Tr; EBT00001677533.
DR   EnsemblGenomes-Tr; EBT00001677534.
DR   EnsemblGenomes-Tr; EBT00001677535.
DR   EnsemblGenomes-Tr; EBT00001677536.
DR   EnsemblGenomes-Tr; EBT00001677537.
DR   EnsemblGenomes-Tr; EBT00001677538.
DR   EnsemblGenomes-Tr; EBT00001677539.
DR   EnsemblGenomes-Tr; EBT00001677540.
DR   EnsemblGenomes-Tr; EBT00001677541.
DR   EnsemblGenomes-Tr; EBT00001677542.
DR   EnsemblGenomes-Tr; EBT00001677543.
DR   EnsemblGenomes-Tr; EBT00001677544.
DR   EnsemblGenomes-Tr; EBT00001677545.
DR   EnsemblGenomes-Tr; EBT00001677546.
DR   EnsemblGenomes-Tr; EBT00001677547.
DR   EnsemblGenomes-Tr; EBT00001677548.
DR   EnsemblGenomes-Tr; EBT00001677549.
DR   EnsemblGenomes-Tr; EBT00001677550.
DR   EnsemblGenomes-Tr; EBT00001677551.
DR   EnsemblGenomes-Tr; EBT00001677552.
DR   EnsemblGenomes-Tr; EBT00001677553.
DR   EnsemblGenomes-Tr; EBT00001677554.
DR   EnsemblGenomes-Tr; EBT00001677555.
DR   EnsemblGenomes-Tr; EBT00001677556.
DR   EnsemblGenomes-Tr; EBT00001677557.
DR   EnsemblGenomes-Tr; EBT00001677558.
DR   EnsemblGenomes-Tr; EBT00001677559.
DR   EnsemblGenomes-Tr; EBT00001677560.
DR   EnsemblGenomes-Tr; EBT00001677561.
DR   EnsemblGenomes-Tr; EBT00001677562.
DR   EnsemblGenomes-Tr; EBT00001677563.
DR   EnsemblGenomes-Tr; EBT00001677564.
DR   EnsemblGenomes-Tr; EBT00001677565.
DR   EnsemblGenomes-Tr; EBT00001677566.
DR   EnsemblGenomes-Tr; EBT00001677567.
DR   EnsemblGenomes-Tr; EBT00001677568.
DR   EnsemblGenomes-Tr; EBT00001677569.
DR   EnsemblGenomes-Tr; EBT00001677570.
DR   EnsemblGenomes-Tr; EBT00001677571.
DR   EnsemblGenomes-Tr; EBT00001677572.
DR   EnsemblGenomes-Tr; EBT00001677573.
DR   EnsemblGenomes-Tr; EBT00001677574.
DR   EnsemblGenomes-Tr; EBT00001677575.
DR   EnsemblGenomes-Tr; EBT00001677576.
DR   EnsemblGenomes-Tr; EBT00001677577.
DR   EnsemblGenomes-Tr; EBT00001677578.
DR   EnsemblGenomes-Tr; EBT00001677579.
DR   EnsemblGenomes-Tr; EBT00001677580.
DR   EnsemblGenomes-Tr; EBT00001677581.
DR   EnsemblGenomes-Tr; EBT00001677582.
DR   EnsemblGenomes-Tr; EBT00001677583.
DR   EnsemblGenomes-Tr; EBT00001677584.
DR   EnsemblGenomes-Tr; EBT00001677585.
DR   EnsemblGenomes-Tr; EBT00001677586.
DR   EnsemblGenomes-Tr; EBT00001677587.
DR   EnsemblGenomes-Tr; EBT00001677588.
DR   EnsemblGenomes-Tr; EBT00001677589.
DR   EnsemblGenomes-Tr; EBT00001677590.
DR   EnsemblGenomes-Tr; EBT00001677591.
DR   EnsemblGenomes-Tr; EBT00001677592.
DR   EnsemblGenomes-Tr; EBT00001677593.
DR   EnsemblGenomes-Tr; EBT00001677594.
DR   EnsemblGenomes-Tr; EBT00001677595.
DR   EnsemblGenomes-Tr; EBT00001677596.
DR   EnsemblGenomes-Tr; EBT00001677597.
DR   EnsemblGenomes-Tr; EBT00001677598.
DR   EnsemblGenomes-Tr; EBT00001677599.
DR   EnsemblGenomes-Tr; EBT00001677600.
DR   EnsemblGenomes-Tr; EBT00001677601.
DR   EnsemblGenomes-Tr; EBT00001677602.
DR   EnsemblGenomes-Tr; EBT00001677603.
DR   EnsemblGenomes-Tr; Mvan_R0001-1.
DR   EnsemblGenomes-Tr; Mvan_R0002-1.
DR   EnsemblGenomes-Tr; Mvan_R0003-1.
DR   EnsemblGenomes-Tr; Mvan_R0006-1.
DR   EnsemblGenomes-Tr; Mvan_R0007-1.
DR   EnsemblGenomes-Tr; Mvan_R0009-1.
DR   EnsemblGenomes-Tr; Mvan_R0010-1.
DR   EnsemblGenomes-Tr; Mvan_R0011-1.
DR   EnsemblGenomes-Tr; Mvan_R0012-1.
DR   EnsemblGenomes-Tr; Mvan_R0013-1.
DR   EnsemblGenomes-Tr; Mvan_R0014-1.
DR   EnsemblGenomes-Tr; Mvan_R0015-1.
DR   EnsemblGenomes-Tr; Mvan_R0016-1.
DR   EnsemblGenomes-Tr; Mvan_R0017-1.
DR   EnsemblGenomes-Tr; Mvan_R0018-1.
DR   EnsemblGenomes-Tr; Mvan_R0019-1.
DR   EnsemblGenomes-Tr; Mvan_R0020-1.
DR   EnsemblGenomes-Tr; Mvan_R0021-1.
DR   EnsemblGenomes-Tr; Mvan_R0022-1.
DR   EnsemblGenomes-Tr; Mvan_R0023-1.
DR   EnsemblGenomes-Tr; Mvan_R0024-1.
DR   EnsemblGenomes-Tr; Mvan_R0025-1.
DR   EnsemblGenomes-Tr; Mvan_R0026-1.
DR   EnsemblGenomes-Tr; Mvan_R0027-1.
DR   EnsemblGenomes-Tr; Mvan_R0028-1.
DR   EnsemblGenomes-Tr; Mvan_R0029-1.
DR   EnsemblGenomes-Tr; Mvan_R0031-1.
DR   EnsemblGenomes-Tr; Mvan_R0032-1.
DR   EnsemblGenomes-Tr; Mvan_R0033-1.
DR   EnsemblGenomes-Tr; Mvan_R0034-1.
DR   EnsemblGenomes-Tr; Mvan_R0035-1.
DR   EnsemblGenomes-Tr; Mvan_R0036-1.
DR   EnsemblGenomes-Tr; Mvan_R0037-1.
DR   EnsemblGenomes-Tr; Mvan_R0038-1.
DR   EnsemblGenomes-Tr; Mvan_R0039-1.
DR   EnsemblGenomes-Tr; Mvan_R0040-1.
DR   EnsemblGenomes-Tr; Mvan_R0041-1.
DR   EnsemblGenomes-Tr; Mvan_R0042-1.
DR   EnsemblGenomes-Tr; Mvan_R0043-1.
DR   EnsemblGenomes-Tr; Mvan_R0045-1.
DR   EnsemblGenomes-Tr; Mvan_R0046-1.
DR   EnsemblGenomes-Tr; Mvan_R0047-1.
DR   EnsemblGenomes-Tr; Mvan_R0048-1.
DR   EnsemblGenomes-Tr; Mvan_R0050-1.
DR   EnsemblGenomes-Tr; Mvan_R0051-1.
DR   EnsemblGenomes-Tr; Mvan_R0052-1.
DR   EnsemblGenomes-Tr; Mvan_R0053-1.
DR   EnsemblGenomes-Tr; Mvan_R0054-1.
DR   EnsemblGenomes-Tr; Mvan_R0056-1.
DR   EnsemblGenomes-Tr; Mvan_R0057-1.
DR   EnsemblGenomes-Tr; Mvan_R0059-1.
DR   EnsemblGenomes-Tr; Mvan_R0060-1.
DR   EnsemblGenomes-Tr; Mvan_R0061-1.
DR   EnsemblGenomes-Tr; Mvan_R0062-1.
DR   EnsemblGenomes-Tr; Mvan_R0063-1.
DR   EnsemblGenomes-Tr; Mvan_R0064-1.
DR   EuropePMC; PMC2937484; 20656856.
DR   EuropePMC; PMC3271072; 22319448.
DR   EuropePMC; PMC4103549; 22673307.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC5550956; 28793878.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP000511.
DR   SILVA-SSU; CP000511.
DR   StrainInfo; 160662; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID:  4000382
CC   Source DNA and bacteria available from Charles Miller
CC   (cdmiller@biology.usu.edu)
CC   Contacts: Charles Miller (cdmiller@biology.usu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6491865
FT                   /organism="Mycolicibacterium vanbaalenii PYR-1"
FT                   /strain="PYR-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:350058"
FT                   /type_material="type strain of Mycolicibacterium
FT                   vanbaalenii"
FT   gene            249..1733
FT                   /locus_tag="Mvan_0001"
FT   CDS_pept        249..1733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mmc:Mmcs_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10852"
FT                   /db_xref="GOA:A1T102"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T102"
FT                   /protein_id="ABM10852.1"
FT                   /translation="MTTDPDPPFVSIWDNVVTELNGAGEVGNGSLTPQQRAWLKLVKPL
FT                   VITEGFALLSVPTPFVQNEIERHLREPIVAALSRQLGQRVELGVRIADPVSDESDSGSV
FT                   ASPAPVAAADPDDDVVDDDLAARASAEESWPSYFTNRANRAAEDDATSVNLNRRYTFDT
FT                   FVIGASNRFAHAASLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRVK
FT                   YVSTEEFTNDFINSLRDDRRASFKRTYRDIDVLLVDDIQFIEGKDGIQEEFFHTFNTLH
FT                   NANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLDV
FT                   PGDVLELIASRIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISDSSTMQIS
FT                   TAAIMAATAEYFETSVEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDHT
FT                   TVMYAEKKIRAEMAERREVFDHVKELTTRIRQRAKR"
FT   gene            2309..3505
FT                   /locus_tag="Mvan_0002"
FT   CDS_pept        2309..3505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mmc:Mmcs_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10853"
FT                   /db_xref="GOA:A1T103"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1T103"
FT                   /protein_id="ABM10853.1"
FT                   /translation="MNVPTTAGLTDLKFRLTREDFADAVAWVARNLPSRPTVPVLAGVL
FT                   LTGSDEGLTISGFDYEVSAEVQIPAEIASPGSVLVSGRLLSDIVRALPAKPVDVSVEGT
FT                   RVSLTCGSARFSLPTMPVEDYPTLPTLPDETGVVSSDLFAEAIGQVAVAAGRDDTLPML
FT                   TGIRVEISGEKVVLAATDRFRLAVRELTWSTGAAGVEAAVLVPAKTLAEAAKAGTDGNE
FT                   VHLALGAGPSVGKEGLLGIRSKGKRSTTRLLDAEFPKFRQLLPTEHTAIATIGVAELTE
FT                   AIKRVALVADRGAQVRMEFADGVLRLSAGADDVGRAEEDLPVEFSGDPLTIAFNPTYLT
FT                   DGLSSLHAERVTFGFTTPSRPAVLRPAAEDDGGAGGSGPFPAAQTDYVYLLMPVRLPG"
FT   gene            3537..4430
FT                   /locus_tag="Mvan_0003"
FT   CDS_pept        3537..4430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0003"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: mmc:Mmcs_0003 6-phosphogluconate
FT                   dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10854"
FT                   /db_xref="GOA:A1T104"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T104"
FT                   /protein_id="ABM10854.1"
FT                   /translation="MQLGLIGLGKMGFNMRARLRDGGHDVVGFDPRPEVSDVASLADLA
FT                   ARLSAPRVVWVMVPSGTVTDSTISELAGVLSPGDLVIDGGNSRYTEDGRHANLLAEKGI
FT                   AFIDAGVSGGIWGLTEGYGLMVGGSDADVARAMPIFETLRPPGPLEDGFVHVGPVGAGH
FT                   FAKMVHNGIEYALMTAYAEGYEMLAAEDLVKDPQAVYQAWTNGTVVRSWLQQLLAKALK
FT                   EDPSLSDISGYTEDSGEGRWTVEEAIRLRVPVPGIAASLFARFLSRQDESPTMKAVAAL
FT                   RNQFGGHAVKRVSESG"
FT   gene            4444..5604
FT                   /locus_tag="Mvan_0004"
FT   CDS_pept        4444..5604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mmc:Mmcs_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10855"
FT                   /db_xref="GOA:A1T105"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T105"
FT                   /protein_id="ABM10855.1"
FT                   /translation="MYVRHLALTDFRSWARVELELEPGRTVFVGSNGFGKTNLIEALWY
FT                   SATLGSHRVASDAPLIRAGAERAVVSTIVVNDGRELAVDLDITSGRANKARLNRSPVRS
FT                   AREILGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPRIAAVRADYDKVVRQRTA
FT                   LLKTASGARYRGDRGALETLDVWNGHLASHGAQLISARVQLVNELAPEVEKAYQLLAPG
FT                   SRPAAIRYRSGVDVVEAEAAAGNSDEEMFEAALLDALSRRRDAELERGVCLVGPHRDDL
FT                   ELRLGDQVAKGFASHGESWSMALALRLAAYELLRVEGSDPVLLLDDVFAELDSARRQAL
FT                   AQVAATAEQVLVTAAVEEDIPAEWDARRIGITMQDSDGGRISVVRT"
FT   gene            5601..6158
FT                   /locus_tag="Mvan_0005"
FT   CDS_pept        5601..6158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   mmc:Mmcs_0005 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10856"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:A1T106"
FT                   /protein_id="ABM10856.1"
FT                   /translation="MTEEDDALNPPAHLEGLKGMDLVRRTLEEARGAARQQGKNVGLGR
FT                   YSPTARRVAGSGRRRWSGPGPDSRDPQLLGAVTGDVARTRGWSAKVAEGAVFGRWRAVV
FT                   GDQIAAHAAPTALHEGVLTVSAESTAWATQLRMVQSQILAKIAAAVGDGVVTSLKIVGP
FT                   VGPSWRKGPYTVPGRGPRDTYG"
FT   gene            6390..8417
FT                   /locus_tag="Mvan_0006"
FT   CDS_pept        6390..8417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0006"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: mmc:Mmcs_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10857"
FT                   /db_xref="GOA:A1T107"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1T107"
FT                   /protein_id="ABM10857.1"
FT                   /translation="MAAQKKNAPAEYGADSIKVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   IWEVVDNAVDEAMAGFATKVDVRILEDGGVQVTDDGRGIPVAMHSTGIPTVDVVMTVLH
FT                   AGGKFEEGAYQVSGGLHGVGVSVVNALSTRLEADIRKDGYEWHQTYDRSVPGTLKQGEK
FT                   SKDTGTTIRFWADPDIFETTNYDFETIARRLQEMAFLNKGLTIELTDERVTPADVVDDV
FT                   VSDHAEAPKSAEEKAAEAAAPQKVKHRVFHYPGGLVDFVKHINRTKTPIQPSIIDFDGK
FT                   GEGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRAALTSVVNKYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSQPQFEGQTKTKLGNTEVKSFVQKICNEQLSHWFEAN
FT                   PAEAKTVVNKAVSSAQARMAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLVENGHIFLAQPPLYKLKWQRS
FT                   DPEFAYSDRERDGLLEAGRAAGKRINVEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   VTLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
FT   gene            8449..12237
FT                   /locus_tag="Mvan_0007"
FT   CDS_pept        8449..12237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0007"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: mmc:Mmcs_0007 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV,
FT                   subunit A; DNA gyrase C-terminal repeat, beta-propeller;
FT                   SMART: Hedgehog/intein hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10858"
FT                   /db_xref="GOA:A1T108"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1T108"
FT                   /protein_id="ABM10858.1"
FT                   /translation="MTDTTLPPGGEAGDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMFDSGFRPDRGHAKSARSVAETMGNYHPHGDASIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYCLTGDSMVRLPFGQSVRIGDVVSGARPNSDNEI
FT                   ELKVLDRHGNPVLADALFHSGDHETFTVRTAEGYEVTGTANHPLLCLVDVGGVPTLLWK
FT                   LIAEIRPSDRVVLQRTPPVEFGPADWYETMEALLLGAFISEGFVSESRAGFNNLDRDYF
FT                   NMVVAAYDTVVGGPRYVYERKIASGSTLLELDIQNLASLRQSRLVGLLGQRSAAKMVPE
FT                   WLWNSAAAVKRAFLQALFEGDGSCSALPRNTIQVSYSTRSGQLAKDVQQMLLEFGVISR
FT                   RYLHATGEHKVVITNRSSAEAFCTRVGFGGAKQHKLQKLLSDLPERAAGLDGDHVPGLA
FT                   AFIRRESGSKWVDKEWLRKHNIDRLSRWRRDGSEILSRIADPDVRAIATELTDGRFYYA
FT                   EVATVVSAGVQPVYSLRVDTDDHSFISNGFVSHNTEARLTPLAMEMLREIDEETVDFIP
FT                   NYDGRVQEPTVLPSRFPNLLANGSGGIAVGMATNMPPHNLRELAEAVYWCLENYEADEE
FT                   ATLEAVCERVKGPDFPTHGLIVGSQGISDTYTTGRGSIRMRGVVEIEEDSRGRTSLVIT
FT                   ELPYQVNHDNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVEIKRDAVAKVVLNNL
FT                   YKHTQLQTSFGANMLSIVDGVPRTLRLDQLIRLYVNHQLDVIVRRTTYRLRKANERAHI
FT                   LRGLVKALDALDEVIALIRASQTVEIARSGLIELLDIDEIQAQAILDMQLRRLAALERQ
FT                   RIIDDLAKIEAEIADLEDILAKPERQRAIVHDELKELVDKYGDDRRTRIIPADGDVADE
FT                   DLIAREEVVVTITETGYAKRTKSDLYRSQKRGGKGVQGAGLKQDDIVNHFFVCSTHDWI
FT                   LFFTTQGRVYRAKAYDLPEASRTARGQHVANLLAFQPEERIAQVIQLKSYEDAPYLVLA
FT                   TRNGLVKKSRLVDFDSNRSGGIVAVNLRDGDELVGAVLCSAEDDLLLVSAKGQSIRFSA
FT                   TDEALRPMGRATSGVQGMRFNEEDQLLSLNVVREDTYLLVATSGGYAKRTAIEEYSAQG
FT                   RGGKGILTIQYDRRRGTLVGALIVDDDTELYAITSGGGVIRTAARQVRKAGRQTKGVRL
FT                   MNLGEGDTLIAIARNAEAGDSTDEVNTDPDATDDEES"
FT   gene            12238..13143
FT                   /locus_tag="Mvan_0008"
FT   CDS_pept        12238..13143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10859"
FT                   /db_xref="GOA:A1T109"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A1T109"
FT                   /protein_id="ABM10859.1"
FT                   /translation="MSSPQEPGYPRAGDAANGPAAGPAGSGHDGGPRPAHTAEGADVPP
FT                   WQRGPAGRARQHQAPEGAQGEGPRPNAPGGLDARLNRFMAGGSAPAGSQETEPAPAPRN
FT                   ARTEVVRTEGNRPEPGPRPDQGAAYASEIPDLSGPRPPQQRKPVDRPVPEQQPKPTPKP
FT                   APPAGNRAVQVATRAHTGPVRASMQIRRVDPWSTLKVSLLLSVVLFFVWMIAVAFLYLV
FT                   LGGMGVWSKLNSNVGDLLTSASGSSGGELVSSGTIFGGAALIGLVNIVLLTAAATIGAF
FT                   IYNLTTDLVGGVEVTLADRD"
FT   gene            13216..13289
FT                   /locus_tag="Mvan_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            13216..13289
FT                   /locus_tag="Mvan_R0001"
FT                   /product="tRNA-Ile"
FT   gene            13436..13511
FT                   /locus_tag="Mvan_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            13436..13511
FT                   /locus_tag="Mvan_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(13523..13717)
FT                   /locus_tag="Mvan_0009"
FT   CDS_pept        complement(13523..13717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4655 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10860"
FT                   /db_xref="UniProtKB/TrEMBL:A1T110"
FT                   /protein_id="ABM10860.1"
FT                   /translation="MRITVDYTLCEGHGQCLMAAPTVFDLPDGSEQVVVIDPDPPATER
FT                   DAVVRAAAMCPAGALRVGD"
FT   gene            complement(13823..14485)
FT                   /locus_tag="Mvan_0010"
FT   CDS_pept        complement(13823..14485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0010"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: mmc:Mmcs_4654 two component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10861"
FT                   /db_xref="GOA:A1T111"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1T111"
FT                   /protein_id="ABM10861.1"
FT                   /translation="MHHGPFVIVIVDDHELFAEGLELLLRRDWGEQFVIGGRTTFVEEA
FT                   ADLVGSCNADLAIVDLSMPPLGGVAAIRHIKARHPATRILALSGTDDHQLAEDALRAGA
FT                   DGFLSKTVRPEALVGPLQTIAAGLKVLDPGLLDRLLSSTRKPASSLADSLTPADLKLWT
FT                   LLSTGMETVDIAARMVVSERTAKRMVASLLHRLGVNNRIAAAALAGRSGLLEDLAEG"
FT   gene            14567..15862
FT                   /locus_tag="Mvan_0011"
FT   CDS_pept        14567..15862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0011"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase A domain protein domain
FT                   protein; KEGG: mmc:Mmcs_4653 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10862"
FT                   /db_xref="GOA:A1T112"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1T112"
FT                   /protein_id="ABM10862.1"
FT                   /translation="MNTAGRLRAFVVPSADRFGLARVVVSVRVVVVLSVIVLAAFGPDW
FT                   MRRQPVALAVVLAGTLAYAAVVMARPNLEVRRTRYAWLVSLLDTGFSLVLIGLTGGVDS
FT                   PVVAALTLVVIASAARLTLAECLGFAGLAGLGYFVVVLVSPAGRGTGLAAPVQGLWWAL
FT                   YLVFIALLSGALSVLLEREHQSRVKALVEAEAEHAAAEEERDLRARLLRSYEAQQEGLQ
FT                   VLLHEFRTPVASLDALTEALVSSEMGSVDRESALKLAGRHARHLSDMLDSLADVNLSRQ
FT                   PAFSSGRVRRIDLAEVIGVAGDAAGIRPPRLQISISGETSAIHVDAQGLRRVLTNLLEN
FT                   AARHGRGLPIDVVCECGDGHLSVAVSDRGPGVPQEDLGQLTTKFVSLSDRHGTAGLGLW
FT                   IVAEIVDALGGTLRFTARDEGGLTASFTIPVN"
FT   gene            16015..17283
FT                   /locus_tag="Mvan_0012"
FT   CDS_pept        16015..17283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0012"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_4652
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10863"
FT                   /db_xref="GOA:A1T113"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T113"
FT                   /protein_id="ABM10863.1"
FT                   /translation="MTTAVPTHRDIDLSDRNFWARPHEERDAAFAVLRRENPVPWSRPA
FT                   DSDLLPPEQNLKGFWSLTKHEDIRYASRHPEIFSSAEGITVEDFPVEIRMMSQSFIAMD
FT                   APRHTQLRGITLDAFKPRNMLRLQDWIQGHARDLISEISHLGEGDFVDLVSVKLPGRIF
FT                   GSFFGLPPGELHEKTINAAQRTLGWTDPEVRGDLTAVELFVGAVMDLHETVTTLLPERR
FT                   ANPGDDLLSWMVQAEFDGEKMTDDELKAFFTLLAVAANDTTRHASAHAILAFSQFPDQR
FT                   DLLVADVEGRVDTAVEEVLRWASPLVHMRRTAVQDVTLRGSEIKAGDKVVLWYSSANRD
FT                   EDIFEDPFKFDIARNPNPHIAFGGGGPHFCLGAALARTMLRSLLTEVYTRIPDISAPEP
FT                   RYQVANFINGINSLPATWTPERR"
FT   gene            17306..18424
FT                   /locus_tag="Mvan_0013"
FT   CDS_pept        17306..18424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0013"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_4651 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10864"
FT                   /db_xref="GOA:A1T114"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T114"
FT                   /protein_id="ABM10864.1"
FT                   /translation="MKTKAAVLWGLHQKWEVEELELDAPRAQEVLVKLTASGLCHSDDH
FT                   LVTGDMPMNLPVVGGHEGAGVVVDVGPGVTEVEAGDHVVLSFIPACGRCTECARGRSNL
FT                   CVYGAAIVAGPQLDGTFRFHGSSGGRAYDIGQMCVLGTFSEYTVVPIASVVKVDNDIPL
FT                   DKAALVGCGVTTGYGAAVRTGEAADGDTVVVMGVGGLGINAIQGAAIAGARNVVALDPV
FT                   AYKRERSFEFGATHAAADVAEAQALITDLTRGTMADVCVVTTDSAEGAYVAQALSLVGK
FT                   RGRVVMTAIPHPTDTVVDMSLFDLTLYEKQVRGCLFGSSNPRLDIPRLLDLYGSGRLKL
FT                   DELITREYTLEEINQGYEDMHNGRNLRGVIRF"
FT   gene            18488..20005
FT                   /locus_tag="Mvan_0014"
FT   CDS_pept        18488..20005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0014"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_4650
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10865"
FT                   /db_xref="GOA:A1T115"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1T115"
FT                   /protein_id="ABM10865.1"
FT                   /translation="MSDIPHYRMYIDGAWRDAADTIEVRSPATGELVATVAYGGVTTVD
FT                   DAVAAAKAADEAGVWRNTSAQQRADVLDAIADNLAARTDELTALQVAENGATVRAAGAF
FT                   LIGYAIAHLRYFAGLARTYAFQSSGPLMEAPTLAAGMIVRDPVGVCAGMIPWNFPLLLA
FT                   VWKLGPALAAGNTVVLKPDDQTPLTLLELARAADEVGLPAGVLNVVTGAGPTVGARLAE
FT                   HPDVRKVAFTGSTEVGKSVMRAAADTVKKVTLELGGKGASIVLDDADLDLAVDGSLFAF
FT                   LLMSGQACESGTRLLVHESIHDEFVRRMVARAETLVMGDPMSLASDLGPLVSAKQKARV
FT                   EKYIALGQEEGCKLAYQGTVPTDPALAQGHWVPPTILTGATNDMRIAREEIFGPVLVVL
FT                   TYGDDDEAVAIANDSEYGLSAGVWSADRERALGIARRLQSGTVWVNDWHMINAMYPFGG
FT                   VKQSGLGRELGPDALDEYTEPKFIHVDMTDDRRKHVYPVVISAAAQG"
FT   gene            20015..21550
FT                   /locus_tag="Mvan_0015"
FT   CDS_pept        20015..21550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0015"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_4649 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10866"
FT                   /db_xref="GOA:A1T116"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T116"
FT                   /protein_id="ABM10866.1"
FT                   /translation="MYPGTHARTAPERAAVVVAETGETLSYRRLDEQSAALARVLHDAG
FT                   LRPGDVVVLLSDNAPEALVVLWAAQRSGLYVTAINHHLTPAEAGYIVCDSGARALVASA
FT                   ALRELADGVVAEAGGPEVRIAFGGRIDGFADYESTLAAAGPPLAEQPCGAVMLYSSGTT
FT                   GFPKGIRPDLPERSVDQPGDPVVAIAGGLFGITSSDVYFSSAPIYHAAPLRWCGMVHAL
FT                   GGTVVLAKRFDAADTLRYIEKFRITATQMVPTMFVRMLKLNDEVRSRYDLSSLRGVIHA
FT                   AAPCPVDVKQAMIDWLGPIIWEYYSSTEVHGMTVIDTGQWLSHQGSVGRSVLGTLHICD
FT                   DDGHDLPAGEVGTVYFERDALPFSYHNAPEKTAEAQHPAHPFWTTVGDLGYVDDEGYLY
FT                   LADRKAFMIISGGVNIYPQEVENALTLHPAVHDVAVIGVPDPEMGEQVKAVVHLTAGVD
FT                   PSEELARELIDYTRARIAHYKAPRSVDFVDDLPRTPTGKLVKGKLRERYLVDV"
FT   gene            complement(21673..22107)
FT                   /locus_tag="Mvan_0016"
FT   CDS_pept        complement(21673..22107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0016"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: mbo:Mb0008c possible membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10867"
FT                   /db_xref="GOA:A1T117"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A1T117"
FT                   /protein_id="ABM10867.1"
FT                   /translation="MSSTTRVRLTPSQRLSRGLMYSTVGPIDVTRGAVGLGVESARSSA
FT                   VWAGNKYRRSKMARQLKAELAAAQEAIAVEVAAAQEVVAGLPQALEKARRSRRRKRPLL
FT                   LAGIAVVVLAGGAVTFSIVRRSTQPEPSPLPPSVEISPKP"
FT   gene            22179..22742
FT                   /locus_tag="Mvan_0017"
FT   CDS_pept        22179..22742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0017"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mmc:Mmcs_0010 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10868"
FT                   /db_xref="GOA:A1T118"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1T118"
FT                   /protein_id="ABM10868.1"
FT                   /translation="MALRPGVAHWIPVTSPIQTATATLHTNRGDIKIALFGNHAPKTVS
FT                   NFVGLAQGTKEYSTENASGGSSGPFYDGVIFHRVIEGFMIQGGDPTGTGRGDAGYKFAD
FT                   EFHPELQFDKPYLLAMANAGPGTNGSQFFITVTETPHLNRRHTIFGEVVDPESRKVVDA
FT                   IATTATDRSDRPTDPVVIESITIS"
FT   gene            complement(22791..23213)
FT                   /locus_tag="Mvan_0018"
FT   CDS_pept        complement(22791..23213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10869"
FT                   /db_xref="GOA:A1T119"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A1T119"
FT                   /protein_id="ABM10869.1"
FT                   /translation="MQQTQWGPPAASIVTAGVLGLVMAVGAVTLVTDPPGRILVGVASA
FT                   GLVVFALMSWRARPKLAITDGSLTYRGWFGVKRLTSADIERIRITEFRRLGRKMRLLEI
FT                   DTRDGQLLVLSRWDLGTDPLHVLDALTEAGYAPGPG"
FT   sig_peptide     complement(23130..23213)
FT                   /locus_tag="Mvan_0018"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.807) with cleavage site probability 0.408 at
FT                   residue 28"
FT   gene            complement(23369..23650)
FT                   /locus_tag="Mvan_0019"
FT   CDS_pept        complement(23369..23650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0019"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   mmc:Mmcs_0012 protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10870"
FT                   /db_xref="GOA:A1T120"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:A1T120"
FT                   /protein_id="ABM10870.1"
FT                   /translation="MPKSKVRKKNDFTINPVSRTPVKVKTGQSSTWFVVLFVGLMLIGL
FT                   VWLIVFQLAGSGPDVPSFLQWMADLNVWNYAIAFAFMITGLLLTMRWR"
FT   sig_peptide     complement(23477..23650)
FT                   /locus_tag="Mvan_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.893) with cleavage site probability 0.627 at
FT                   residue 58"
FT   gene            23716..24534
FT                   /locus_tag="Mvan_0020"
FT   CDS_pept        23716..24534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0020"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   mmc:Mmcs_0013 protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10871"
FT                   /db_xref="GOA:A1T121"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A1T121"
FT                   /protein_id="ABM10871.1"
FT                   /translation="MCRESLTQAHLAAPKETTPMDHRSTRTGKRSVWRFGVPVICVAAG
FT                   LLLGATHGVSGGDEIRRSDAPRLVDLVRESQQSVDRLGAERDSLSLEIDNHHGGSPGAD
FT                   AALSAIVERGDLLAAQAGMTPLRGPGLVVTLNDAQRDAQGRFPRDASPDDLVVHQQDIQ
FT                   AVINALWSAGAEGIQVQDQRIIGTSAPRCVGNTLLLNGRTYSPPYVISAVGDPGAMQAA
FT                   LAAAPLVTLYKRYAVRFGLGYTEESREVELVGHQEPVRMKYAQPLGPVGY"
FT   gene            24746..25918
FT                   /locus_tag="Mvan_0021"
FT   CDS_pept        24746..25918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0021"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mbo:Mb1465 PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10872"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T122"
FT                   /protein_id="ABM10872.1"
FT                   /translation="MRVREGRRMFTAALAVPAAICLSWAPAAPAATVLGVEGTGQPKGT
FT                   TQTAFQGSFCERNTCRSINNNRTPFDVALGSSQIHTAVSATPGDVIVMAYSLGAASTYH
FT                   RLREWAEKPAKAPDPDRIVLVVTFGNPENKFGGDDRNLFWTGLPEGSPYQHLDVTMQYD
FT                   SVADRPTRWGFFSSINTTFARHMAYFDDVDINDPDNLVYRDGNTTYMLIKADVLPMLGW
FT                   LDWFVDDEGMAKLDATFRPLVERDYRRPAFTPQGDGADWGNGNPPPIVDGVTDPEPSER
FT                   RSDDGDGDGDAQPSAADTDIAEGEPDADIAEGEPDADGVEDEPDAPEPADVIGGDEHGA
FT                   DGPEGDEPEAEIETEPGAEAEQQRETSSPTVAESGSPEGVAPDGAEGVAA"
FT   sig_peptide     24746..24838
FT                   /locus_tag="Mvan_0021"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.665 at
FT                   residue 31"
FT   gene            25953..26627
FT                   /locus_tag="Mvan_0022"
FT   CDS_pept        25953..26627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0022"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mmc:Mmcs_0014 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10873"
FT                   /db_xref="GOA:A1T123"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1T123"
FT                   /protein_id="ABM10873.1"
FT                   /translation="MQVLVVDNYDSFVFNLVQYLGQLGVDAQVWRNDDDRLVTDADVSR
FT                   VAEEFDGVLLSPGPGTPERAGASIGLVHACAAARTPLLGVCLGHQAIGVAFGGTVDRAP
FT                   ELLHGKTSTVHHTNQGVLKGLPDPFTATRYHSLTILPETMPAELEVTAKTEGGVIMGVR
FT                   HVELPIHGVQFHPESILTQGGHRMLANWLGFCGAAPDEALVRRLEDEVADAVAAATTRN
FT                   SA"
FT   gene            complement(26605..28482)
FT                   /locus_tag="Mvan_0023"
FT   CDS_pept        complement(26605..28482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0023"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: mmc:Mmcs_0015 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10874"
FT                   /db_xref="GOA:A1T124"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1T124"
FT                   /protein_id="ABM10874.1"
FT                   /translation="MTTPQHLSDRYEVGEILGFGGMSEVHLARDLRLHRDVAIKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPTGPLPYIVMEYVDGVTLRDIV
FT                   HNDGPMAPQRAIEVIADACQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAL
FT                   ADAGNPVTQTAAVIGTAQYLSPEQARGVKVDARSDVYSLGCVLYEVLTGEPPFVGDSPV
FT                   AVAYQHVREDPVPPSQRHAGISPELDAVVLKALAKNPDNRYQTAAEMRTDLVRVHSGEA
FT                   PDAPKVFTDAERTSLLAANPAHHRTEPVEPAGRRQPRYAEPERGGSLGRWLIAVAILAV
FT                   LTVVVTIGINMFGGGTRDVQVPDVRGQASADAIATLQNRGFSIRTQQKPDSEVPPDHVI
FT                   DTDPGANTEVGAGDEITLNVSTGPEQREVPDVSGLSYTEAVRRLTEAGFEKFRQTASTS
FT                   LPEQKDRVLSTVPPANQTSAITNEITIVVGKGPATAVVPECVGQTVEVCQQILSASGFT
FT                   KSVPVEVDSTVAAGQVVGLEPAAGQTVPQDTVIQIQVSRGNQFVMPDLRGQFWADAEPR
FT                   LRALGWTGVLDKGADVPNSGQRTNAVVTQSPSPGSGVNYGSRITLNFAS"
FT   gene            complement(28479..29771)
FT                   /locus_tag="Mvan_0024"
FT   CDS_pept        complement(28479..29771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0024"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mmc:Mmcs_0016 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10875"
FT                   /db_xref="GOA:A1T125"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1T125"
FT                   /protein_id="ABM10875.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEGVDSRLGRRVAIKVLK
FT                   AEYSTDAEFVERFRAEARTVAMLNHPGIAGVYDYGETDIDGEGRTAYLVMELVNGEPLN
FT                   SVIKRTGRLSLRHALDMLEQTGRALQVAHSAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDVYSLGVVGYEAVSGKRPFIGDGA
FT                   LTVAMKHIKETPPPLPADLPPNVRELIEITLVKNPGMRYKSGGPFADAVAAVRAGRRPP
FT                   RPNAAPSIGRAAPTAVPPAIASRPAADPTGRAPAPTSRTRATGSHHRSAPPPRGGFSSG
FT                   QRALLWAAGVLGALAIVIAILIVLNAQDRKDQPPPTTVTETPTSQGAPPETPGAAAPAF
FT                   GDHEPDRYWVLRPVDNLSPLTTRHVSEQNLR"
FT   gene            complement(29875..31350)
FT                   /locus_tag="Mvan_0025"
FT   CDS_pept        complement(29875..31350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0025"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: mmc:Mmcs_0017 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10876"
FT                   /db_xref="GOA:A1T126"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1T126"
FT                   /protein_id="ABM10876.1"
FT                   /translation="MNTSLRRISVMIMALVVVLLANATLTQVFTADGLRSDPRNQRVLL
FT                   DEYSRQRGQISAGGQLLAYSVSTQGRFRFLRVYPDPMIYAPVTGFYSLSYSSTGLERAE
FT                   DTILNGSDERLFGRRLADFFTGRDPRGGTVATTINPQVQRAAWDAMEKGCDGPCTGSVV
FT                   ALEPSTGKILALVSAPSYDPNLLATHDVAEQAEAWQRLRDDPGSPLLNRAISEAYPPGS
FT                   TFKVITTAAALQAGATPDTQLTAAPQIALPDSTATLQNFGGVSCGAGPTTSLRNAFAHS
FT                   CNTAFVQLGIDTGADPLRSTAGDFGVGAVPPAIPLQVAESTVGPIADDAALGMSSIGQR
FT                   DVALTPLQNAMIAAAVANKGVMMRPYLVESLKGPDLANIATTAPTEERRAVTEQVADTL
FT                   TDLMVAAEQVTQQKGAIAGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGGNRLSATGGALAAPIGRATIAAALREAS"
FT   sig_peptide     complement(31258..31350)
FT                   /locus_tag="Mvan_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.773 at
FT                   residue 31"
FT   gene            complement(31347..32759)
FT                   /locus_tag="Mvan_0026"
FT   CDS_pept        complement(31347..32759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0026"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: mmc:Mmcs_0018 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10877"
FT                   /db_xref="GOA:A1T127"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A1T127"
FT                   /protein_id="ABM10877.1"
FT                   /translation="MTTQPQPAVAVTPPLPNRRNAELFLLGFAALITTVALLLVEANQE
FT                   QGLHWDLAQYTVAYLALFTGAHLAVRRFAPYADPLLLPVVALLNGLGLVMIHRLDLAEG
FT                   ETTAQGLGGTANQQMLWTLVGVLGFSAVVIFLRDHRTLSRYGYVCGLTGLVLLAIPAIL
FT                   PRSMSEQNGAKIWIQFEGFSIQPAEFSKILLLIFFAAVLVSKRDLFTSAGKHVLGMDLP
FT                   RPRDLAPLLAAWIASIAVMIFEKDLGTSLLLYASFLVMVYIATERFSWVVLGLALFAAG
FT                   SVAAYYLFDHVRVRVQTWRDPFADPDGAGYQMVQSLFSFATGGIFGTGLGNGQPGTVPA
FT                   ASTDFIVAAIGEELGLVGLSAVLMLYTIVIIRGLRTAIAVRDSFGKLLAAGLSATLAIQ
FT                   LFIVVGGVTKLIPLTGLTTPWMSYGGSSLVANYLLLAILVRISHSARRPIVTRSLPPGN
FT                   IAGASTEVIQKV"
FT   gene            complement(32756..34309)
FT                   /locus_tag="Mvan_0027"
FT   CDS_pept        complement(32756..34309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0027"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   mmc:Mmcs_0019 protein serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10878"
FT                   /db_xref="GOA:A1T128"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1T128"
FT                   /protein_id="ABM10878.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLDSAVREGNSAIAAHVEADPELDGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLLRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREARAGDRYLLCSDGLSDPVSHDTIAEALQIEDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTQPILAGAVSGDDDQSDPPNTAAGRASAFNPKRNAAKRV
FT                   VPQPEEPPPRPHSRRRMIIAAAVLVLVVLTGLAVGREIVRNNYYVSEHNGTVSIMRGVQ
FT                   GSFLGVSLQEPYLLGCLNARNELSLISAGQSQDSLDCRLLGVGDMRPSERAQVIAGLPS
FT                   GSLDEAIGQIEELARSSVLPVCAPPAPPSTTRPPAPSPRPAPAPTSTAPQTTGPSTTPR
FT                   ASGPAPAPETPRTVTTTAPSPASPAPVPPASPTPPPPPPTVTALPPPPPEPGTNCREVS
FT                   "
FT   gene            complement(34306..34812)
FT                   /locus_tag="Mvan_0028"
FT   CDS_pept        complement(34306..34812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0028"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0020 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10879"
FT                   /db_xref="GOA:A1T129"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A1T129"
FT                   /protein_id="ABM10879.1"
FT                   /translation="MREEYQRRRRGRQMQGLVLQLTRVGFLLLLWLFIWSVLRILRTDI
FT                   YAPTGAVMVRRGLALRGSLLPNRSRRHVPRQLVVTEGALAGTRIPLGTQPVLIGRADDS
FT                   TLVLTDDYASTRHARLSPRGPEWYVEDLGSTNGTYLDRAKVTTAVRVPMGTPVRIGKTV
FT                   IELRP"
FT   gene            complement(34934..36346)
FT                   /locus_tag="Mvan_0029"
FT   CDS_pept        complement(34934..36346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0029"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0021 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10880"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A1T130"
FT                   /protein_id="ABM10880.1"
FT                   /translation="MGLVGRFERKLEDKVGDAFARVFGGSIVPQEVESLLRREADAGVR
FT                   ELHGGRILAPNDYVITLSVPDYRKVSADPDITATTFAKHLEGYIHEQGWQTYGDVVVRF
FT                   EQSPNLHTGQFRARAAVNPDATTVEPAPPPRDVTSQAEPGVPPMTDNPTYRGGQGPGRP
FT                   ADDYYNRPEDERPNRGDEPRGGYPPADQGGYPPPADQGGYPPRGGYPEHGGYPEHGGYP
FT                   DQGGYPEQGGYPPQSYEQRPPAGYGPPPGGYPDQGYRQPPPGYGPPPGGQPGYGPPSGD
FT                   YDYGRRPDDGGYGPQGPQGRPSYPDQGGYPDQGGYGGQQYGRQDYAQPDYGRYGEAPAG
FT                   YQDQGYGEPAGYQDPGYGQGGSYAGYGAQGDYPAAGATVTLQLDDGSGRTYQLREGANV
FT                   IGRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTTVNNAPVQEWQLADGDVI
FT                   RLGHSEIIVRVH"
FT   gene            36595..36677
FT                   /locus_tag="Mvan_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            36595..36677
FT                   /locus_tag="Mvan_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(36837..37739)
FT                   /locus_tag="Mvan_0030"
FT   CDS_pept        complement(36837..37739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10881"
FT                   /db_xref="UniProtKB/TrEMBL:A1T131"
FT                   /protein_id="ABM10881.1"
FT                   /translation="MKSTNGRPDARPHRSIDEAVDVTNIADAIAHTRVPIFHGTRASLA
FT                   EPILCGGFAPLPVTKQIEDVAAQYDVSMDDLMEDLKAYNRFAVVDARPNTAFVTGDAVK
FT                   AGSWADRAPEATWEALWAVYRIQNPEIGWDWNMSDEGHLWVLAQRVDDPPAVLEARAPL
FT                   VALRNRNNGRTAADGIREAIESGSTDALSTELELFRASPEWLVAPCDLTPISYQTVPMR
FT                   VDHDLMLFMSGESKETFVERLRAGCWGEPGASSGPGDRPWHPFEEVWARLSSERQTALE
FT                   EIVGTPITSRISVEPDTVA"
FT   gene            complement(37736..38185)
FT                   /locus_tag="Mvan_0031"
FT   CDS_pept        complement(37736..38185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10882"
FT                   /db_xref="UniProtKB/TrEMBL:A1T132"
FT                   /protein_id="ABM10882.1"
FT                   /translation="MKRISIKAAAIAPIVAVGLSGCIAPDEVTSANGNDSVSAWSDMTT
FT                   TSPTRAAAPPTPADFVVGVVITEQKCFGSAGCNYRYTINPQYISSKPLPERTTVVYTVT
FT                   GGEQDQVGNFTIDADGTATFDRETRISGEENANLQATVTQVIPGR"
FT   sig_peptide     complement(38090..38185)
FT                   /locus_tag="Mvan_0031"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.594 at
FT                   residue 32"
FT   gene            complement(38210..39631)
FT                   /locus_tag="Mvan_0032"
FT   CDS_pept        complement(38210..39631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0032"
FT                   /product="transcriptional regulator, Fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10883"
FT                   /db_xref="UniProtKB/TrEMBL:A1T133"
FT                   /protein_id="ABM10883.1"
FT                   /translation="MTDLKGARLGDDQSTIVINHLTIEDKDVVREAQRWTTGQRGEIVD
FT                   DPAVLADADLSDFVAEAVKIGAHALSATGQSQDARALERMIKEAGDKTAATSAQAAELT
FT                   DRTVKDATKTMAKAAEDAKKAIVEADQTSRKEFTESVTAAKTALTAEVRRIFAGDSPEL
FT                   LEKLQPLLEKFSAELDAKSSASITEVVTKAVKQFDPADPTSPMAKHTATLELRQQQLTE
FT                   LLGKNHEVLTQKIDEIGTAVKVQEARASLSKVTPIKGDTFENQVNEVLFTIATGLGDEY
FT                   SDTRAIVGHLPRSKKGDGLLTVDGGSARVAIEMTDSARGGWTEYLDEAERNRQAAASLG
FT                   LVRTLEQNAGQSIRVIGSRRVVLAFDPTADDPDLLRTVLMLLRTAALAASTRRGAKQLS
FT                   TAEEKICEAVNQLDRIDDIKKAAGSIHKSAEKIETGCTAVTSGINRLLSEALAALADAQ
FT                   ASEDPSTDTSGDTAA"
FT   gene            39801..41663
FT                   /locus_tag="Mvan_0033"
FT   CDS_pept        39801..41663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdi:DIP2315 hypothetical DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10884"
FT                   /db_xref="UniProtKB/TrEMBL:A1T134"
FT                   /protein_id="ABM10884.1"
FT                   /translation="MRTLTLQDVADLANVQRPVVSMWRNRPRVRGELVPFPEAVSRRDG
FT                   IERFDPDAVVEYLKRTGRGNNTEVEYDAPAIAVPDNADLEELVVLLAWRVLTGVELAGT
FT                   NPAERARLAEEYDPDDRCVLTEIRTIRPTGAVLEYVDELVEASFGLPDALARIEQGRLY
FT                   RERAVRELTGDAVRILGRVVTECAVFLGAEDMTLRADGSTVSMAVAAECGMGVTSKDRA
FT                   VLRRAVITGAGTGRSHAGEISFVSAVGLDAAAVLDRADVLVLGLEPGRIGVLVGPASAL
FT                   TDTLAGELQQRRADVLRVGNVMAAVRLPRGLWREAHRQNLALWVCLGGAEEQRPYVTDL
FT                   AAIPDLDIGDFASDIAAALAQTDVRAFRYARRIDRAGVLAGGPFVPRGARAVGLSPAGR
FT                   DSHVERVHTITLTTTTPLQPVDVLVEASPGRLKLRHRSLGELRDEGKLTLKRGNRIDLA
FT                   HATSDGTVRVLPADDGLALDPVDAERLYPHSTRTEPGDVIFVQKPQPRAWVDTFGGAMV
FT                   AAPARILRLGRTADLGPQVLAAVINETATAGSEWPSWTVPEMSADEAARLEVALADIAH
FT                   YEAEARRRVEAARELKTALIDGVAAGALTLDAQPTTPGVAAADH"
FT   gene            41676..43310
FT                   /locus_tag="Mvan_0034"
FT   CDS_pept        41676..43310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0034"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: mbo:Mb2777c possible
FT                   type I restriction/modification system DNA methylase HsdM
FT                   (M protein) (DNA methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10885"
FT                   /db_xref="GOA:A1T135"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A1T135"
FT                   /protein_id="ABM10885.1"
FT                   /translation="MPPRRGTKKAEPLLPSTMKELKDTLWKAADKLRGSLSASQYKDVI
FT                   LGLVFLKYVSDAYDERREAIRTELEADGLDAEQIEDLIEDPEEYQGYGVFVVPPGARWK
FT                   FLAENAKGLPAAGGEPAKNIGQLIDEAMDAVMKANPTLQGTLPRLYNKDNIDQRRLGEL
FT                   IDLFNSARFSRQGDGRARDLMGEVYEYFLGNFARAEGKRGGEFFTPPSVVKVIVEVLEP
FT                   SRGRVYDPCCGSGGMFVQTEKFIYEHDGDPKEIAVYGQESIEETWRMAKMNLAIHGIDN
FT                   KGLGARWGDTFARDQHPDVQMDYVLANPPFNIKDWARNEEDARWRFGVPPANNANYAWI
FT                   QHILYKLASGGKAGVVMANGSMSSNSNGEGDIRAQIVEADLVSCMIALPTQLFRSTGIP
FT                   VCVWFFAKDKTAGKQGSVDRSGQVLFIDAREMGYMVDRAERALSDDDIVKIGDTFHAWR
FT                   GSASAAAKGVVYQDVPGFCKSATLAEIKAADYALTPGRYVGAAAVEDDGEPIDEKIARL
FT                   KTELLAAFDESARLEKVVREQLERIDA"
FT   gene            43303..44505
FT                   /locus_tag="Mvan_0035"
FT   CDS_pept        43303..44505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ana:alr4602 type I site-specific
FT                   deoxyribonuclease chain S"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10886"
FT                   /db_xref="GOA:A1T136"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A1T136"
FT                   /protein_id="ABM10886.1"
FT                   /translation="MRESVRLGDLISVKHGYAFPGEGFTEDPTYPILVTPGNFAIEGGF
FT                   KESKPKTFNGDYPPGFELAPGDLVVSMTDLSRDGATLGMPALIPAGPTYLHNQRIGLIE
FT                   AIDRSKIDRLFLNYYLRTAAYRSHILGTASGSTVRHTSPSRIEDFVALLPGLLEQQAIG
FT                   AILGSLDDKIGVNRRLANVGRLLQSELWHRAATGSRQVSLGSLVRPHLGGTPSRSDSNL
FT                   WAGDVPWASVRDMSAADGGVLLATAETISSAVSQSVGRLAALPERSVALTARGTVGKVV
FT                   TLGVASAINQSAYGFIPPAGRGVALRCALESISDELKARAHGSVFSTITMSTLESVRVP
FT                   AINETDWDGVCESLELIEDRRLSALRETRVLARTRDELLPLLMSGRIRVKDAEARVSEV
FT                   V"
FT   gene            44554..45648
FT                   /locus_tag="Mvan_0036"
FT   CDS_pept        44554..45648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0036"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   ava:Ava_4508 protein of unknown function DUF1016"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10887"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:A1T137"
FT                   /protein_id="ABM10887.1"
FT                   /translation="MTGVDRDPDDGVSAPTRNTSGPDWYPAFLTAVADRIEIGRRRAVT
FT                   AANTELVLTYWAVGREILARQDTEGWGTRVIDRLSADLRARFPDAKGFSARNLKYMRAF
FT                   AAAWPDPEIVQGRLAQLPWYHHVALLDKLDASDLREWYAQTAIEQGWSRDILVHHIEGR
FT                   FHERAGKAITNFARTLPPADSDLAQQSTRDPYLFDFVGAADIRRERDLELALTDHVEKF
FT                   LLELGQGFAFVGRQVHLEIGDADFYTDLLFYHLRLRCFVVIELKIGDFDPSYLGQLGTY
FT                   MAAADDLLRHPDDNPTIGLLLCKAKNNVVAEYALRGYTAPIGVAEWKTVITESLPADLE
FT                   SSLPTIAELEAELAHDPVVQEGEQ"
FT   gene            45645..48830
FT                   /locus_tag="Mvan_0037"
FT   CDS_pept        45645..48830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0037"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: cef:CE2329 putative type I
FT                   restriction-modification system subunit R; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM: type
FT                   III restriction enzyme, res subunit; protein of unknown
FT                   function DUF450; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10888"
FT                   /db_xref="GOA:A1T138"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A1T138"
FT                   /protein_id="ABM10888.1"
FT                   /translation="MTDFSEAEWESLALETLAQQEWLPLNGSAIAPGTENGRASWDELV
FT                   LPDRMLAKLRELNAHVPGEYLEQARAAILQPSSQDAIAENYRLHQYLVGGYRGISYVDS
FT                   DGIEQNPTIRLISHRPEENELLAVQQVTIRDAEHDRRFDIVLYLNGMPIAFFELKQAGS
FT                   KYADLPGAHAQFATYLREFPMAFRFAVLNVISDGLTARYGTPFTPLEHFAPWNVDDDGK
FT                   PVAFGDPVDDVHLGTELEYLIDGLFNPERFLQLVRNFTAFDAGADGLIKRIAKPHQYFA
FT                   VTKAVGSTVTAAESNGKAGVVWHTQGSGKSMEMELYTHLVAQQPKLKNPTVVVVTDRKD
FT                   LDGQLYATFDRSKLLGESPVKVTTRSQLRDELSNRTTGGIYFTTLQKFGLSKAERESGA
FT                   DHPLLTDRRNIIVVVDEAHRSHYDDLDGYARHIRDALPNAVYIAFTGTPISEADRDTRD
FT                   VFGPDIDVYDLTRAVNDKATVPVFFEPRLIKVALAQGVTEDDLDKAADEVTAGLDDVER
FT                   DQIEKSVAVINAVYGAPDRLAALARDIVDHWEVRSQEMRKFISCPGKAFIVGATREICA
FT                   ELYEEIVKLKPEWHDDAVDKGVIKVVYSGSAKDQGLVAKHVRRDGQNKTIQQRLRDPDD
FT                   ELQIVLVKDMLLTGFDAPPLHTLYLDRPLKGALLMQTLARVNRTFREKPNGLLVAYAPL
FT                   VENLNKALAEYTQTDRTEKPVGKNIDEAVALTETLIAQLDALCAGYDWRAKVAQPHGWM
FT                   KAAVGLTNYLRSPATAGNQVAEGEATVSDRFRALANQLSRAWSLCAGNQALDALRPTAK
FT                   FYEEVRVWMAKFDANDRQASGKPVPEAIRRMLESLVYDSTASDGIVDIYDAAGLPKPSL
FT                   SDLTPEFEAKAASASNPHLAIEALRAVITEEAVRATKSNVVRQRAFSERLTDLMRRYTN
FT                   QQLTSAEVIAELIEMAKEVAAESNRGAHFSPPLSHDELAFYDAVAQNESAVELQGEDVL
FT                   AQIARELVGVMQRDTKTDWTVRDDVRAKLRSSIKRLLVKYKYPPDKQPEAIKLVIEQME
FT                   ALAPGYADAARAG"
FT   gene            complement(49139..49930)
FT                   /locus_tag="Mvan_0038"
FT   CDS_pept        complement(49139..49930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0038"
FT                   /product="Excinuclease ABC, C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC, C subunit domain protein;
FT                   KEGG: cgb:cg1566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10889"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:A1T139"
FT                   /protein_id="ABM10889.1"
FT                   /translation="MIRHSFNTGEALGLRGPEDLTEDKVREYTRFQGISPRQFPANPER
FT                   HWVVLVADGRRRSRLWGTFENHGEIVAERTAEARFFDLRRSDILKPLVNRLVVEWDTPR
FT                   VWHRRAASAADMPVLEIADRDKVPFPGFDNVLLTFHDLGEMLSDPRYRDWQVALSQVQG
FT                   IYLITDSSNGKQYVGKADGAERILQRWKSYAQDGHGGNRALRDLAKISIGLGSGKTDHA
FT                   RHFLFSILRVFGPSTSSSEVDKAESHYKDAMMTRKFGLNRN"
FT   gene            complement(50159..50842)
FT                   /locus_tag="Mvan_0039"
FT   CDS_pept        complement(50159..50842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10890"
FT                   /db_xref="UniProtKB/TrEMBL:A1T140"
FT                   /protein_id="ABM10890.1"
FT                   /translation="MTQDVPPSLAAVLAEPAVPQRPFPWNRSAWATGMHDLPDVQRVLD
FT                   SLPDGVDRNLVREVVNSQLSDGQVLPAFVSAMIWGYGDSGYGPTRVRWVLTGIKTGARD
FT                   APVRGDVVESLRAAVDTVRIQGPVEGFRYMNNEGRVKHLAGAFFTKWLYFASATTSADD
FT                   ANAAPILDRQVQVWLKLEANLFIDIHRTSDYGRYLDVLRAWAAAYDRTPVQVEKAIFGL
FT                   ATGRT"
FT   gene            51521..52831
FT                   /locus_tag="Mvan_0040"
FT   CDS_pept        51521..52831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0040"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_2471 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10891"
FT                   /db_xref="GOA:A1T141"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1T141"
FT                   /protein_id="ABM10891.1"
FT                   /translation="MSSTVVDSPAGCTQSERLEVLFEELSELAGQRNAIDGRIVEIAAQ
FT                   IDRDGLVGITGARSVAALVAWKTGCSPHNAKTITTVADRLEEFPRCVTALGEGRLSLDQ
FT                   VAVIAEHAGQGSDAHYAHLAASASVSQLRTAVKSEPRPDPEPVRDPFADADEEPEPAPV
FT                   PRPEITSTCDADYTYWRIKLPHEQSARFTAALQSHKDRLIAQHTRDHGTDPTGDGDGDR
FT                   GVQLPPWPSAGEAFMELVEAGWDAEATRRPHGQHTTVVVHVDIDTRVAALHLGPLLTDE
FT                   ERRFLLCDATCEVWFQRHGRPLGTGRSTRTINRRLRRALEHRDRTCVVPGCGATRGLHA
FT                   HHLVHWEDGGDTELDNLVLVCPYHHRTHHRGLITITGPAHQLLVTDHTGRPLQPGSLAR
FT                   PPTTPPPEVNPYPGTSGERAQWKWYHPYQPPPPTSNN"
FT   gene            complement(52968..54452)
FT                   /locus_tag="Mvan_0041"
FT   CDS_pept        complement(52968..54452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0041"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_2825 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10892"
FT                   /db_xref="GOA:A1T142"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T142"
FT                   /protein_id="ABM10892.1"
FT                   /translation="MGRHSKVSGIGWAAWVTSGIAVHVTVVVACTYVSGGPLAATDLAA
FT                   ATSIFVDGSKPILGGREDGVPFYRMADSFKGGYSGPEYIENFVIYPRSLGALTGWGDPT
FT                   YDDSEDEGTVNTIDAVRNAKKDTAFRAGDPIRIVGYSQGAGAASAAIPELEGGEFADDN
FT                   IQYVLASNPSRNDGGILTRFPKGTYLPIIGVSFGDGVSTTDPDTDVVQVTKQYDGVADA
FT                   PDYVLNVVADVNAVLGFAYLHSGYYKDVERVDPETLDPDDPPAGMLVSTNAADTVTDVV
FT                   LEAPEGELPLTMPLRQLGVSDDVVVALDPFLRSVIETGYDRPVGSGEYPDEPEPFRLVP
FT                   PADQWESDAASVAEGLAETKRRLAALRDTDTGAGQDASDDDAGPLATGSEDADRHDRRT
FT                   PSSEVDTTDTIHGPSWSDEDATDDTDSGNPQKVGPSSDHVGWNQISRASALSPGADAAA
FT                   GTPPAESTAHPDDDARRSPESEPLQRSEKTRRRGAS"
FT   sig_peptide     complement(54363..54452)
FT                   /locus_tag="Mvan_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.766) with cleavage site probability 0.670 at
FT                   residue 30"
FT   gene            complement(54714..56093)
FT                   /locus_tag="Mvan_0042"
FT   CDS_pept        complement(54714..56093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0042"
FT                   /product="transcriptional regulator, CdaR family"
FT                   /note="PFAM: purine catabolism PurC domain protein; KEGG:
FT                   mmc:Mmcs_5287 transcriptional regulator, CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10893"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1T143"
FT                   /protein_id="ABM10893.1"
FT                   /translation="MSEVHAEPAAPTLRDLATAGLGLSVPDGTAQELDRPVSWVHTTEM
FT                   RDPSRYLRGGELVCTVGISLHTDQDCATFVDALSRARAAGVCFGVGDEHDAVPEALLAQ
FT                   CRLHGLPLLVAPPSVPFSVVSRFVAEYWLGSEIAVARATNALVPELLSSLRRHDSPRQL
FT                   LDSAGQLLGCYFLLEPEGGADSDDDAVTVPVPGLGTLVWVGRGDHPEPALLDLIARFVR
FT                   AAQGERDIEAALARERVGQLLSLVERRMLLPDALSQLLEWPGFSAGEIACSAWPAGAGA
FT                   LVSMAFPDALIGDAPDLCLMLTVGALEVTDDLALPTGHSAPVPLTDIGSAIAQARIALT
FT                   LAEHRGGRVGPDQLSTLESLLEQLPLAQLAPFKQLLIAPLAELDSQRGTQHVRTLRVFL
FT                   ACNGSLSETAKELFLHTNTVRHRLSRIQEITGRDPLQHNDLTAFVIGLWAADRAERPAG
FT                   L"
FT   gene            56236..57687
FT                   /locus_tag="Mvan_0043"
FT   CDS_pept        56236..57687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0043"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_5286 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10894"
FT                   /db_xref="GOA:A1T144"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1T144"
FT                   /protein_id="ABM10894.1"
FT                   /translation="MSISVSPAEQPPQLRREFSLGSAFAFAFAFISPIVALYGIFGLAL
FT                   SAAGPSFWWGFALVFAGQFLVALVFAALVSRWPLEGSIYQWSRRLLGSTYGWFAGWVYM
FT                   WTLVIAMATVALGAAGFVAHIVGIEEASGGTLAWIALLILLAGTAVNLVGRQALKIFMI
FT                   GSIIAEVVGSVVLGTWLLLFHRQNSLSVLFEGGGTDVDLWSYLGGPFLLAVAFIGWSFV
FT                   GFESAGSIAEEVHNPGRDLPKAVLFSLAFIALVVGYSSLAIILAIPDLDAVAEGAVSDP
FT                   VYETLTTALGAGIAKPVQVLFVIGFLASFLALQTSASRVIWAYARDGALPAAGTLVQLR
FT                   GRARIPVVAILVTTVIGAGLFLLSIVAGDIYSLMVNFTAGGFYLAFLFPLIGFLVVVLR
FT                   KVWKPASFSLRGWTLPVAVVAVVWAVLQFLNIAWPRVAFEQRYLDWSVWIGVVVLGMIG
FT                   AVLFATVKSRIAAPQDQDDRALVDD"
FT   gene            57680..58372
FT                   /locus_tag="Mvan_0044"
FT   CDS_pept        57680..58372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0044"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_5285 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10895"
FT                   /db_xref="GOA:A1T145"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T145"
FT                   /protein_id="ABM10895.1"
FT                   /translation="MTDQPVALVTGGASGIGAAVVEALTARGYTVGCLDLNPGPAENTW
FT                   AVDVSDADAVARAVGQLQDRLGPVSAVVTSAGYYEMAPVSDISEDAWRRMLRVHLGGLV
FT                   NVARATLPDLTATRGSLVAVASELAVGGGDEDAHYAAAKGAILGLVRSLAVETASSGVR
FT                   VNAVAPGPTDTPLLAPDSPWRAPEYLQTLPLRRLTTPAEVARCVEYLVCDATFSTGDVV
FT                   NVNSGAVI"
FT   gene            58369..59133
FT                   /locus_tag="Mvan_0045"
FT   CDS_pept        58369..59133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0045"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_5284 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10896"
FT                   /db_xref="GOA:A1T146"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T146"
FT                   /protein_id="ABM10896.1"
FT                   /translation="MSTDLRGRVALVTGAARGMGAAHARRLAAAGATVAVNDREDSDAL
FT                   TALATEIGGLTAPGDVSDPKSCRALATHVAATTGRLDVLVANHAYMTMAPLLEHADDDW
FT                   WKVVDTNLGGTFFLVQSVLPHMRRTGAGRIVVIASEWGVTGWPEATAYAAAKSGLISLV
FT                   KTLGRELAREHIIVNAVAPGVIDTPQLQVDADAAGVGLDDIHRRYAEAIPLGRIGSADE
FT                   VAVAVELLSDFDLEAVVGQVISCNGGSTRTRA"
FT   sig_peptide     58369..58458
FT                   /locus_tag="Mvan_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.773) with cleavage site probability 0.581 at
FT                   residue 30"
FT   gene            59149..60114
FT                   /locus_tag="Mvan_0046"
FT   CDS_pept        59149..60114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0046"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="TIGRFAM: putative agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: mmc:Mmcs_5283
FT                   agmatinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10897"
FT                   /db_xref="GOA:A1T147"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1T147"
FT                   /protein_id="ABM10897.1"
FT                   /translation="MQNDPRMRSESGVLGQIDAQQVPRYAGLGTFARLPQRHEVASHDI
FT                   AVIGVPFDSGVTYRPGARFGPAAIRQASRLLKPYHPALEVSPFATAQVVDAGDIAANPF
FT                   DITTAVEQIKDGILGLVTSPEQRFVLLGGDHTIALPALQAVNELHGPVALVHFDAHLDT
FT                   WDTYFGAPCTHGTPFRRASEQGLIVKGHSAHVGIRGSLYDAADLLDDAELGFTAVHCRD
FT                   IDRIGVDGVIERVLERVGEHPVYVSIDVDVLDPAFAPGTGTPEIGGMTSRELVAVLRAM
FT                   RALNIVGADVVEVAPAYDHAEVTAVAAANLAYELISLMVG"
FT   gene            60111..60977
FT                   /locus_tag="Mvan_0047"
FT   CDS_pept        60111..60977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0047"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   mmc:Mmcs_5282 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10898"
FT                   /db_xref="GOA:A1T148"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR037950"
FT                   /db_xref="UniProtKB/TrEMBL:A1T148"
FT                   /protein_id="ABM10898.1"
FT                   /translation="MMDRFRWPDGKTAAAAFTFDVDAESAILWGNESVGARMSVMSHQA
FT                   YGPLVGIPRILDLLEQHQVPSTFFVPGHTADRYPEAVRSIVAAGHEIAHHGYLHEQPTA
FT                   LTLEQEIDALDRGLAALADVAGVRPVGYRAPMWDLSWRTPALLAERDFLYDSSLMDADH
FT                   PYELAITPGAQESLVEIPIQWALDDWEQYCFLPDISGSGLIETPRKARELWQSEFDALR
FT                   KVGGCWVLTNHPFLTGRPSRAAELGELMRYVLDHDDVWVSSLGAVAEHVRSLNLSPRSI
FT                   TPPDVPR"
FT   gene            complement(60981..61526)
FT                   /locus_tag="Mvan_0048"
FT   CDS_pept        complement(60981..61526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10899"
FT                   /db_xref="UniProtKB/TrEMBL:A1T149"
FT                   /protein_id="ABM10899.1"
FT                   /translation="MTTGISRHVAALLIAMSAVGGCSPMSPSDQSTPKADGPTAPPPSD
FT                   AESRAQVVDTAKDVVRAADLRVTYASFQWEWCNDQGDPPFHGRVDMAFEVPPGADSQGL
FT                   GRQIAATLAELPGWAPGPPPGFQPAGDVVHRGGVMVIVGPGNYPERGAVEIYGECRNMN
FT                   DHRDDNELTDITAEVRAG"
FT   sig_peptide     complement(61419..61526)
FT                   /locus_tag="Mvan_0048"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.601 at
FT                   residue 36"
FT   gene            complement(61510..63393)
FT                   /locus_tag="Mvan_0049"
FT   CDS_pept        complement(61510..63393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0049"
FT                   /product="protein of unknown function DUF1023"
FT                   /note="PFAM: protein of unknown function DUF1023; KEGG:
FT                   mmc:Mmcs_0775 protein of unknown function DUF1023"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10900"
FT                   /db_xref="InterPro:IPR010427"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T150"
FT                   /protein_id="ABM10900.1"
FT                   /translation="MAVSVSTVRDSKPDRLVDAADATGRHRSELQTIIAGQRESLSHLQ
FT                   EHWSGQAASAALARGLDDIARQDRVAGRLLNLESALRNGGLQMGALRDALLDLVSSLER
FT                   FGFAVADDGTVTPEQWLVGQFLDSLADKFTGFLQKMLQLFTDLDENTAAAIDQAAGVDS
FT                   PNPPVEVGGQDIHIPSPDTDPADVKQWWDSLSEQQRRELIDRHPPMLGNLNGIPAEVRD
FT                   QVNVAVMDDDLDRVQNVADRNGVSTDEVAGNPGRYGLTDGDVTRYQNAKRTQEGLLHQL
FT                   GAQDGETRRYSEIGEQERRDKNWRPTMLWAYDPQAFDGKGRAAVSIGNPDRASNTAVIV
FT                   PGTSASVRDGWLSDGHNDAIHLYGQSLKADPADPTAVISWMGYNTPESFTDPNIANTGL
FT                   ARAGGDALAWDVNGLNVTHEAGVPEHVTVIGHSYGSTTVADAFANSGMQADDAILLGSP
FT                   GTDVARSAADFNLDGGQVYIGDASTDPVGWLGQMGNTLPGELNDSLGNMVGPTAGLGAD
FT                   PAFEDFGATRFRAEVPGADMIDPSDHSYYYTVGSESLRSMTEIVTGNGGRLDELGLLAQ
FT                   PRTELTVSTPQQLDVPVLGEVPLPHLEVETPVIYDPEWNRAGGSVTNDHGY"
FT   gene            complement(63451..63675)
FT                   /locus_tag="Mvan_0050"
FT   CDS_pept        complement(63451..63675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10901"
FT                   /db_xref="UniProtKB/TrEMBL:A1T151"
FT                   /protein_id="ABM10901.1"
FT                   /translation="MPSSNSSCVRRIRRSRVFCCLASSTQQMNSLRASGVMSFHAASAD
FT                   AFPSSAVRRSAGSSCTTPPGTRWLLTAPE"
FT   sig_peptide     complement(63574..63675)
FT                   /locus_tag="Mvan_0050"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.783) with cleavage site probability 0.321 at
FT                   residue 34"
FT   gene            complement(63824..65200)
FT                   /locus_tag="Mvan_0051"
FT   CDS_pept        complement(63824..65200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0051"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: mtc:MT0378 divalent cation
FT                   transporter, MgtE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10902"
FT                   /db_xref="GOA:A1T152"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A1T152"
FT                   /protein_id="ABM10902.1"
FT                   /translation="MSSPTSAAVRLTDILPTAGPGEIQAWLRSVAGPAERRHQVSRLSR
FT                   AELRRLGEVLDGRTAEILLESLDDELAARAVTAMDAAVAATLLAGLDTDHATDILREMR
FT                   APARDSVLSAMPADRSEALRRVLEWPRESAAAHMIPEALAITSELTVADAVEQLRRDAV
FT                   ELRVDAHTSAYIYVTDRDRRLLGVAAFRDLVLADPGRHVSELMNDDLLWVSPLTDAEEA
FT                   AQALEDHNLVAVPVVDADMRLLGILTQSTAAEIAEEEATEDAERQGGSEPLDMPYLRAS
FT                   PWHLWRKRIGWLLLLFVAEAYTGTVLRHFEEEMEAVVALAFFIPLLIGTGGNTGTQITT
FT                   TLVRALATGDVRFRDVPSIVAKELSTGMLIALTMALAAVIRAWTLGVGPEVTLCVSLTI
FT                   GAIVLWSSFIASILPPLLKKCRLDPALVSAPAIATIVDGTGLIIYFWIAHLTLAQLQGL
FT                   "
FT   gene            65387..66511
FT                   /locus_tag="Mvan_0052"
FT   CDS_pept        65387..66511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10903"
FT                   /db_xref="UniProtKB/TrEMBL:A1T153"
FT                   /protein_id="ABM10903.1"
FT                   /translation="MIATMKPAFTAGVALLGAGVIACAPVEPAAAVAPVVDATVQLSAI
FT                   PSPLELYPQVLVRAVQNSAALVEAYLADPLPLTRLTIEKQIVALGEAFDALGEGDGAAA
FT                   MAAIGRVILQPVRTVFGAFEYVDILMNQPNAPQALFQIALSPILGGVAAFGVAIDEVVD
FT                   AAAALDLVGLVNAVVNIPARVLDGVLNGGYGSPFGDFDNLPGLVTPLTVEGYLFPGPIA
FT                   LGILIDQDAADYIEDQAGQQELTELTATDAPEPEAVDESAGPAEDEVAGIFDELETDDP
FT                   QTADPAAAPTEPADTIDGEEGGESADTIDGEEGGESADTIDGEDGGEPADTIDGEDGGE
FT                   PETDDGQDGGEPETDDGQGTGESAGTENSDPATE"
FT   sig_peptide     65387..65482
FT                   /locus_tag="Mvan_0052"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.742 at
FT                   residue 32"
FT   gene            complement(66641..67330)
FT                   /locus_tag="Mvan_0053"
FT   CDS_pept        complement(66641..67330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0053"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: nfa:nfa35310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10904"
FT                   /db_xref="GOA:A1T154"
FT                   /db_xref="InterPro:IPR022468"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1T154"
FT                   /protein_id="ABM10904.1"
FT                   /translation="MTMQHNDIQLAVIDMAGTTVADDGLVVEAFEVAAEAGGLPAAGPD
FT                   RDDARQYVLDTMGQSKITVFRALFGDEATAQRANASFEDAYAALIAAGRAEPIPGAAES
FT                   LSRLRDAGIKVALTTGFSPDTQGKLISALGWHDIADVVLAPGDGVRGRPYPDLILTALL
FT                   RTGADRVQAVAALGDTANDVESALRAGCAIAAGTLTGAHDERQLVAAGATHVVASVTDF
FT                   ADLLLRG"
FT   gene            complement(67327..68442)
FT                   /locus_tag="Mvan_0054"
FT   CDS_pept        complement(67327..68442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0054"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   nfa:nfa35260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10905"
FT                   /db_xref="GOA:A1T155"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017741"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T155"
FT                   /protein_id="ABM10905.1"
FT                   /translation="MQVTIIGAGILGTAHAWHAVRRGHHVIHLEREVEARGATVRNFGL
FT                   VWVSGRASGELEASLRSRALWEEIGAEVPAIGFRPCGSLTLLRTPAEVAVAEEVCGRAD
FT                   AASRGFRLLEPVEAREINPVLRGKFLAALHCDRDGAVESRQALPAIRAVLDATGRYTFV
FT                   PGTEARAVDGTRVHDDRGNTYDADVVIVCAGAAHGGLVRDLAGDLPVRRVRLQMMQTAP
FT                   LGEQLTTAIADGDSLRYYPGFAGGALDTLRRSESQDPVADEHHMQLLCVQRLHGGLTIG
FT                   DTHEYTEPFDFDVTEAPYSYLTGVVEELLGRSLPPIRRRWAGVYSQCVDPERLAYREQV
FT                   SPGVWVVTGPGGRGMTLGPVIGEQTTNEIGL"
FT   gene            68533..69078
FT                   /locus_tag="Mvan_0055"
FT   CDS_pept        68533..69078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0055"
FT                   /product="HD phosphohydrolase-like protein"
FT                   /note="KEGG: cvi:CV1839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10906"
FT                   /db_xref="GOA:A1T156"
FT                   /db_xref="UniProtKB/TrEMBL:A1T156"
FT                   /protein_id="ABM10906.1"
FT                   /translation="MRYRGGMSLRAREIRAETAAVLESLRGVWDEEMVDEWDHAMQAAA
FT                   CAIEDGADDELVLAAALHDIGHSPLLGGPHVHDHCGLARDWITPRFGPRVGWLAGAHVS
FT                   AKRHLAAVDPAYTAALSPTSVASLAAQGGAHVDPEFAEHPWCADALRLRRYDDAAKDPD
FT                   AVGASADLVLDLAQKLAR"
FT   gene            69075..69773
FT                   /locus_tag="Mvan_0056"
FT   CDS_pept        69075..69773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0056"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   rha:RHA1_ro06603 probable transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10907"
FT                   /db_xref="GOA:A1T157"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T157"
FT                   /protein_id="ABM10907.1"
FT                   /translation="MNVPKPYLVRTGLDGILDGLQEGDPFPPERELAARFGVARETVRQ
FT                   ALHELLVEGRIERRGRGTVVSRPKLVQPLSLRSYTEGAQRMGRTPGRLLVTWENITVDA
FT                   EIAAALDVSPSARVMHLERVLLADDVRIGLESTYLPRHRFGDLEQHFDPTTSLYSAIRA
FT                   RGVKFGSATERIETVLPSPREAELLESTTAMPMLLLNRRSVDVDGVPIEVVRALYRGDR
FT                   VAFEATLDDR"
FT   gene            69811..70416
FT                   /locus_tag="Mvan_0057"
FT   CDS_pept        69811..70416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO6238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10908"
FT                   /db_xref="GOA:A1T158"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1T158"
FT                   /protein_id="ABM10908.1"
FT                   /translation="MRFDKAAVWRFVHAERARLADDLAGLPHDAWATPSLCPGWDVHDV
FT                   LAHLVDSAKTTRVGFARRMMAARFDFDADNALGIARERSDDPRDTLDALRAVVPLTRTP
FT                   IAPRRTRLVEAIVHGEDIRRPLGIKACYDAHAAAAALDYQVGTAVAMGGGRERAEGLRL
FT                   IATDSDYEAGRGDAVRGSTVDLLLAVSGRPVPGYWLRE"
FT   gene            complement(70432..70644)
FT                   /locus_tag="Mvan_0058"
FT   CDS_pept        complement(70432..70644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10909"
FT                   /db_xref="InterPro:IPR021425"
FT                   /db_xref="UniProtKB/TrEMBL:A1T159"
FT                   /protein_id="ABM10909.1"
FT                   /translation="MSDNTTQAPRENAEKDTSQWVTGDEPMTGAQRSYLHTLAQEAGAG
FT                   VPDDATKAQASDLIDELQHLTGRGE"
FT   gene            70740..71237
FT                   /locus_tag="Mvan_0059"
FT   CDS_pept        70740..71237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0059"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0051 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10910"
FT                   /db_xref="GOA:A1T160"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A1T160"
FT                   /protein_id="ABM10910.1"
FT                   /translation="MGKNERAKIVMSDGEIAEFIERSRTATMATVLPNGRPHLVAMWYA
FT                   VLDGEIWFETKAKSQKAVNLRRDPTITVMIEDGLSYDTLRGVSIDGQAEIYDDPETSLR
FT                   VGISVWERYTGPYTDEMRPFVDQMMNNRICVRVVPSRTRSWDHRKLGMQGMPISGSTAQ
FT                   YL"
FT   gene            complement(71234..72040)
FT                   /locus_tag="Mvan_0060"
FT   CDS_pept        complement(71234..72040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10911"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A1T161"
FT                   /protein_id="ABM10911.1"
FT                   /translation="MTTRAYFLPDRDGFVPTALARGPWGGTISGNYVGGLLGHVIDRDT
FT                   GDPELQPARLTVDLMRPVAMAPVQVQTSVVRSGRRLKLVEASMTQSGTVVARASALMLR
FT                   RGEQPPGPRWSTPVRMPPVPPLPDPPPKRAVLMVWSYGNNGDTPAPGLDAWRYDGPKRI
FT                   WTCDLGPLVAGTEQSAFTRAAVVGEMASSLTHFGVDGLPFINADYTLTLSRLPETPYLG
FT                   LAALTHFSHAGVATGTAVVVDELGPIGTATATAVANPGFDPAHPIG"
FT   gene            complement(72059..72400)
FT                   /locus_tag="Mvan_0061"
FT   CDS_pept        complement(72059..72400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10912"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A1T162"
FT                   /protein_id="ABM10912.1"
FT                   /translation="MTTDKTGAPTDVAQESDRFSISVDGKKAGFTEYVDFGDHRNQRIF
FT                   PHTEIDDAFGGRGLATILVGEALEATRTAGLRIVPVCEMVAGFIDKHPEFKDVVDPVTA
FT                   DVEQLVSNR"
FT   gene            complement(72409..73374)
FT                   /locus_tag="Mvan_0062"
FT   CDS_pept        complement(72409..73374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0062"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: mpa:MAP0031c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10913"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T163"
FT                   /protein_id="ABM10913.1"
FT                   /translation="MSNTDPAPAEVDCVASPFAGVLHPREVPLGGPRAIRVRRTLPQRE
FT                   RSLIGAWCFADHYGPHDVRGGTGMDVPPHPHTGLQTVSWLFSGEVEHRDSAGVHAMVRP
FT                   GELNLMTAGAGICHSEVSTGATEILHGAQLWVALPESDRDTDRDFAHYAPTPRQVGAVT
FT                   TRVFLGELEGQRSPVHTFTPLLGAQLDLDPGAEVSLDVDDRFEHGVLVDRGDVEACGSA
FT                   LAVADLAFQGTGHHRLHLLNRGDIPARVLLLGGTPFTEDLVMWWNFVGRSHEDIARFRE
FT                   QWQNHDARFGAVEGYRGAVTRLPAPPLPNATLRPRRHPGV"
FT   gene            complement(73415..73801)
FT                   /locus_tag="Mvan_0063"
FT   CDS_pept        complement(73415..73801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0063"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmu:22376 Wiskott-Aldrich syndrome homolog
FT                   (human)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10914"
FT                   /db_xref="UniProtKB/TrEMBL:A1T164"
FT                   /protein_id="ABM10914.1"
FT                   /translation="MIHSKVRVALAAVAGAAVLPFAVGCSSGSAAAEQPSGNHDAFVQC
FT                   MTEHGVSAPPGGGHSGPPPEGAPGPPPEGAGGPPGSPADGAGGPPGSPADGSPPPAPLG
FT                   VDQQTWDAATQACGSLMPGPPPSR"
FT   sig_peptide     complement(73703..73801)
FT                   /locus_tag="Mvan_0063"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.617 at
FT                   residue 33"
FT   gene            complement(73869..74306)
FT                   /locus_tag="Mvan_0064"
FT   CDS_pept        complement(73869..74306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0064"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mmc:Mmcs_0055 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10915"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T165"
FT                   /protein_id="ABM10915.1"
FT                   /translation="MTNWINTVSRDHVERGVRGRFTQANHGKPHMLRKMSRGDWIVFYS
FT                   PKTAYPDGEPLQAFTAIGQVADDEPYQVEVAPDFQPWRRNVDFLDCAETPIRPLLDDLE
FT                   FIEDKARWGYKFRFGVFRIDDHDLEVIRSAMVTPTAHIAGT"
FT   gene            74390..74659
FT                   /locus_tag="Mvan_0065"
FT   CDS_pept        74390..74659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10916"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A1T166"
FT                   /protein_id="ABM10916.1"
FT                   /translation="MSDGAVTAEYLRNFVFEKPPWGKRGYNEKAVGDFVALCARRLDGR
FT                   GHLSAEDVRNVRFNKPPFGKRGFDEAQVDALLGEIATAIAKLDA"
FT   gene            74652..76211
FT                   /locus_tag="Mvan_0066"
FT   CDS_pept        74652..76211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0066"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: mmc:Mmcs_2679
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10917"
FT                   /db_xref="GOA:A1T167"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1T167"
FT                   /protein_id="ABM10917.1"
FT                   /translation="MPDPIRDDLAELWRRRALTEDAARPDAVERRHAAGGRTARENVAD
FT                   LVDTGSFVEYGRFAIAPQRMRRDVEDLITRTPADGLVAGTARVDGHPCAVLSYDYTVLA
FT                   GTQGALGHRKKDRLFELIERMQLPTVFFAEGGGGRPGDTDYPVVSALDTRAFALWARLS
FT                   GVVPRIAIVKGRCFAGNAVIAGASDLIVATRDASLGMGGPAMIAGGGLGDVPPDEVGPM
FT                   TTQEPNGNVDVVVDDEAEAVAVTKTLLGYFQGPADSWSAPDQTVLRTAVPDRARRAYDV
FT                   APVIETIADEDSVTFLRPRFAREMVTALARVEGRPVGVIANDTRFTAGAITAAASDKAA
FT                   RFLQLCDAFGFPVVSLIDCPGYMVGPAAEAESLVRRASRMLVAGAALCVPMVAVILRRG
FT                   YGLGAQAMAGGSLHEPVLTVAWPGAHLGPMGLEGAVRLGMRKELDAIEDEQEREERVRL
FT                   ATAAAQENAKALNAAMLFEIDDVIDPAETRAVIAATFAAADTDTRKPAPGGSRFGRFVD
FT                   TW"
FT   gene            complement(76386..76679)
FT                   /locus_tag="Mvan_0067"
FT   CDS_pept        complement(76386..76679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0067"
FT                   /product="transcription factor WhiB"
FT                   /note="KEGG: mmc:Mmcs_0057 transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10918"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A1T168"
FT                   /protein_id="ABM10918.1"
FT                   /translation="MNAIPWDETPIGECTRDPERWTTTADDEAKAICRSCPRRWLCARE
FT                   ACESPRVEGLWAGIYVPEAGRGRTFALRQLKSLAEQHGYTVRERRVYYAESA"
FT   gene            77024..77764
FT                   /locus_tag="Mvan_0068"
FT   CDS_pept        77024..77764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0068"
FT                   /product="conserved hypothetical alanine rich protein"
FT                   /note="KEGG: mmc:Mmcs_0058 conserved hypothetical alanine
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10919"
FT                   /db_xref="UniProtKB/TrEMBL:A1T169"
FT                   /protein_id="ABM10919.1"
FT                   /translation="MTNAEPVDQSTGAPDPGMVRAGAAAAARRRELDISQRSLAAEGII
FT                   NAGALIAFEKGRSWPRERTRARLEEILQWPPGTIARLRRGEPLRAAPPPPESRAPASND
FT                   EVSLIAQAVTTAVSAFGSTVAALPPVDDAAFVPRVTAILADLRQLDAVASRAARIGRVT
FT                   PALIKALSAVRGLYDDLMVRAARAPHATLGQRLYAARRGANLTVLETAQAAGVSEDAVQ
FT                   QAEADEPLSPADIAAIETLISQIG"
FT   gene            complement(77748..78920)
FT                   /locus_tag="Mvan_0069"
FT   CDS_pept        complement(77748..78920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10920"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T170"
FT                   /protein_id="ABM10920.1"
FT                   /translation="MVNDRDDPATDQAAVTPEPPRPREMFRQPTRPLPPQPRRPDGWEQ
FT                   QQPPPGWAPQAPPSAPPYPPRPQADAPWTAPQPTSYAEWIRPADLVPHRKVVPGSGWRL
FT                   ALYKASFGLINLGPSPEDKRVAELEATIRTPLRGRFKIGVMGKGGVGKTTVSASIGSVL
FT                   AEIRQDDRVVAVDADTAFGKLGSRVDPRAQGSFWELAADRHLEAFADIRNHLGCNAAGL
FT                   FVLAGEATPARRRVLDPAIYREATTRLDRHFTISVIDCSSTMDSPVTQEVLRDLDALVV
FT                   VSSPWVDGAAAAGQTLDWLAARGLTDLLQRTVVVLNDSDGHADKRTRGILAQQFSGHGQ
FT                   LVIEVPFDGHLRPGGVIDGTGEMSPSARRKFIEVVAALAAFFPASVTRSG"
FT   gene            79338..80189
FT                   /locus_tag="Mvan_0070"
FT   CDS_pept        79338..80189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10921"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A1T171"
FT                   /protein_id="ABM10921.1"
FT                   /translation="MASPFLGDGEPTHYDDVVGVEVTIDGMLVIADLLHLVDFPLSLGI
FT                   RPNIPYEDQRKIVWDQVTRDLTAQGILTAYGDPHPEVAAMVDALSRPDRTLDCRWWRRD
FT                   LGGKMVRFVVCRKGDRHVVAARDEDMLVLQRVAPQIGLAAMVGVVIGGAPAADVEPLTG
FT                   IATKLAEARTAEQIGAYGQPPLSAKIYAEATANPDSWVEITAAERHPGGTYSQAGVGAG
FT                   VLDSAHGRIVSIPRQVGGELYGSFLPGTQENLQRALDGLVEFLPSRAWFDHADALDNSY
FT                   SD"
FT   gene            80207..80713
FT                   /locus_tag="Mvan_0071"
FT   CDS_pept        80207..80713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T172"
FT                   /protein_id="ABM10922.1"
FT                   /translation="MANPPPGFEASGFDASGFHDGGDHDDLAALDFSIAGDEDEADLGV
FT                   IFGDFGSASDDDGEMPMFTVTNPPGTVTVTTYMDGRVHQIELAPSAAALPEAVLADEIV
FT                   VIAGLATQDARSAQYTFMLEGMREHGHDNVTTRDFLNRDLDLPTPEQARAARAELFTTR
FT                   YAGDE"
FT   gene            80710..82434
FT                   /locus_tag="Mvan_0072"
FT   CDS_pept        80710..82434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0072"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: magnesium chelatase, ChlI subunit; AAA ATPase,
FT                   central domain protein; SMART: AAA ATPase; KEGG:
FT                   mmc:Mmcs_0064 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10923"
FT                   /db_xref="GOA:A1T173"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A1T173"
FT                   /protein_id="ABM10923.1"
FT                   /translation="MTDHLASVFGTAVGLLPTSQARSLELFTEITTLDESACDAWVGRI
FT                   RCGDTDRVTMFRAWYSRNNFGQLAGTAEISMNSLGARVPIGGMYGDITYPVNSPLAITL
FT                   GFAVSEAALGNYADAMEALDEAQAAGGEHLVSWVKAVVYGAAQRWTDVIEEVRTAGAGW
FT                   PDKFLAGAALVAHGVAAANLGLFTEAERRLVEANSAPAGQACNRTIAWYSAMAYRALGN
FT                   EEAAVRLLEWLQASHPSPEVAAALKDPSYRLQTTTAEKIASRRDPWDPTTVEADNTGRE
FT                   MLLADAQAELDRQIGLTRVKDQIERYRAATQMAKVRAARGMKVAQASKHMIFTGPPGTG
FT                   KTTIARVVANILAGLGVIAEPKLVETSRKDFVAEYEGQSAVKTARTIDRAMGGVLFIDE
FT                   AYTLVQERDGRADPFGTEALDTLLARMENDRDRLVVIIAGYSNDIDRLLETNDGLRSRF
FT                   STRIEFDSYSPEEIVDIARVIAAHNDSSLTDEAAKRVLEAATLLSQSTSNGKPALDVAG
FT                   NGRYARQLVEAGEQTRDMRLARSPDFDTLDVEQLSEINGDDMAAAITSVHGRMDISG"
FT   sig_peptide     80710..80775
FT                   /locus_tag="Mvan_0072"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.620) with cleavage site probability 0.528 at
FT                   residue 22"
FT   gene            82438..83925
FT                   /locus_tag="Mvan_0073"
FT   CDS_pept        82438..83925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0073"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0065 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10924"
FT                   /db_xref="GOA:A1T174"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:A1T174"
FT                   /protein_id="ABM10924.1"
FT                   /translation="MAGFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   TTGIVIAVLICLGAVLLAYFKPLGKRGGDTLLVDRTTNQLFIVLPDSGQLRPVYNLTSA
FT                   RLILGDGKTPVAVKSQELDKMPKGQPVGIPGAPYATPVASSAESQWTLCDTVIKPDSVA
FT                   PAVESSVLITPLALDASVGAMRPEQGMLVSFRDQNWLVTEAGRHLIDLADRAVTSAVGI
FT                   PVTARSAPISEGLFNALPNAGPWRLPDIPAGGSPNSVGLPPELVVGSVFVTVTDAGEQA
FT                   GEQNYVVLPNGVAKVNTTTAAALRATNSFGLIEPPSLESSAVARIPEQVYDSPLPGVPM
FT                   DVLARQELPTLCWAWQRVAGDQAPKMTVIAGRRLPLPPSALSTGIDQITGDATVYIDGG
FT                   QYIRLQSPDPRFGENLYYIDPQGVRYGLPDEETAAKLGLSSPRTAPWQVVSLLVDGPVL
FT                   SQQAALVEHDTLPPNPNPRSVGADAAAPVGANNGGGG"
FT   gene            83922..86144
FT                   /locus_tag="Mvan_0074"
FT   CDS_pept        83922..86144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0074"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mmc:Mmcs_0066
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10925"
FT                   /db_xref="GOA:A1T175"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T175"
FT                   /protein_id="ABM10925.1"
FT                   /translation="MTTRKFTPIIKRGPRLTPGEINVTPPEDLGVDIPPSGMQKALPWV
FT                   MGGCMLGMIAILIFGGMRNFSPYMLMMPMMVVMGAVGMMAGGGSGGKKVPEINADRKEY
FT                   LRYLAGLRTRVTSSASAQVTFFNYHGPHPDDLLSIIGTHRQWSRPANHDFYAATRIGLG
FT                   SEPAVDRLLKPAVGSELAGPAGAPQPHLEPVSHMWVTKFLRTHGLIHDCPKLVQLKTFP
FT                   TIAVGGDSAGSAALLAAMICHLAVFHPPDMLQMRVLTDDPEDPAWAWLKWLPHLQHETD
FT                   TDAAGTTRMVFTRPDALSDLAARGPHTADAAPSGPYVVVIDLTGGRAGFPMDGRSGVTV
FT                   ITLGNHRSAYRIRVDADGTADDKLPGASFRLVASQVDGMTPRQAERVARKLAGWSITGT
FT                   IIDKGTRVQKKVATEWHEIVGAQSVEEVTPARWRMFTDTDRDRLRIPFGHELKTGDVMY
FT                   LDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLAATHHPDQINLLLTDFKGGSTFL
FT                   GMEKLPHTAAVVTNMEEEAELVSRMGEVLTGELDRRQSILRQAGMQVGAAGALSGVAEY
FT                   EKHRERGADLAPLPTLFVVVDEFAELLQNHPDFIQLFDRICRVGRSLRVHLLLATQSLN
FT                   TGGTRIDKLEPNLTYRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDPVKF
FT                   QSVYTGNPYVPTVGNAGDDEAPKAHADKNIRIHRFTTAPIMDARLG"
FT   gene            86144..87904
FT                   /locus_tag="Mvan_0075"
FT   CDS_pept        86144..87904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0075"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mmc:Mmcs_0067
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10926"
FT                   /db_xref="GOA:A1T176"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T176"
FT                   /protein_id="ABM10926.1"
FT                   /translation="MSIDSGQKVLREVVLEQLTTGENHAYRMWLPPLADPTPVNELIAR
FT                   DYDRRPLRIGLGIMDEPRRHRQEVWGVDVATAAGNIAVGGAPQTGKSTLLQTFILSASA
FT                   SHTPRQIQFYCVDMGGGGLMYIEDLPHVGGVATRAEPDRVNRVVAEVKAVLRQREQTFK
FT                   EYRVGSMADYRQMREDPNHPASADPFGDVFLVVDGWPAFTAEFPDLEATVQDIAGQGLA
FT                   FGVHTMISTPRWTELRSRVRDYLGTKIEFRLGDVNETQIDRITREIPVNRPGRAVSTEK
FT                   HHLMIGVPRLDGVHSAEGLVPAMAAAVKEIAARHTEEAPRVRVLPSRIHLHELDPTPPG
FT                   PEADYRTRWTIPVGVRESDLTVAHNHMHSTPHHLIFGAAKSGKTTIAHAIARAICARNS
FT                   PQQVRFMVADYRSGLLEAVPESHLLPAGAINRNHATLEESIKALVANLTKRLPPSDLTP
FT                   SQLRQRSWWTGPDVVLLVDDWHMITAAGGMLSPMAPLAPLLPAAADIGLHLVVTCQMSQ
FT                   ASRAVMDKFVGAAYGAGTPTMFLSGEKQDFPSREIIVKKRPPGQAFYVTPDVKEVIQAA
FT                   YVDPPEEEVF"
FT   gene            88073..88369
FT                   /locus_tag="Mvan_0076"
FT   CDS_pept        88073..88369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0076"
FT                   /product="PE-like protein"
FT                   /note="KEGG: mmc:Mmcs_0068 PE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10927"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A1T177"
FT                   /protein_id="ABM10927.1"
FT                   /translation="MQPLSHNPGAIGVGGQVTANGARGLATGTAATSAVSALAPAGADE
FT                   VSAAAAVTFAAEGIQTLGINALAQEEIARAGASIIEAAGAYQAVDASNATTLI"
FT   sig_peptide     88073..88219
FT                   /locus_tag="Mvan_0076"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.672) with cleavage site probability 0.502 at
FT                   residue 49"
FT   gene            88399..89718
FT                   /locus_tag="Mvan_0077"
FT   CDS_pept        88399..89718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0077"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0069 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10928"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A1T178"
FT                   /protein_id="ABM10928.1"
FT                   /translation="MATIGIPIPPIWGAFPPEINTSRLQAGAGAVPMLQAAAGWEAFAI
FT                   SLETQADELAASLATLSQMWQGTASERAVMATMPMVMWLRMLSLQAQKRAAQASAQATA
FT                   WASAATSTPQLPEIETNHITNAVLNATNFLGVNTVPIAVNEADYIRMWNQAAAVMTGYE
FT                   TETILNSTFEPVAPPKPITVFGSTQAAMATAIGSAAPGIASAAARNATFTKVSVVGKLD
FT                   EVNQKAGHAEGLLQQAADSGRSQAEQGQLLQQAPQQGMQMGMQMASQLGSTLGQLPQQM
FT                   MQGVTQPFQQLTQPLQQMSSLFGQMGGLGGDRGAQIGMLGATPFSNHPAIGGSGAATGA
FT                   GLVRAASLPGAGGTAARTPLMSNLVGSGLQPTVSAVAVGAGAGAGAGAGLAPVGAGSGM
FT                   GGGGPMGMLGQRGKSGGNKPGLNAPAPLEHDLSEDDDDDW"
FT   gene            89821..90126
FT                   /locus_tag="Mvan_0078"
FT   CDS_pept        89821..90126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0078"
FT                   /product="10 kDa culture filtrate antigen LHP (CFP10)"
FT                   /note="KEGG: mmc:Mmcs_0070 10 kDa culture filtrate antigen
FT                   LHP (CFP10)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10929"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T179"
FT                   /protein_id="ABM10929.1"
FT                   /translation="MALEADVAVLAAEAATFDRITGELQAVRAQIEAIAAASSANLRGA
FT                   AGDAAQAAMMRYREAADQQNRLLADISENINISGVKYDTTDADNASSLTNSMGSVL"
FT   gene            90169..90450
FT                   /locus_tag="Mvan_0079"
FT   CDS_pept        90169..90450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0079"
FT                   /product="6 kDa early secretory antigenic target EsaT6
FT                   (EsaT-6)"
FT                   /note="KEGG: mmc:Mmcs_0071 6 kDa early secretory antigenic
FT                   target EsaT6 (EsaT-6)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10930"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T180"
FT                   /protein_id="ABM10930.1"
FT                   /translation="MITYNFAGIESDAGEISGQVGKVAGLLAEGHGALTRLQAVWTGDG
FT                   QMAYDAVQNRWNQNSEELNLALQSLSEALSRSGGDMFGADQGVAGQFT"
FT   gene            90551..91918
FT                   /locus_tag="Mvan_0080"
FT   CDS_pept        90551..91918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0080"
FT                   /product="conserved hypothetical proline and alanine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0072 conserved hypothetical proline
FT                   and alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10931"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T181"
FT                   /protein_id="ABM10931.1"
FT                   /translation="MSADYDRLFHSPDAARTADESDRETPPAGRDTVAPPGGAPNGDAT
FT                   PPPMPAARAQAMQAPPSWQTEVMSPITGLQPPNQPAAQRVPDNGMMRAPQAPPVGARHE
FT                   QQRSAPPPAPRPAPAPPPSQFYGEPTDQRQPTAPTSAAAMGNHRAIDALSHVGVRSAVK
FT                   MPSQRGWRHWLYVMTRINLGLSADELYELDLHARIRRNARDSYHIGVFGLKGGVGKTAV
FT                   TVALGSALASIRGDRILAIDADPDGGNLADRAGRQSAATITDLLSDKELNRYNDIRAYT
FT                   SMNASNLEVLSSDEYSAARREFNDEDWREATEIVSRYYNLVLADCGAGLFQPGARGVLS
FT                   TVSGLVIVASASIDGARQAAITMDWLRQNGYQDLLGRSCVVINHVTPGKPNIDVEDLVQ
FT                   QFERHVPAGRVIVLPWDKHIAAGTEIQLSLLGKTFNRKIVELAAALSDDFDRLERR"
FT   gene            91915..93441
FT                   /locus_tag="Mvan_0081"
FT   CDS_pept        91915..93441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0081"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0073 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10932"
FT                   /db_xref="GOA:A1T182"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1T182"
FT                   /protein_id="ABM10932.1"
FT                   /translation="MTATVAPPTSSNVTPGRPTTTRVTILTGRRMTDLVLPSAAPIETY
FT                   VDETVSVLADILADTPENVLADFDFKAQGVWSFARPGAPPIKLTESLDDAGVVDGSLLT
FT                   VVSVSRTERYRPLVEDVIDAIAVLDETPEFDRSALYRFVGLILPLAAFMVACVAILSWS
FT                   STGRDWWWAVALGVLGAGLMGGSVLAQNRYRHLDMAESLLVSSLVTLVGAVVLAVPLPE
FT                   GVDSLGAPQVAGAGALVLLMVLATRGGPRRRAEVAAFLAVIALALTIAAVAFGYGWNDW
FT                   VPAGAIAFGLIVVTNAAKLTVAVARIALPPIPAPGETVTNDELLDPVTTTDASEESETW
FT                   QAIIASVPSSAARLTERSRLAKRLLIGFLSAGALILAAGSIAVVVQGHFFLHSMIVAGL
FT                   VTMLCGFRSRLYAERWCAWALMAAAVAVPTGVVVRLCLWYPERAWLLLAIYTALALLAV
FT                   IVIGASEGVRRISPVTKRILELLDGATIAAVIPMLLWIAGVYDVLRNLRF"
FT   gene            93451..94170
FT                   /locus_tag="Mvan_0082"
FT   CDS_pept        93451..94170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10933"
FT                   /db_xref="UniProtKB/TrEMBL:A1T183"
FT                   /protein_id="ABM10933.1"
FT                   /translation="MATGGTPPLSVDPEELSAAGGALLDSARELPQAPAPFNPVGTDPL
FT                   SAAIIGQIPAVEAPIATQLPLIQAQATSTAQNVVSAAQVYAETDARNGAAIHEQMQSRL
FT                   DPLGTGSGGGSLPSTAGGGADSLGMPMQMAGQMAQMPMQVMGAVAAVPQGIMQGAQQAG
FT                   QQVQQMVGQFGDQGAKDGQKGTPSGELPTAANREEGAAAAEPHAERAPEPEEKTDTDGG
FT                   QRPGRHRAAESDERIEL"
FT   gene            94167..94478
FT                   /locus_tag="Mvan_0083"
FT   CDS_pept        94167..94478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10934"
FT                   /db_xref="GOA:A1T184"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A1T184"
FT                   /protein_id="ABM10934.1"
FT                   /translation="MSAPLEVDTSVMRRVGSDFDSAGDRMAGLQADAPLGDAAAAVPQL
FT                   QTAAACNAARTTVATEMTKIAGSARTYGADLRSAADRYDATDETSGRAIDGVGIPGPR"
FT   gene            complement(94479..95549)
FT                   /locus_tag="Mvan_0084"
FT   CDS_pept        complement(94479..95549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10935"
FT                   /db_xref="UniProtKB/TrEMBL:A1T185"
FT                   /protein_id="ABM10935.1"
FT                   /translation="MLPSPPRQWPHPGRLNVPGSPTSGPTEKWSIRVAVLLVLTLVTVV
FT                   THQGMPRNAAPPPPATPASPAGPPADASQIASAEDEDPVSIVTDDPTCPEWEPITAALN
FT                   TELGNGWHQRDPSIPQTEWTDDQHTQYRAVAVAMRAAADKSVALAKQTPHRVMRELYEQ
FT                   AIAYWRAYADTVDNYRPSADHLAGAATSAAESIQSICAAIDFGAAAGRAALTLPGPPPV
FT                   PESPLADPAHPPRFITGASAFCSEWVTMVGDYDAATREWRDRHDPNLPASQSPPDLREL
FT                   NAKAATVMQQNADRTQLLGLLSGNLTAADFAALSSHYRRAYAMALPSYGLPDTHLDDAA
FT                   SRLQSLTDHACRAVRK"
FT   gene            complement(95565..97766)
FT                   /locus_tag="Mvan_0085"
FT   CDS_pept        complement(95565..97766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0085"
FT                   /product="conserved hypothetical alanine and proline rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_2470 conserved hypothetical alanine
FT                   and proline rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10936"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T186"
FT                   /protein_id="ABM10936.1"
FT                   /translation="MGISKNVGEYVEEMTEPAGWPHVDEDHLYTRASGFVDKVTQLIAV
FT                   RDSWQQQQARLFGGGAWSGAAANAAETAIQARVSEMISLINHLEKAIAWYTMTARTIAQ
FT                   TKATINQNLETSYSFIASIRASPELDEVEKDGIIQSWVQSQRAVNTVTVLTAAGDVAAF
FT                   DSWQPPPSPQRIPATLSPPESVSAPSGPEPPKQNVGYFGPTRPPAAEPRGGSAGLSAKA
FT                   ANDAYMAQGPSASADQPVPISQSSGGGSPGSPGGLGSPGSPSSSTSGSSPISTSGGSSS
FT                   GSGASSSGSGSGSGGSSSAAASSSGTSPTSGGQSATGAAGGQPTAASPASAAKAQPSPM
FT                   QQMVNQAPPPLASSAPATSPAPAPAPSQPAAAPSAAAGAGPSSGGVGGISASAGSAPVG
FT                   AAPPSGAPPAPPVPLGPPTSPAPPGPVPPTGTPGTAPGGAMGPGVAPMSTTGTAGGAAP
FT                   APIPVSTARAERDAIAAASTAGALRRKTNGADPLQQARHIAAALNVGIMDFGFFWVTGV
FT                   TMEGTIVVANSYGLAYIPAGVALPDQVRMATADESIPAGERAKWATYPILAVQGWAQHH
FT                   NQQLRAVVATEEQFANFDPGVAKIILTQDDIPESGQMQGRSRLEVIAPEAAQRLSAVSD
FT                   FGLNDLLPPATADLEPPADDSARLWFEVAKPLMSTNPQRSGPHLQAFVAYAKHAQELAL
FT                   HKAHNAAEPGDQRLAIADWVYWQHLEVLLTDAVSTDAAV"
FT   gene            complement(97769..98962)
FT                   /locus_tag="Mvan_0086"
FT   CDS_pept        complement(97769..98962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10937"
FT                   /db_xref="GOA:A1T187"
FT                   /db_xref="UniProtKB/TrEMBL:A1T187"
FT                   /protein_id="ABM10937.1"
FT                   /translation="MKPKRRRLSALSGLTWEDGNDGARYGEVYMSSPPPDQWPAPPPPP
FT                   TGPPQGATQWGPRTTGPTRGGAAAKWVLGGLALLVVVVITVVATILVTQSPQTSGPPVT
FT                   STPPRTTASQVAVASADDRDPAGIILDDATCQQWSPISAAFAHVASNGWNDRDPTIPAS
FT                   DWPPALRSQYEAVATVLNESADRSSELARKTPHRVMRELYEQFIAYSREYAERIRSYTP
FT                   EANGFALVTVGLAATLTAVCDAVRSGAAGARSPLVPDAPPPSGSMAKADPDNPQRFLKD
FT                   LNPVCSQWLNTAKQFGDDTAAWRSVDPNIPGNELDANQRAINASVMSVMEANAMETQLL
FT                   GKQSSNPIWADIATLSAQYRRAYVSALTTYQPADNDLQIAASSAIGTVSEACRTVGA"
FT   gene            complement(99179..99544)
FT                   /locus_tag="Mvan_0087"
FT   CDS_pept        complement(99179..99544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10938"
FT                   /db_xref="GOA:A1T188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T188"
FT                   /protein_id="ABM10938.1"
FT                   /translation="MGYEKIHCCGSRDSGGRCDRRHHSGRRGGVDAVRRVDLGQFFGPA
FT                   SLIGVVAGTTYLMLVVLQVVEVNYGFAALVIAGAPLMLTWGWVKQLGTGLVLSISVLPL
FT                   TVIAFLIGAGLGGSVFG"
FT   gene            complement(99755..101167)
FT                   /locus_tag="Mvan_0088"
FT   CDS_pept        complement(99755..101167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP4333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10939"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T189"
FT                   /protein_id="ABM10939.1"
FT                   /translation="MGGVTISVVRSSNPVGLAEASESMQRTIRALDDLIESRQRTLDQL
FT                   SLVWSGAASDTAIRRGRRLLREKNNFRDRLHAIQTTLFRGGSQLSALREEILSTTSQAT
FT                   TLGGIVGDDGSVQPTSVAHMLTPTIATAYSTVLRKLLHTFEAVDEATASGLRGGRPGTG
FT                   ESIYQAVDFVVGGGAPEAPPDQDPAATTRRQNEINAFKQVFGRHPESPTDWKTAAALDP
FT                   HSYDDKYNDEPPSVVVGRIEPVPGQGIVKSGLFIPRDVVFNVPRDDLGDNRGFDPNSGP
FT                   EETRVSIYVDYENGLVIARQNPSVDTAGNVRVLTPDIKVQQAPGGAVRIQYEAANGFAP
FT                   PGAELSGHVVRGDIVVTPGAGSAAASVDGVIGDYPSLEVYQDLPTGQTYTLAQDAADSG
FT                   NVYGPLTELPFSHEIGEGTAAFAPFESLTPQLPGGPRYPGDAMPYVPGRVDPNTPTELA
FT                   PADKIPNVVVVR"
FT   gene            complement(101172..101516)
FT                   /locus_tag="Mvan_0089"
FT   CDS_pept        complement(101172..101516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10940"
FT                   /db_xref="GOA:A1T190"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A1T190"
FT                   /protein_id="ABM10940.1"
FT                   /translation="MTDDMHPEVAAVLRQARRLQSLMDEQLDKMATESFTATDENDTVE
FT                   VTLNGHQWLKDVYIQDGLLRLGAEEVEQRVNEALHKASAEASASIDADRERIDAVVAEI
FT                   TAEISDDERE"
FT   gene            complement(101516..103141)
FT                   /locus_tag="Mvan_0090"
FT   CDS_pept        complement(101516..103141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10941"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="InterPro:IPR041275"
FT                   /db_xref="UniProtKB/TrEMBL:A1T191"
FT                   /protein_id="ABM10941.1"
FT                   /translation="MADELKVDPDDLDTKAGTVEAIPWGEDPSAVAVADPDKLTPTTAS
FT                   VRNLIKNAEALGAEQRWGIAESRRLAETLRLVAQAYRAVDEASAGNIDSTMPGGTSSPA
FT                   PAPVPIPPNSVPAPPPPPPMPGFENVAADGDILDPIETDNKLLEGDQAAALRAAAARWS
FT                   ANAVRLADASAPFEIKIQNWEGVAAEAAYIKFKSFGGWLQTLAGKWTQLAAEAEKLAAA
FT                   HDQAKAANAPVRAQYEALQTQLMTTSMDGGAQRAVQLQMEQLYQESEAIRETYAKAGQP
FT                   TPVQPPQPRPDAVAPAAPVTGNGDPNRRGMPAHTEEESRRGGGSGAGQPSGSGGQQPGG
FT                   QPQIPQEAPVSPMSAAEQAAQGAQQAAPQGGSQGGSPGGGSQGDGSQGGSPAGGSQGGA
FT                   PGGGMPGLGKGEPKLPTDPSLRPAAAGGGGSGGGGGGGGVPAGPLQPAVGAETVAPTPI
FT                   VPAAAAGPGVSSGSGGVAGGMGAGGMAPMMGGAHGGGAGEKKRNPALSPDEPLYVEDRP
FT                   HTEQVIGVRPRRRGAAEDTKKGDT"
FT   gene            complement(103173..104570)
FT                   /locus_tag="Mvan_0091"
FT   CDS_pept        complement(103173..104570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0091"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0077 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10942"
FT                   /db_xref="GOA:A1T192"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A1T192"
FT                   /protein_id="ABM10942.1"
FT                   /translation="MSRFASIFGLRFTTGHALWAAALIPACILVFARLELLWLGITLGV
FT                   LIGLASVVTIRGRRLTGWVAALFAWRRRHRQPPPTPSEPAVGATVIPGDHVALRWQDDY
FT                   LVSVIELVPRPFTPTVIVNGEAFTDDVVETRLVEDLLTAYCPDLEADIVSAGYRVGKTA
FT                   PAALVALYEQVVGPYPAPASRRTWIVLRADPDKTRKSALRRNEGVAGLAQYLVSSTTRI
FT                   ADHLASKGVDARPARSFDDFDRATEISFERETWSMVKGRSTFTAAYHAPGGPDVWWSAR
FT                   ADHTLTRMRIVPGSAPTTTVLLTTLANPSTPRGFSCLFGGQRAALLGENPVTDRHYELP
FT                   IGSAGVLVGETADRYPVYMPFDDVDVSINLGNARLFTQFVVRSAAAGAAVTLQPQFEEF
FT                   AGFVNARIGQVAKVAWPHATTYLRPHPGVGRVMLRDDFIATPRHKQLPIRLINPREESR
FT                   YQMVLEP"
FT   gene            complement(104567..105913)
FT                   /locus_tag="Mvan_0092"
FT   CDS_pept        complement(104567..105913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0092"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0078 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10943"
FT                   /db_xref="GOA:A1T193"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1T193"
FT                   /protein_id="ABM10943.1"
FT                   /translation="MRRIGALIAALFLVLLTAPPASAIEPPIVDPAAIPPDETGPDQPM
FT                   EQRRICAAPTVFPNSNFADRPWASDYLRLTEAQKFATGAGVTVAVIDTGVNGSPRVPAE
FT                   PGGDFVDQAGNGMSDCDAHGTLTAAVIAGRPAPHDAFIGVAPNARILSLRQTSDSFLPV
FT                   GARTDPNDPNSTQTAGSLRSLARAIVHAANMGAQVINISEAACYKITRPINEAVVGAAI
FT                   NYAVNVKGAVIVVAAGNTGENCTQNPPPDPAVPADPRGWQEVQTIVSPAWYSPLVLTVG
FT                   SIAPNGQPSGFSMQGPWVGAAAPGENLIALGYDGNPVNALQGEDGPIPISGTSFSAAYV
FT                   SGLAALLRQRFPELTPAQIINRITATARHPGGGVNNVVGAGVIDPVAALTWDVPPGPAD
FT                   IPYNIKEIPPPVYVPPPDRSPITGVVLVGVGLAALLGIAALGRRALRRR"
FT   sig_peptide     complement(105842..105913)
FT                   /locus_tag="Mvan_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            complement(106149..106406)
FT                   /locus_tag="Mvan_0093"
FT   CDS_pept        complement(106149..106406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0093"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: mmc:Mmcs_0079
FT                   phosphotransferase system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10944"
FT                   /db_xref="GOA:A1T194"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1T194"
FT                   /protein_id="ABM10944.1"
FT                   /translation="MPTKTVIVGSAIGLHARPAAIIAEAVVEAGVPVTLSMDGGEPVDA
FT                   GSALMIMTLGAGNGAEVTVSSDDEDALNKVAELVQQDLDA"
FT   gene            complement(106439..108409)
FT                   /locus_tag="Mvan_0094"
FT   CDS_pept        complement(106439..108409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0094"
FT                   /product="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIC component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIA component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; phosphotransferase system, EIIC;
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: mmc:Mmcs_0080 phosphotransferase system,
FT                   fructose IIC component; TC 4.A.2.1.4; TC 4.A.2.1.4; TC
FT                   4.A.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10945"
FT                   /db_xref="GOA:A1T195"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1T195"
FT                   /protein_id="ABM10945.1"
FT                   /translation="MTSSTAPIITRDLVLLDVAIDGDKQAVIARLVNALAAAGRTDDAD
FT                   GLIGAAMAREEQSATGLPGGIAIPHCRSPYVDTPTIGFARLTPGVDFGAPDGPADLAFL
FT                   IAAPDSGGQEHMKLLSSLARALVRKDFVESLRNAGSADEVVALVEGVVNPAPAAPPAPV
FT                   EKPAAKTIVAITACPTGIAHTYMAADALAAAAKEAGVTLVVETQGSSGSTPLPSDTIAG
FT                   ADAVIFATDVGVKDRGRFAGKPVVASGVKRAINEPAKMIAEAVAAADNPNAPRVEGSGA
FT                   AASEAPSGDVGWGTRTRQILLTGVSYMIPFVAAGGLLIALGFLFAGYEIADTGNDIALN
FT                   NSLTNLPPGGFLEYLGAILFSLGGLAFGFLVPALAGYISFAIADRPGIAPGFTAGALAV
FT                   FIGGGFIGGIVGGVLAGFAALWISNLKVPQWFRGLMPVVIVPLGASLFVGLIMFFLVGR
FT                   PLALINSGLTNWLSGLSGTSAIFLGIILGLMMCFDLGGPVNKAAYAFATAGLAAETTAS
FT                   FEIMAAVMAAGMVPPLAMALATTIRPGLFSEPERENGRAAWLLGASFISEGAIPFAAAD
FT                   PLRVIPSMMFGGAITGALCMAFGATSRAPHGGIFVLFAIDNKLGFVIALVAGTVAAALA
FT                   VVAAKQFIKAGAKTEPELVTA"
FT   gene            complement(108433..109410)
FT                   /locus_tag="Mvan_0095"
FT   CDS_pept        complement(108433..109410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0095"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mmc:Mmcs_0081 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10946"
FT                   /db_xref="GOA:A1T196"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR022463"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1T196"
FT                   /protein_id="ABM10946.1"
FT                   /translation="MIVTVTANPSIDRTVSLPSPLTRGAVHRVTSVTNQAGGKGVNVAK
FT                   VLTMAGVDAVAVLPAAANDPLLHALQIAAVPYRAVTTTEPARTNLTITEPDGTTTKINE
FT                   PGAKLDAATLEAFTDAVLDAAGGADWVVMSGSLPPGVPASWYGDVVASLASRDCRVAVD
FT                   TSDAPLAALIGSLDRGAPDLIKPNAEELAGVLGLSAQSLEDAVLQGDPGPVVAAARQLI
FT                   DRGIGAVLATLGAAGAVLVDHNGAWMATPPPIVPRSTVGAGDSSLAGYVRAEVGGAVPP
FT                   QRLQMAVAYGSAAAALPGTTLPSPAEIDLNAVQVSPISPIPATR"
FT   gene            complement(109407..110186)
FT                   /locus_tag="Mvan_0096"
FT   CDS_pept        complement(109407..110186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0096"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: mmc:Mmcs_0082 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10947"
FT                   /db_xref="GOA:A1T197"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1T197"
FT                   /protein_id="ABM10947.1"
FT                   /translation="MYPEERQQAIASLVMSKGRASVTELAQAYDVTTETVRRDLAVLDK
FT                   AGVVRRVHGGAVPVRALHLVEPGVGERDVIRAEHKDAIAAAAAEFFPLSGASVLLDAGT
FT                   TTMRIAAQLPADRELVIVTNSVPIAARLATVPSVSLQLLGGRVRGVTQAAVGEQALRVL
FT                   DTLRVDIAFIGTNAISVRHGLSTPDSEEAAVKRAMVRAANYVVVAADSSKVGREDFVSF
FT                   APISSVDTLITDPEISAADSAEFGEHGVEVICAGGRP"
FT   gene            110199..111989
FT                   /locus_tag="Mvan_0097"
FT   CDS_pept        110199..111989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0097"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: mmc:Mmcs_0083
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10948"
FT                   /db_xref="GOA:A1T198"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1T198"
FT                   /protein_id="ABM10948.1"
FT                   /translation="MWVLRQINVDIVGFTPECVDLSTVSCNLVHMTASIPLTSHPTAGT
FT                   VLHGVPVVGGVQYAPVIRPGKLPSTDVGDTMPDLAEDRRAAENERFAAAAATVAGRLRE
FT                   RAAHATGAASEVLAATATLAQDRGWLGAAEKRIKEGTPAVRAVNGAIDQFIEMFTKLGG
FT                   LMAERVTDLRDIRDRVVAELNGLPEPGVPLPDEPSILCAEDLAPADTAGLDPALVVALA
FT                   TTLGGPTSHTAIIARQLGIPCVVAVAGLDDVPAGAMVLVDGTRGTVTVGPDEVSAREAV
FT                   AEAKRAAETAAQWSGPGVTADGHAVAVLANVQDGAAARAARQTPAEGVGLFRTELCFLN
FT                   SDTEPAVDEQATIYSEVLEAFAGNKVVIRTLDAGSDKPLKFAGHPDEANPALGVRGVRI
FT                   AANNPGLLDRQLEAIAAAGQRTGNPPWVMAPMIATAEEAKSFADRARTHGLTPGVMIEV
FT                   PAAALLADRILEHVDFLSIGTNDLAQYTMAADRMSAELATLTDPWQPAVLALVAMTVNA
FT                   GAAAGKPVGVCGEAAADPLLACVLTGFGVTSLSAAAAAVQAVGAKLAQVTLQQCRDAAE
FT                   AVLRTASAADARAVAMSVLG"
FT   gene            complement(111986..112225)
FT                   /locus_tag="Mvan_0098"
FT   CDS_pept        complement(111986..112225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10949"
FT                   /db_xref="UniProtKB/TrEMBL:A1T199"
FT                   /protein_id="ABM10949.1"
FT                   /translation="MTEVHQPGRWEVVAATLHDRGNPADGAEETSLVQGSEDEARRVYA
FT                   DATAQAAEQGYEYVKLRHNGDEVGSWPQATGWTV"
FT   gene            112316..113290
FT                   /locus_tag="Mvan_0099"
FT   CDS_pept        112316..113290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0099"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: mmc:Mmcs_0084 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10950"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A0"
FT                   /protein_id="ABM10950.1"
FT                   /translation="MPAITADTLTLPRISGPDPAETERPVRSVTTGPRGYEGEGFPVVR
FT                   AFAGVNARDLDPFVHMDQMGEVEYQPGEPRGTDWHPHRGFETVTYMIDGRFAHQDSHGG
FT                   GGLISDGATQWMTAGSGILHIETPPAELVESGGLFHGIQLWVNLPRKDKFAAPRYQAIE
FT                   GGQVKLLSSDDGGALVRIIAGEIDGQGGPGVTHTPITLAHATIEPGAQLSLPWKRDFNA
FT                   LVYVLSGRGAVGPVAHPVRQGQLAVLGPGDRITVAADGSQDSHRPALEVLLLGGRPIRE
FT                   PVFQYGPFVMNSKSELIQAVEDFEAGKFGVIPPDALMPHRPLR"
FT   gene            complement(113294..115441)
FT                   /locus_tag="Mvan_0100"
FT   CDS_pept        complement(113294..115441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0100"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmc:Mmcs_0085 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10951"
FT                   /db_xref="GOA:A1T1A1"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A1"
FT                   /protein_id="ABM10951.1"
FT                   /translation="MAAAPHELRHRLVRRVAQRDPDNDALRRALRAAAVVPLAAALSFA
FT                   LAGGSAQTPLFTIFGSTALLVFSDFPGNRQNRAVAYAGLGFNGFVLITLGTLVAPHPWP
FT                   AVAVMFALGVVVTFSGVLSETIAAGQRATLLTFVLPACTPAGPVGERLLGWAIALAVCV
FT                   PAALFVLPPRHHGQLRRRAARACRALADRLDGSATPADVQRAMDALRATFLGADFRPVG
FT                   LTAGSRALVRVVDDLEWVADRVGRNTGVALRDKDAVVRVLRCAAAVLQISRPADRDAAR
FT                   ADLEAALITLRTVARGRWRDDLDAILSAPDDAQAVDLGRDLLRRRTIAATIGATGRVIS
FT                   AAAAADARPVWARALGLRLPPTGASDRLLPETVAAAQITSGFLANRSVAVRNSLRTGLG
FT                   LALAVAVTHLFPVEHGFWVVLGALSVLRSSALTTGTRVWRAVFGTAIGFLFGAVLISLV
FT                   GVNPVLLWLLMPVVVFGSAYVPEIASFTAAQAAFTMMVLIFFNLIAPTGWQVGLIRVED
FT                   VVMGTLVAAAVSMLLWPRGATASVTRAIDSARTVFATYLRTAVLRITRGASEARTDEVA
FT                   TRSHAALAASRVIDDAVRQYLSESSGETDFRAPIVRSFNRAIRLRGAADLVADIPTPPP
FT                   LGTYPSVRAVVESHADAICERVAGRADPDHSWEPISDDFVRALRSEARGDDLGLSAALP
FT                   LLTAAAALGELELIYPRPATG"
FT   gene            complement(115441..115962)
FT                   /locus_tag="Mvan_0101"
FT   CDS_pept        complement(115441..115962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro00767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10952"
FT                   /db_xref="GOA:A1T1A2"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A2"
FT                   /protein_id="ABM10952.1"
FT                   /translation="MSEAPASEADDAPVGHVVAMLRERLYGAISCLATLVVLTRYTEDD
FT                   TSGWARMLDVGVTMGGLWAASLLADWVAHLSVHEQTPRGIEWWRMLQASAQILQAALLP
FT                   LLALGSAAVGLVETDTALWVAKWILVAELGLITLLAVRKTRLPGWQQIVTVLLLIGVGL
FT                   LVIGIKVLAH"
FT   gene            complement(115955..116521)
FT                   /locus_tag="Mvan_0102"
FT   CDS_pept        complement(115955..116521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0102"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0086
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10953"
FT                   /db_xref="GOA:A1T1A3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A3"
FT                   /protein_id="ABM10953.1"
FT                   /translation="MGAVASRESFFKTGLDVLADLGYGGLKLAEVCDRLGVTTGSFYHY
FT                   FPNWPAYSQELVGHWYEGMTLKVVDTVQAETDPRLRIDRLIEAGLTLPHSAEAAIRVWS
FT                   GVDPHVGSVQEAVDRQRFDVMRESALEVLRNPRQAELFAAWAVYLLVGYEQASLPADVD
FT                   GLRWIVGQLLEALDSGRFTSVPGRE"
FT   gene            116760..117323
FT                   /locus_tag="Mvan_0103"
FT   CDS_pept        116760..117323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0103"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10954"
FT                   /db_xref="GOA:A1T1A4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A4"
FT                   /protein_id="ABM10954.1"
FT                   /translation="MRAAREIFSELGYDAATFQAIAVRADLTRPAINHYFSSKRVLWAE
FT                   VVEQTYASVVGVGIARAHEQTSLLNRLMAFLSVATQVDTDDRSAAAFLVTSVLESQRHP
FT                   ELADDDHDSLTNSRAFVSWAVNDAVARGELSADTDVNHLVEMLVAVVWGMGFYAGFVGD
FT                   RSDFGAVMHKLELLLANKLWNLGE"
FT   gene            117451..118380
FT                   /locus_tag="Mvan_0104"
FT   CDS_pept        117451..118380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0104"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0088
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10955"
FT                   /db_xref="GOA:A1T1A5"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T1A5"
FT                   /protein_id="ABM10955.1"
FT                   /translation="MSSLRTDNDTWDIASSVGATAVMVAAARAAETERPEPLIDDPYAK
FT                   ILVAGAGNGAWQYIADDGFVAKVTESDPEIGPLFEHMKNYQAVRTHFFDAFFAAAVDAG
FT                   IRQIVILASGLDSRAFRLPWPAGTTVFEIDQPLVLAYKSSTLASHGVQPTADRREVPID
FT                   LRQDWPTALTHAGFDADQPTAWLAEGLLMYLPADAQDRLFAQITELSAPGSRVAAESMG
FT                   IHAQDRRERMRERFASITAQFDVEPMDITELTYEDPDRADVAQWLTAHGWRAEAVPSQD
FT                   EMRRLHRLVEIADGDDQSFSTFTTAVKR"
FT   sig_peptide     117451..117540
FT                   /locus_tag="Mvan_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.792) with cleavage site probability 0.777 at
FT                   residue 30"
FT   gene            118588..120000
FT                   /locus_tag="Mvan_0105"
FT   CDS_pept        118588..120000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0105"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0090
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10956"
FT                   /db_xref="GOA:A1T1A6"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A6"
FT                   /protein_id="ABM10956.1"
FT                   /translation="MTTESVVPAQAANVGGTDIPAVVRKLRQTFATGRTRSVQWRKEQL
FT                   HALERLMTENEGAIAEALEKDLGRGPFEAWLADVASTVGEAAYAAKNVGKWMKRRYRLL
FT                   EMSQLPGRGWVEYEPYGTVLIIGAWNFPFALTLGPAVGAIAAGNTVVLKPSEVAPASSA
FT                   LMAELVPRYMDNDAIAVVEGDGAVSQELIAQGFDHLIFTGGTEVGRRVYEAAATHLTPV
FT                   TLELGGKSPVIVAADADIEVAAKRIAWTKLINSGQICIAPDYVLAEAPIRDKLVEAIRK
FT                   AIDTFEAGNAAGKKIVNERHFNRLANALAATKGKVAIGGGSDAVAMKIQPTVVVDPDPA
FT                   EPLMTDEIFGPILPVVTVQNLDEAISFVNSRPKPLAAYLFTKAKAVRERVIKEVPAGGM
FT                   VVNHLIFHFATHKLPFGGVGPSGLGAYHGKFGFEEFSHRKSVLTKPTRPDLGAMIYPPY
FT                   TEKAWKLARKLF"
FT   gene            120037..120900
FT                   /locus_tag="Mvan_0106"
FT   CDS_pept        120037..120900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0106"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0091 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10957"
FT                   /db_xref="GOA:A1T1A7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A7"
FT                   /protein_id="ABM10957.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAREGASVVVNDLGGARDGT
FT                   GAGSAMADEVVKEIKAAGGRAVANYDSVAEPEGAANIIKTAVDEFGKVDGVVSNAGILR
FT                   DGTFHKMEFANWDAVLKVHLYGGYNVIRAAWPHFRENGFGRVVVATSTSGLFGNFGQAN
FT                   YGAAKLGLVGLINTLAQEGAKYNIKANAVAPIAATRMTQDILPPEVFEKLTPEYVAPIV
FT                   SYLCTEEVPETASVFIVGGGKVQRVALFQNSGVTFTEVPSVDDVAARWGEITDLSAAER
FT                   ATFSLG"
FT   gene            120942..121910
FT                   /locus_tag="Mvan_0107"
FT   CDS_pept        120942..121910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0107"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0092 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10958"
FT                   /db_xref="GOA:A1T1A8"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A8"
FT                   /protein_id="ABM10958.1"
FT                   /translation="MKALVAQELTGPAGLAYTDVEDVHGGDAVVLDVGAAGVCFPDLLM
FT                   LRGEYQMKVPAPFVPGLEVAGTVRSAPAESGFVAGQRVSAFSLLGAWAEQVAVPVGSVV
FT                   PTNDALDDGSAVCLLGNYYTMHFALQRRGALQAGETVLVLGSGGGVGTASVQIAKALGA
FT                   RVIAMVHRPSAIEFVESLGADVVLPLTEGWLDAVKAETGGRGVDLVVDPIGGPAFDDAI
FT                   RALATEGRLLVIGFAAGGIPTVKVNRLLLRNVSVVGVGWGEFVNRTPGAQAQVGAALAT
FT                   LVDQGLRPPEPVRFSLSDGVAALQAFADRAVNGKLVLEPDR"
FT   gene            121979..122698
FT                   /locus_tag="Mvan_0108"
FT   CDS_pept        121979..122698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0108"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mmc:Mmcs_0093 haloacid dehalogenase, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10959"
FT                   /db_xref="GOA:A1T1A9"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1A9"
FT                   /protein_id="ABM10959.1"
FT                   /translation="MREEQTVVIRALAFDVFGTVVDWRSSVIRELGDFGRRNGVSADWP
FT                   RFADDWRAGYVPAMDRVRRGELPWTRLDDLHRGRLVELLEGTGITVSDSEIDELNRAWH
FT                   RLDPWPDAVAGLTRLKRRFVITTLSNGNVSLLTNMAKRAGLPWDCVLSAEIFGHYKPDR
FT                   EAYLGCAEILDVAPGELMLVAAHPSDLRGARRAGLATAFVHRPLEQGPDRAPARPADGE
FT                   FDVMADDFHDLADRLGV"
FT   gene            122721..123431
FT                   /locus_tag="Mvan_0109"
FT   CDS_pept        122721..123431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0109"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mmc:Mmcs_0094
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10960"
FT                   /db_xref="GOA:A1T1B0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B0"
FT                   /protein_id="ABM10960.1"
FT                   /translation="MTHTVLRMTERLLIDPPEHPDTSKGYLDLLGDEPDSNRGAIQALW
FT                   ASRLGSMFYDNAQTLARRLMTAWQQPTEWLNVPVGGTALDVGSGPGNVTGALGRAVGPG
FT                   GLALGVDISEPMLARAVRAEAGPNVGFIRADAQHLPFRDESFDAVVSIAMLQLIPDPAV
FT                   ALAEMVRVLRPGRRMAVMVPTAGPAAGLLRYLPNAGAHAFGDDELGDTFESLGLAGVRI
FT                   NTVGTIQWVRGRKS"
FT   gene            123502..124035
FT                   /locus_tag="Mvan_0110"
FT   CDS_pept        123502..124035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1185 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10961"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B1"
FT                   /protein_id="ABM10961.1"
FT                   /translation="MSIPTSGAPATVEIPAQGGAIVSVACGHQLRLIDVEGTQVADLFA
FT                   VSIENETEWLSVSVTRAMNWRLFPAVGQSFFSTGYRALLTFERDDSPGPHDMLAAPCST
FT                   EMYRALGYDGHHRSCSENFRTAASTVDWRPLHVPDPVNFFQRTPVDETGVVSALPALSR
FT                   PGTRSRFAPRPTSM"
FT   gene            124120..124743
FT                   /locus_tag="Mvan_0111"
FT   CDS_pept        124120..124743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sma:SAV7466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10962"
FT                   /db_xref="GOA:A1T1B2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B2"
FT                   /protein_id="ABM10962.1"
FT                   /translation="MLNALTAGLLIGLSAAALAGGAALLVLETAALRGWLVALAAGAGI
FT                   ASGDAAWSAVVAAAGSPLGRLLAPGAVVLQWTGVVVVLALWVLAVRALLRIDAVSGPPD
FT                   AGLPTSPRRAYLECAAFTAADTVTVLFFLSVIVGAAPSYRGLEATVFVGGAFLASLSWQ
FT                   WGAAAIGRRRRRGVSVRTRRIVHLIDIVLLTVFMAYIGLGMYQT"
FT   sig_peptide     124120..124185
FT                   /locus_tag="Mvan_0111"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.256 at
FT                   residue 22"
FT   gene            124762..125247
FT                   /locus_tag="Mvan_0112"
FT   CDS_pept        124762..125247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10963"
FT                   /db_xref="GOA:A1T1B3"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B3"
FT                   /protein_id="ABM10963.1"
FT                   /translation="MSTGGIVLVALAIAIGLVGIIVPILPGGILVIGAIGVWAFVDNTA
FT                   VAWVVLGVAAALFIASQIIKYTWPVKRMRRADVRTSVLVVGGVAGVVGFFVIPVIGLLI
FT                   GFVLGVYAAELGIRRDAARAWASTWHALKGVALSVGVELTGALLATVAWVVGVFLTA"
FT   sig_peptide     124762..124881
FT                   /locus_tag="Mvan_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.616 at
FT                   residue 40"
FT   gene            complement(125363..126295)
FT                   /locus_tag="Mvan_0113"
FT   CDS_pept        complement(125363..126295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0113"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sal:Sala_2222
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10964"
FT                   /db_xref="GOA:A1T1B4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B4"
FT                   /protein_id="ABM10964.1"
FT                   /translation="MTSEQIAHGVGPDRLDIAYRRHGHSGDPAAVLIMGIAAQLVNWPP
FT                   EFIRALTDRGLQVIVFDNRDTGRSTHLDSAPADLSAVQAGDLTSVSYTLSDMAADTVGL
FT                   MDHLGIRAAHLVGASMGGAIAQTIAIEHPDRTLSLSSMMSTTGAPEVGAAHPDVMAALF
FT                   GEPPVTTREEEAARAIRAATVVGSPAYPPDPAAIARRAGIAYDRSHDIAGITRNAVAVV
FT                   ASGDRTGALRTLKIPTLVIHGRADRMCDPSGGRATAAAIPGAQLELIDGMGHDIPAPLY
FT                   DRIADLIAENARRSDHLQFKTRAPSTHTP"
FT   gene            complement(126292..126891)
FT                   /locus_tag="Mvan_0114"
FT   CDS_pept        complement(126292..126891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0114"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="KEGG: bja:bll2019 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10965"
FT                   /db_xref="GOA:A1T1B5"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B5"
FT                   /protein_id="ABM10965.1"
FT                   /translation="MSARGRTSGGHRLYTSEDVRRLYQIRALREFGLSLTETASALDGS
FT                   VSLDSVLRTHLQHVETRLAQLSSLRDWLAAACVQAGALPSTESLLATLEAMSVIAGHTR
FT                   NRRPSDTRHAWTALGQELRTLRDAGQPSSSSTVIELAQAARDLINSFADHDQAVLDALA
FT                   HLRRNAPQLDAAGWDQDLIEFLDDALTALDRQEDLR"
FT   gene            complement(127120..127920)
FT                   /locus_tag="Mvan_0115"
FT   CDS_pept        complement(127120..127920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0115"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: mmc:Mmcs_0097 protein tyrosine/serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10966"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B6"
FT                   /protein_id="ABM10966.1"
FT                   /translation="MAAAGDELSGAWNFRDVSEQTGVAPGRFFRASELSKLDDTGRAAL
FT                   KGLGVTDVADLRTSRELERHGPGLVPAGVEIHHLPFVETMAADGESPHEHAFQRMMTDK
FT                   PDDEPVADAAARYMTEEYGRIATAPFARRAVHRVVNLLGSERAVLAHCFAGKDRTGFTI
FT                   AVVLEAAGVDRDAIMADYLRSNVAVPRLRESILATVRERAVDAPEIMELAEARLTDAVL
FT                   GVREEYLDSARRTIDDQFGSLTGYLESADVTDEDIRRLRKVLLG"
FT   gene            complement(127920..129263)
FT                   /locus_tag="Mvan_0116"
FT   CDS_pept        complement(127920..129263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0116"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0098 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10967"
FT                   /db_xref="GOA:A1T1B7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B7"
FT                   /protein_id="ABM10967.1"
FT                   /translation="MDLTVYTCHIVAVMDFSMSAKAQDYHDRLTDFMTESVFPAEESYH
FT                   AYRAEAGPDDHTVPPVVEELKKLAKARGLWNLFLPSESGLSNLEYAPLAELTGWSMEIA
FT                   PEATNCAAPDTGNMETLHLFATEEQRKQWLEPLLAGEIRSAFAMTEPAVASSDARNIET
FT                   TMLRDGDDYVINGRKWWITGAADPRCKILIVMGRTNPDGPSHRQQSMILVPADTPGVDI
FT                   QRSLPVFGWQDQHGHCEIVFDNVRVPASNLLDEEGSGFAIAQARLGPGRIHHCMRAIGA
FT                   AERALALMIDRVQTRIAFGKPLAEQGVVREAIAKSRNEIEQTRLLCHKAAWTIDQQGNK
FT                   SKDAQLLVAQIKAVAPQMACDVIDRAIQVHGGAGVCDDFPLARLYSWHRAMRLFDGPDE
FT                   VHMRTIARAELGREKSAMATAASRQSDTAASRQSNPAASRQSETAVTG"
FT   gene            129341..130897
FT                   /locus_tag="Mvan_0117"
FT   CDS_pept        129341..130897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0117"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; FAD dependent
FT                   oxidoreductase; KEGG: mmc:Mmcs_0400 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10968"
FT                   /db_xref="GOA:A1T1B8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B8"
FT                   /protein_id="ABM10968.1"
FT                   /translation="MSSLWTDGRIEIASRPDEVAQAHTADVLVVGAGITGLTTAVLLAR
FT                   AGKKVLVVEARHVGACATGNTTGKVSVLQGTKLARIRAKHGPDVLSAYVTGNAEGRDWL
FT                   IRYHDDHGLAYQREDDHSYAQAESGLSTARDVLAACREAGVDAQWVDEADVPFPFQGGV
FT                   RVREQAQLDPVPYLGSLVTELEKHGGTLLQGVRATTVTGTDPVRVRFRLTDTAQDTRDE
FT                   QFSVTARHCVLATGTPILDRGMFFARVEAKRSYCLAFDVPGDITTPMFLSVDSPTRSVR
FT                   YAPTAAGSKLIVGGAGHPVGRADNPSKAVAELSHWAALHYPGAVQTHYWSAQDYHPDDE
FT                   VPFIGPLLPMHESVLVATGFDKWGMTNGVAAALALSARILGGRMDWAQTFASWRLHELR
FT                   GVPTALQANMKVGLHLANGWLAPLTSSAEEPADGTGVVSGPPWRLRATSVVDGVQRTVS
FT                   PVCPHLGGIVKWNDSDRAWECPLHGSRFAPDGALLEGPATRGLSGCRPAQLRNVSEGLR
FT                   P"
FT   gene            complement(130861..131856)
FT                   /locus_tag="Mvan_0118"
FT   CDS_pept        complement(130861..131856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0118"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mmc:Mmcs_4344 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10969"
FT                   /db_xref="GOA:A1T1B9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1B9"
FT                   /protein_id="ABM10969.1"
FT                   /translation="MHTATIDTATAPYAPRDDLHFESDDLDATEDFLVRAYTKMSISAE
FT                   DGERASALIDRRWLGPVSYDELRLDFHMSYDAAPLGRICLCRVHEGCIEEDFIGEPQDV
FT                   FVPGDVALLSPPELPYSGRVCEASYDLTMFDTALLDRVATPDRGRSAGSVRLLGHRPVS
FT                   PEAQLQLNSAIECVRTVVHSDGPAPTRLVASTTASMIAAVVLSAFPTNAASEPTALDRI
FT                   DAKPPLLRRATAYIEGNADADIALADIAGSVHVTPRALQYMFRKYLDMTPMEYLRRVRM
FT                   DHAHRELIKADAGQTTVQIVAARWGFAHTGRFAAMYREAYGRNPSDTLRS"
FT   gene            complement(131994..133433)
FT                   /locus_tag="Mvan_0119"
FT   CDS_pept        complement(131994..133433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0119"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10970"
FT                   /db_xref="GOA:A1T1C0"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C0"
FT                   /protein_id="ABM10970.1"
FT                   /translation="MFTLETAATAAYVVAALLFILALAGLSRHETSRAGNTFGIVGMVV
FT                   ALVATIALALARHIEPLGLALLVGAMTIGAAIGLWRAKIVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEGDPGSAEALQLGSEGMLGIHSAEVVIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPLMLPGKNILNVGALVVFIALTVWFVIDPQLWLLVVVTVLALALGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAAAGFLLGNDLLIVTGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIEAGPAEDKDYGEHREITAEGAAELLASASSVIITPGYGMAVAQAQYGVADL
FT                   TRKLRDRGVDVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFDGTSVVLVI
FT                   GANDTVNPAASEDPGSPIAGMPVLTVWNADNVIVFKRSMASGYAGVQNPLFFRENTQML
FT                   FGDAKDRVDAINAALSVAEHV"
FT   sig_peptide     complement(133329..133433)
FT                   /locus_tag="Mvan_0119"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.735) with cleavage site probability 0.518 at
FT                   residue 35"
FT   gene            complement(133438..134970)
FT                   /locus_tag="Mvan_0120"
FT   CDS_pept        complement(133438..134970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0120"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   mmc:Mmcs_0101 NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10971"
FT                   /db_xref="GOA:A1T1C1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C1"
FT                   /protein_id="ABM10971.1"
FT                   /translation="MIIGIPRESQPGETRVAATPQTVGQLIKLGYQVVVESGAGAAASF
FT                   SDAAFAEAGAGIGSPDEVWSADVVLKVNAPTEAEIATLRDGATLIGLISPALRPELVEQ
FT                   LATRRITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHRFGRFFTGQVTAAGKV
FT                   PPAKVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVRSLGGEYLSIESPEAEVS
FT                   ATGYAKEMGDDYKAREAQLYAQQSEDVDIIITTALIPGRPAPRIITADMVASMKSGSVI
FT                   VDMAAANGGNVEGTVKDQAVVTDNGVTIIGYTDLAGRLPTQASQLYGTNLVNLLKLLTP
FT                   EKDGQLTVDFDDVVQRSVTVVRDGEITWPPPPVQVSAAPVAAAAAPVEQKPAKKPMTTG
FT                   RRLGVTFAVAAALFVLIALSPAALQVHLTVFALAIVIGYYVIGNVHHALHTPLMSVTNA
FT                   ISGIIVVGALLQIGHGNIAITALAFAAILLASINIFGGFAVTRRMLAMFSRS"
FT   gene            135213..136091
FT                   /locus_tag="Mvan_0121"
FT   CDS_pept        135213..136091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0121"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmc:Mmcs_0104
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10972"
FT                   /db_xref="GOA:A1T1C2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C2"
FT                   /protein_id="ABM10972.1"
FT                   /translation="MSVFVDIAADPDLGARHHARGADARPGRSRWRGRVTRAALPLLSL
FT                   LVFGVVWQFAAASGVWNQTFVPYPATVWGAFVDVSTTHDGVRGYAGYLLWEHLYMTLRR
FT                   VLAGVAIGVVLGVLLGLVMGSVSWVRSVLEPWLTFLRALPPLAYFFLLVIWLGIDEAPK
FT                   ITLLALAALPPAAVATTAAVVAAPVGLQEAARALGASRRQVIRDVVVPSALPETFTGIR
FT                   LAVGMAYSSVVAAELFNGIPGVGGLVKDASNYNNTPVVLVGIFAIGFSGLVIDGLLRAA
FT                   ERRAVPWRGKV"
FT   gene            136098..137135
FT                   /locus_tag="Mvan_0122"
FT   CDS_pept        136098..137135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0122"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: mmc:Mmcs_0105
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10973"
FT                   /db_xref="GOA:A1T1C3"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C3"
FT                   /protein_id="ABM10973.1"
FT                   /translation="MKLKALLVVLVSAVLALAGCSVDNGGQHGDDSGKPTIRIGYQTFP
FT                   SGDLIVKNNKWLEEALPDYNIKWTKFDSGADVNTAFVAGELDFGALGSSPVARGLSEPL
FT                   NIPYKVAFVLDVAGDNEALVVRNGAGVDTIAQLKGRRIGTPFASTAHYSLLAALDQNGL
FT                   SANDVQLIDLQPQAILAAWERGDIDAAYTWLPTLDELRKTGRDLITSRQLADAGKPTLD
FT                   LATVSDEFASAHPEAVDVWRQQQGRALDLIREDPQAAAEAIAAEIGLTPQDVAGQLKQM
FT                   VFLTPQDISSTEWLGTEGNPGNLAVNLESASQFLADQSQIPAAAPLKTFQDAVYTKGLP
FT                   GALNE"
FT   sig_peptide     136098..136163
FT                   /locus_tag="Mvan_0122"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.595 at
FT                   residue 22"
FT   gene            137119..137898
FT                   /locus_tag="Mvan_0123"
FT   CDS_pept        137119..137898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0123"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0106 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10974"
FT                   /db_xref="GOA:A1T1C4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C4"
FT                   /protein_id="ABM10974.1"
FT                   /translation="MPSTNDGAIRIDSVSHHYGSGGAEVTALGPVDLTVDPGSFLVLVG
FT                   ASGCGKSTLLRLLAGFEEPSQGSVQVAGARPTPGVTAGVVFQQPRLFPWRTVGGNVDMA
FT                   LRYAKVPRDKRIERREELLGRVGLEGTADRRIWEISGGQQQRVAIARALAAETPLFLLD
FT                   EPFAALDALTRERLQEDVRQVSAESGRTTVFVTHSADEAAFLGSRIVVLTRRPGQVALD
FT                   IPVDLPRTGVDPDELRRSPEYGQLRAEVGRAVKAAAA"
FT   gene            138027..138413
FT                   /locus_tag="Mvan_0124"
FT   CDS_pept        138027..138413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10975"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C5"
FT                   /protein_id="ABM10975.1"
FT                   /translation="MSRVVERGLARCPRCVAVADYVFIESERHGTRYEVRCRKCGECYA
FT                   EDSRPGAPLTATAEESLIQWPPDCEPVPPRDWREEVRSKLSVAGQRGRAEVDIMGRRAH
FT                   QAMEYARMWVSERRSARTVDQTGG"
FT   gene            complement(138398..138508)
FT                   /locus_tag="Mvan_0125"
FT   CDS_pept        complement(138398..138508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT2026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10976"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C6"
FT                   /protein_id="ABM10976.1"
FT                   /translation="MDPNPDYDASDELEYGINWWAWILRGVYPPPAYPPV"
FT   gene            138638..139312
FT                   /locus_tag="Mvan_0126"
FT   CDS_pept        138638..139312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0126"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0108
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10977"
FT                   /db_xref="GOA:A1T1C7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C7"
FT                   /protein_id="ABM10977.1"
FT                   /translation="MSESTTNGMSRREELLAVATKLFAARGYHGTRMDDVADAVGLNKA
FT                   TVYHYYASKSLILYDIYKGAADFTVDALHDDPTATARETIYHFTRRLLVGIANDIERAA
FT                   VYFQEGPYITEWFTEEQVEYIREKETQVYEHVRDVIDRGIASGEFYDCDSHVLALGYIG
FT                   MTLGSYRWLRPHGRRTAQEIAVEFSTALLRGLIRDETVRTLSPLGVGIDAPVKTRILEE
FT                   PS"
FT   gene            139343..140083
FT                   /locus_tag="Mvan_0127"
FT   CDS_pept        139343..140083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0127"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   mpa:MAP1580c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10978"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C8"
FT                   /protein_id="ABM10978.1"
FT                   /translation="MTVRVGTSGWSYDHWRNVLYEPGLPAARRLERYAAEFDTVELNGS
FT                   FYRWPSDAQFQRWRDQLQPGFVMAVKAARGLTHARRLRTPEVWIERLERGWRALGDRGG
FT                   PLLVQLHPALERDDARLDHFLGAMSAGIPVAVEFRHPSWDDPAVYELLERHDAAYVVMS
FT                   GGGLPCILKATAGFSYVRLHGPDPQAMYGGSYSADDLRWWAARIGEWDAQGRDVYVYFN
FT                   NDLGGNAVRNARDLKAELGRRPEG"
FT   gene            140086..140913
FT                   /locus_tag="Mvan_0128"
FT   CDS_pept        140086..140913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0128"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   mmc:Mmcs_1609 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10979"
FT                   /db_xref="GOA:A1T1C9"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1C9"
FT                   /protein_id="ABM10979.1"
FT                   /translation="MLTSVGQWIMTTGLHIAMVVVFALVVTRAIRWAAERVSRRIADGD
FT                   DREPTVRSETVKHRQAVAAATSSVAIGVLYVLVALDIANQLGLPIASLVAPAAVLGAAL
FT                   GFGAQRLVQDLLSGFFVISEKQYGFGDLVELTVSAGGTATGTVEAVTLRVTKLRTSEGE
FT                   VYTVPNGMIAKSRNLSKDWASAVVDVPVPSTADINRVNDVLREVAVTAGNDEDLARLLL
FT                   DEPQLMGVESIEVDTVNVRMVARTLPGKQFEVGRRLRALVVAALRREGIALAA"
FT   gene            140944..141384
FT                   /locus_tag="Mvan_0129"
FT   CDS_pept        140944..141384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0129"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: mmc:Mmcs_0113
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10980"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D0"
FT                   /protein_id="ABM10980.1"
FT                   /translation="MPLVSKTVEVEAAAETIMGIVADFESYPQWNEEIKGCWVLARYND
FT                   GRPSQLRLDVVVQGQAGTFITAVYYPGENQIYTVLQQGDHLSKQEQRFSVVAMGATSLL
FT                   TVDLEVEVKMAVPNAMVKKIVGDTLDYLADNLKTRAEQLAST"
FT   gene            complement(141608..142294)
FT                   /locus_tag="Mvan_0130"
FT   CDS_pept        complement(141608..142294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0130"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0114 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10981"
FT                   /db_xref="GOA:A1T1D1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D1"
FT                   /protein_id="ABM10981.1"
FT                   /translation="MNAPARTPVAGAVRREQLSDEVAARLRAEIMTGALRPDSFIRLDE
FT                   TAARLGVSITPVREALRTLRGEGMVELEPHRGHRVVPLTRTDIEDIFWLQSTIAQELAA
FT                   TAARNITDAQIDELAQLNERLAEAVEQRDPDRVARAEFTFHRAFNRAGGRIKLAWFLLH
FT                   AARYLPPQLFASDETWGPVAVASHAELIEALRRRDVDTVVELTRGQFTDGRARLIAWLE
FT                   QVGLWS"
FT   gene            142383..144095
FT                   /locus_tag="Mvan_0131"
FT   CDS_pept        142383..144095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0131"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0115 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10982"
FT                   /db_xref="GOA:A1T1D2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D2"
FT                   /protein_id="ABM10982.1"
FT                   /translation="MFDQISSFRNPSMEQKTLTEAIQQPGFATEQPYLARRQNWTNQLA
FT                   RHALMQPDQPALRFLGNTTTWGELDRRVSALAGALHKRGVGFGDRVLILMLNRTEFIEA
FT                   VLATNKLGAIAVPVNFRMTPAEIAFLVSDCEAKAIITEAVLANVATAVRDIDPTLATVI
FT                   SAGGSGDDVLDYDDVLAENAPCPVVDIPNDAPALIMYTSGTTGRPKGAVLTHTNLTGQV
FT                   MTLLFTNGADINHDIGFIGVPFFHIAGVGSSVSGLLLGRPTVLYPVGAFDPNELLDVLE
FT                   AEKVTGIFLVPAQWQAVCAAQKARPRDLKLRFLSWGAAPASDTLLREMAETFPGAQILA
FT                   AFGQTEMSPVTCMLLGDDAIRKLGSVGKVIPTVSARIVDEDMNDVPVGQVGEIVYRAPT
FT                   LMAGYWNNPKATAEAFAGGWFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVEN
FT                   VLAAHPEIVEVAVIGRAHEKWGEVPVAVAVVRSSLEATPGAGIELADLEQFLTERLARY
FT                   KHPKALEIVDALPRNPAGKVLKTELRIRYSAASFADAGESSTPPTISTAPQRN"
FT   gene            144309..145106
FT                   /locus_tag="Mvan_0132"
FT   CDS_pept        144309..145106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0132"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0116 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10983"
FT                   /db_xref="GOA:A1T1D3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D3"
FT                   /protein_id="ABM10983.1"
FT                   /translation="MTSSSNLTGYVREQVKPGLEAVGGFVRMCVLVGKATLRPPFQWRE
FT                   FILQSWFLMRVAFLPTLAVSIPLTVLLIFTLNILLAEFGAADVSGAGAAIGAVTQLGPL
FT                   VTVLVVAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVASTFVAILLNGA
FT                   VITVGLVGGFIFGVYLQNVSAGAYVSTLTLITGLPEVVISIVKAATFGLIAGLVGCYRG
FT                   LTVAGGAKGVGTAVNETLVLCVIALFAVNVVLTTIGVRFGTGS"
FT   gene            145108..145977
FT                   /locus_tag="Mvan_0133"
FT   CDS_pept        145108..145977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0133"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0117 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10984"
FT                   /db_xref="GOA:A1T1D4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D4"
FT                   /protein_id="ABM10984.1"
FT                   /translation="MSTSAVLRSRFPRGVATAEKWAGAPARGLEAMGHVAVFVVTAVGS
FT                   IGHALRFYRREMLRLIAEIGMGTGAMAVVGGTVAIVGFVTLSGSSLVAIQGFASLGNIG
FT                   VEAFTGFFAALINVRIAAPVVAGQALAATVGAGATAELGAMRISEEIDALEVMGIKSIS
FT                   YLVSTRIMAGFVVIIPLYAMAIIMSFLSAQVTTTVFYGQSVGTYEHYFRTFLRPDDVFW
FT                   SFIQAVIISVIVMLNHCYYGFYASGGPVGVGEAVGRSMRASLVAIVVVVLLASLALYGV
FT                   DPNFNLTV"
FT   gene            145983..147209
FT                   /locus_tag="Mvan_0134"
FT   CDS_pept        145983..147209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0134"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0118 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10985"
FT                   /db_xref="GOA:A1T1D5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D5"
FT                   /protein_id="ABM10985.1"
FT                   /translation="MTVPQAALNTRRQPPYKLAGLVLAILTVIAVTLVYLQFRGDFMAR
FT                   TQLTMISARSGLSMDPGAKVTYNGVEIGRVGNVEETSVDGEPRAKIILDVNPKYLDLIP
FT                   SNVNADISATTVFGNKYVSFTTPEDPRPERISASDVIDVTSVTTEFNTLFETVVSLADQ
FT                   VDPIKLNQTLTATAQALDGLGDRFGESIINGNQILSEINPQMPQIRRDNQLLADLGDVY
FT                   ADAAPDLFDGLQNAVTTARTLNEQQGDVDQALMAAVGFGNTGGDVFERGGPYLARGAED
FT                   LVPTTALLDKYSPSFFCMIRNYHDVEPKIADALGGNGYSLKTHSEVLGLGAGNAYVYPD
FT                   NLPRVNAKGGPGGRPGCWQPITRDLWPAPFLVLDTGASIAPYNHMELGQPLLTEYVWGR
FT                   QVGEHTINP"
FT   gene            147206..148237
FT                   /locus_tag="Mvan_0135"
FT   CDS_pept        147206..148237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0135"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0119 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10986"
FT                   /db_xref="GOA:A1T1D6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D6"
FT                   /protein_id="ABM10986.1"
FT                   /translation="MKITGTAIKLGAFSLVLLMFTAIIIVVFGQMRFDRTTGYSAIFSS
FT                   ASGLRPGQFVRASGVEVGKVKGVELIEGGSKVRVDFNVDRSLELFDESTASIRYLNLIG
FT                   DRYLELARGESNTRMAAGGTIPIERTQPALDLDALIGGFRPVFQSLEPEKVNTIAQSII
FT                   TVFQGQGGTINDILDQTASLTSALADRDQAIGEVITNLNTVLDTTVRHQQEFDDTVKNF
FT                   EVLITGLKNRADPIATSVADISDAAGTIGDLLADNRPLLKDTVSKLEILNQPLVDQRDQ
FT                   LNDLLVKLPDALAIIGRSGGVYGDFFNFYACDVTLKLNGLQPGGPVRTVKVWSQPSGRC
FT                   TPQ"
FT   sig_peptide     147206..147295
FT                   /locus_tag="Mvan_0135"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.805 at
FT                   residue 30"
FT   gene            148234..149805
FT                   /locus_tag="Mvan_0136"
FT   CDS_pept        148234..149805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0136"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0120 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10987"
FT                   /db_xref="GOA:A1T1D7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D7"
FT                   /protein_id="ABM10987.1"
FT                   /translation="MRVLEGSNRIRGGMMGIIILVLVIGVGQSFASVPMLFATPTYYAQ
FT                   FSDTGGINSGDKVRIAGVDVGTVRSMEIDGDRVLIGYGLGGTEIGTESRVAIRTDTILG
FT                   RRNLEIDPRGSEPLRANGVLPLGQTTTPYQIYDAFFDVSNNTAGWDTKTVRDSLNVLSE
FT                   TIDQTSPHLSAALDGVARFSDTIGKRDEQIKQLLANANKVAGVLGNRSEQINQLFVNAQ
FT                   SLLAAINERNYAVSQLLERVDTFSTQVRGFIDDNPNLNHVLEQLRVISDVLAERKLDLA
FT                   DTLSSLSKFMVSLGEALASGPYFKVMLANLAPYWILQPFVDAAFKKRGINPEEFWRNAG
FT                   LPAFRFPDPNGVGFENGAPPPAPTPIEGTPENPGPAVPPGSPCSYTPPADGLPRPGNPL
FT                   PCAGLTQGPYGPVPGGFPPPNVATSAPNAHGPQPSPGVPAAAIPGQLSPAVPGARPPLP
FT                   PAPPGARTVPLEPQPSPPDFTPGIAPLPPALTGPPPPAGPGPAPAPAGQPLLPGNPPFL
FT                   PPGSQG"
FT   sig_peptide     148234..148329
FT                   /locus_tag="Mvan_0136"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.863 at
FT                   residue 32"
FT   gene            149815..151449
FT                   /locus_tag="Mvan_0137"
FT   CDS_pept        149815..151449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0137"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0121 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10988"
FT                   /db_xref="GOA:A1T1D8"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D8"
FT                   /protein_id="ABM10988.1"
FT                   /translation="MSTVFNVRNLKSPGASRATLIIGVIVVVLAVVGAVLGWNLYKQMT
FT                   TKTVVAYFTQTLAIYPGDKVQIMGVQVGSIDKIEPAGDKMKVTFHYAGKYKVPQDATAS
FT                   ILNPSLVASRTIQLSPPYTGGPVLADGAVLDVDRTQVPVEYDDVRDSISRLLTDLGPTP
FT                   EQPKGPFGDIIESAADGFAGKGEQLNKTLNNLSEALFALNEGRGDFFSVVKSLALFVNA
FT                   LHQSDQQFVALNNNLAQFTNAFTDTDREVADALRDLNELLTTTRNFVDENGEVLAHDVQ
FT                   NLADVTNAILQPEPRDGLETALHAYPNVAANLMNISSPNAGGIVTMPVISNFANPMQFL
FT                   CSAIQAGSRLGYQESAELCAQYLGPILDAIKFNYLPFGANQLQTAMTLPKQIAYSEERL
FT                   RPPPGYKDTTVPGIFSRDTLFSHGNHEPGWVVAPGMQGVEVQPFTQNMLTPESLAELMG
FT                   GPDIVPPPAPPAFGTTRNGNLPGPPNAFDQNNPLPPPWYPQPGPPPAPAPGVVQGNPLG
FT                   AIAPAAPPAGPAPAAPSGPLLPAEAGG"
FT   sig_peptide     149815..149919
FT                   /locus_tag="Mvan_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.438 at
FT                   residue 35"
FT   gene            151455..152600
FT                   /locus_tag="Mvan_0138"
FT   CDS_pept        151455..152600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0138"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0122 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10989"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1D9"
FT                   /protein_id="ABM10989.1"
FT                   /translation="MGKWTRLARRTVALAAAAVVLTSCGSWKGISNVPLPGGPGSGSER
FT                   TTIYVQMPDTLALNVNSRVRVADVYVGRVRAIELKNWIATLTLDLEPSVQLPVNTLARI
FT                   GQTSLLGSQHVQLDLPPDPSPQKLKSGDVIPLANASAFPTTERVLASISSILTGGGVAN
FT                   LETIQTEIYNVLNGRADQIREFLGRLDTFTEELNRQRDDITRAIDSTNRLLAIVGQRNQ
FT                   TLDAVLTEFPPLIQHFADTRDLFADAVESLGRISNAAVDALAPASDDINTNLANLQRPL
FT                   RELGKSGPYLLGALKIFLTAPYNIENVPKAIRGDYINVSLTVDLTLSAIDNGFFSGTGI
FT                   SGMLRALEQAWGRDPATMIPDVRFTPNPNSVPGGPLIERSE"
FT   sig_peptide     151455..151583
FT                   /locus_tag="Mvan_0138"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.901 at
FT                   residue 43"
FT   gene            152604..154166
FT                   /locus_tag="Mvan_0139"
FT   CDS_pept        152604..154166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0139"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0123 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10990"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E0"
FT                   /protein_id="ABM10990.1"
FT                   /translation="MLTRFIKFQLITFTILTVVALGVLGLYYLRLPSLAGIGEYKLYAE
FT                   LERSGGLYPTGNVTYRGTQIGKVTEVEPTETGARVTMSIGDEYKIPADVSANVHSVSAI
FT                   GEQYLDLVSETGTDQYLSAGQTITKSTVPAEVGPALDAANNGLAVLPKEKIDGLLTETS
FT                   AAVGGLGPALQRLVDSTTNVAEGFRDNLPQVNDIITNSAPILQSQVTSGDAIEQWSRNL
FT                   NVIASQTAEQDAALRSGLQQAAPTLDQVTTVFSDVRDALPQTLANLAVINDMLKRYNKG
FT                   IEQTLVIYPQGASLLQMGSIFEDGGLLHFGLSINQPPPCMTGFLPASEWRSPADTSTAP
FT                   LPSGMYCKIPKDYQGNAVRGARNYPCVDVPGKRAASPKECRSDEPYVPLGTNPWYGDPN
FT                   QIVACPAPGARCDQRVAPGQVIPAPSVNNGQNPLPADQLPPPQSLAPVSDPLSPPGSGT
FT                   VRCSGQQPNPCAYTPAQGPPGTTAGYSPSSGEVVGPDGVRYNVSNSNNPGDDGWKEMLA
FT                   PAG"
FT   gene            154136..154780
FT                   /locus_tag="Mvan_0140"
FT   CDS_pept        154136..154780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0140"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0124 putative conserved MCE
FT                   associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10991"
FT                   /db_xref="GOA:A1T1E1"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E1"
FT                   /protein_id="ABM10991.1"
FT                   /translation="MEGDAGTSRLIPDPETDTADGAQDAPDEASLGAPDTPPQEQPPAE
FT                   PRRPSRLGTGWVATICVVLLLLGGGGITAGYLALRANARAAEVARSDDAALQAAKECVA
FT                   ATQAPDTAAMTAAQSKILECSTGEFGVQAGLFSSVLAEAYQAADATVAVDDLRAAVERR
FT                   NEDGTVNVLVAVRVRISNSEAADQRVGYRLRATMAFDEGQYRISSLDQVNS"
FT   gene            154777..155760
FT                   /locus_tag="Mvan_0141"
FT   CDS_pept        154777..155760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0141"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   mmc:Mmcs_0125 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10992"
FT                   /db_xref="GOA:A1T1E2"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E2"
FT                   /protein_id="ABM10992.1"
FT                   /translation="MTAVFDTTPTASADDPTTPMPLASWPARAGAITVDILPGLGVIVT
FT                   TALLALTAPADGWVRWMFIVALAVTFFLMAANRLVLPVATGWTLGRALFGIAVRRADGR
FT                   PVGVLRVTGRELAHLLDTLAVFVGWLWPLWDRRRRTFADLLAGTEVYRVERPQRDMRRA
FT                   VATVLVAAAVASVAAVGLGYALVYRHERAVDTAREQVAAQGPRIVEQMLSYGADTIVDD
FT                   FARAQALTTDGYRPQLISQQQAVQQAGATTNEYWAVNSAVLTDPPVTPDRVSMLLAMQG
FT                   QRGTDPNDVKFITATVRVDFEKSADGQWRVANLTVLKKPQMNVAGR"
FT   gene            155757..156329
FT                   /locus_tag="Mvan_0142"
FT   CDS_pept        155757..156329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10993"
FT                   /db_xref="GOA:A1T1E3"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E3"
FT                   /protein_id="ABM10993.1"
FT                   /translation="MSPARKFSDTDPGDSAVGADYFLVSPKPPVRWGLPLVSVIVAVVM
FT                   TAAVAAGALMLVRHEQDRRAAVNEAAALGFASEFMVMYTSLDPYHANDYADRVAAQATG
FT                   EFAKNFAGRLNEILVQVARSEPSTGEVLAAGVRQWNDDGSADVLIATKVTSKAPDGKST
FT                   IESGSRWVATAIKEGQQWKISNLIQVI"
FT   gene            156296..157093
FT                   /locus_tag="Mvan_0143"
FT   CDS_pept        156296..157093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10994"
FT                   /db_xref="GOA:A1T1E4"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E4"
FT                   /protein_id="ABM10994.1"
FT                   /translation="MEDQQPDPGDLTTEVEDPKVPVGKSRRTPKAQPQTQAPEADAEAD
FT                   AEPETDAEPDAEPETEGSADAEDTDDTDLPDPAPEPEPVVLVPHRPAGRKLVIAAAVAS
FT                   AVFVGASGFAAAMVQPYLVQRALVETKLNIARTATDAITTLWTYTPDDMATLADRASAY
FT                   LDGDFAAEYRRYIDAIVEPNKQAQVTNTTQVMGAAVESVSPPTTPTEATALVYTNSVAT
FT                   SPVTKNIPSLRYLSYRLSLQRDGGDWRIVRMSTITSFDLTPQL"
FT   gene            complement(157146..158255)
FT                   /locus_tag="Mvan_0144"
FT   CDS_pept        complement(157146..158255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10995"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E5"
FT                   /protein_id="ABM10995.1"
FT                   /translation="MPTPRANIRRLLAGARIAALASKATAAAMCGVMAAAAGTPTAQAA
FT                   GARELLAGAIANTRGSYLVYNFGSGFPAPMLNAAGNWYELSNGGRLMIIKGASQRLAPR
FT                   LLADSHTGYQARCERDPRARTGEGLWQASEIYSPIEAWMALGQPTIAINANFFDVRGQQ
FT                   GGSWKSTGCSSPLGAYVDNTRGLGRTNAAVTGTLAYAGKQGLSGGNEHWMALSTMILPV
FT                   KGAPFVVPPRGDDDFDAATPVVTSLIDKGTRFVAVAGIGLLAPGETGQLNDPGPSAART
FT                   AIAYVKERDEMYVFQGGSYTPDQIQDLFRGLGSDTAVLLDGGGSSAIVLRRDTGGMWAG
FT                   AGSPRGSCDTMAVLCDSRERAQPAWLAFN"
FT   sig_peptide     complement(158121..158255)
FT                   /locus_tag="Mvan_0144"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.963 at
FT                   residue 45"
FT   gene            158449..158895
FT                   /locus_tag="Mvan_0145"
FT   CDS_pept        158449..158895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0145"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10996"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E6"
FT                   /protein_id="ABM10996.1"
FT                   /translation="MPTVTRTFTVTPPPDLVVGYLKDFEHAQQWDPGTRSCERIDSGPV
FT                   AEGAYWHSVSKMLGITSELTYKLEELTDRRVVFVGENQSSRAVDIITVQAQGSGSVVSY
FT                   QADLEMYGTAKLLNPVIKLVCEKRAGDTERQMATVLNKLATAAG"
FT   gene            complement(158892..160208)
FT                   /locus_tag="Mvan_0146"
FT   CDS_pept        complement(158892..160208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0146"
FT                   /product="SMP-30/gluconolaconase/LRE-like region"
FT                   /note="KEGG: mmc:Mmcs_0134 SMP-30/gluconolaconase/LRE-like
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10997"
FT                   /db_xref="GOA:A1T1E7"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E7"
FT                   /protein_id="ABM10997.1"
FT                   /translation="MRDLVRHKPIGAILLGVALLAGCTAERQAEPSPTAPPPASTTPAA
FT                   PAAGTARVTVEVDADLAGAPFDAPREAMVPQGWTLSVWARTPRPRLAAWTPDGDLLVSV
FT                   PSAGRVLRFEPRGDGPPDESVLLDGLDEPHGLAFDGSTLYVAESDQVDAYRYAAGAATE
FT                   PRTVAGGLPDDRSPDLRGAYAHALKSVAVGPDGAVYFSIGSTGNISAQDRSADPPRATV
FT                   MRVPPGGGRAEPFATGVRNGTGLAVAPDGAVWTANNGRDNVAYPEPGPSYGQVIPEYVN
FT                   DNPPEQIARLTPGRELGWPYCNNVDGPADLPFVRDVQTNPDGALLDCAALPPVEQSMGA
FT                   HSAPLGLSFVDGELPAPFQRGALVGVHGSWNRQPPRAPEVSFYPWQDGTLGGQQTLVGG
FT                   FQTDDGTRWGRPVAAVVGPDGAVYITDDAADAIYRLAPG"
FT   sig_peptide     complement(160065..160208)
FT                   /locus_tag="Mvan_0146"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.439 at
FT                   residue 48"
FT   gene            complement(160186..160953)
FT                   /locus_tag="Mvan_0147"
FT   CDS_pept        complement(160186..160953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0147"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   mmc:Mmcs_0135 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10998"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E8"
FT                   /protein_id="ABM10998.1"
FT                   /translation="MTTSPSIVNVRRADDRAKTRIAWLDSKHSFSFGSHYEPDNTHHGL
FT                   LLVNNDDTVKPGTGFDTHPHRDMEIVTWVLRGSLVHQDSTGNSGVIYPGLAQRMSAGRG
FT                   IMHSEKNDSWTLTGRESHSEPVHFVQMWVVPDESGREPGYQQLEIDDELLRGNLVTIAS
FT                   GMPAHSDAAAIAIGNRYAALHGARLQPGQSIQLPEAPYLHLFVPRGEVSLEGAGPLREG
FT                   DAVRFTASGGQRVTATAPAEILVWEMHAGLGAA"
FT   gene            161051..161506
FT                   /locus_tag="Mvan_0148"
FT   CDS_pept        161051..161506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0148"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_0136
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM10999"
FT                   /db_xref="GOA:A1T1E9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1E9"
FT                   /protein_id="ABM10999.1"
FT                   /translation="MEWLSDEQQLIWRNYLAMVSRLHTAMHRQLQQDCELSLSDYDVLV
FT                   ALSERGPMRINELGELIGWEQSRLSHQLRRMRGRGLVGREGDGDDRRGATVALTDAGLA
FT                   ALRTAAPGHVDLVRTMVFDGLTPAAQREFGAAVETVLSRLRAAGSTD"
FT   gene            complement(161503..162525)
FT                   /locus_tag="Mvan_0149"
FT   CDS_pept        complement(161503..162525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0149"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   mmc:Mmcs_0139 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11000"
FT                   /db_xref="GOA:A1T1F0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F0"
FT                   /protein_id="ABM11000.1"
FT                   /translation="MSQPVRKLHFVTVTALDDSSAEDAFLADAQRYRRELLAHCYRMTG
FT                   SLHDAEDLVQETYLRAWKSFKGFQGKSSVRTWLYRIATNTCLTALDGNKRRALPSGLGQ
FT                   PASDPAGELFVRPEVTWLEPLPDAPREDPSDPSVIAESRESVRLAFIAALQHLPPRQRA
FT                   VLVLREVLQWKAAEVGEAVGTSTAAVNSLLQRARAQLDEISPSRDDEPVPPESPEAAEL
FT                   LDKYIAAFEDYDMDRLVELFTDDAVWEMPPFDGWYQGPANIVTLSKVQCPAEKAGDMRF
FT                   LRTTANGQPVAALYMRNPETGVHEAFQLHVLDAGKAGITHVVAFKENDLFARFGLPDTL
FT                   "
FT   gene            162600..163439
FT                   /locus_tag="Mvan_0150"
FT   CDS_pept        162600..163439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0150"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0140
FT                   acylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11001"
FT                   /db_xref="GOA:A1T1F1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F1"
FT                   /protein_id="ABM11001.1"
FT                   /translation="MAVTRTERSFDGVGGVRIVYDVWTPETPPRGIVVLAHGYAEHARR
FT                   YDHVAARFAEAGLGIYALDHRGHGRSGGKRVYVRDISEYTGDFHSLVRIAAGEHPGRKL
FT                   VVLGHSMGGGVVFTYGVEHPDDYDAMVLSGPAVDAHSSVSPVMVLLAKVLGRLSPGLPV
FT                   ENLPADAVSRDPQVVAAYENDPLVHHGKLPAGVGRALIGVGETMPARAAAITAPLLIVH
FT                   GDNDKLIPVEGSRKLVDRVGSADVHLKEYPGLYHEVFNEPEKALVLDDVTSWIESQL"
FT   gene            163436..164431
FT                   /locus_tag="Mvan_0151"
FT   CDS_pept        163436..164431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0151"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0141 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11002"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F2"
FT                   /protein_id="ABM11002.1"
FT                   /translation="MKTLVLLLLSALLWVAGCSSDATEDQSKWTDEEVTFDAGGLTLHG
FT                   TYRFRAEGQPAPAALLISESGNTDRNGDNQVAGPIGNMRQLAELLSDRGVASLRYDKVG
FT                   TGRTGLGPFKDRPADVVSEVYTEGAAAALGFLAGRPATDPQRVSVYALGEGTIHALKLA
FT                   GDTTPDAPKVHSLGLFQPLPGRYLDIITKRVEADGSPETVATWQAAVEEIRTKGTVPAK
FT                   LPDGLNAIVNPGNVAAVVEADKIDPLALAAAVPAGTPVLLTCSDSDNQARCDAVAPLIA
FT                   ALQHTDLTVVELKGVSHVLRDDPTDNIANYAKQDPLSAQLVSALDGFADK"
FT   sig_peptide     163436..163504
FT                   /locus_tag="Mvan_0151"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.854) with cleavage site probability 0.635 at
FT                   residue 23"
FT   gene            164454..165269
FT                   /locus_tag="Mvan_0152"
FT   CDS_pept        164454..165269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11003"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F3"
FT                   /protein_id="ABM11003.1"
FT                   /translation="MWGWGILQRSETSYRIPNLAGMSTDEKMLARIAALLRQAEGTDNP
FT                   HEADAFMAAAQRLATATSIDLAVARSHTDQRTKAQTPVQRTITIGETGARGLRTYVQLF
FT                   VVIAAANDVKCDVASNSTFVYAYGFAEDIDTTHALYTSLVMQMVRASKDYIGSGAHKPT
FT                   PTITARLNFQLAFGARVGQRLAEAREEAQREATSGPRSNPGTAIALRNKDIELKDYYRE
FT                   TSRARGTWRATSATAGYSSAARRAGDRAGRRARLGGETELAGARSALER"
FT   gene            165266..165757
FT                   /locus_tag="Mvan_0153"
FT   CDS_pept        165266..165757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0153"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11004"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F4"
FT                   /protein_id="ABM11004.1"
FT                   /translation="MTRDGQRAKVYAAEGFVRTMFDRAAERGNPVVDFFGTQLTLPPEG
FT                   RFGSAEAVQSYVDDVLSHPAVQDRWPAAAPLRVRPRRGAAAAHYERADGAATIAVPQGR
FT                   AVWALRELVVLHEIAHHLCDVDPPHGPAFVATFCELAATVMGPEVAHVLRVVYAREGVK
FT                   "
FT   gene            165768..166430
FT                   /locus_tag="Mvan_0154"
FT   CDS_pept        165768..166430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0154"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; O-methyltransferase, family 3; KEGG:
FT                   mmc:Mmcs_0144 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11005"
FT                   /db_xref="GOA:A1T1F5"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F5"
FT                   /protein_id="ABM11005.1"
FT                   /translation="MTAPDWVSLDELFTSVLHSEDDALREARAAGQAAGMPAIEVSAQH
FT                   AKLLSLLVAISGARRVLEIGTLAGYSTIALARAVGPDGTVVTLEYEPAHAQVARRNLER
FT                   AGVSDRVEIVVGAALESLPTLQQRGETFDLVFIDADKENNVSYVEWAVTLGRPGTVIVV
FT                   DNIARNGRVLDPAPDDEQARAVRAMFDMMGANPRLDTAAIQTVGAKGWDGFAVAVVS"
FT   gene            complement(166423..167154)
FT                   /locus_tag="Mvan_0155"
FT   CDS_pept        complement(166423..167154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0155"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mbo:Mb1802c
FT                   probable transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11006"
FT                   /db_xref="GOA:A1T1F6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F6"
FT                   /protein_id="ABM11006.1"
FT                   /translation="MPGADQNGRIDATEGRDDGLQVLRRAAAALDEIATAPGRLRLVDV
FT                   GTNLGLAKSTARRLLVALVDVGFAAVDDSGRYHLGDRLLGLTSADGSTLAARLRPVIER
FT                   LALATGETVDLSVLRGRQMWFVDQIESAHRLRAVSAVGGRFPLHDTANGKAALALMEDD
FT                   AIPDGLLDEIAEVRRTGIAYDRDEHTAGISAAGIAVRLPGGHVVAISVPAPTERFRAQE
FT                   STIVDALRAAAADPVWAGGVS"
FT   gene            167223..168557
FT                   /locus_tag="Mvan_0156"
FT   CDS_pept        167223..168557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0156"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   mbo:Mb1803 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11007"
FT                   /db_xref="GOA:A1T1F7"
FT                   /db_xref="InterPro:IPR006093"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F7"
FT                   /protein_id="ABM11007.1"
FT                   /translation="MELPTRHFFRGDDGYEQARARTVWNARTPERYPDLVAQAADVDDV
FT                   VAAVRYAAAHDLQIGIRSGGHSWAGNHIRDGGVLLDVHGLDRCEVDAEAGTAVVGPGVG
FT                   GSVLAGRLWEQDLFFPAGHCKGVCIGGYLLQGGYGWNSRVLGPACESVLGLDVVTADGE
FT                   QIYIDGENHADLYWAARGSGPGFFAVVTAFHLKLHRRPRVCGSSLYVYPIELAEQIYPW
FT                   ARSISAEVDRRVEFQMVASRAVPGAGLDSPGIVMASPVFADTEQEAIDALALLETCPVR
FT                   DRALVAVPYAPTDLETWYAGVMSNYPDGYRYATDNIWTSASADELMPGITRILETMPPH
FT                   PAHFLWLNWGPSPQRQDMAYSMEDEVYLALYGVWRDAADDEKYGDWARSNMAAMEPLQT
FT                   GIQLADENLGRRPAPFATPEAMARLDRVRAEYDPQGRFHSWMGRA"
FT   gene            168557..169330
FT                   /locus_tag="Mvan_0157"
FT   CDS_pept        168557..169330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0157"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb1804 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11008"
FT                   /db_xref="InterPro:IPR041526"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F8"
FT                   /protein_id="ABM11008.1"
FT                   /translation="MAHAYLGYRGDDGNTEYGGFFDPQMAALPAHVVDALHHGPQAEPV
FT                   LLRLDSAATLLGDGYHETENGYGRLANGAFQVSVRTDMPGVTPQMWDWWFGWHGSDTRR
FT                   YKLWHPRAHASARWADGGGDGHYVGRISLIEEYLGSAYAKAAIRFIDPAAMGLDVNPGD
FT                   SVSVCARLGSSEVPVDIGWFVHQVRSTSAGAEMRSRFWMGGPYVGIRHGNLLANTVIRP
FT                   VAARQLPDPRDLLVHCAQEMNHLAGFLPALHARFG"
FT   gene            169356..169742
FT                   /locus_tag="Mvan_0158"
FT   CDS_pept        169356..169742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11009"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1F9"
FT                   /protein_id="ABM11009.1"
FT                   /translation="MWTVSRDVEASADAVWHVLTDLEAWPQWGPSVVRAELDGAAFELG
FT                   ATGRIWTPVGVPLPFAISELDQGRSWGWRVAGVPATRHGVQPRNDGSRVWMSAPAWAPG
FT                   YLPVLAIALRRIEAMAAVADRDVP"
FT   gene            complement(169744..170643)
FT                   /locus_tag="Mvan_0159"
FT   CDS_pept        complement(169744..170643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0159"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   tfu:Tfu_1373 regulatory proteins, AsnC/Lrp"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11010"
FT                   /db_xref="GOA:A1T1G0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G0"
FT                   /protein_id="ABM11010.1"
FT                   /translation="MDELDEAIVELLEVDGRLTHREIARRVGLSRSAAAARVQRLIGSG
FT                   QVVIRGAVHPAVLGRGALAHVSVVVHGPAAPVAARLACRDDVPFLSLTSGPHGLVAEVR
FT                   AGSARDIDRAVAELRALPGVSAVDTLTYVEVMRDVIGPVGEVRTEIDDTDRTLLAALQQ
FT                   DGRASYVDLAARVGLSAAGARRRVVRLIDARVVRIGAVVRHSGQDRQSAMGCGIRLTGD
FT                   HHDVVAALTDMPAVIFVARTLGRFDVLMTVRAFSAAQLVELMDTVRALPGVWTLESWTH
FT                   LDVVKESYASGLDAVTKP"
FT   gene            170871..172457
FT                   /locus_tag="Mvan_0160"
FT   CDS_pept        170871..172457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0160"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin; KEGG: sma:SAV791 transmembrane
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11011"
FT                   /db_xref="GOA:A1T1G1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G1"
FT                   /protein_id="ABM11011.1"
FT                   /translation="MAAETPALAPPPKVTEVETHGVEPIPDAERSARPLDLFRLTFGGA
FT                   NTIATVVLGSFPIIFGLSFRDALLATLLGVVAGAAILAPMALFGPRNGTNNAVSSSAHL
FT                   GVHGRVVGSFLSLLTAVAFFSISVWTSGDVLVGGATRAIGGAGSAAPNDWAVGVAYGVF
FT                   ALLVLTVCIYGFRFMLLVNKVAVVAATVLFLLGIFAFGGTFDPGYAGIFGPDADAATNA
FT                   LYWPSFVGAALIVMSNPVSFGAFLGDWARYIPRDTPPWKPMAAAFCAQLATLVPFLFGL
FT                   VTAAVVATNAPQFIDEGNYVGGLLEVSPGWYFLPVCLIALIGGMSTGTTALYGTGLDFS
FT                   SVFPRFSRVQATVFIGVLAIVFIFIGRFAFNVVQSISTFAVLIVTCTAPWMVVMTTGWV
FT                   VRRGWYDSDSLQVFNRRQRGGRYWFARGWNFRGLGAWLVSAALSLCFVNLPGQFVGPLG
FT                   DLADGIDLSIPVGLGVAALLYPLLLVAFPEPADAFGPEGPRFVRAGAPAGIPITSEDEA
FT                   EKPVVSEGVTA"
FT   gene            172454..173443
FT                   /locus_tag="Mvan_0161"
FT   CDS_pept        172454..173443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0161"
FT                   /product="agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="TIGRFAM: putative agmatinase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: tfu:Tfu_0058
FT                   putative agmatinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11012"
FT                   /db_xref="GOA:A1T1G2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G2"
FT                   /protein_id="ABM11012.1"
FT                   /translation="MNEREAQRDRTSTPPPVGPVDASKTPRFAGPATFARLPRLDQVPR
FT                   ADVAVVGVPFDSGVSYRPGARFGPTHVREASRLLRPYHPALDVSPFEIAQVADAGDIAV
FT                   NPFNIHEAIETIEAAAVDLTRDGTSLVTIGGDHTIALPLLRAAHATHGPVALVHFDAHL
FT                   DTWDTYFGAEYTHGTPFRRAVEEGILDTEALSHVGTRGPLYGKKDLEDDRRFGFGIVTS
FT                   SDVYYQGVREIVDKLRQRLGDRPVYLSVDIDVLDPAHAPGTGTPEAGGMTSRELLEILR
FT                   GFVGLNVIGADVVEVSPAYDHAEITGVAASHVAYDLVSLLAMRAEASR"
FT   gene            173613..174218
FT                   /locus_tag="Mvan_0162"
FT   CDS_pept        173613..174218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0162"
FT                   /product="RNA polymerase, sigma subunit, SigZ"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   rba:RB6078 RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11013"
FT                   /db_xref="GOA:A1T1G3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G3"
FT                   /protein_id="ABM11013.1"
FT                   /translation="MSSDETKTSPAAVLDQPTEQMWREMLPQLRTFVRRRIADPDRADD
FT                   LVAEILLRIHQNIGSLDDRERLPNWVFRIARNAIIDEYRRAGRSREQLMASLQEEPAAL
FT                   DEDEPGVVRELSACLRPMLAGLPPDQKAALEMIDLDGMTQADAAQQAGVSLSGMKSRVQ
FT                   RGRRRLAELLSQCCTMTLDGRGVPMDYEPPPGCGCAGR"
FT   gene            complement(174240..174704)
FT                   /locus_tag="Mvan_0163"
FT   CDS_pept        complement(174240..174704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0163"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: nfa:nfa24520 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11014"
FT                   /db_xref="GOA:A1T1G4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G4"
FT                   /protein_id="ABM11014.1"
FT                   /translation="MSTTRIQLALNVDDIAEATAFYQKMFGVPPHKVRDGYANFAIEDP
FT                   PLKLVLIEKPGAGEHLNHLGVEAATADDVATMLGRFETAGLETKIAENDVCCHATQDKV
FT                   FVTAPDVPLGWWEFYSISDDDPANPDGATTSVCEKNCAAQDSAEGTCCAS"
FT   gene            174863..175168
FT                   /locus_tag="Mvan_0164"
FT   CDS_pept        174863..175168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11015"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G5"
FT                   /protein_id="ABM11015.1"
FT                   /translation="MKRHTLLKRATAAALLSAALATPAGIELNAGTASARPIENTVGGN
FT                   CGASGGAWQSFWAAGSYIGGTCTYNNNTRYSFDSKDIQYMEERRVKGKWTVVWTGN"
FT   sig_peptide     174863..174970
FT                   /locus_tag="Mvan_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.979 at
FT                   residue 36"
FT   gene            175292..175528
FT                   /locus_tag="Mvan_0165"
FT   CDS_pept        175292..175528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11016"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G6"
FT                   /protein_id="ABM11016.1"
FT                   /translation="MKRIGLLSAVAGALSAAVIGFAGPAQADGNGPAFGGHGNDNDYGY
FT                   DYGYGYGRDSNNPWLNQLYPTVKVPHVDTSVRN"
FT   sig_peptide     175292..175375
FT                   /locus_tag="Mvan_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            175683..176117
FT                   /locus_tag="Mvan_0166"
FT   CDS_pept        175683..176117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0166"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11017"
FT                   /db_xref="InterPro:IPR021975"
FT                   /db_xref="InterPro:IPR038611"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G7"
FT                   /protein_id="ABM11017.1"
FT                   /translation="MVVPQTPKPFEVHESGAFLHGTKADLSVGDVLLPGRRSNYDEGRV
FT                   MNHVYVTQTLDAAVWGAEMAAGDGRCRIFIVEPQGALEDDPNVTDKRLPGNPTRSFRTR
FT                   EPVRIVGEITDWTGHSDEQLQAMRDSLAELRRRGLDVIYD"
FT   gene            176310..177698
FT                   /locus_tag="Mvan_0167"
FT   CDS_pept        176310..177698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11018"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G8"
FT                   /protein_id="ABM11018.1"
FT                   /translation="MTVTGERPEILLEDVDFNRRDHPDRPLRPIPPGRDQFAAQWRHMR
FT                   EFMFGAWIDIDNEVEPSNLTRLRDDYFWQRDEHMIGVVDTFERLGHAQGRALFEQALTQ
FT                   GIETLDDPPQEFVDLFEHLDQLPGQFDLVAAERGRMLAMSSTMAATTIIRAWAVYETAM
FT                   TGDISAATGATGRFADDGPRRFIETARVFAQFTLPEIFDRRSEAFQDVVRVRLMHALAS
FT                   RGLRRKWGDDVYLKFGEPIPVTSLLGFGSGMLLGRLVDHAFGRKLTHEQLEDLAEYSSF
FT                   SGRLWGAPELLQSSNALELIKSLNYVLARGGNPSPWRAELVDAIAGPEHLRTLTETLPG
FT                   WLRNVVSRYSNQITATIAFAPAGVVFGYQQIEAMLVGTLFEPLGYNIERRVQTFEQLTR
FT                   LNVRIAMVADKLPWSNPIRERRRQTGAAARERIAMLDKIAGGRKIPLTYTHHDRSTSGE
FT                   GFTG"
FT   gene            complement(177695..178516)
FT                   /locus_tag="Mvan_0168"
FT   CDS_pept        complement(177695..178516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11019"
FT                   /db_xref="GOA:A1T1G9"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1G9"
FT                   /protein_id="ABM11019.1"
FT                   /translation="MTTAFPDTAVLESVLDLAAQAPSVRNTQPWRWHVDQRGVQLFADW
FT                   TRRLGDTDSDRRDVVLSCGAVLHHCAVALADAGWSSRIRRLPDDGVLAALELEERPPGA
FT                   GSHELAAAIAHRRADRRPYTGSLPAGMIELLMLRAERFGVRLAVVPTVRWARIGDAEFA
FT                   LRYGDSSPGHPGDDAAMLVLATDTDTEAMRLRAGEALSDLTLAATALGLASCPLTEPLK
FT                   DERNRLALACEVFDGEAHPQALIRLGRPGAGDPLPPVRRRPVAETTTFDLN"
FT   gene            complement(178656..179477)
FT                   /locus_tag="Mvan_0169"
FT   CDS_pept        complement(178656..179477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0169"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mpa:MAP0702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11020"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H0"
FT                   /protein_id="ABM11020.1"
FT                   /translation="MVRALPHKIAVITGGASGIGAGTARRFLAEGARVVIADIDRERGE
FT                   ARAAELGPDCVFKYTDVASRDDVTELVEYAVDRFGGLDVMMNNAGISGRMQPELLDDDF
FT                   ADFDRVMRVDLLGVMLGTQIAARHMKDHGGGSIINTTSIGGIQAGCTVMTYRAAKAGVI
FT                   HFTKSAAIDLAQYAIRVNTIAPGGIPTAILSAATGVDESDELGTTAAIRKEIAAERPLK
FT                   MTASVDDIAAAAAYLGSEDARYVTGVVLPVDGGMTAGNPRNPLRDLMIAAH"
FT   gene            179603..180181
FT                   /locus_tag="Mvan_0170"
FT   CDS_pept        179603..180181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0170"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0620
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11021"
FT                   /db_xref="GOA:A1T1H1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H1"
FT                   /protein_id="ABM11021.1"
FT                   /translation="MTTASSAQMPPQSARQRVLDVALALFTRHGYAGTSLQMIADEMGV
FT                   TKGSLYYHFRAREDLLRALVGPLIEQLRAIVEHAEAQRSPSVRAEHVLTGYARLAAANR
FT                   ALVAVTSGDPSVVEVIHADPDWADLIDRQIGLLAAVQPGLAGRVRATIVMAGIAATAAP
FT                   GVVEADEAELCRQLIDAGRRTLGLRAPRA"
FT   gene            complement(180200..180631)
FT                   /locus_tag="Mvan_0171"
FT   CDS_pept        complement(180200..180631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11022"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H2"
FT                   /protein_id="ABM11022.1"
FT                   /translation="MAHVLVAASAALIGLIVYPSAPLAEADADQTIRVQNGQVRCLLSA
FT                   DFEGRGRPAAVCARADGAPFSTSPARMNLAVVQGSGELYYLKGALPGPDDGDAVLGAGE
FT                   TYRVNGWTIETEELRTLITYDVGRHGIRVNPVEVAVIWK"
FT   sig_peptide     complement(180551..180631)
FT                   /locus_tag="Mvan_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.595 at
FT                   residue 27"
FT   gene            complement(180742..181353)
FT                   /locus_tag="Mvan_0172"
FT   CDS_pept        complement(180742..181353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0172"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rpc:RPC_2485 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11023"
FT                   /db_xref="GOA:A1T1H3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H3"
FT                   /protein_id="ABM11023.1"
FT                   /translation="MTLAFLLTSLVIVATPGTGALYTIATGLAHGTRASVVAAVGCTIG
FT                   IVPAMLAAVTGLAAILHSSAIAFQTIKWLGVGYLLYLAWITWRDKTELVADAVSSERPG
FT                   SWRITGTAVAVNVLNPKLTIFFFAFLPQFVDPARPPVLQMLYLSAIFMAMTLVVFALYG
FT                   AFAAGVRTHVISRPRVVTWMRRTFAATYVALAARMAVTTR"
FT   gene            complement(181363..183060)
FT                   /locus_tag="Mvan_0173"
FT   CDS_pept        complement(181363..183060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0173"
FT                   /product="dihydroxyacid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: mmc:Mmcs_0146 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11024"
FT                   /db_xref="GOA:A1T1H4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H4"
FT                   /protein_id="ABM11024.1"
FT                   /translation="MPSSPDIKPRSRDVTDGLEKAAARGMLRAVGMGDEDFAKPQIGVG
FT                   SSWNEITPCNLSLDRLAKAVKEGVFEAGGFPMEFGTISVSDGISMGHEGMHFSLVSREI
FT                   IADSVETVMQAERLDGSVLLAGCDKSLPGMLMAAARLDLASVFLYAGSILPGRVKLSDG
FT                   SEKDVTIIDAFEAVGACARGLMPREDVDAIERAICPGEGACGGMYTANTMASAAEALGM
FT                   SLPGSAAPPATDRRRDGFARKSGMAVVELLRRGITARDILTKEAFENAIAVVMAFGGST
FT                   NAVLHLLAIAYEANVKLTLEDFTRVGAKVPHLADVKPFGAYVMNDVDRIGGVPVVMKAL
FT                   LDAGLLHGDCLTVTGKTMAENLAHIAPPDPDGKVLRALSRPIHPTGGITILHGSLAPEG
FT                   AVVKSAGFDSDVFEGTARVFERERAALDALEDGTITHGDVVVIRYEGPKGGPGMREMLA
FT                   ITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPIAFIKDGDKIRLDVAK
FT                   GTLDVVVDKDEFEARKVGFEPLPPVYTTGVLAKYTKLVGSAATGAVCT"
FT   gene            183138..183755
FT                   /locus_tag="Mvan_0174"
FT   CDS_pept        183138..183755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0174"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   mmc:Mmcs_0147 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11025"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H5"
FT                   /protein_id="ABM11025.1"
FT                   /translation="MTTLMARVIAVVAALVLLAACGGQSDGADDSQSGSNEPEAPLITG
FT                   DPAGYNAADIAFAYDMVPHHAQAIDLSRTALERSTNPELTALAQQIVATQQPEINILNV
FT                   FLVQWNENPENRSGPDDGGPERALPGTVDEATITKLESLSGPEFDKLWLQSMIGQHQGA
FT                   VELANTEIADGANVDAIAIARNIVAAQEAQIAQMTQMLEGLP"
FT   sig_peptide     183138..183221
FT                   /locus_tag="Mvan_0174"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.902 at
FT                   residue 28"
FT   gene            183752..184189
FT                   /locus_tag="Mvan_0175"
FT   CDS_pept        183752..184189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0175"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mmc:Mmcs_0148 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11026"
FT                   /db_xref="GOA:A1T1H6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H6"
FT                   /protein_id="ABM11026.1"
FT                   /translation="MSGANSQAPGGANSQAPGGANSQAPGGANSQAPGGANSQGPTENA
FT                   PEAVAADAHGYSGQKANYAKRLRRIEGQVRGIAKMIDEDKYCIDILTQISAVNSALQSV
FT                   ALGLLDEHLSHCVSHAVTVGGSEADAKLAEASAAIARLVRS"
FT   gene            complement(184206..184559)
FT                   /locus_tag="Mvan_0176"
FT   CDS_pept        complement(184206..184559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0176"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   cgb:cg1374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11027"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H7"
FT                   /protein_id="ABM11027.1"
FT                   /translation="MTAVAAAASIATASSDTGAMIVAFSLSPSGGDETGGVGDAVAEAV
FT                   RIVRASGLPNETNAMFTNIEGEWDEVMAVVKQAVEAVVAVSPRVSLVLKADIRPGYTGQ
FT                   LTAKVQRIENALG"
FT   sig_peptide     complement(184464..184559)
FT                   /locus_tag="Mvan_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.602) with cleavage site probability 0.416 at
FT                   residue 32"
FT   gene            184774..185799
FT                   /locus_tag="Mvan_0177"
FT   CDS_pept        184774..185799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0177"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0151 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11028"
FT                   /db_xref="GOA:A1T1H8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H8"
FT                   /protein_id="ABM11028.1"
FT                   /translation="MRQRNRGRLIALFMAVGVVAGLTLGAPSALAQPAPAPAPAPPPPP
FT                   PANPFVFPNPLAPPAPPAPAPAGAAAPAAANPLAVIPGNPLPIPEGTPAGQNPNPFVGQ
FT                   PPFIPPSFNPSNGSIVGAAKPIYINFQRPIANRQMAQDAVHISSNPPVPGRFYWVNDTQ
FT                   LRWRPQDFWPAGTVVTIDAAGTKSTFSVPEQLVATIDNDTKQMEVVRNGVVEKTFPVSM
FT                   GKSGYDTKNGTYYVLEKFADIVMDSSTYGVPVDDPSGEGYKLKVQDAVRIDNSGIFVHS
FT                   APWSVGAQGESNVSHGCINLSPANAQWFYDNFGSGDAVVIKNTDGGMYTQPDGASDWQM
FT                   F"
FT   sig_peptide     184774..184869
FT                   /locus_tag="Mvan_0177"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.322 at
FT                   residue 32"
FT   gene            185889..186836
FT                   /locus_tag="Mvan_0178"
FT   CDS_pept        185889..186836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0178"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11029"
FT                   /db_xref="GOA:A1T1H9"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1H9"
FT                   /protein_id="ABM11029.1"
FT                   /translation="MPDKIEPADNRAVVRTVAVAVLLLLAVVALRGYLPDGDRAAPPDE
FT                   RPESGTGSLVAVAAMLAVSIGIIAISILAQGRHRLPAPDQGGPVRDLREPWPGLRWRPL
FT                   LIAAAALLVWSVLMLLLMRWASPGVVDDAPPPAPGADARAETDRGPAPQTPTGDGGGSV
FT                   FVLLAGTTILLLALSVAATLLGRRRAPAPPPPVDPATVGTTPAEPDLARAAELGLAEMG
FT                   DLSRDPRQAIIACYLAMERELEKSPGTIPQESDTPSEVLARAIERHALRADTGIELVDL
FT                   FEEARFSPHVMNEGHRADAVRALRQVQHQLQAAI"
FT   gene            186833..187315
FT                   /locus_tag="Mvan_0179"
FT   CDS_pept        186833..187315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11030"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I0"
FT                   /protein_id="ABM11030.1"
FT                   /translation="MTKVVVVGAFLIVVVQMLAVTQLDRDIVLTVTGGALACVLIAVRT
FT                   HLTHQEGDVDDPVTDEAAASMRRWLSRTETLISWSESSRSDWDRRLRPMLARQFELAAG
FT                   RRKIKDPRAFDATGRMVFGDELWQWVDPENISRTGGQEQGPGRRTLDEILQRLEKL"
FT   gene            187312..188274
FT                   /locus_tag="Mvan_0180"
FT   CDS_pept        187312..188274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0180"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mmc:Mmcs_0154 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11031"
FT                   /db_xref="GOA:A1T1I1"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I1"
FT                   /protein_id="ABM11031.1"
FT                   /translation="MTTPALTTARCEAVLDEIGRAVVGKRNALNLILITVLARGHVLVE
FT                   DLPGLGKTLIAKSFAAALGLEFTRVQFTPDLLPADLLGSTIYDMQSGRFEFRRGPIFTN
FT                   LLLGDEINRTPPKTQAALLEAMAEGQVSVDGVTHRLPQPFLVLATDNPIEYEGTYPLPE
FT                   AQLDRFAIRLELKYLNESEEVTMLRRRLERGSTAPTVQQVVDSHDLLAMQESVENVTVH
FT                   DDVLQYIVSLATASRQHPQVAVGTSPRAELDLVQLARARALLLGRDYVIPEDVKALAVP
FT                   ALAHRISPRPEMWVRRVQGADVIEELLRRTPVPRARETQ"
FT   gene            188271..189488
FT                   /locus_tag="Mvan_0181"
FT   CDS_pept        188271..189488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0181"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mmc:Mmcs_0155 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11032"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I2"
FT                   /protein_id="ABM11032.1"
FT                   /translation="MTAVELRWRPSPLTRSIATCAAAAIVAALLAGRWELAAFAAPLLG
FT                   VLCSIGWQRGKPSVTVQAEPVFQRCFEGESVLVTVSAGAEDGSAVTLDCSVVTGMELVG
FT                   PTSLPTLSVRASRWGRYPLLATVRVGGRGGLLEGTGTADAAEVCVFPVAPPQSTAIPRT
FT                   DLLDRLGTHLTRHVGPGVEFADIRPYVPGDQLRTVNWPVSARRGALHVTERLTDRAADV
FT                   VALVDTYPQPPGPATAATERIARGAAQVVQSALRYGDRAGLVALGSRNVRWLGADIGQR
FT                   QFYRVLDTMLGASDTFQNATGTLAPRPAVPTRAIVIAFSTMLDTEFALALIDLRKRGHP
FT                   VVAIDVLDGSPLEGDHDPLVHRMWSMQRSFMYRDMATVGVDVVGWPAAVTLDQAMALVP
FT                   VHRARR"
FT   sig_peptide     188271..188393
FT                   /locus_tag="Mvan_0181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.984 at
FT                   residue 41"
FT   gene            189527..189895
FT                   /locus_tag="Mvan_0182"
FT   CDS_pept        189527..189895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11033"
FT                   /db_xref="GOA:A1T1I3"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I3"
FT                   /protein_id="ABM11033.1"
FT                   /translation="MVAAAAYRVHGYGVVAAAAALAAVVVSAWWRPAATGAVLLAVLTT
FT                   VLADAAPMHTVLAGLAAAVYLVLRHTNPTAPTAFFAVGFAAAAAAVLALPVHVPWLPLA
FT                   APLALLAGYLLALKPFTR"
FT   sig_peptide     189527..189673
FT                   /locus_tag="Mvan_0182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.823) with cleavage site probability 0.462 at
FT                   residue 49"
FT   gene            189965..190393
FT                   /pseudo
FT                   /locus_tag="Mvan_0183"
FT   gene            complement(190402..192423)
FT                   /locus_tag="Mvan_0184"
FT   CDS_pept        complement(190402..192423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0184"
FT                   /product="endothelin-converting enzyme, Metallo peptidase,
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: mmc:Mmcs_0157 neprilysin"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11034"
FT                   /db_xref="GOA:A1T1I4"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I4"
FT                   /protein_id="ABM11034.1"
FT                   /translation="MTVEATRNLKSGIDLRYVDTDARPQDDLFGHVNGRWLAEYQIPAD
FT                   RATDGAFRTLHDRAEEQIRDLITEVAGSGAARGTDEQRSSGSIDASRIGDLYASFMDED
FT                   TVRARGLTPLRDELAAVDAADTPEALARVLGALQRVGVGGGTGLYVDTDSKNSSRYLLH
FT                   LSQSGIGLPDESYFREERHAEILAAYPGHIAAMFGLVYGGDPDDHAATADRIVALETKI
FT                   AAAHWDVVKRRDADLTYNLRTFAEVTDQAPGFDWPGWLAGLGGTAEQAAEVVVRQPDYL
FT                   TAFAGLWADESLEDWKNWLRWRVIHARAFLLTDELIAEDFSFYGRRLSGTEEIRERWKR
FT                   GVSVVESLMGEALGRLYVERHFPPHAKARMDELVDNLREAYRVSINSLDWMTPQTREKA
FT                   LVKLDKFTPKIGYPNKWRDYSALVIARDDLYGNYQRGYALEYDRDLAKLGGPVDRDEWF
FT                   MTPQTVNAYYNPGMNEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGFDDQGA
FT                   KYDGDGNLVNWWTDQDRDEFGLRTKALIEQYEELVPRGLEPSHHVNGAFTVGENIGDLG
FT                   GLSIALLAYRLSLKGEPAPVIDGLTGEQRVFFGWAQVWRTKSREAEAIRRLAVDPHSPP
FT                   EFRCNAVVRNMDAFYDAFEVDEDDELYLEPQRRVHIWN"
FT   gene            192464..193060
FT                   /locus_tag="Mvan_0185"
FT   CDS_pept        192464..193060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11035"
FT                   /db_xref="GOA:A1T1I5"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I5"
FT                   /protein_id="ABM11035.1"
FT                   /translation="MPDDEQLSDPEPRPEPRRDGVFSAYGIASAVLGVVAVAAAVLALV
FT                   VWTGHRDEADELRYRTQVLQTAADWTGVLINMNSDTVDADMAKLHDGTVGQLNADFETA
FT                   VEPYRKLVQTLRSSTTGQIDSVAIETIHHADPGSPPQEEGIEGFASRTDTVMVVATSLS
FT                   ENAGTDEPRTVRWTLRLDVTDVDGRLAVSRLEPIR"
FT   gene            193057..193746
FT                   /locus_tag="Mvan_0186"
FT   CDS_pept        193057..193746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0186"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0159 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11036"
FT                   /db_xref="GOA:A1T1I6"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I6"
FT                   /protein_id="ABM11036.1"
FT                   /translation="MRNRLRLLAFDVLAPVAAVAALLYIGVALGWPLWWVSVCSVLCVL
FT                   VAEGVVVNFVLARRDAVTVGTDDDGPGLRLAVVGVTTAALVGAAVVGYTQWTLPDRALR
FT                   DDSAEVAGIASSVAEASATFTPQNPTASIDRAVGMMSAASAERFKNEFAAVAEDLGGRN
FT                   VSAQASTVSAGVEAIGPDAASVAVILRGTQSTPGQRPDTAVLALRVALSKTDGRWIVED
FT                   VAPIHSR"
FT   sig_peptide     193057..193149
FT                   /locus_tag="Mvan_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.846) with cleavage site probability 0.788 at
FT                   residue 31"
FT   gene            complement(193844..194338)
FT                   /locus_tag="Mvan_0187"
FT   CDS_pept        complement(193844..194338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0187"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11037"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I7"
FT                   /protein_id="ABM11037.1"
FT                   /translation="MVAPEMSGKVRGEDRRVTPPADDRPVEFWPTAAIRAALENDDLAV
FT                   WQRIVVAIKRDPFGRTARQVEEVLETARPYGVSRAMSEVLTRTREHLEANECAEVARHV
FT                   HLLLERSGLGEHEFASRIGVPADDFAAYLRGSVSPPASLMIRMGRLSDRFAKMRAQRPR
FT                   D"
FT   gene            complement(194338..197244)
FT                   /locus_tag="Mvan_0188"
FT   CDS_pept        complement(194338..197244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0188"
FT                   /product="MmpL11"
FT                   /note="KEGG: mmc:Mmcs_0162 MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11038"
FT                   /db_xref="GOA:A1T1I8"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I8"
FT                   /protein_id="ABM11038.1"
FT                   /translation="MLRVSSNLRRFRWAVFAVWLLLLVPSIYLALNQSSHLTGGGFEVE
FT                   GSQSLYVQRQLEAQFPDQGASPLALVAAPRSDASYDDMTSAVSHLERLAAEVPSVTVVP
FT                   TPQQPPPRPDRPYVITLQLDFENTGAVDVAKQLREKVGVDGEEPGEMENGKVRLYVIGQ
FT                   GALGAAATLATKHDIAQAEKWNFPIVLVILLAVFGSLAAAAMPLLLGVCTVVVTMGLVF
FT                   LLSMYTTMSVFVTSTVSMFGIAVAIDYSLFILMRFREELRAGREPEDAADAAMATSGLA
FT                   VLLSGLTVIASVTGIYLINTPVLQSMATGAILAVAVAVLTSTTLTPAVLATFGRRAAKR
FT                   SSYLHWGRGVEATQSKFWSRWTGWVMRRPWVSATAAAAVLLAFAAPAFSMMLGNSMQRQ
FT                   FDPTHEIRGGVNAAAEALGPGALGPIRVLVTFPVDDGAEAAAPLLESLRQKMGQAPNTV
FT                   SVSPPVFGSDGRSALLSAVLSVDPEDMGARDTVDWMREQLPPVAGDAARVDVGGPTALI
FT                   KDFDDRVSQTQPLVFVFVALIAFVMLLVSIRSVFLAFKGVLMTVLSVAAAYGSLVVVFQ
FT                   WGWLADLGFKQISSLDSTIPPLVLALTFGLSMDYEIFLLTRIRERFLQTGNTRDAVAYG
FT                   VSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATIVRLVLVPALMAM
FT                   FDEWNWWLPRWLDRILPSVDFEKPLPKADIGDLVIIPDDISALAPSGSDLRTVVKSAAK
FT                   LKTLAPQAITVADPLAFSGCLPCGKISGNRVGRDERITAAVTNRAHGKTVAVKLPKHPV
FT                   TMWRGRLDVALDALAVEQSAGNGEPRIERISPMETTNVLLPTGDRLQIPTGAETLRLKG
FT                   FLIMSRNTARDYRDFTELVDSMDVDTAADVLAGMDRYYAGQPARAHWVATQLVRRLAEP
FT                   LPSDGPDIAAAGADEETEWAKVRQRCLSVAVAMLEETR"
FT   sig_peptide     complement(197119..197244)
FT                   /locus_tag="Mvan_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.703) with cleavage site probability 0.543 at
FT                   residue 42"
FT   gene            197526..197948
FT                   /locus_tag="Mvan_0189"
FT   CDS_pept        197526..197948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0189"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="KEGG: mmc:Mmcs_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11039"
FT                   /db_xref="GOA:A1T1I9"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1I9"
FT                   /protein_id="ABM11039.1"
FT                   /translation="MHLLEKFALAAAGAAGAVMLTATPAGAAPDPCAASEVARTVAEVA
FT                   TYTGNYLEANPEANRAITTISQQQGGPQSVAALKTYFDANPKVAADLQRLQQPLAALSG
FT                   KCKLPLTLPQVFGLMQAAQQVPALPAAQNVGVTATR"
FT   sig_peptide     197526..197609
FT                   /locus_tag="Mvan_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            198083..198475
FT                   /locus_tag="Mvan_0190"
FT   CDS_pept        198083..198475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11040"
FT                   /db_xref="GOA:A1T1J0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J0"
FT                   /protein_id="ABM11040.1"
FT                   /translation="MLFSATAVRRLVVGALGAGAVSGGMLVGALPSASAQPAPPPPNCT
FT                   AADFSGVASGVSAASSAYLFTHPDVNTFLTGLHGMPHEQIRTEVANYLEMHPQVNAELR
FT                   GIRQPLADIKHRCGFTPEDPDGPNFP"
FT   sig_peptide     198083..198259
FT                   /locus_tag="Mvan_0190"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.754 at
FT                   residue 59"
FT   gene            198493..199227
FT                   /locus_tag="Mvan_0191"
FT   CDS_pept        198493..199227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0191"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0165 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11041"
FT                   /db_xref="GOA:A1T1J1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J1"
FT                   /protein_id="ABM11041.1"
FT                   /translation="MDAPSARGGELSAQDGAGRTVLMVDDDPDVRTSVARGLRHSGFDV
FT                   RVAATGKEALRLLSSESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTVND
FT                   RIAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDPTSDTMTVGSLTIDTARRLVFV
FT                   AGERVELTKREFDLLAALAENAGVVLSRQRLLELVWGYDFDVDTNVADVFVSYLRRKLE
FT                   REGLPRVIHTVRGIGYVLRAEL"
FT   gene            199238..200590
FT                   /locus_tag="Mvan_0192"
FT   CDS_pept        199238..200590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0192"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mmc:Mmcs_0166 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11042"
FT                   /db_xref="GOA:A1T1J2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J2"
FT                   /protein_id="ABM11042.1"
FT                   /translation="MLTLPRLPRFLRSASLRTRVAIAAAAAAAAVVAAFTILTSLVLAN
FT                   NDEAQLDRRLDAIVDASMFPDQLSDPRRGVLQTGRSRSSGDVVFQRGFQLPPLPPGTDT
FT                   VMVNGVEYRVRTIPVEQGGGVLMSIGIRADSILLSRARIPFYVGVGVVTVLIAGVLGWL
FT                   LAGPAIRPLRKLTEHTKRLDHETEQMPAVRGVREAEDLSEAMSAMLDRLAAAQRATTNS
FT                   LQAAQDFAANAAHELRTPLTAMRADLDTLRIHNLPDDEREEVVADLSRAQRRVEGIITA
FT                   LGQLASGQLAQAEDREVIDVTDMLERVARENMRVRRDVQIDIDAADDLGTVLGWPGGLR
FT                   LAVDNLVRNAATHGEATRIVLAARRDGGAVTIVVDDNGRGLPADEHEAVLGRFSRGSNA
FT                   APGGSGLGLALVAQQAALHGGTITLSDGPLGGLRATFTISNEPAPQQDSDS"
FT   sig_peptide     199238..199372
FT                   /locus_tag="Mvan_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.991 at
FT                   residue 45"
FT   gene            complement(200579..201025)
FT                   /locus_tag="Mvan_0193"
FT   CDS_pept        complement(200579..201025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0193"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0167 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11043"
FT                   /db_xref="GOA:A1T1J3"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J3"
FT                   /protein_id="ABM11043.1"
FT                   /translation="MRHRRTRIASLHQVSTEPTIDRPSTGLALKSLAADVVCVVVFCAI
FT                   GRRSHAEGLTVSGIAETAWPFLSGTAAGWLLVRAWRRPTSLIPTGLVVWAATVVVAMLL
FT                   RKATGQGTAMSFIVVASLTTAVLLLGWRAVVQVARRRAAHRSGI"
FT   gene            complement(200997..202175)
FT                   /locus_tag="Mvan_0194"
FT   CDS_pept        complement(200997..202175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0194"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmc:Mmcs_0168 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11044"
FT                   /db_xref="GOA:A1T1J4"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J4"
FT                   /protein_id="ABM11044.1"
FT                   /translation="MSHDAPASDAPAGPAGPDRSRGKYWWLRWALIALAVIVLTVELAL
FT                   VRDQLAKAWKSLVSADWLWVLAAAAAAMASMHSFAQIQRTLLRSAGVRVHQWRSEAAFY
FT                   AGNALSTTLPGGPVLSATFIFRQQRLWGASPLVASWQLVMSGALQVIGLALLGLGGAFL
FT                   LGARENPLSLIFSLGGFVALILLAQAVATRPELLDGIGARVLRWINSVRGKPTRAGLAK
FT                   WREILTQLESVQLSRRDLGEAFSWSLFNWIADVACLLFACFATGGHPSLAGVTVAYAAA
FT                   RAVGSIPLMPGGLLVVEAVLVPGLVSSGMSLASAISAMLIYRLISWIFISAIGWVVFFF
FT                   MFRTAHDVEPDPAAAPTATPAEDVAPQLFSPDPDAFHPPDQKSGAPPEDPDR"
FT   gene            202253..203407
FT                   /locus_tag="Mvan_0195"
FT   CDS_pept        202253..203407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0195"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmc:Mmcs_0169 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11045"
FT                   /db_xref="GOA:A1T1J5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J5"
FT                   /protein_id="ABM11045.1"
FT                   /translation="MSAGPCFDTFADDSVSPLVRKAAAWSWRLLLILGAIVTLLWLILR
FT                   LEIIVVPVALATILAALLLPVVDFLDRRGAPRGGAVALVLLSGFALFGGLLAFVITQFV
FT                   EGAPALVGQVTTSIEGVGTWLTDGPLDVSPQQINQLRDAAIEALRSNQEKLTSGALSTA
FT                   GTVTEIVTGALLVLFTLIFLLHGGRNIFAFVTKMFPVHVRDRVRDAGRAGFRSLIGYIR
FT                   ATFLVALVDATGIGVGLAIMGVPLALPLASLVFLGAFIPLVGAVVTGFLAVIVALIAKG
FT                   WIYALITLGLIIAVQQLEGHVLQPLVMGRAVAIHPLAIVLAIAGGGVLAGIVGALLAVP
FT                   ALAFVNSAMRVLLAEDPAAEEAAMEAEDGPVVRAEPDDVETPQE"
FT   gene            complement(203416..206457)
FT                   /locus_tag="Mvan_0196"
FT   CDS_pept        complement(203416..206457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0196"
FT                   /product="conserved large membrane protein"
FT                   /note="KEGG: mtu:Rv0206c conserved large membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11046"
FT                   /db_xref="GOA:A1T1J6"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J6"
FT                   /protein_id="ABM11046.1"
FT                   /translation="MFAWWGRTVYQYRYIVIGVMVALCLGGGVYGISLGQHVTQSGFYD
FT                   DGSQSVHASVVSDEVYGRDRTSHVVAILTPPDGEKVDNPEWMEKVTGELNDVVAEHEDR
FT                   IVSWVGWLRAPDSTAETVQQMKTADGSKTFVSIPLKGDDDDEILKNYQAVEPDLLKIND
FT                   GNIKLAGLQPLASELTGTIGEDQKRAEVAAIPLVAVVLFFVFGGVIAATLPAIIGGLTI
FT                   AGALGIMRIFAEFMPVHFFAQPVVTLMGLGIAIDYGLFMVSRFREEIAEGYDTEAAVRR
FT                   TVMTSGRTVMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAILSVTVLPAAFSI
FT                   LGRNVDALGVRTLLRVPFFRNWKPMRVYLEWLAEKTQKTKTRAEVEKGFWGRLVNVVMK
FT                   RPIAFAAPILIVMILLVIPLGQLALGGISEKYLPPDNSVRIAQEDFDRTFPTFRTEPLT
FT                   LVLERQDGQPVTDQQLAEVRAKAMTFSGFIEDNNDPTKMWQERAAQDSGTKDPSVRVIQ
FT                   NGLVDRNDASQKIEELRSIQPPRGVQISVGGTPALEQDSIHSLFDKLPLMVLVLIVTTT
FT                   VLMFLAFGSIVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLI
FT                   IAVIWGLSTDYEVFLVSRMVEARERGMSTAEAIRIGTATTGRLITGAALVLAVVAGAFV
FT                   FSDLVMMKYLAFGLLIALLLDATIIRMFLVPAIMKLLGDDCWWAPRWMKRVQEKLGLGE
FT                   TELPDERKRPTVRENPAPAEALVGAGGPPVAAPPRPLPPHDPTHPAPGGRPPGATTRMT
FT                   APPRAGDPSAAGTTRLPSAPPRPPAAPEEEPQTTRLSIAKNAVRNAVSTAAAAAQRATE
FT                   RPASGPPAPPAPSAPPAREDREIESWLGDLRGSRASGTAAANPPQPLRPSAEPTRAMPD
FT                   TGAAGNEPTTAIPAQRESERHRESARHDDSDDSAASTRAIPTARQSDADAATEKLNTRP
FT                   DDEATRRGGKGLSAQDLLRREGRL"
FT   gene            complement(206533..207252)
FT                   /locus_tag="Mvan_0197"
FT   CDS_pept        complement(206533..207252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11047"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J7"
FT                   /protein_id="ABM11047.1"
FT                   /translation="MSLTDNIPAVPDAQDTPASPADLGANPAPPARVLLVWDAPNLDMG
FT                   LGSILGGRPTAAHRPRFDALGRWLLARTADLSAEYTGNGRSVALEPEATVFTNIAPGSA
FT                   DVVRPWVEALRNVGFAVFAKPKVDEDSDVDSDMLAHIALRRGEGLAGLIVASADGQAFK
FT                   LPLEDIARDGVEVQVLGFREHASWALASDTLEFVDLEDIPGVFREPLPRIGLDSLPEQG
FT                   AWLQPFRPLSSLLTSRV"
FT   gene            complement(207249..208049)
FT                   /locus_tag="Mvan_0198"
FT   CDS_pept        complement(207249..208049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0198"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: mmc:Mmcs_0173 hypothetical protein; TIGRFAM:
FT                   tRNA (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11048"
FT                   /db_xref="GOA:A1T1J8"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T1J8"
FT                   /protein_id="ABM11048.1"
FT                   /translation="MSDHGRMHIPESGLATPAAAHSDDPPHPHFNRRVTSFRARRSTIS
FT                   DAQQATWDRLWPELGRQVRDGDAPAGRLDTTPAGRLDTEAWFGRHAPVVLEIGCGTGTS
FT                   TLAMAQAEPDIDVVAVEVYRRGLAQLLSAMDREGVTNIRLIRGDGVDVLTHMFGPDSLT
FT                   GVRVFFPDPWPKARHHKRRLLQPDTVALIADRLRPGGILHAATDHMGYAGHIAEVGDAE
FT                   PRLRRIDPDDAGLPISTARPVTKYQRKALAGTEVAELLWEKTTP"
FT   gene            208291..209199
FT                   /locus_tag="Mvan_0199"
FT   CDS_pept        208291..209199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11049"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1J9"
FT                   /protein_id="ABM11049.1"
FT                   /translation="MEKRLRAPHRVAVRGRRGVGRNAVAWAFTAAGVRVVTDIGSADIQ
FT                   VVVTAETLKPEDRAMLRVSIPTLVVLNKADLAGREPGGPLAAATRRAAQIAAAAGVPVV
FT                   PMIAHLASVELDEQDIAVLRTLAAIPVDMTSTDAFVAADHEVPAAVRERLLARLDRFGL
FT                   AHAVLACADGATAETLTGALRALSGADRVLECVRAAAAEVRYRRVCAAVDELHRLAAET
FT                   RDDGLAAFLASDEVVVAVMAAAVDAMEAAGLRVDRWDDREAHERRAVRWHRYAAGPVTE
FT                   MHRRCAADITRGSLRLLGRRR"
FT   gene            209196..210455
FT                   /locus_tag="Mvan_0200"
FT   CDS_pept        209196..210455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb0216 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11050"
FT                   /db_xref="GOA:A1T1K0"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K0"
FT                   /protein_id="ABM11050.1"
FT                   /translation="MTGPETVLVAGPPRAGVSGVVAELRRRMPSHRFVEAGETGAPQRP
FT                   AVVVFVVSAVAPITRSDCVLADRVAASTDAVVAVLAKIDDHRDWTAVLEANRECLAGHA
FT                   GRFGRVPWVGAAAAPRLGEPRMDELVALLRAQLDDPTRPARNALRALESRECLLRGTRD
FT                   RLVQRRRREASERATALRSAIQQSRLTLTHTARRRCAELRTDLLAEATAVGRGEVCRFA
FT                   HRARRRSAEVLAAVEADLTAYTHDAPPRVTAPLLLPDPPLRARRLETRLMTVLGAGFGL
FT                   GVAVVVTRFLAGLAPEFATAALTAGAAIGLVTTAWVIRARALLHDRAVLERWAADGVAA
FT                   LRAAVEERVAAGMLAAETAIAAESARAAAARDGDTRRRIAAIEAELHDLSQARMLLVRR
FT                   ENLLPVGRPPGGGHLNRSCE"
FT   gene            210603..212432
FT                   /locus_tag="Mvan_0201"
FT   CDS_pept        210603..212432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0201"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   mmc:Mmcs_0176 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11051"
FT                   /db_xref="GOA:A1T1K1"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T1K1"
FT                   /protein_id="ABM11051.1"
FT                   /translation="MTAATIPGLDNAPTKHQGLLEWVREVAELTQPDRVAWADGSQEEY
FT                   DRLCAQLVEAGTFKKLNPEKQPNSYLALSDPSDVARVESRTFICSKREIDAGPTNNWMD
FT                   PAEMRGILTDLYRGCMRGRTLWVVPFCMGPLDADDPKLGVEITDSEYVVVSMRTMTRMG
FT                   AAALQKMGDDGFFVKALHSIGAPLEPGQKDVPWPCNDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYYIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETVGDDIAWMRFGKDGRLYATNPEFGFFGVAPGTNWDSNPNAMKTIAAGN
FT                   TVFTNVALTDDHDVWWEGLEGEPDHLIDWKGQDWILRETETKAAHPNSRYCTPISQCPT
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLITEARDWQHGVFIGATLGSEQTAAAEGKVGT
FT                   VRRDPMAMLPFLGYNVGDYFQHWINIGKQADESQLPKVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWAIERIEHKADGKSTPIGIVPTAADLDLEGLDVDPADVDEALAVNADEWRAEV
FT                   PLIEEWFEFVGEKLPTGIKDEFDALKTRLAEDS"
FT   gene            complement(212524..213084)
FT                   /locus_tag="Mvan_0202"
FT   CDS_pept        complement(212524..213084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0202"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_1490
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11052"
FT                   /db_xref="GOA:A1T1K2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K2"
FT                   /protein_id="ABM11052.1"
FT                   /translation="MMPTTRSFDALLRSALDLIADGGIDGLTLSQVAEHAHVSRATAYR
FT                   EFGDKDGLVGAVAQHEIGLMLVAVHADIDTTADATALVASIVVSALRYLRSHRAFTYVR
FT                   THEPHWLLHAALAVGDSRTDLVQTVAAAVTPAIAVDTRRLRLSAVQAAEVMVRTVLSHT
FT                   LIEYSTLTDAQVGEAVAHALITD"
FT   gene            213297..214691
FT                   /locus_tag="Mvan_0203"
FT   CDS_pept        213297..214691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0203"
FT                   /product="Carotenoid oxygenase"
FT                   /note="PFAM: Carotenoid oxygenase; KEGG: mpa:MAP1324
FT                   lignostilbene-alpha,beta-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11053"
FT                   /db_xref="GOA:A1T1K3"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K3"
FT                   /protein_id="ABM11053.1"
FT                   /translation="MGPDDLSSLGVSEPQPAEHDYRVEQIDGTIPAGLRGTLYRNGPGR
FT                   WEDHKGRPLRHLFDGDGMLSAFTIDAAGVHYRNRYVRTRHFGGRGGVSHMGTSAPGGWR
FT                   ANICRVPPNLANTNVVEHAGRLYALWEGGPPHEIDPDTLETMGVRRFGGELRWLGSYSA
FT                   HPSFCPSSGAMFNFGVELMPRPHLRIYRTDRTGRLRHFRSAALPYAAMVHDFAITERYI
FT                   VFLISPIIPDAMSVALGRAPIGDTLRYRPERGSVVLLVPRAGGKIRRIECEAVLQFHLS
FT                   NAFDDGDDVVIDAITYADGRLLERIARFHTTSLADMPSQFTRFRVGATGRVGAEPLTDS
FT                   PSEFPRHHPAREGRPHRYAYVNTRRTLGTLYDTVTKLDLADQTELSYPAPEPGNSFCEP
FT                   VFAPRPGATAEDDGWLLTVEYRAAHKTSRLVILDAADPSRGPVATAQLASHIPQGFHGN
FT                   FSARTS"
FT   gene            complement(214705..215913)
FT                   /locus_tag="Mvan_0204"
FT   CDS_pept        complement(214705..215913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0204"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   fra:Francci3_1888 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11054"
FT                   /db_xref="GOA:A1T1K4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K4"
FT                   /protein_id="ABM11054.1"
FT                   /translation="MAALRVAVVGGGIVGLAVARELLHSIDGARVTVFEKESGVARHQT
FT                   GHNSGVVHAGLYYAPGSLKARLCRRGVHLLREYLAQKDIRYSECGKIVVAHTAGDAARL
FT                   AGIHERALANGVPGVRLVDAGEITDIEPHARGISALHSPSTAIVDYPAVAEALAVDIAD
FT                   AGGEVLCDHGVIGMRRHGTEVVVTTAATSGAFDVVVTCAGLQSDRVARMFGDSSSPRIV
FT                   PFFGDYFLLHEAKSDMVNGLIYPVPDPRYPFLGVHLTKHVDGRVSLGPNAFLAPGREAY
FT                   TRGGWSARDVAAAVGFPGFWRFAVRNTAAAVREARTVMSRAAFVREAQKYVPDVSVDDV
FT                   VRGPRGIRAQAMNADGTLEDDFVITGTDKVIHLRNAPSPGATSSLAIAEYIVGTVVPAR
FT                   LGA"
FT   gene            216012..216962
FT                   /locus_tag="Mvan_0205"
FT   CDS_pept        216012..216962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0205"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG:
FT                   fra:Francci3_2659 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11055"
FT                   /db_xref="GOA:A1T1K5"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019923"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K5"
FT                   /protein_id="ABM11055.1"
FT                   /translation="MSIGDQLEFIAPMPRLLDDGSAWVEELRRLEEFGFDTVSVSHHVT
FT                   SGWQLAPVAAMAFAAASTSRLKVLTLVAQNPLQHPALLAKDIATIDRLSGGRAELGLGA
FT                   GWLAADYAALGVPFESHRTRVDQCAEALTIIRDFFTEDTVDFVGHHYHVTGLEALPRCC
FT                   RQPSPPILLGAAGPRMLDLGGRSADIVGVLPRMVNGRIDHETVADVAAPSLHAKIARVR
FT                   DSAARAGRQMPRIQFSVLHLDVTDVESPPRPVTQWEEALATERNWPLHGTPACLVGTAA
FT                   ECAEQVAEFSHRFGIGYWHLGQDSRAAAAVIAHLH"
FT   gene            complement(216974..218425)
FT                   /locus_tag="Mvan_0206"
FT   CDS_pept        complement(216974..218425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bth:BT1012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11056"
FT                   /db_xref="GOA:A1T1K6"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024749"
FT                   /db_xref="InterPro:IPR025277"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K6"
FT                   /protein_id="ABM11056.1"
FT                   /translation="MARNVSPAPEKPPRRRTGGWFTAIAVAIPTLIFVGLGLQSGVSAK
FT                   TDGPVPTPPLLVSDNSRYFLDAAGEPFFWMADTAWSLPINLTRDEVVTYLDIRNAQGFN
FT                   VIQTVAIFNQAGGPGPNRYDDWPYDKTLSQLAVTDGADPNDPGQYDYWNHLDFIVDQAN
FT                   IRGIRVAVVPVWAHGQVGDLVTHDNAAEYGRFIGARYRDRKVIWVLGGDAAANGHEDVW
FT                   RALARGIALGLTGKENYQGSAMTYHPIGGTSATHWFRGDPWLTFDMIQGGHCLRYNERR
FT                   DLLRAAYETAPTRPFLDGEPIYSGHPYCWDQEPEGYSTPIDVRRDAYWAVFAGAAGHTY
FT                   GDHAVWQFSGSTGRSSELGAVGEWRSAMEDEAAWQMRNLVSLVHSYPWWKGSPDNGRIV
FT                   KSVRSGGARLQAMSAADRSYALIYSPDGEEFEADIATVVDPRAQLSWFDPRSGARTPLG
FT                   ALEAGKVSYTPPSNEDWVLVADANP"
FT   sig_peptide     complement(218291..218425)
FT                   /locus_tag="Mvan_0206"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.978 at
FT                   residue 45"
FT   gene            complement(218429..220174)
FT                   /locus_tag="Mvan_0207"
FT   CDS_pept        complement(218429..220174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11057"
FT                   /db_xref="GOA:A1T1K7"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K7"
FT                   /protein_id="ABM11057.1"
FT                   /translation="MTLQNRLPSSGDTSSTDDQPARARAHGPAVMLVVAVGVWAVALST
FT                   LRHVEAGTYGLLATSGGALLGASACVTLAAFFWAIAVHRTVWAVLAIVVMALIARVTAT
FT                   LLTEMPLYVWTYKHIGIAEYMIDGHASPSIQIYGDWPSFFALMAWFSSVSGVDSLTVAH
FT                   WFAPVSSSLLSLLVGTLVVSAGFGARAGLIAAMLALIMNWTGQDYYSPQAAGLILTLSI
FT                   LTLVLYSKTARIAGYLAIPLAAVLVATHQLTPFWLFFVLAALAVFRQMRPWWLPVVYLT
FT                   MLAVYVVPRLNRAAKFDVFSGFNPLKNSTVVAEAPGSAGREFTILLERGLFVGLWILAA
FT                   VCFIVIWRRHGAPWGFAVLAFSPAMILAGQDYGGEAILRVFLYSIAGCSALLAVVAVLL
FT                   IDFESPWPRVIGCAVTALVAAAIGAVGLQGYYSGWSYVTVTRSQVEHSRNLLAQTEGKY
FT                   VVGTLAQNVGWPEGSTADAVRLRLLDPAYDSVFDGVRPHLLHKDFATPQDVSLIESTFQ
FT                   RNGRARALYVILPRQVRAYGEYQDWFPQTYVPSLIDLLSRTPLWSRVIDDEHTVVFEYR
FT                   PQKKR"
FT   gene            complement(220171..220554)
FT                   /locus_tag="Mvan_0208"
FT   CDS_pept        complement(220171..220554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro05770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11058"
FT                   /db_xref="GOA:A1T1K8"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K8"
FT                   /protein_id="ABM11058.1"
FT                   /translation="MKVSRWLRTLSSRDERVATVSLAAAACGALATVPVSTPLRGVVLL
FT                   AFVLTGVGSAVMCWIDLPAAVTMAAVVGISIAALTAVAVVMAWLEFWYPVPSCLIVAAL
FT                   VALSGAIRLRTLRDPATEADPTW"
FT   sig_peptide     complement(220414..220554)
FT                   /locus_tag="Mvan_0208"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.356 at
FT                   residue 47"
FT   gene            complement(220551..221291)
FT                   /locus_tag="Mvan_0209"
FT   CDS_pept        complement(220551..221291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0209"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   bfs:BF4060 putative beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11059"
FT                   /db_xref="GOA:A1T1K9"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1K9"
FT                   /protein_id="ABM11059.1"
FT                   /translation="MTVRVVALGSSLCLLLSACTGTAKTHTERCPVTAAASLGWGTPNR
FT                   LDNFDGPSSLPDWIVYDGPGHAGNGRRTPGAMSVTDGMLTITGDSQGNSGGMGWLPGQL
FT                   HGRWEACVRSSIAPAAYHSLVLLWPDAEDWPAGGEVDFMEIVDPARQQVEFWLHWGPGG
FT                   AKQSTKVTVDATRWHSYAVEWTSSHLIYYVDGEPEWLITDPNLLPPRPMHLCLQLDYFG
FT                   GDTGGGAQQWVDWVRQYDLKGESS"
FT   sig_peptide     complement(221214..221291)
FT                   /locus_tag="Mvan_0209"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.485 at
FT                   residue 26"
FT   gene            complement(221304..222659)
FT                   /locus_tag="Mvan_0210"
FT   CDS_pept        complement(221304..222659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11060"
FT                   /db_xref="GOA:A1T1L0"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L0"
FT                   /protein_id="ABM11060.1"
FT                   /translation="MNTAGRLRLRTIPGGELAAEANLNVNTFSLMVSNVLTCVLGLVYW
FT                   GATARVFPAEDVGVAAALINSALMLSTLSILSIDRFYERFLPVAGHRAGELISRGFLLV
FT                   TAVSMAGGIALIVFGPRETLFTSDWVLLAYPLFVVVIAVFILQDKVLAGLGVARWAAVK
FT                   NTGLAVGKLAVLLAVATLAGSGALMGTAAASTAIVAAWGSTAALIAAYFFVVISRRCRQ
FT                   HPRFSLHPDLPPWKDIWSYFGSSFGIAAMLSTGALLVPLIVVAQAGPAANAHFQIAWQF
FT                   VSALYLTIHLVVSPYVAEAATHPDKIPALSWRTVRMLIAVAVVGCAGLILVAPPMLNLI
FT                   GSDYRTGSEDLLLLAAIFVPLSVVGAAYEGFARVQRKLRLQLFMTFVWTLTVVGGSLIA
FT                   TRYVGVTGVGWAYLAAESICAVVLIGPAVMWLRKRMYLPPTSQRPSTELVDG"
FT   gene            complement(222656..224527)
FT                   /locus_tag="Mvan_0211"
FT   CDS_pept        complement(222656..224527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0211"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   fra:Francci3_1580 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11061"
FT                   /db_xref="GOA:A1T1L1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L1"
FT                   /protein_id="ABM11061.1"
FT                   /translation="MTTTDAPGAIAAGPAVMQTPKVSICIPAHQAAAYLQPLLDSVLSQ
FT                   AYDDFEVVVIDNHSTDGTSDILARVDDPRVRVMRNPATLPFVENWNLLVSQSRGEFVKL
FT                   VCADDLLKPGCLAVQASVLDNNPDVALVSVKCDFIDDNERLIVPARGLDGIEGQVTAEG
FT                   VVRRIVRNGGNPIGAPVAGMFRRADFDRVGGFTADFPFLSDIHLWVRLLGCGDFYGIPA
FT                   THASFRIRGGSMSGLTSARTQLAQSLDFEKSLARDPRWDLSQIDLFRGWMRCHEQTLRR
FT                   MALFGLTKWRVARRDRGPVRAGPRAGTDLPSTVVADTLTVVICAYTTQRWDELCPAVES
FT                   VLNQDFPVLGVVVVIDHCPELYRLARDRFGARGRVTVLESDGERGLSGARNTGVGAARG
FT                   DVVAFLDDDAVAEPGWAHALMRHYRDPRVAAVGGYAAPVWPTGARPHWMPAEFDWVVGC
FT                   SYTGQPTELAEVRNPLGCNMSIRRSVFDDIGGFRSEVGRVGNHPVGGEETELCLRIRGR
FT                   QPDARVLYDPDAVVRHHVSCDRTTIRYFRRRCYHEGISKAVVTEIAGVGNPLLAERAYT
FT                   TRTLPRGVLRELTAPRQGGFRRAGVMAFGLAATTAGYLRAKTQYRLS"
FT   gene            complement(224524..225603)
FT                   /locus_tag="Mvan_0212"
FT   CDS_pept        complement(224524..225603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0212"
FT                   /product="C-methyltransferase"
FT                   /note="PFAM: C-methyltransferase; KEGG: nha:Nham_2770
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11062"
FT                   /db_xref="GOA:A1T1L2"
FT                   /db_xref="InterPro:IPR013630"
FT                   /db_xref="InterPro:IPR013691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038576"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L2"
FT                   /protein_id="ABM11062.1"
FT                   /translation="MNECRGCGRDATLPVLDFGNVPAPDHFPPAADPIGADEACHRLAI
FT                   ALCSSCGLAQLADDDTGGQEMHGLEPRALREQAQAAVEQVAAAGWLRGDTVLEFESPHS
FT                   GSWLPLVAVFGYHPAPGSDADLVLDCFGIMHEPEQRASFARRAAATRSGGVLLLQYQPI
FT                   VTIVTEGQWNALRHGHFAYYSLTSLRSLLATVGMSVATLWEFDLYGGTTLVAAVHGDVE
FT                   GDESVQHLLNKEQQMGITTPAGLAGLQEGADRDVEMLRGWLEQEAAAGHTVYAYAAASK
FT                   AVSLFSRAGITTDLVKAVADGAPAKQGRRMPGTDIPIISPEELLAADPDRVLLTLADLL
FT                   PEVEARFPELSGRWKAHGR"
FT   gene            225618..226172
FT                   /locus_tag="Mvan_0213"
FT   CDS_pept        225618..226172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0213"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: rha:RHA1_ro05744 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 3,5-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11063"
FT                   /db_xref="GOA:A1T1L3"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L3"
FT                   /protein_id="ABM11063.1"
FT                   /translation="MRIDNADLADVLVLTPTPFRDERGLFTRTFDAALFDAHLGTPGLS
FT                   ARFVQDSQSRSVRGVIRGMHGRSGRGEAKLVRCAHGAIHDVLVDIRPGSVTFGRQQAFL
FT                   LDDNDFRHLYVPPGFLHGFQALTATADVCYRIDRPHDPSENLAVAHDDPDLAIDWPLAG
FT                   AIVSAQDRRAPRWADLLMQLS"
FT   gene            complement(226156..227184)
FT                   /locus_tag="Mvan_0214"
FT   CDS_pept        complement(226156..227184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0214"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: sco:SCO0395
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11064"
FT                   /db_xref="GOA:A1T1L4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L4"
FT                   /protein_id="ABM11064.1"
FT                   /translation="MKVLVTGHQGYLGTVMVPVLQAAGHDVTGLDSGLFEQCVLGPAPL
FT                   DPPGIEQDLRDVSVTQLAGFDAVVHLAALSNDPLGALAPEITYAINHRGSVRLARLAKE
FT                   AGVRRFLYASTCSVYGAADDGLVNEDTALRPLTPYAESKVRVEDDVAAIADDWFSPVFL
FT                   RNATAFGFSPRLRADIVVNNLVAHAVLTGVVRVLSDGTPWRPLVHAQDIAVAFLTALEA
FT                   PIHKIHCAAFNVGTETNNLTVAEIAEAVVGAVPSSHLLITGETGPDPRSYRVDFSRFRD
FT                   TLGYEATWSVADGATQLYRAYLAYGLNQHDFAHKFTRLPHLDALRSAGLLDESMRWIRT
FT                   AA"
FT   gene            complement(227181..228446)
FT                   /pseudo
FT                   /locus_tag="Mvan_0215"
FT   gene            complement(228490..229269)
FT                   /locus_tag="Mvan_0216"
FT   CDS_pept        complement(228490..229269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0216"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate cytidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: nha:Nham_2767
FT                   nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11065"
FT                   /db_xref="GOA:A1T1L5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L5"
FT                   /protein_id="ABM11065.1"
FT                   /translation="MKAVILAGGRGTRISEESESRPKPMVDIGGRPILWHIMKIYETAG
FT                   ITDFIVLVGYKGYMIKEYFMNYFLHTSDVTIDLATDSVATIQSKTEPWTVTLLDTGLNT
FT                   MTGGRLLRAKEYIGDDTFCFTYGDGVSDLDVRNVIDHHRAERTTVTVTAVQPPARYGTL
FT                   EFDERRVSFQEKPIGDGGWVSGGFFVAQPSVLDYISGDDTVFEQAPLQRLATDGELSAY
FT                   QHSGFWRGMDTLWDKIYLNDLWDNGKAPWKIWADQLV"
FT   gene            complement(229453..230304)
FT                   /locus_tag="Mvan_0217"
FT   CDS_pept        complement(229453..230304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0217"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sma:SAV6573 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11066"
FT                   /db_xref="GOA:A1T1L6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L6"
FT                   /protein_id="ABM11066.1"
FT                   /translation="MGELPATGHVGSASHQGQTTTSSPHAQFMLARDGVKVTPSVSLVI
FT                   PVRNEARNVAWVLEQITEDVDEIILVDGASTDATLITALRYRPDIKVVAQDGVGKGSAL
FT                   RTGFFAASGDIIVMMDADGSMAPQEIRHYVHFLRNGYDFVKGSRFIGGGGSLDITAFRK
FT                   LGNRFLLGVFNSLYDSDLTDLCYGFCAFHRRYLELLELSATGFEIEAEMTVRAMQAGLR
FT                   IAEVPSLEMPRRSGKSNLRAVRDGTRVLRTVLHGHRSGVSGHLLEVLSQRRGPAAAAAE
FT                   AC"
FT   gene            230995..232545
FT                   /locus_tag="Mvan_0218"
FT   CDS_pept        230995..232545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0218"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0177 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11067"
FT                   /db_xref="GOA:A1T1L7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L7"
FT                   /protein_id="ABM11067.1"
FT                   /translation="MQIRDTAVATPDKPAIIMYPSGTVVTFGELEARANRLAHLFRDAG
FT                   LVEGDAVAILMENNEHIHAVMWAARRAGLYYVPISTHLTAAEVAYIVDNSGAKAIVGSA
FT                   KLKDTLAGLAEELPNGLPPLRLIAGGAESSATSASSELEGWQRYPECVADKPDTPIADE
FT                   IEGDLLQYSSGTTGRPKGIKRELPHVPPSESPGLMAALVSFWMHPDAVYLSPAPLYHTA
FT                   PSVWSMQTQAGGITTVVMEKFDAEGALDAIAKHKVTHGQFVPVMFTRMLKLPEAVRKSY
FT                   DVSSLERVMHAAAPCPVDIKKQMIDWWGPIVDEYYASSEAHGSTLISAEDWLTHPGSVG
FT                   KPLTGVVHIVGEDGEELPPGQAGEIYFEGGYDFEYLNDPDKTASSRHPQGWKTVGDIGY
FT                   LDDEGYLYLTDRRHHMIISGGVNIYPQEAENLLVTHPKVMDAAVFGIPDEEMGQSVKAV
FT                   VQTVDPADATEEFAAELISWLRDRLAHYKCPRSLSFEAQLPRTDTGKLYKQELVKKHS"
FT   gene            232542..233429
FT                   /locus_tag="Mvan_0219"
FT   CDS_pept        232542..233429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0219"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0178 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11068"
FT                   /db_xref="GOA:A1T1L8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L8"
FT                   /protein_id="ABM11068.1"
FT                   /translation="MNSPVELGGGVRVAVGTPSDDATFTVTEDDVDDRRAVTVTSVPDT
FT                   LAELEERCRRWPQAAAVCDDVLRAFDPGGSTFAGVITESLAYSTLQSGSEFARWLAERG
FT                   PARVPDISDPVVAERHDGRLTIRFNRPQRHNAFSTDARAALLEALEVARLDPSVDEVVL
FT                   AGNGPSFCSGGDLAEFGTFTDPAGAHLARTRHSPALVLDEITARLGRGCRAELHGQVQG
FT                   SGLEMAAFCGWVSCDADAVLGLPELTLGLIPGAGGTVSVTRRIGRWRTAYLVLSGRPID
FT                   AGTALRWGLVDAVG"
FT   gene            complement(233473..234195)
FT                   /locus_tag="Mvan_0220"
FT   CDS_pept        complement(233473..234195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0220"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   mmc:Mmcs_0181 UbiC transcription regulator-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11069"
FT                   /db_xref="GOA:A1T1L9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1L9"
FT                   /protein_id="ABM11069.1"
FT                   /translation="MPPAYQVLRERLRDDIAAGRYPDGTRLPTESELVARHGLSRQTVR
FT                   RAFQDLVAEGTVYRVPGRGSYASEQGRRYLRQLGSIEDLMSLSDDTTMEVVDGLRRRVD
FT                   IEAASRLRLDGDVVYSVQFRRLHGGIAFGHTTVALPPAVATSVLTSPHLVTGATSTHTV
FT                   IGLLEPHLEKPIAEAAQSITVAAADEAAAAAVACPPGHPMLRVDRLYADDEGHPVELAV
FT                   SQFLPEQYTYRVTLRRSS"
FT   gene            complement(234195..235352)
FT                   /locus_tag="Mvan_0221"
FT   CDS_pept        complement(234195..235352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0221"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0182 butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11070"
FT                   /db_xref="GOA:A1T1M0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M0"
FT                   /protein_id="ABM11070.1"
FT                   /translation="MVEGLSSEEAMLVETVRTFIDREVRPTVRDVEHANTYPEAWIEKM
FT                   KQIGIFGLAIPESEGGAPVSTRCYVLVTQELARGWMSLAGAMGGHTVVAKLLSLFGTDE
FT                   QKQRYLPPMATGELRATMALTEPGGGSDLQAMSTVARRDGDELVISGAKTWISNARRSG
FT                   LIALLCKTDPEATPRHSGISVVLVDNPTDGLTVSRDLPKLGYKGVESCELTFDGCRVPE
FT                   SAILGGAAGRGFAQMMKGLETGRIQVASRALGVASAALADALAYAQDRESFGQPIWKHQ
FT                   AVGHYLADMATKLTAARQLTLYAADRYDSGARADMEAGMAKLFASEVAMEIALNAVRIH
FT                   GGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIAGQLVARGGI"
FT   gene            235459..236445
FT                   /locus_tag="Mvan_0222"
FT   CDS_pept        235459..236445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0222"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11071"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M1"
FT                   /protein_id="ABM11071.1"
FT                   /translation="MSGGPHFDDLRVGQVFDSAPSMTLTAGVAATHQAIIGDRMRLPLD
FT                   GELSLSVAGATAPLAHPALVCDVAIGQSTLATQRVKANLFYRGLTFYRYPVIGDSLFTR
FT                   TEVVGLRQNTAKPGRAPTGLAALRMTTIDGVGRLILDFYRCAMLPLSDDTAQTGHDDDL
FT                   SAIGAGAAPVADPTADWDAEAFRTRVPGPHFDPALVGTVGRSTADVVSSAPELARLSLN
FT                   IAATHHDSRVAGRRLVYGGHTIGLALAQATRLLPNLVTVLGWESCDHTGPVYENDTLYS
FT                   DLTVESADPLPDGRGAVLRLRSVVHAAGDEPGADRQVLEWRFSALHF"
FT   gene            236520..237659
FT                   /locus_tag="Mvan_0223"
FT   CDS_pept        236520..237659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0223"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11072"
FT                   /db_xref="GOA:A1T1M2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M2"
FT                   /protein_id="ABM11072.1"
FT                   /translation="MHRRGAVTHNGPVTSVRIPAAVLEHARSTAARAGIAADTDELLGG
FT                   RAALLGLRSGGRVSAGGASRLMAAHDGWCALTLSRPDDIAAVPALVEADAVVGDPWPAV
FT                   ERNVHDRGVVAFAERARLLGLPVGVLGETGSAAPVFRRSGDPVQPCGLTGLLVADLSSM
FT                   WAGPLCGQLLARAGATVVKVESATRPDGTRQGPPTFFDWMNGGKLSYRADFTRPDGVRR
FT                   LLAVADVVIESSRPAALERRGLGPADVPARRGRIWLRVTGHGTAGDRADWVAFGDDAAV
FT                   SGGLVGGSADAPEFCGDAIADPLTGLHAALAVLESHARGGGELVEISMAAVAAGYAGLP
FT                   GDDERYCAATPSVPDSGPELGSGNDVVDRLVADRLAAPC"
FT   gene            237653..238939
FT                   /locus_tag="Mvan_0224"
FT   CDS_pept        237653..238939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0224"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mmc:Mmcs_0185
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11073"
FT                   /db_xref="GOA:A1T1M3"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M3"
FT                   /protein_id="ABM11073.1"
FT                   /translation="MLIRRAALLDGTRTDIRVGERITGMADGLTAEPGETEYDAAGGAV
FT                   IPGLHDHHIHLRAAAAALHSVRVGPDEVHSRAELAETLAAATVGADGWIRAVGYHDAAA
FT                   GPLDRHVLDELAPSVPVRIQHRSGAQWILNTAALRRVGLADHPDGRLPSADGSWAATLR
FT                   SDPGLDELGALLCRYGVTGVTDATPDLAAGDVAALQREMRQRVRCLAPGKRILHDDELD
FT                   PDELSRWIGDRHAEGFPVAVHCVTAAQLVVTLEALRSSGTHPLDRIEHAAVVPDGSLAD
FT                   LAGRAVTVVTQPNFVAERGDQYLADVAPAEQPELWRVASLLRAGVPVALSTDAPFGDAD
FT                   PWAAMRAAVFRRTPAGHVLGEAECVPASAALQMFLGDPGRPATPRRVEPGAAADLCILS
FT                   TPPEATLAELDAAAVAATVIGGEVVYQRG"
FT   gene            complement(238944..239885)
FT                   /locus_tag="Mvan_0225"
FT   CDS_pept        complement(238944..239885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0225"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0200 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11074"
FT                   /db_xref="GOA:A1T1M4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M4"
FT                   /protein_id="ABM11074.1"
FT                   /translation="MPLPHTHTERVPDIEFHPELRRSARLLPKQVITPLTLPFIRAASR
FT                   LMWRRNDSPADVEVLTLSSGVGVRLFRPSGVAPGRGPALLWIHGGGYVIGDAAQDDVLC
FT                   RRFARELGATVASVNYRLAPEYPYPVPVEDCYSALHWLTQLPSVDPARVAIGGASAGGG
FT                   LAAALALLTRDRGEIELAAQLLVYPMIDDRTVHRKGLDHPGHRLWNQSSNRFGWRAYLG
FT                   DADPNEAVPARRDDLAGLPPAWIGVGTLDLFHDEDLAYAERLRVAGVQCEVMVVDGAFH
FT                   GFDGIAPKADVSQSFFNSQCALLRTVFASAAP"
FT   gene            complement(239889..242090)
FT                   /locus_tag="Mvan_0226"
FT   CDS_pept        complement(239889..242090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0226"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0201 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11075"
FT                   /db_xref="GOA:A1T1M5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M5"
FT                   /protein_id="ABM11075.1"
FT                   /translation="MSKTVSATVTASRLAITDDHQDLAAAVSGQLTRLQTPAKARAALA
FT                   GGSTHPADIWSAATELGWTGLALPEDVGGSGFGLEELAVVIECLGSQLAPGPFLSSAAA
FT                   SVVIDRSAPDSVRAELLPVLAGGETVAALGVSGSVVVGTDLIVSGESPVVLAAPDASVL
FT                   VLTAGEDVVILDAGPASAAGGVTVTPLDCLDPTRSIGSVTLRDVPVAADRVLRGAARNA
FT                   RTVFRILAAAEAVGVSWAALDMAVGYAKVREQFGRTIGTFQAVKHHAANMLVAAEVATA
FT                   ATWDAARADDLDSAWFAGAVAAALAIRAQVFNAQNNIQLHGGIGFTWEHDSHLYLRRAR
FT                   TLAALMADGVDPLLDIVDGQRNGRAHGASFTLPPESEEYRSQAREAAAKVRSLPAGQQR
FT                   DFLVESGYLVPHWPQPWGRAANVLEQLVIEEEFAGVDRPDMGITGWVALTIAQAGTDDQ
FT                   RERWVEPVLRGQVMWCQLFSEPGAGSDAAAVRTSAKKVDGGWRVTGQKVWTSLAHLCQW
FT                   GLATVRTDPDAPKHAGVTMMAIDMNAEGVTVNPLRGITGDSHFNEVFFDDVFVPDADVV
FT                   GDVNKGWLVARATLGNERISIGGGSGGPVGTTPDHLIKLLDSSPATSAMYVRQAGEVIA
FT                   ELHSLRLLNLRRATRAIAGAEPGPEGNVTKLLVAESGQRLTELAFELAGTAAVVGQTPQ
FT                   LTRSYLGNRAMTIAGGTSEITRNTIAERILGLPRDPLLR"
FT   gene            242257..243480
FT                   /locus_tag="Mvan_0227"
FT   CDS_pept        242257..243480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0227"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0202 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11076"
FT                   /db_xref="GOA:A1T1M6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M6"
FT                   /protein_id="ABM11076.1"
FT                   /translation="MTERPDIRYPGPTLTTRLQWLLNAGPSDFMLAMSVASASLPVIGK
FT                   HLEPLGALTAAGIWGTRHAPDFVGALAKSLITPNDAERKKQERDCTNAVTEAALRDVVG
FT                   PKDLEIEWPAAERTPPVWRMREHRRHVHRTSVRYGPRPTQLLDVWRRDDLPAEPAPVLI
FT                   FVPGGAWVHGSRMLQGYALMSHLAERGWVCLSIDYRVAPHNPWPAHVADVKTAIAWARA
FT                   NVDKFGGDRNFVAISGASAGGHLAALAGLTANDPEMQDELPEGSDTSVDAVVGIYGRYD
FT                   WEDKSTVERVRFMDFLERVVVRRKFDRHPELFRKASPMARVHPEAPPFLVVHGTGDSVI
FT                   PVAQAQSFVERLRGVSRSVVGYVELPGAGHGFDMTDGARTGAASTAIGLFLNHIHRNRT
FT                   LIGAKEVI"
FT   gene            243506..244936
FT                   /locus_tag="Mvan_0228"
FT   CDS_pept        243506..244936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0228"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mmc:Mmcs_0203 protein of unknown function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11077"
FT                   /db_xref="GOA:A1T1M7"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M7"
FT                   /protein_id="ABM11077.1"
FT                   /translation="MKRLSGWDAVLLYSETPNVHMHTLKLAVIELDDTFAREGGATFGV
FT                   EELRKVIHGRLYKLDPFRYQLIDIPFKFHHPMWRENAEVDLEYHVRSCRVDAPGGRREL
FT                   DEAVGRIASTPLDRSRPLWEMYLIEGLAGGRIAVLGKIHHALADGVASANLLARGMDLQ
FT                   DSPQADRDSYATDPAPTRGELVRSAFTDHLRQIAKLPGVVRYTAQGVRRVQRSERKLSP
FT                   ELTRPFTPPPTFMNHMVDATRRFATATVALDDVKQTGKQLGVTINDMVLAMSAGALRKL
FT                   LLRYDGRADHALLASVPVSFDFSRDRISGNYFTGVLVSLPVDVEDPLERVSAAHTAAAA
FT                   GKESNNLIGPELVSRWSAYFPPAPAEAMFRWLSNKDGQNKVMNLPISNVPGPRERARVG
FT                   GALVTEIYSVGPLTAGSGLNITVWSYVDQINISVLSDGKTLDDPHELTTAMVDEFIEIR
FT                   RAAGLSTELTVIETAMAN"
FT   gene            complement(245021..245392)
FT                   /locus_tag="Mvan_0229"
FT   CDS_pept        complement(245021..245392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11078"
FT                   /db_xref="GOA:A1T1M8"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M8"
FT                   /protein_id="ABM11078.1"
FT                   /translation="MRTSFNKAPLPVIGYILTLVGFISLGSFTAALAFGSNLAVILGVA
FT                   MLVSYALAAGCFMLRARQIAAADPTDPVVLGLDPIRGDIDRRTAERYLARYRSQDAAVS
FT                   DPGTGAREAGVTPRLADAA"
FT   sig_peptide     complement(245285..245392)
FT                   /locus_tag="Mvan_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.514 at
FT                   residue 36"
FT   gene            245470..246039
FT                   /locus_tag="Mvan_0230"
FT   CDS_pept        245470..246039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0230"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0857
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11079"
FT                   /db_xref="GOA:A1T1M9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1M9"
FT                   /protein_id="ABM11079.1"
FT                   /translation="MRRQQHRRRQMAAQSTDEVGARILDAALELLRARGPRAVTMQAIV
FT                   DATGIAKTTIYRRHQNRRMLLTAALETLGERPSAPPESGRAERLQWVITQSVDVIAAGI
FT                   GAGGFAALLTDEDPEFSEAFRAILVAYRRQAIDALAIGDRVGDTLVDIIVGSYVAELAR
FT                   TGSIDDGWAARIAAVLDGVLDAAAND"
FT   gene            complement(246036..247274)
FT                   /locus_tag="Mvan_0231"
FT   CDS_pept        complement(246036..247274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0231"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0204 LipO"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11080"
FT                   /db_xref="GOA:A1T1N0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N0"
FT                   /protein_id="ABM11080.1"
FT                   /translation="MPKRRPLLRAVAELLNAANGLRPLARDGYLTIPVFAFGWPTSEVS
FT                   PLYMAGSMLDAIRRGVRGDFRGARGRIALLLTAAAWALLYLIHRRNVAAQPYFEDPLRE
FT                   ALGENYQRIAEAAKSSRRRRVGVFPPDLVRRRYVESVVQYGPLRVNRADIWRRADLPRD
FT                   GKAPVLLQVPGGAWAIGMRRPQAYPLLSHLADHGWICVSIDYRVSPRNTWPDHIVDVKR
FT                   ALAWIKEHIAEYGGDPDFVAITGGSAGGHLSALAALTADDPQFQPGFEDADTSVAAAVP
FT                   IYGRYDWVSGRGSGRREFIAFLQEFVVKKPISGNRQLYVDASPRYRLRADAPPFFILHG
FT                   RDDSIIPVPEGRAFAEALRNVSTSPVVYAEIPHAQHAFDFYYGSPRAHYTAQAVEEFLS
FT                   WVQGERMLARKAG"
FT   gene            complement(247277..248911)
FT                   /locus_tag="Mvan_0232"
FT   CDS_pept        complement(247277..248911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0232"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mpa:MAP1159c acyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11081"
FT                   /db_xref="GOA:A1T1N1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N1"
FT                   /protein_id="ABM11081.1"
FT                   /translation="MGITDPVTKTLGLLSTMVRAGVIAPMRPDKYLRIAGAMQRENMAI
FT                   TSGFAAAAQRCPDRAGLIDELGILTWRQIDQRADAFAAALQALPGGQPEVIALMARNHR
FT                   GFVDALIAANRIGADVLLLNTSFAGPALAEVMEREGEGRSVAVVYDEEFTDTVDRALAG
FT                   RPDTTRIVAWTDTPGDRLTVEGMIAEHGGQEPVRAPEKSRVILLTSGTTGTPKGASHSG
FT                   GDPSVLKAILDRTPWRAEQPVVIVAPMFHAWGFSQLAFAASMSCTIVTRRRFDPEATLE
FT                   LVDKYRATGLCVVPVMFDRIMDLPDEVLDKYSGRSLRFAAASGSRMRPDVVIKFMDRFG
FT                   DVIYNNYNATEAGMIATATPRDLRAAPDTAGRPAEGTEIRILDADFNEVPTGEVGGIYV
FT                   RNSTQFDGYTTGKTKDFHEGFMSSGDVGYFDEAGRLFVVGRDDEMIVSGGENVYPIEVE
FT                   KTLAAHPDVAEATVLGVDDEKFGQRLEAFVVLTADAAATPETLKQHVRDNLANYKVPRE
FT                   ITILDELPRGVTGKISRKDLQDRLDNA"
FT   gene            complement(248916..249725)
FT                   /locus_tag="Mvan_0233"
FT   CDS_pept        complement(248916..249725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0233"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mmc:Mmcs_0205 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11082"
FT                   /db_xref="GOA:A1T1N2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N2"
FT                   /protein_id="ABM11082.1"
FT                   /translation="MSATDIDTSEITKWDPVLTERVMGLLKPFLKGWHRAEVRGLEDFP
FT                   NGGALVVANHSGGLFPMDVPIFASGFYEKFGYDRPVYTLSHDMLMVGPTGAFFKKTGFI
FT                   PANHRNADEALRSGGVVVVFPGGDYDVYRPTLAANKIDFGGRTGYVKAAINAGVPIVPT
FT                   VAIGGQESQLFLSRGTELAKALGPVARAFRTKILPVSFGFPFGLSVVLPLNVPLPAKIT
FT                   MKALPPIDIVAEFGEDPDIDEVDAHVRRVMQRALDELAQERRLPVLG"
FT   gene            complement(249922..250605)
FT                   /locus_tag="Mvan_0234"
FT   CDS_pept        complement(249922..250605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0234"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0499 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11083"
FT                   /db_xref="GOA:A1T1N3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N3"
FT                   /protein_id="ABM11083.1"
FT                   /translation="MTDTEHTTALVTGANRGLGRRFAEALVARGAKVYAAARRPETIDI
FT                   PGVVPIQLDITDPESVRRAAEQATDVTVVINNAGVSTRAGLLDGTLEDIRLEMDTHYFG
FT                   TLAVTRAFVPVIERNGGGAILNVLSVLSWLHPPTSGAYSAAKAAGWAMTDALRAELAPR
FT                   GIHVAALHVGFMDTDMVSYIPADQKTDPAVVAELALDGLFAGQPEILADELTRNVKAQL
FT                   SAAPA"
FT   gene            250816..251652
FT                   /locus_tag="Mvan_0235"
FT   CDS_pept        250816..251652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0235"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: mmc:Mmcs_0211
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11084"
FT                   /db_xref="GOA:A1T1N4"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N4"
FT                   /protein_id="ABM11084.1"
FT                   /translation="MADMPTLLDAYFTRIGLTMPVESTLDALRDIVAGHNRSIPFENLD
FT                   PVTGIPVVDLSAEALADKLLGRRRGGYCYEQNGLLGYVLDDLGFGVQRLVGRVIWMHDD
FT                   DTLPAQTHQVLSVTLPDGDGPYLVDVGFGGQTLSSPIRLAPGQVQQTRHEPYRLLDHPE
FT                   GFELQARVGGVWESLYLLDPIPRPRIDLEVGSWYVSTYPESVFVRGLTAALVTDDARWN
FT                   LRGRRLAVHRAGGSEKTRLGSAADVLEVLEGRFGINLADLGDRAELEARVGRVLDS"
FT   gene            251709..252764
FT                   /locus_tag="Mvan_0236"
FT   CDS_pept        251709..252764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0236"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mmc:Mmcs_0214 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11085"
FT                   /db_xref="GOA:A1T1N5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N5"
FT                   /protein_id="ABM11085.1"
FT                   /translation="MTDDPSPEHAALPDPSALRASAHPDPSALRASAHPDPSALRASAH
FT                   RRDRLRELLDAVTDSANADVGDMARSSYASEFHFSREVRRLTGESPAALRRRVMLERAA
FT                   WRLQRGEAVSAVAADEGWSSAEVFSRAFRRMYGLPPSQASDVHFRLPAPNGLHFHPPQS
FT                   LWLDSDPGDRTPPGMHTPDIAQLMIDHDIADTSHLLGQAALLSPQQWVAEVAPGQTVLE
FT                   WDGPEPSVGAVLGAIVWTKQVWLATIAGDDFPSRACTQPEFVDAATLAAHHDDVGNRWR
FT                   AMVSEYAVAGRLGDTVIDALCDPPESFQLYGIVAHVLTYSAHRRGLARTMLAGHGVTTR
FT                   LGDPLDWMRGN"
FT   gene            252765..253286
FT                   /locus_tag="Mvan_0237"
FT   CDS_pept        252765..253286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0237"
FT                   /product="bifunctional deaminase-reductase-like protein"
FT                   /note="KEGG: mmc:Mmcs_0215 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11086"
FT                   /db_xref="GOA:A1T1N6"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N6"
FT                   /protein_id="ABM11086.1"
FT                   /translation="MSTVYYTASSLDGYIVDENKSLDWLTSREIAADGPFAIDPFMETV
FT                   GSLVMGADTYEWILENHPGEWMYPQPTWVLTHRPGIIADGHDVQTFAGDVADLHPVLEE
FT                   AAAGKNVWLVGGGDVAAQFVAAGLVDEMIVSYAPCTLGAGSRVLPMRSEWALVSSAVNA
FT                   DFVCAHWRRA"
FT   gene            253337..255172
FT                   /locus_tag="Mvan_0238"
FT   CDS_pept        253337..255172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0238"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   nfa:nfa54510 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11087"
FT                   /db_xref="GOA:A1T1N7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N7"
FT                   /protein_id="ABM11087.1"
FT                   /translation="MGHYKSNVRDLEFNLFEVLALEKVLATGEFGDLDGPSVREMLHEA
FT                   AKLAEGPLAEAYAETDRNPPSFDPATHVVSIPEPFKKSFRAWLDGEWFRVGMAEEIGGV
FT                   PAPAMLEWAINELALGAQPAAFMYAAGPKMADIINAIGNEEQRHWAALMIERNWGATMV
FT                   LTEPDAGSDVGAGRTKAVQQADGTWHIDGVKRFITNGDADDLFENILHVVLARPEGAGP
FT                   GTKGLSLFLVPKFHFDPQTGEPGERNGVFVTGLEHKMGLKASATCELTFGQHGVPAVGW
FT                   LVNDTHNGIAQMFKVIEYARMMVGTKAMSTLSTGYLNALEYAKTRVQGADMTQMTDKSA
FT                   PRVTIIHHPDVRRALLIQKAYAEGLRALYLYTAAHQDPAAADIVSGADAAMADRVNDLL
FT                   LPIVKGVGSERAYQCLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIARDQGGALLHVVSQLRRFLDDLSAREELATERALLGTAVDDVQEMVAAMTKYLVD
FT                   SQQNARELYRLGLESVPFLLAVGDLLLGWLLLHQAETALTALEGDVSERDRAFYTGKVA
FT                   TAKFFARNVLPRLTAQRGILQAVDLTAMELSEAGF"
FT   gene            255198..255614
FT                   /locus_tag="Mvan_0239"
FT   CDS_pept        255198..255614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11088"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N8"
FT                   /protein_id="ABM11088.1"
FT                   /translation="MAVCTGMSDDEKQVRETIERWVDAISACDLDGVIAAHTDDVVLFD
FT                   VPPPHDGIRGIAGYRDSWPEFFEFIRSGAVLQLLELDVTAGDDVAFARGLLRCGTPEDI
FT                   AANPENRLRTTIGLRKVDGRWMIAHEHHSFPMTG"
FT   gene            complement(255701..257176)
FT                   /locus_tag="Mvan_0240"
FT   CDS_pept        complement(255701..257176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0240"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0217
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11089"
FT                   /db_xref="GOA:A1T1N9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1N9"
FT                   /protein_id="ABM11089.1"
FT                   /translation="MTQSTTFRTEWDKLFIGGKWVEPATSDVIEVHSPATGELVGKVPL
FT                   ASAADVDAACAAAREAFDNGPWPHMSPAERGEILGRAVKIMEERADELKFLLAAETGQP
FT                   PTIVDMMQYGAAMSSFQFYAGAADKFTWQDIRDGVYGQTLVVREPVGVVGAVTAWNVPF
FT                   FLAANKLGPALLAGCTVVLKPAAETPLSVFAMAEMFVEAGLPEGVLSIVPGGPETGQAL
FT                   TANPNLDKYTFTGSSGVGKEIAKIAADKLKPCTLELGGKSAAIILEDADLDSTLPMLVF
FT                   SGLMNSGQACVGQTRILAPRSRYDEVVEKLAAAAAGMAPGLPDNPAAMIGPLISEKQRD
FT                   RVEGYIKKGIEEGARVVTGGGRPEGLDSGWYVQPTVFADVDNSMTIAQEEIFGPVLAVI
FT                   PYEDEDDAVRIANDSVYGLAGSVYTTDNDRALKIARRIRTGTYAVNMYAFDPCAPFGGF
FT                   KNSGIGRENGWEGIEAYCEPKSILLPFGYTPAT"
FT   gene            complement(257231..257998)
FT                   /locus_tag="Mvan_0241"
FT   CDS_pept        complement(257231..257998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0241"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0218 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11090"
FT                   /db_xref="GOA:A1T1P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T1P0"
FT                   /protein_id="ABM11090.1"
FT                   /translation="MPATDRFSDRATLARSVRLLTAFRFEQSAPDRFYGALADDTVAMV
FT                   GDLWESATGESQAGLTLLDVGGGPGYFASAFTAAGVNYIGVEPDPREMHAAAALTHERA
FT                   GTFVRASGTALPFADDSVDVCLSSNVAEHVAQPWRLGDEMLRVTRPGGLAVLSYTVWLG
FT                   PFGGHEMGLTHYLGGRRAAEMYTRRHGHRPKNDYGSSLFAVHARDGLRWAQGTGALLAA
FT                   FPRYHPRWAWGLTKVPGLREFLVSNLVLVLRPC"
FT   gene            258037..259197
FT                   /locus_tag="Mvan_0242"
FT   CDS_pept        258037..259197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0242"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mpa:MAP3664 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11091"
FT                   /db_xref="GOA:A1T1P1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P1"
FT                   /protein_id="ABM11091.1"
FT                   /translation="MSDLPLRSVLLLCWRDTGHPQGGGSETYLQRIGAQLAESGTRVTL
FT                   RTARYPGAARREIVDGVQIQRRGGPYTVYVWAGLAMAAARIGLGPMRRIRPDIVVDTQN
FT                   GLPFLSRLVHGRRTVVLVHHCHREQWPVAGPVMSRMGWFVESRLSPRLHRRNQYVTVSL
FT                   PSARDLALLGVQPERIAVVRNGVDAAPEPTLAVPRSESPRVVVLSRLVPHKQIEDALDA
FT                   VARLRTRIPDVHLDVLGDGWWAQRLVDHAARLGISDAVTFHGHVDDATKHAVLQRGWVH
FT                   VLPSRKEGWGLSVVEAAQHGVPTIGYRSSGGLTDSVIDGVTGMLVDDFDELVDSLERVL
FT                   TDDVLREQLGAKAQVRSGDFSWKQSADAMRAVLTAVRAGRPASGVI"
FT   gene            259305..261959
FT                   /locus_tag="Mvan_0243"
FT   CDS_pept        259305..261959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0243"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; SMART: AAA ATPase;
FT                   KEGG: mpa:MAP1875c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11092"
FT                   /db_xref="GOA:A1T1P2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P2"
FT                   /protein_id="ABM11092.1"
FT                   /translation="MTEKWTELPDWPLVGRARELGRAIDALRPGSGFRGVVFVGEPGSG
FT                   KTTLARAIAATLRSEGVTTRFVLGTDTGQAVPLGAFHRTLSIEDPHEPAVMLAAAHRAL
FT                   AREHNLVLAIDDAHLLDPLSALLVQQAATSDTARLIVTIRSGEVVPDAVTALWKEQLLM
FT                   RVDLNAFDRTQTQELVDAVLDGEVDSSVVDRLHDLAGGSPLVLRGLIGAAREDGVLVRQ
FT                   GGRWRLHGRLRVGTDVHELVQTQLAGLTEGEFEVVEIVSAAEVLDWNVLRALCDAEAIA
FT                   RTEHRGVIEFVDDGSHTLVRAGHPILGEVVRQRGGVARTRQLNTMLAQSISDFLGTDAT
FT                   HPYSVGADVRSRIQLARFMTCSDAEPDLELITAAAADAVTMSNLVLAEQLARFAFDRGG
FT                   GLPSAIALADAISWQGRGQEAEAILAAFDPDGADALMTVRWGCLRGANLFFGCGHSDGA
FT                   WAALATVRERVASEDLLSLVTAMEVSLAFFSGDVPVAVRLGQAALATERMPMATVWAAM
FT                   ATAGALSLSGRLDEVRPIARQGLQAARYCESGPQHYTIGLAEVLAYTASGDMDAADHAC
FT                   ERYSAMTCGVPQAEAIVNALVGRVNFARGLLAAACDALSTSLWTMSESLPSGWVMLVAA
FT                   WLAQAEAARGNADGAAAALARAEDANGPQVAVFVPELELARSWHRACVGQTTTARDHAL
FT                   RAAQTARVKGMWAVEMCALHTAVRFGDRSQSARLRQCAAQLDSPLAEAIAAHGIGLSDH
FT                   DGDRLDAAADMFDRLGAAAMAADASAHAAREHARAGARVKELEATTRAHWLAGRNCVRT
FT                   PAVTAIEDPLPITDREREIAVLVGESLTNREIAERLGVSVRTIDGHLYRIFAKLSIEDR
FT                   EQLARLFRIRPAT"
FT   gene            complement(261978..264584)
FT                   /locus_tag="Mvan_0244"
FT   CDS_pept        complement(261978..264584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0244"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2; KEGG: nfa:nfa53720 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11093"
FT                   /db_xref="GOA:A1T1P3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P3"
FT                   /protein_id="ABM11093.1"
FT                   /translation="MASAWPLIGRRHELALTHAAIAESGAVVLTGAAGVGKSRVAREVL
FT                   ERSQYRIARWIAATQTGRSVPLGALAQFAGDCGPDPLRRVQEVIDALIGDEPPMTVLVC
FT                   VDDAHLLDEQSAFVVSQLVERRIAPVLMTIRDGEAVPDAIASLCADGRRPRIDIAPLTA
FT                   GDVTALLESVLDGPLESASVQRFWSYTRGNALHLRQLIADEVAAGRLAQRSGVWIWDGA
FT                   PRLSPSLVELIGSSIGRLAESVIDVIDVLAVCDPVELTVLHGLAGASELGAAAEHGLVA
FT                   VDQVAGLVHLAHPLFGEVRRDQAGTARLRNLRRQVADAIGMLPSQSPVQLVRRGVLAMD
FT                   ADGNRDPELLRSAAEAALQLLDLDLAVQLSRCAVQAGGGRAAQLTHALALGMVGGGSGC
FT                   DDMLAALMATAEGGELAQIALMRAAILTWNMGKPHTAEAVLDSASEAAAGCGLAPSCDA
FT                   LRASIWAQLGRPQAAVELAGTALAGNAVQPLAAMFGIWALVIGHGDLGDVDHLREAAAR
FT                   GYDLALSAPEASQLRFSLGLMEIVGLRLAGALESARSVAARLRGQSQDVDVSHAVTAML
FT                   TGLSELCCGDLISAQRWFRESLARAAKFPDLSVSVCELSGLWLTTALAMSGNRAAAQDV
FT                   YDQTLKTFDGEIVLWQSEARLAQAWLHAANGSTSLAVAFAIDAARAARKHGRPAREVVC
FT                   LQAATQFGSTSSADRLRELSSAVRGPRADAAYAHARALRKADGHGLLAAVGRYEAFGDR
FT                   VAAVDAAAQAAVVLDKRGQREASIAAAATARRLATESGADTVTFRSMRCSAVLTRRQRE
FT                   VIALAASGLSNREIADRLVTSVRTVESHFLRACRNTGTNTRDELIAFLLGDDRAPS"
FT   gene            264735..266132
FT                   /locus_tag="Mvan_0245"
FT   CDS_pept        264735..266132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0245"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP1344
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11094"
FT                   /db_xref="GOA:A1T1P4"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P4"
FT                   /protein_id="ABM11094.1"
FT                   /translation="MVGTVEREDLGALPLAPRNPLPYRQQVRAIRTFHTGLETLRDAGG
FT                   PVTRLKLAPKWLMPPMVVATSPQGARDILARGGGHIDKTRVHHEMRRLLGANLFDLTHE
FT                   PWLPRRRALQPIFTKQHVREFAGHMATAAQTVADSWADGTELDLDTECRKLTLRALGRS
FT                   VLGLDLDEHSDAIAEPLRTALEYIADRALQPISAPRWLPTPARRRARAASSTLHKLADK
FT                   ILQACRTDPTRDAPLVQALIAASDPATGRPLSDDEIRDELIVFMLAGHDTTATTLTYAM
FT                   WALGHHHDVQDRVRAEVVGIGDRELTPEDVPALGYTIQVLHEALRLCPPAAATARMAMR
FT                   DVEVDGYRIEAGSMMAVGIYALHRDPALWERPLVFDPDRFSAQNSGGRDRWQYLPFGAG
FT                   PRSCIGDHFAMLEATLALATIIRSAEIRSSDPHFPMIVPFTTVAAEPIRARVKSVNRIP
FT                   AADSGGR"
FT   gene            complement(266206..267426)
FT                   /locus_tag="Mvan_0246"
FT   CDS_pept        complement(266206..267426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0246"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP3818
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11095"
FT                   /db_xref="GOA:A1T1P5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P5"
FT                   /protein_id="ABM11095.1"
FT                   /translation="MATDAISIGGVDLADPDTYVGGMPHGAFRELRRHAPVAWHPYGDN
FT                   PGFWALTGYDEVLAVSRDSRTWSSQTTGVFLDVPAPEDSYQLSLMMLTMDPPRHTALRA
FT                   LVSRGFTPRHLARLNARTADMARDILDAALQRGECEFVDDVAGALPSYVIAELLGIPLD
FT                   DGRRLYALTEIMNTRPLHDPELMQTQVELFGYAGDLAASKRAAPGDDIATALLHAEVDG
FT                   QRLTDLEFNLFFMLLLNAGGDTTRNLVAAGTLALIEHPEQWARLAADPSLMPTAIEEML
FT                   RWTSPVNVFTRTATRDTEVGGVPLRAGERVAMFYPSANRDEKHFADPDRFDIGRAPNHH
FT                   LAFGGGGTHFCLGASLARVEATAIFGEILTRTAHIELAGPVERVRSVLMNGIRSMPVRL
FT                   TPASVPA"
FT   gene            267569..268597
FT                   /locus_tag="Mvan_0247"
FT   CDS_pept        267569..268597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11096"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P6"
FT                   /protein_id="ABM11096.1"
FT                   /translation="MGRHRAAARRPVRGARDRRRGTQARPLRQRRRPAPSGGVRRLRGV
FT                   LARTAGHGRLYLMSRNRIQIDRRTARWSDDPVTVADAMDFWSFAAGAANVIMQLSRPAV
FT                   GYGVVESKVDSGNLSKHPWKRARTTFQYLAVAIFGSDDDRAAFREAVDGVHRQVKSGPS
FT                   SPVRYNAFDRDLQMWVAACLFVGLEDTYQLLRGEMTHEQSEQFYLSAATLGTTLQVSAE
FT                   QWPLTRTDFDRYWDTACQQVEMDDVVRSYLTDLINLRMINPVLALPFRPLLKFLTAGFL
FT                   APVFRDALGVTWGGGRQWCFERLFLVVAFVNRFIPGFIRQGGSHVLLADVRMRVRRQRR
FT                   LV"
FT   gene            268608..268868
FT                   /locus_tag="Mvan_0248"
FT   CDS_pept        268608..268868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11097"
FT                   /db_xref="GOA:A1T1P7"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P7"
FT                   /protein_id="ABM11097.1"
FT                   /translation="MPGIRAATRSLLSRRMSVADVVELGLWLAIPYVTIGLAWAFFHVE
FT                   EVRHLENLLQTRLPAGGGMLAYLLVAALWPVHVLLPAVCVA"
FT   gene            complement(268809..270512)
FT                   /locus_tag="Mvan_0249"
FT   CDS_pept        complement(268809..270512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11098"
FT                   /db_xref="GOA:A1T1P8"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P8"
FT                   /protein_id="ABM11098.1"
FT                   /translation="MTLGVTAPLLAPGHLLLRDAVSTPRSYLTDGALGLTQAAPRALPQ
FT                   DFAVALASTVVDGGVVVKALLMLGLWLAGWGAARLVATVLPDAGTAGQCVAVTIAIWNP
FT                   YVAERLLQGHWSLLVGYGCLPWVALCFAPKLHSSSGSASGPLLECNFGRVGALLFWIAL
FT                   AGLTPTGLMLAATIALACSMAAGRSRWRCAGLSLAASMIAALPWLVASAVGGGWAAAAD
FT                   QQPGVAAFAARAEPGLATLGSLASLGGIWNAEAVPASRTTLFALASAGVLLAIVAAGVP
FT                   LLIRRRTALPLLVVAAAAVVIPTLMATGPGLAAVDAVIGAVPGLGVIRDGQKWVALAMP
FT                   AYALAGAAAVIALRPRVPAAATAAVFAAALVATLPDLAWGVGGRVNPVQYPAGWSAAAA
FT                   VINADPAPVAVLPVDSMRHFSWAGEVPVLDPLPRWVRADVLSTGDLTIAGRTVPGEGTR
FT                   AREVQQMLISGADADQLAAAGVGWVVVEGTADGTPELRLPVAYRDDDLTVYAVGGDAAG
FT                   SPHRTVLLAAHTVWLAALGAGLIAMLVGLLRSRHAHRRQQDVDGPERGDQ"
FT   gene            complement(270572..271777)
FT                   /locus_tag="Mvan_0250"
FT   CDS_pept        complement(270572..271777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11099"
FT                   /db_xref="GOA:A1T1P9"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1P9"
FT                   /protein_id="ABM11099.1"
FT                   /translation="MNRAVALRIAACGIMGLGAALLIAALLLSTYTQGKIAKIPLDIDA
FT                   TLISDGTGTAFDPASLLGERFVINEDVPVVMQQQMTVESPANADVVTLQVGTTLKRSDQ
FT                   QKDEGLLLAMVDTVTVNRQTAMAVSSETNPGGSVQKPRAIEDENPPTSIALPHEGLTYR
FT                   FPFDTEKKTYQVFDPIAQKAFDANYSGEEDVNGLTAYKFTQNIGFDADGKLVEPVKFAS
FT                   LYDDDADSQATATAKLWGLEGDPEESITMTRYYAAQRTFWVDPVSGTIVKKTDRGYQYY
FT                   AREALKPEVTFVDYTVTSNEETVEAQVAAAQDERDRVSLWGRILPITFTALGLVALVGG
FT                   ALLGTFSLRAESLLIDPGLDDTGGRFFGRRGDEGEPVPGAEAMTEKLPAQRPSDLPPDK
FT                   PV"
FT   sig_peptide     complement(271673..271777)
FT                   /locus_tag="Mvan_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.429 at
FT                   residue 35"
FT   gene            271954..273138
FT                   /locus_tag="Mvan_0251"
FT   CDS_pept        271954..273138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0251"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmc:Mmcs_0222
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11100"
FT                   /db_xref="GOA:A1T1Q0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q0"
FT                   /protein_id="ABM11100.1"
FT                   /translation="MTVTAAPADPSVVGGTRGFLPAVEGLRACAAIGVVVTHVAFQTGQ
FT                   SGGVVGRVLGRFDLAVAVFFALSGFLLWRGHAAAARGLRSRPTTGHYLRSRVVRIMPGY
FT                   LVAVVVIMTLLPDVNADFTVWLANLTLTQIYVPLTLTSGLTQMWSLSVEMSFYLALPLL
FT                   ALLARRLPVRARIPAIVVVAAASLFWVRIPFDPDSGHNLWNWPPAFFSWFAAGMVLAEL
FT                   TVGPVGWAHRLARRRVLMAVLAVTAFLIAASPLAGREGLHPGSVGQVTLKTAMGAVVAG
FT                   ALLAPLVLDRIDTPHRILGSPVMVTLGRWSYGLFVWHLAALAMVFPIIGAFPFNGHFTV
FT                   VLVLTVLFGFAIAAVSYALVESPCRNALRRWERRNHPTPLDSSVSDEIEPARAR"
FT   gene            complement(273212..274666)
FT                   /locus_tag="Mvan_0252"
FT   CDS_pept        complement(273212..274666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0252"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0223 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11101"
FT                   /db_xref="GOA:A1T1Q1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q1"
FT                   /protein_id="ABM11101.1"
FT                   /translation="MTAAPVPPIGTQVSALAAQAPDAPAATCDGVTVTRRELDATSNRL
FT                   ARAFASLGVGVGDYVTIVLPNSLDWAYSVLACWKLGAVPQPLSARLPDAELAALLELRR
FT                   PALLVGRPDPTGVTPDVAVELAAEFPDSPLPEAVSPVWKSMASGGSTGRPKLIEAGNDS
FT                   RVPPAIGYPLGAQEGDVTLVSVPLSHNTGFTTFAVGLLQGHHLVVMPRFEPHEFLRLVT
FT                   EHRVTFLTTVPTIMQRLLPVYRADPDAYDLSSIRRFWHLAAPCPPAVKHAWIELLGPDA
FT                   VWELYGGTELQALTFISGDQWLTHPGSVGVVVAGEMKVLDDDGDECPPGVAGEIYMRSA
FT                   PGGPPTYRYVGSTAKSRDGWESLGDLGYFDEDGFLYLNDRRVDMFTVGGRNVYPAEIES
FT                   ALAEHPRVLSSLAMGLPDDDLGQVPHAIVQAHGLDEAEVIAFLAERIASHKLPRSVEFT
FT                   DRPLRDDAGKARRSAVRDEVIARRSS"
FT   gene            complement(274668..278894)
FT                   /locus_tag="Mvan_0253"
FT   CDS_pept        complement(274668..278894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0253"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0226 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11102"
FT                   /db_xref="GOA:A1T1Q2"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q2"
FT                   /protein_id="ABM11102.1"
FT                   /translation="MAATAALVLTFAQSPGQISPDTKLDLTANPQRFLARAFNLWNSEL
FT                   PFGQAQNQAYGYLFPHGTFFLAGDVLGVPGWVTQRLWWALLLVVGFWGMLRLAEALGIG
FT                   STTSRVIGALAYALSPRVLTTIGAISSETLPMMLAPWVLLPVVLVLQGGSGGVGETQGG
FT                   SGGVGETQGDTRVRQLAARSALAVALMGAVNAVATLTACLCAVVWLLCHRPNRTWWRFV
FT                   AWWLPCVALAVTWWVVALLHLGRISPPFLDFIESSGVTTQWMSLTEMLRGTGAWTPYVA
FT                   PTATAGAPLVTGSVAVLATTLVAAGGLAGLALATMPARGRLVTMLLVGVVLLAAGYSGG
FT                   LGSPVAQHVQAFLDADGTPLRNLHKLDPLLRLPLALGLAHLLGRIPLPGSVPRPVWRDA
FT                   FAHPENDKRVAVGIVLLSALTAATALAWTGRLTPPGAFDTIPQYWHDTAAWLDDNNSGG
FT                   RVLVAPGAPFATQVWGNSHDEPLQVLGDSAWGVRDSIPLTPPETIRALDSVQRLFAAGR
FT                   PSAGLAETLARQGISYVVVRNDLDPDASRSVRPILVHRAIDASPGLTKVAEFGDPVGPG
FT                   TVEGFVSDSGLRPRYRGVEIYRVDRPGSLQPYVVDTDTMARVDGGPEALLRLDERRRLA
FT                   GEAPLGPMLLTQDATRAGLPAPLVTVTDTPTARETDYGRVDDHSSAIRGPDDARNTFNR
FT                   VPDYPSTGADLVYGQWDGGRLSVSSAASDSTALPNVSPSSGPASAIDGDSSTSWVSNAL
FT                   QTAVGQWLQVDFDHPVTNATLTITPSATAVGAQVRRLEVSTPNGTSTVRFERAGEPLTV
FT                   ALPYGEAPWVRITATATDDGSPGVQFGITDISVTQYDANGFAHPVNLRHTVDVPGPPPG
FT                   SAVAQWDLGSELLGRAGCAQSPTGTRCAAAMALAAEEPVNLSRTLTVPGPTPVTPTVWV
FT                   RGRQGPNLADLIAQPGRTRAVGDSDLIDVLGSAYAAADGDPGTAWTAPQRMMQPRTPPS
FT                   LVLKLPEEKEVSAIRVTPSSSPLPARPTLIAVDLGDGPQVRRMTAGAETFRLHPRTTDS
FT                   VTIWLLDWDDVIDRTALGFDQLKPPGLAEIVVLDDRGAPIGAADATANRARTVSLPCGR
FT                   GPVIGVAGEFVQTSVTTTVGALLDGRPIPARPCRTEPIPLPAGQQELLVSPGPAMIVDG
FT                   VQLATPRTGEVGSATTSPVSTGAWGSAHREVIVEGSGVSRILVVPESANPGWVARSADG
FT                   VALTPVAVNGWQQGWVLPAGTSGTVTLDFASNATYRAGLIGGLALLPLLLVLAFVPARR
FT                   PGPAAQPVHPWRPRPLAIAAGTAAAAGVISGFVGVVVACVAVGIRYLLRGRAGVRDALT
FT                   VGTAAFGLILAGAALSQNPWRSVDGYVGHSAGVQFLALLSVVAVAVSLVTFPDSRRVRP
FT                   REREDD"
FT   gene            complement(278929..279102)
FT                   /locus_tag="Mvan_0254"
FT   CDS_pept        complement(278929..279102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0254"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0227 small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11103"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q3"
FT                   /protein_id="ABM11103.1"
FT                   /translation="MDRFLVPAAASIVVGLLLGAAAVFGVTLMVQQDTKPPLQAGDPAS
FT                   SVLNRVEYGDRT"
FT   sig_peptide     complement(279025..279102)
FT                   /locus_tag="Mvan_0254"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.570 at
FT                   residue 26"
FT   gene            complement(279128..279616)
FT                   /locus_tag="Mvan_0255"
FT   CDS_pept        complement(279128..279616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0255"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0228 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11104"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q4"
FT                   /protein_id="ABM11104.1"
FT                   /translation="MTGPEPRDKKSVLVIAFDGSPTARRAVQYAGRFLTADRAVVLTVW
FT                   SPLDRGSDPGSYSYDLDGPPDPRDDDEIDIALAEAQRINDEGLELALAAGLPAEPLRRA
FT                   ATFTVWQAIIEAADELDADLIVTGTRATTGLRSLIQSSVADHVLRRGGRPVLIVPPEP"
FT   gene            279751..280953
FT                   /locus_tag="Mvan_0256"
FT   CDS_pept        279751..280953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0256"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mmc:Mmcs_0229 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11105"
FT                   /db_xref="GOA:A1T1Q5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q5"
FT                   /protein_id="ABM11105.1"
FT                   /translation="MANPRTAPEALVGVLAASALLVGCTSSTAPEPTPHVLHATPSMAA
FT                   GPALNLPAAPAPAAPACGDPAAIVASMSTRDKLAQRLMVGVTGAADARAVVDAHHVGGI
FT                   MVGSWTDLSMLSDNSLADIAATAAPLPPAVSVDEEGGRVSRLAGLIGAQPSPRRLAATS
FT                   SPEQVYQIALERGRKMRGLGITIDFAPVVDVTDAPDGTVIGDRSFGADPTAVVDYAGAY
FT                   ARGLRDAGVLPVLKHFPGHGSGSGDTHAGSVVTPPLGDLVARDLVPYRTLTTQGPVGVM
FT                   VGHMEVPGLTGSEPASLSPPAYALLRSGDYGGPPFGGPVFTDDLSGMQAITDRLGVADA
FT                   VLRSLQAGADVALWLSTAEVPAVLDRLEQAVAAGELTMPRIDEAVTRVIAMKGPSPRCG
FT                   G"
FT   sig_peptide     279751..279942
FT                   /locus_tag="Mvan_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.350 at
FT                   residue 64"
FT   gene            281018..281647
FT                   /locus_tag="Mvan_0257"
FT   CDS_pept        281018..281647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0257"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0236
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11106"
FT                   /db_xref="GOA:A1T1Q6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041669"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q6"
FT                   /protein_id="ABM11106.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVEIFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEELFGACLNRELGRFVDEVNSNIDFSAAPKELLRTAVLAFLKYIDANR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIELVGRLLRSGTKFPEPDTDFELMAVALVGAG
FT                   EAIASRVSTGDADVDEAAELMINLFWLGLKGAPSAADVDATAVISS"
FT   gene            complement(281634..282488)
FT                   /locus_tag="Mvan_0258"
FT   CDS_pept        complement(281634..282488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0258"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmc:Mmcs_0239 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11107"
FT                   /db_xref="GOA:A1T1Q7"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q7"
FT                   /protein_id="ABM11107.1"
FT                   /translation="MNESKQPSGLKNLALAVAGALPLVPRGDTLPTRTLTVEDLTIDPV
FT                   NVAEYANVTGLRFGNTVPLTYPFALTFPTVMALLTGFDFPFAAMGSVHLENHITQYRPI
FT                   AVTDTVSVGVHAENMREHRRGLLVDVVTDVKVGNDPAWHQITTFLHQQRTSLSDQPKPP
FT                   PQKQPKLPPPNAVLRITPAQIRHYASVGGDHNPIHTNAIAAKLFGFPTVIAHGMFSAAA
FT                   VLANIEGQLPDAVKYSVRFAKPVVLPARAGLYVDRSADAWELTLRHLTKGYPHLQATVT
FT                   SLR"
FT   gene            complement(282491..283930)
FT                   /locus_tag="Mvan_0259"
FT   CDS_pept        complement(282491..283930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0259"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mpa:MAP3692c FabG4"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11108"
FT                   /db_xref="GOA:A1T1Q8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q8"
FT                   /protein_id="ABM11108.1"
FT                   /translation="MDATVLGNPITVDNDVPRSSKGSAVASDLLSQVVNSGPGSFLAKQ
FT                   LGVPQPEPLRRYKQGEPPLAGSLLIGGSGAAGGGRVVEPLRAALADDYDVVANNLGGRW
FT                   ADSFGGLVYDATAITEPEGLKGLYQFFTPLMRNLGHSGRVVVIGTTPEETGSVHERTAQ
FT                   RALEGFTRSLAKELRNGSTASLVYLSPDAKPAATGLESTLRFLLSGKSAYVDGQVFRVG
FT                   AADATPPADWDRPLEGKVAVVTGAARGIGATIAEVFARDGAKVIAVDVEGAAEALAETA
FT                   TKVGGTALTLDVTAADAVDRIAEHVREHYEGRLDILVNNAGITRDKLLANMDEARWDSV
FT                   LAVNLLAPLRLAEGLVASGLIGDGGRIIGLSSMAGIAGNRGQTNYAATKAGMIGLTDAL
FT                   APQFAEKNITINAVAPGFIETKMTDAIPFATREVGRRLNSLFQGGQPVDVAEAIAYFAS
FT                   PGSNAVSGNTIRVCGQAMLGA"
FT   gene            283966..285306
FT                   /locus_tag="Mvan_0260"
FT   CDS_pept        283966..285306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0260"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: mmc:Mmcs_0241 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11109"
FT                   /db_xref="GOA:A1T1Q9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Q9"
FT                   /protein_id="ABM11109.1"
FT                   /translation="MTLDTPSVSREADVADTNTTRRVAILGGNRIPFARADGAYAKASN
FT                   QDMFTATLDGLADRFNLKGEKLDAVIGGAVLKHSRDFNLMRECVLGSSLSSATPAFDLQ
FT                   QACGTGLQAAIAAADGIARGRYEVAAAGGVDTASDAPIAFGDDLRRVLLGLRRAKSNVE
FT                   RLKLVGKLPAALGVEIPVNSEPRTGMSMGEHAAVTAKEMGVKRVDQDELAAASHRNMAA
FT                   AYDRGFFDDLVTPFLGLYRDNNLRADSSVEKLAKLRPVFGVRSGDATMTAGNSTPLTDG
FT                   ASVALLSSEEWAAEHSIPVLAYFVDGQTAAVDYVNGRDGLLMAPTYAVPRLLARNGLTL
FT                   QDFDFYEIHEAFASVVLATLAAWKSDEYCKERLGLDKALGSIDRSKLNVNGSSLAAGHP
FT                   FAATGGRIVAQLAKQLAEKKAETGKPVRGLISVCAAGGQGVTAILEA"
FT   gene            285447..286376
FT                   /locus_tag="Mvan_0261"
FT   CDS_pept        285447..286376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0261"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: nfa:nfa26250
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11110"
FT                   /db_xref="GOA:A1T1R0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019910"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R0"
FT                   /protein_id="ABM11110.1"
FT                   /translation="MQISMFGQISGLGGNPIDATIAYLSQLRDEGFARVWISQLPYEPD
FT                   LLTILAVALREVDTIEVASGVVPIQNQHPMQMAQRALTVSLASGGRFILGLGMTHAAVT
FT                   EGMWGIPWDRPVRRLNEYLDGLLPLLAGEPANATGETVTTRGALVIPGAPRPDVYIAAL
FT                   GPQLLRVAGRRTAGTCTWMTGPATLRDHVSPALRQAAADAGRPPGSVRVVASLPVAVTD
FT                   DVEAARKQAAEQFAVYGTLPSYRAMLDREGYAGPEDAAIIGDEATVRDRLAELAEAGVD
FT                   EYVGAVFDSSAEGRDRTRALLRDMRSGG"
FT   gene            286551..287948
FT                   /locus_tag="Mvan_0262"
FT   CDS_pept        286551..287948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0262"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; KEGG: nfa:nfa22880 putative two-component
FT                   system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11111"
FT                   /db_xref="GOA:A1T1R1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R1"
FT                   /protein_id="ABM11111.1"
FT                   /translation="MVWPAPPSRRWAPLSRLPSPPDQHGGVTVPTSPPTDPTTVTDMPP
FT                   TRTGTDWPRLLLAPVAPAAWRAYLYVHLVSVLAIVDIAFLFAAGLASALMILTVIGIPL
FT                   LALLVMSGRAWNRLYRALAQLVGAQIDAPPEFERPAGRLQVVTAALTDSVGWRSLGFLT
FT                   LHAVLMTPIGFAVVVGVVASALLIVSPVVWLVTGEPFISLVEPVDSLAVYVVLSVAGVL
FT                   ALYLLGWVMIGISRVHVRVAAALLGPTGRERRVAQLENARAGVVDDAAARLQRVERDLH
FT                   DGTQARLITVAMALARADEHLAEAGDTAQARMLVSDALANTKDTLAELRDLIRGIRPPA
FT                   LDLGLGPAIHTLAARNPIPVDVTVDLSVRPSIGVETMAYFCVAELLANVSKHSGAGAAA
FT                   VRVAGDATELRIDVEDNGSGGVQVGNGSGLTGLAERLAMVDGRLEIDSPAGGPTVVTVV
FT                   VPPGAGQ"
FT   gene            287945..288589
FT                   /locus_tag="Mvan_0263"
FT   CDS_pept        287945..288589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0263"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: nfa:nfa22890
FT                   putative two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11112"
FT                   /db_xref="GOA:A1T1R2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R2"
FT                   /protein_id="ABM11112.1"
FT                   /translation="MTRIVIAEDSAILREGLAQLIAERGHDVVAAVGNADDMLGAVREF
FT                   APDVVVVDIRMPPTFTDEGLVAAVSLRRSHPEVGVLVFSQWVETRYATELLAGNAEGVG
FT                   YLLKDRVADIAEFDAALQRVAARGTALDPEVVRQLMGSRGTSALDRLSPREREVLALMA
FT                   EGHSNLSLARQLSITERSVEKHVSAIFTKLDLAPSQAHHRRVLAVLTYLDS"
FT   gene            288611..288880
FT                   /locus_tag="Mvan_0264"
FT   CDS_pept        288611..288880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11113"
FT                   /db_xref="GOA:A1T1R3"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R3"
FT                   /protein_id="ABM11113.1"
FT                   /translation="MTALNVAQLLTFVAFLGLAAYAVFAPRDANAAKRRRQARLYSGWA
FT                   LIAGAAFMAAIAADRVGWSRYVFGAIALAVLVGAAVAFAKNREK"
FT   sig_peptide     288611..288706
FT                   /locus_tag="Mvan_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.924 at
FT                   residue 32"
FT   gene            complement(288980..290815)
FT                   /locus_tag="Mvan_0265"
FT   CDS_pept        complement(288980..290815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0265"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mpa:MAP3694c FadE5"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11114"
FT                   /db_xref="GOA:A1T1R4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R4"
FT                   /protein_id="ABM11114.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKALGQGSYSDLDADTAVEMLGEM
FT                   ARLAEGPVAASFEDGDRNPPVFDPKAHTVTLPESFKKSVRAVIDGGWDKIGVDEELGGT
FT                   PMPRALFWAIQEHILGANPAVYMYAMGAGFADIFYHLGTDEQKKWAKLAADRGWGSTMV
FT                   LTEPDAGSDVGAGRTKAVQQPDGTWHIDGVKRFITSADSDDLFENIMHLVLARPEGAGP
FT                   GTKGLSLFFVPKFHFDPETGEPGERNGVFVTNVEHKMGLKVSATCELSLGQHGVPAVGW
FT                   LVGEVHEGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKERVQGADLTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATHQDAEVAKALYGIEPELALKVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTLGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGVALAHVAGQIEQFVKAETGNGRLKAERALLATALEDVQGMAASLTGYLMA
FT                   SQEDAKSIYKVGLGSVRFLMSVGDLVLGWLLQQQAAVAIEKLDAGAQGDDRAFYEGKVA
FT                   VASFFAKNFLPLLTSTRSIVENLDNEVMELDEAAF"
FT   gene            291056..292144
FT                   /locus_tag="Mvan_0266"
FT   CDS_pept        291056..292144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0266"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   nfa:nfa27230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11115"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R5"
FT                   /protein_id="ABM11115.1"
FT                   /translation="MGATTAVAVWGTGNMGATAIRSVTAFPGLHLAGLITSSEDKAGRD
FT                   AASFARLDAPTGISASTDVDAVLADCHAVAYMASGDIRPDEAVADIERCLRAGVHVVTP
FT                   SLYSLYDPRSAPPEWVQRLTGAAEDGRAALLVSGVDPGWANDALAVTAAGLCTRINTIT
FT                   CQEIFDYSTYDQPYAVRVSCGFGGPMDETPMMLLPTIPTMVWGGNIRLIGRGLGLEIDE
FT                   ITEEVERLPLADSVDTVMGRFDEGTQGAFFLRVIGWSGGRQRVIVEHITRIDPSCAPHW
FT                   PQPDQGVGDHRVIVDGDPQLTIVTRADVPGGTRADGGNTTAANRLLGAISWLAAQKPGI
FT                   YDGLDVPLHPPLAPELEATRWS"
FT   gene            complement(292141..292932)
FT                   /locus_tag="Mvan_0267"
FT   CDS_pept        complement(292141..292932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0267"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0271 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11116"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R6"
FT                   /protein_id="ABM11116.1"
FT                   /translation="MTKSVFITGAATGIGRATALLFAQRGYRVGGYDIDEAGLRLLAAD
FT                   ITAVGGRPVVGRLDVTDADEVAHRLAEFVDAAGGRLDVLINNAGLLQAGRFEDIPLPVH
FT                   HRAIEVNVKGVVNGLHAAFPYLRDTPDAVVVNLSSASAIYGQVELANYSATKFYVRAIT
FT                   EALNLEWAQHGIRVIDMWPLYVNTAMTQGVKTGTTQSLGIRLTAQDIARDIVTAVEATW
FT                   PRRLVKQVHFPVGGQAKALALGSRFSPAWLTRLINKRLAGS"
FT   gene            complement(292952..293443)
FT                   /locus_tag="Mvan_0268"
FT   CDS_pept        complement(292952..293443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0268"
FT                   /product="TspO and MBR like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: xcv:XCV1865
FT                   putative tryptophan-rich sensory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11117"
FT                   /db_xref="GOA:A1T1R7"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R7"
FT                   /protein_id="ABM11117.1"
FT                   /translation="MVADASPTRPKSWLALTISIVAVVAASTIGGLASRTAADDYGRLQ
FT                   QPGFAPPSWVFGPTWTVLYLLMAVAAWLVWRTGPSPETRRALTWYAVQLVLNTAWTPLF
FT                   FGLGWRGIAFAELSVLLVVLIATVVLFWRRSAIAGAMLLPYLAWSGFALCLNFAVWQLN
FT                   "
FT   sig_peptide     complement(293327..293443)
FT                   /locus_tag="Mvan_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.837 at
FT                   residue 39"
FT   gene            complement(293453..304483)
FT                   /locus_tag="Mvan_0269"
FT   CDS_pept        complement(293453..304483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0269"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase,
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR; KEGG: mmc:Mmcs_0244 beta-ketoacyl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11118"
FT                   /db_xref="GOA:A1T1R8"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R8"
FT                   /protein_id="ABM11118.1"
FT                   /translation="MGSAEHPNGPAPRFAIVGYAARFPGAPDADAFWDVLREGRDAISD
FT                   VPRDRWDAEEFFDPEPGAPGKVVTRRAGFVDDVTGFDAPFFGMSTREVRMMDPQHRLLL
FT                   ETAWRAVEHSGTAPTALAGSNTGVFVGLATHDYLGMASDELTYPEIEAYMAIGTSNAAA
FT                   AGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALRLGECDLALAGGANVLLTPATMIT
FT                   FSNAHMLAPDGRCKTFDAAADGYVRGEGCGVIVIKRLEDAVRDGDRIRAVIRGSSINQD
FT                   GASGGLTVPNGVAQQRVIADALKRSDLEPKDVGYLEAHGTGTSLGDPIEAQAAGAVLGA
FT                   GREPSRPLLIGSAKTNIGHLEAAAGIAGVIKVILSLEHRTLPKHLNFENPSPHIPWDRL
FT                   AVEVVKETIPWERDGGPRIAGVSSFGFAGTNAHVILEEAPEQAAAPGPVQQPDRRFSLL
FT                   PLSARTPAALTQLAGQYRDWWTAHPEATLADVCFTAGAGRAHLEHRAALVVNSAESAVE
FT                   LLGALADDRPAPGLVRGESHDTPKTAWLFTGQGSQYPGMARELYDTEPVFAETLNRCAE
FT                   AVADVLEKPLLDVIFDAEADDAEKTLQNTCYAQPALFAVEMGLARLWQSWGFEPDVVLG
FT                   HSVGQYSAACVAGVFSLTDGARLMAERGRLFGSLPEGGRMVAVFTTAERAEAMTDEFPS
FT                   LSVAAYNGTNTVLSGPAGDLEKAVATLSADGVRCDWLDTSHAFHSALLDPILDDFESYA
FT                   NQFDFAAPQRILIDNRTGTALGRSVQLDGTYWRRHARQPVEFAKSVRTLAEMNCKLLVE
FT                   IGPRPVLTAAALGAWPDPATAPRVIASLRRTAADHRQITEAVADAYVLGHLPEFGAFRD
FT                   AGARKLDLPTYPFEHRQYWFRDNQDPDGSEALQPRTPSTEAVRLLEDGRIEELATLLDG
FT                   AAGDQQTLDVLSRLAAQHNQQRSSQSITNDRYEIRWEQSAAALSGAETDEVSSWILVGD
FT                   DTEATRPLVDVLSARGQRYRIFGLPVSDADEEQLGEALRLAAAEDSTLRIVHVGGLDSD
FT                   PDPGTAPSMRSLLRMQHRILGGTRRLFRAAAAAELRTPIWVVTRRAQHVTATDTVAPDQ
FT                   SCLWGFGRAAALELPQLWGGLADLADGTADEWSRLLNRITAPHGPAVREDQIALRDHAV
FT                   YVPRLVRRAGRPAGKPLQLRDDATYLVTGGLGSIGLEIAGYLAAHGARHLVLTSRRAPG
FT                   DATQQRIDALGAQHSCQIRVVAADVADAHDVARLLAAVAAELPPLAGIVHAAGEIGTTP
FT                   LVSLEDSEVDRVFAGKVWGAWHLSEAAADLQLDFFLGTSSIASVWGGYGQTAYGAANAF
FT                   LDGLAWRLREQGISGVSINFGPWSAGMADAESRARLDQRGVRTLSPADALAGLADVVTA
FT                   AEAPGPAQGIVARIDWERFLPLYQQAGRRAFLAELEREVPDTAPAATPSGRTELVERLT
FT                   NAPVQQRKKLLTDYLRTAVAEITRVDATEIREDAGFFDLGMDSLMAVELRRRIEQGVGR
FT                   EIPATLAMDHPRLSDVADYLLGEVLGLAEQAPAKAGSQPASAAANRTDEPIAIVAVSCR
FT                   FPGAPDPEAFWEVLAGGVDAIREVPEDRFDIDEFYDPDPDAAGKTYTRFGGFLDGIDGF
FT                   DPEFFGISPREAVWIEPQQRLMLETVWEGLERAGLAPADLRGSRTGIFVGVAANEYAHL
FT                   LSSESIEKIEPHFITGNALNAISGRVAFALGLEGPAVAVDTACSSALVAVHQACQALHS
FT                   GDCDLALAGGVNVLLSPVTSVAASRARMLSPVGRCKTFDASADGYVRSEGCGILVLKRL
FT                   GDAVRDGDRVCAVIPSSAVNQDGASSGLTVPNGGAQQRLIGMALARAGLSGGDVDYLEA
FT                   HGTGTPLGDPIEVQAAAAAYGASRDADRPLLMGSVKTNIGHLESASGAAGLIKVVLSLQ
FT                   HNLLPQSLHFENPSPHIPWDSLPVRVVDKAIPWQADGRPRRAGVSSFGFTGTNAHVLIE
FT                   EAPLPQAADPVEEPDTRALPVGVLALSARSPEALTALAQRYEAWLSAHPDADLADVCRT
FT                   AGTGRSHFEHRAALVVDSVAAAREGLAELAQNRLRPGVVRGEHTHHPTTAWLFTGQGSQ
FT                   FPGMARELFETEPVFADAVTRCADAVKDILPRPLLEVLFAADRESGEALRHTSFAQPAI
FT                   FAVEMGLARLWQSWGIEPDVVLGHSVGQYAAACVAGVFSLEDGARLMAERGRMFGSLPE
FT                   GGRMVAVFTDAKLVEEIAGDFPRVSVGAYNGPNTVLSGPGEDLEQIVDRFGDDGVRCTW
FT                   LQTSHAFHSELLDPVLDEFESYAAQFQFATPTLPLVCNRTGTVLTAQTPLDAQYWRRHS
FT                   RQPVQFAESVRTVAALGCSVLMEIGPQPVLTGSAVQVWPEHLAAPRAIVSLRKGVSDRR
FT                   QITEALAAAYVGGHRPDFGALYRRPGRAVALPTYPFQRRRFWPKTSGITTDGPAVSGIL
FT                   GSAKDLASGDTVYTSRWSVRSQPWLADHVIYGTVVVPGATYAAMALAAVGTPARVKDVF
FT                   FYEPIILPEKASREVQLTLHPSEDGGQKFQVHSREYGERGTEWSLNAEGTVASGVDENP
FT                   QAEPSGPVDEAIERLNRMRPQDLFETFADMELAWGPTWSGSLKSLWLGEGEAIGDILVG
FT                   EELAEQLGTEPMHPVLMDLCTGVAFPAFPALLAAEQGVSDLFLPLRYGQVTLRDKMPRR
FT                   FYCRATWHTSELDSETQVFDLDFLDRDGRHLGGIREFTVKRAPREALLRGLGGDATRLL
FT                   YTLGWHEVPAPASGDAALNGNWLIAGFDELAAGVPGCIPFDRSTDPEPLGQLLAQAHER
FT                   GIGFSGVVWRAAAPSADESSTAMAARIETEIADLLSAVHTVQNGAVKLPGGLWIVTERA
FT                   VATESGEPVDPVQAALWGFGRTTINEEPALRCRLVDVDGSPEAVLALAGLLAAPVDEPE
FT                   LAVRQGKLLASRLLPWARSGHLTVPRSADYVLAPTERGAIDNLRLTETDVAPPAEGYVQ
FT                   VRVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGTVTQLGSGVTGLEVGQRVYGFMQGAF
FT                   ASRFNVPAQLLAPIPDGIGAVDAATIPAAALTARLAFDWAQLKPGDRVLIHAASGGVGL
FT                   AAIQMAQQHGAVVFATASTYKRATLRKLGVDHVYDSRTTEFADQILADTDGEGVDVVLN
FT                   SLTNEGFIEATVRATAQNGRFAEIAKRDIWTPEQMAAARPDIAYEIVALDTVTLLEPER
FT                   IRGLLGEVSDGLGKADGSSRAEWVPLPAEIYPLTEARAAFRRMQQARHVGKIVLQMPKP
FT                   LQPRADRSYLITGGLGAIGLHTAAYLAQLGAGDLVLTSRRAPDADARRAIEEITERYKC
FT                   RVHTFCADVGDESQVAELLARIRAELPPLAGVAHLAGVLDDALLSQQSLERFRTTLAPK
FT                   AFGACHLDRLTAGDDLDFFIMSSSVSSLFGSPGQANYATANALLDGLTAHRRARGLPAT
FT                   GVNFGPWAQGGMASSEAATANIGAQGLVPLEPSAALGALAEVLANGTGQAAVLKANWQR
FT                   AAKVLGSSRPPILDLVLPRPEGEVAGDSELLRQLQEIPVAQRAGFVTEFLQREVQNFLR
FT                   LAQPPAATSRFLDLGTDSLMAIELRNRLHSQFGGAFTINATAVFDYPTIGGLAEYLVGQ
FT                   LPDSDAAAGETPATETSPIDHNHPDREADSPG"
FT   gene            304714..306135
FT                   /locus_tag="Mvan_0270"
FT   CDS_pept        304714..306135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0270"
FT                   /product="condensation domain protein"
FT                   /note="PFAM: condensation domain protein; KEGG:
FT                   mmc:Mmcs_0245 PapA3_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11119"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1R9"
FT                   /protein_id="ABM11119.1"
FT                   /translation="MRIGKITVGALDEWSLNPGSVTSWHPTAAAVETARRAQVSSVPVS
FT                   YMQGQHLRNYWERTTAGLNFSRQIIASCEVPGQCDIAAMDHAVNAYLRRHDTFRSWFER
FT                   TEEGEFLRRAIADPADIEFVPIEHGDMTVDEIFAHVVDIPSPLEWGCFTFGVIQHDGHF
FT                   TFFASMDHVHGDATLIGTTMMEANGMYSALSGGGAALTLPDAGSFDEFCVRERAHTSEL
FT                   TEDSPEVRAWIEFAENSGGGFPEFPLPLGNPAESTRSCMTSEILMDTAQTERFESACTA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRSASDNFMTQGWFTGLIPITVPIGA
FT                   TSFADAAWAAQASFDSNLFMAKVPYYRVLELAPWLSWPRPNFPVSNFFHGGAAPLNAIL
FT                   AAADMGLANNIGIYPDGRFSYQLTIYIFRYGEGTVMAIMHPDNPVAKKSVTRYMKVMKS
FT                   VAGLVADSGTWGLVA"
FT   gene            306163..309165
FT                   /locus_tag="Mvan_0271"
FT   CDS_pept        306163..309165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0271"
FT                   /product="Transport protein"
FT                   /note="TIGRFAM: Transport protein; PFAM: MMPL domain
FT                   protein; KEGG: mmc:Mmcs_0246 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11120"
FT                   /db_xref="GOA:A1T1S0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S0"
FT                   /protein_id="ABM11120.1"
FT                   /translation="MRRLADLVVRWPWAVIAVWVAMAVALPLSFPSLGEMAQKHPLVIL
FT                   PSDAPSSVTAAKMAEAFQETSNDNLLLVAFINETGLEPADEATYRKVVDALRDDVTDVV
FT                   SVQDFVSTPQLRQFLTSEDKTTWVLPVSLEGELGTPRAFDSFNRVSDVVKHHLGDGPLQ
FT                   VYLTGPAATVADLTVAGEQDRLPIEIAIAVLVLGVLLLVYRSAVTMLLPLVTIGSSLVI
FT                   AQAVVAGYSQLSGSGVSNQSIVFLSAIMAGAGTDYAVFLISRYHDYLRSGADFDDAVRA
FT                   AMISIGKVITASAATVGVTFLVMSFAQMGVFRTIGVSSAIGIGVAFLAGMTLLPAILVL
FT                   AGPRGWVKPRRELTARFWRRSGIRIVRRPVPHLVASVLVLILLAGCAAFATFNYDDRKA
FT                   VAASAPSSVGYAALERHFPISQSIPQYILVQSPRDLRSPQALADLEQMASRIAQLPDIS
FT                   LVSGVTRPLGEVPREFRATFQAGLVGDRLAAGSAQIGARDDDLDELTTGADTLADTLVD
FT                   VRAQVNKIAPSLQTLLDAVTRVRVEYGGDRLVRDVETAAKLVQSVNELGLSMGISFAAV
FT                   RDMFGWIGPVLAALHGNAVCDANPSCVNTRMQFERLMDARADGRLERINTLAGELEGLD
FT                   DTQSLNSTVKTLNAAMTNIVKAVDELGLDSPGGAQTSLRDIRQGTDRLASGSRQVAGGV
FT                   DQLVEQVRVMADGLNQAAAFLLTMRHDAASANMAGFSIPAEVLNAVEFQKAAEAFISPD
FT                   GHSVRYLVQTRLNPFSPEAMDQVNVINDIARGAQPNTSLADASISMGGFPAALRDTRDY
FT                   YERDIRFIIIAALIVVLVTLSVLLRSLVAPLYLVGSVVVSYFAAIGIGVLTFQLLLGQQ
FT                   LHWSVPPLAFVVLVAVGADYNMLFVSRLRDESPHSVRYGVIRTLGSTGGVITAAGLIFA
FT                   ASMAGLLFSSIGIVVQGGFVIGVGILLDTFVVRTITVPAIAALVGRANWWPSKVGPQQA
FT                   APRAVESAGSG"
FT   sig_peptide     306163..306276
FT                   /locus_tag="Mvan_0271"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.793) with cleavage site probability 0.424 at
FT                   residue 38"
FT   gene            309258..310979
FT                   /locus_tag="Mvan_0272"
FT   CDS_pept        309258..310979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0272"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0247 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11121"
FT                   /db_xref="GOA:A1T1S1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S1"
FT                   /protein_id="ABM11121.1"
FT                   /translation="MTSQSSILSMLHGRASMRPGDVAFTFTDYAVDPAGVRQTLTWSQL
FT                   SIRTLNLAREIRRHGAVGDRALILAPQGLEYILAFLGSMQAGLVAVPLPLPHPGSGHDR
FT                   VGAVLHDTEPSVVLTTSATANDVGDYVASSRLDAAPTIVEVDALDLDAGGGLSLEPADL
FT                   PSIAYLQYSSGSTRLPAGVMLSHRNLTVNFEQLMRSFFAEKPLPPDATLVSWLPFYHDM
FT                   GLVLGVCAPILCGRRAELMSPVSFLEKPSRWMRALAENPHAWSSAPNFAFDLAARKTTD
FT                   ADLAGLDLGGVVGIISGAERVEPATLHRFVDRFAHFNFQDHMMRPSYGLAEATVFVASG
FT                   VWSESSPAAHFDTEGLAAGRVQPCAAGKGTALVKYKVPQSPLLRIVDGDTHRECPSDVI
FT                   GEIWVHGENVAAGYWNKPSEDQSCFGATLVDPAPGVPDGPWLRTGDLGFIDGGELFIVG
FT                   RIKDLLIIRGRNHYPEDIEATVQEITRGRVAAISIPVNSTEKLVTVIELKKPAHLGELS
FT                   EVKSDVTAAISNAHGLNVEDLVLVPSGSIPTTTSGKIRRAACVEQYRQDQFVRLDA"
FT   gene            complement(311224..312624)
FT                   /locus_tag="Mvan_0273"
FT   CDS_pept        complement(311224..312624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0273"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_2471 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11122"
FT                   /db_xref="GOA:A1T1S2"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S2"
FT                   /protein_id="ABM11122.1"
FT                   /translation="MGTGTGGVVRQSDRLEVCFEELAELAGQRNAIDGRIAQIAAEIDG
FT                   AGLWAITGVKSLEGLLAWKLGTSFRNAETIVAVARRLEQFPRCSRDLREGRLSLDQLGV
FT                   IAERAGAGSDDHYADLAAHSTVAQLRTAVKQEPRPEPEPDPESESGADCDPESESEAKP
FT                   RRDPAPRASITKTSDEQYTYWRIALPHEEAATFDTALRSHHEALVAQWKRDHNITDHTD
FT                   DHNHDINSDPGHGDGRDITNPGPDYDGGGGEGVGRAPLPDTVAAFWALVKAGWDVEVAR
FT                   RPHGQHTTVVMHVDVKDKIASLHLGPALSAAERRYLSCDATCEVWFERHGQVIGSGRTT
FT                   RAISRRLRRALEHRDRTCVVPGCGATRGLHAHHIRHWEDGGLTELDNLVLVCPHHHRLH
FT                   HRGVITITGPADQLTVTDSVGRHLEPGSLARPPTQSPPAVAPYQGPPGERAQWKWYTPF
FT                   QPPPPTTN"
FT   gene            313106..313531
FT                   /locus_tag="Mvan_0274"
FT   CDS_pept        313106..313531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0274"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: rha:RHA1_ro00170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11123"
FT                   /db_xref="GOA:A1T1S3"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019965"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S3"
FT                   /protein_id="ABM11123.1"
FT                   /translation="MPIRFNGFDELRRYEHCLVVTYRKDGTPMPQPVWPGYDGDRVYLW
FT                   TEVQAYKAKRLRRNPEALIAPCSFRGKPLAPPIAARGRILETAAERAHAEAVIRSQWGW
FT                   KRKAFAAASRPLTDVHYIELVPLTSATADTPATEDRA"
FT   gene            313528..314109
FT                   /locus_tag="Mvan_0275"
FT   CDS_pept        313528..314109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0275"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3635
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11124"
FT                   /db_xref="GOA:A1T1S4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S4"
FT                   /protein_id="ABM11124.1"
FT                   /translation="MSPRTSDARERMLDSASTLIREHGASGTSLDDILRHSRAPRGSVY
FT                   HHFPGGRAQLIEEVVDRAGGALAAILGDAGDATPATTFDVFISTWKAGLEASGFRAGCP
FT                   VLAVAVETNDDAPQLTEAAARAFGSWRDALNTVLRHQGVPPARARRLATLIVAAVEGAV
FT                   ALSRVERNTQPIDDVARELRALIRQATDAS"
FT   gene            314202..315368
FT                   /locus_tag="Mvan_0276"
FT   CDS_pept        314202..315368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0276"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0248 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11125"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S5"
FT                   /protein_id="ABM11125.1"
FT                   /translation="MQPSRSGWCVKAMKRLLAFGTALTTIGAAGCLGFGIAAADEAPAV
FT                   PPSPTPADAPPPLGTPGRAYALGGAHVLGIPYDEYIMRTGADWFPGLDRQIVDYPAGQV
FT                   QGHTLERLFPGIGRLDDSFPGIGIDGPSVGESVDVGTPNVITAIREGGRGTAIGLSEGA
FT                   MVLNDVQAKLAYDPAAPPPDQLSFAMYGDPVARHAFGESFLTQNFPVGSVVPSLDYRIP
FT                   PPVESQYDTYQFVSAYDSIADWPDRPDNWISVANAIVGLATGHTAVAFTEPSMVPPQNI
FT                   RTTVNSRGAKTTTYMIPEEHLPLVLPFKYLGVPTETLIELDAVLKPFVDAGYSRNDDPL
FT                   TAPITVDPVNGYDPAEVTAPATQAAFGGAADPVSQLLSGLQYVLNNPP"
FT   sig_peptide     314202..314321
FT                   /locus_tag="Mvan_0276"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.399 at
FT                   residue 40"
FT   gene            complement(315383..316045)
FT                   /locus_tag="Mvan_0277"
FT   CDS_pept        complement(315383..316045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11126"
FT                   /db_xref="GOA:A1T1S6"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S6"
FT                   /protein_id="ABM11126.1"
FT                   /translation="MWFPLLVMAAAVSLEPFRIGMTVVMVNRPRPVLQLLSFLAGGFVM
FT                   GTAVGLIVLFVLRPALGSAHFTLPRVQLGVGAVVLVNAVLLATGVLGGNRDGTAAGRWA
FT                   PLVTRARRLLEGRSLWTAGVAGLGIALPSIDYLAALALIVASGAAAAVQFSALIVFNVV
FT                   AFALVEIPLLCYLVAPDRTRAALSSLYEWVRAQGRRGVSLLLAVVGCVLVAVGFAGL"
FT   gene            316143..316346
FT                   /locus_tag="Mvan_0278"
FT   CDS_pept        316143..316346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11127"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S7"
FT                   /protein_id="ABM11127.1"
FT                   /translation="MTALSTALPVVDLRDDLDTLRDQLRRVARGVTADPSDERIFPVYG
FT                   RKAWKSRLRAHPDVAAAHGYVG"
FT   gene            316355..316858
FT                   /locus_tag="Mvan_0279"
FT   CDS_pept        316355..316858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0279"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mmc:Mmcs_0250 flavin reductase-like, FMN-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11128"
FT                   /db_xref="GOA:A1T1S8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S8"
FT                   /protein_id="ABM11128.1"
FT                   /translation="MSGSGTHSQTNLDAASLREAFGHFPSGVIAIAAEVDGARVGLAAS
FT                   TFVPVSLDPPLVSFCVQNTSTTWPKLKDVPYLGISVLGEAHDAAARTLAAKTGDRFAGL
FT                   ETASSARGAVFIHGTSVWLESSIEQLVAAGDHTIVVLRVSDITVHPDVPPIVFHRSTFR
FT                   RLGA"
FT   gene            complement(316880..317041)
FT                   /locus_tag="Mvan_0280"
FT   CDS_pept        complement(316880..317041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0280"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11129"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1S9"
FT                   /protein_id="ABM11129.1"
FT                   /translation="MSLREPHSINDIRTAIRELSTRADLARKEGRNADAAELDQRVKNY
FT                   REELAARP"
FT   gene            complement(317127..318899)
FT                   /locus_tag="Mvan_0281"
FT   CDS_pept        complement(317127..318899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0281"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   nfa:nfa40720 putative acyl-coA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11130"
FT                   /db_xref="GOA:A1T1T0"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T0"
FT                   /protein_id="ABM11130.1"
FT                   /translation="MPETPLLLDPNNFDPKRLDPESRRLLAALIDWFEQRGKVRLLRDD
FT                   LNAEWVTDFLDFVRRERLFATFLTPSEFANGDPNKRWDTSRNAVLSEILGFYGLSYWYA
FT                   EQVTILGLGPIWQSGNVKAKERAAEQLEAGGVMAFGLSERDHGADIYNTDMLLTPAGDE
FT                   RSREEQTTADGDDDGVLFRASGEKYYIGNGNVAGMVSVFARRTDVEGADGYVWFVADSG
FT                   HERYELIGNVVHGQMFVSNFALHDYPVHEEDILATGPDAFSAALNTVNVGKFNLCSGSI
FT                   GMCEHAFYEAINHANNRILYGNPVTAFPHVRAGFVDAYTRLIAMKLFSDRAIDYFRSAG
FT                   PDDRRYLLFNPVTKSKVTSEGEKVVTLLWDVLAAKGFEKNTYFYQVTRLIGALPRLEGT
FT                   VHVNVAQILKFMPNFMFNPAPYPEIGTRDDPADDVFFWSQGPARGASKVRFADWAPVYE
FT                   RNTGIPNVAVFYQQVQAFKDLLATAAPDADQQRDLDFVLVVGHLFTLVVYGQLILEQAE
FT                   LTGLESDLVDQIFDVQIRDFSAYAVALHGKPSSTLEQQEWALSAVRKPTVDAVRFDRVW
FT                   DQVRSYDGAYEMRP"
FT   gene            complement(318972..319415)
FT                   /locus_tag="Mvan_0282"
FT   CDS_pept        complement(318972..319415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mtc:MT1786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11131"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T1"
FT                   /protein_id="ABM11131.1"
FT                   /translation="MTQTDDGAERAVVGSLRTQNSYVVAGSIATTDSAVVAGSIATAGS
FT                   AAVAGSIATAGSAAVARSIATAGSAAVAGSIATAGSAAIAGCILVVLSIACRGCLACLG
FT                   CIACIKCKACVGCIDCEDCIGCVGCVNCSGLRNAVGLRNVHAA"
FT   gene            complement(319445..320200)
FT                   /locus_tag="Mvan_0283"
FT   CDS_pept        complement(319445..320200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0283"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mmc:Mmcs_0252 succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11132"
FT                   /db_xref="GOA:A1T1T2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T2"
FT                   /protein_id="ABM11132.1"
FT                   /translation="MAAYQGKLRVWRGDDTGGGLQDFTVEVNDGEVVLDIIHRLQATQT
FT                   PDLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSTFGEDEVVTVTPLRTFPVMRDLVTD
FT                   VSFNYEKAREIPSFAPPKNLQPGEYRMAQEDVNRSQEFRKCIECFLCQNVCHVNRDHEE
FT                   NKLAFSGPRYLMRQAELDMHPLDTHGHRAEQAQDENGLGYCNITKCCTEVCPEHIKITD
FT                   NALIPMKERAADRKYDPVVWLGNKLFRRR"
FT   gene            complement(320203..322086)
FT                   /locus_tag="Mvan_0284"
FT   CDS_pept        complement(320203..322086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0284"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: mmc:Mmcs_0253 succinate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11133"
FT                   /db_xref="GOA:A1T1T3"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T3"
FT                   /protein_id="ABM11133.1"
FT                   /translation="MVVIGAGGAGLRAVIEARERGLRVAVVTKSLFGKAHTVMAEGGCA
FT                   AAMRNVNTKDSWQVHFGDTMRGGKFLNNWRMAELHAQEAPDRVWELETYGALFDRTKDG
FT                   RISQRNFGGHTYPRLAHVGDRTGLEIIRTLQQKIVSLQQEDKKELGDFEARIRVFHETS
FT                   ITELIKDGDRIAGAFGYYRETGKFVLFEAPAIVLATGGIGKSFKVSSNSWEYTGDGHAL
FT                   ALRAGSGLINMEFIQFHPTGMVWPLSVKGILVTEGVRGDGGVLKNSDGKRFMFDYIPEV
FT                   FKGQYAESEEEADQWLKDNDSARRTPDLLPRDEVARAINEEVKAGRGTPHGGVYLDIAS
FT                   RMPAEEIKRRLPSMYHQFIELAEVDITKDEMEVGPTCHYVMGGIEVDPDSGGAATLGLF
FT                   AAGECSGGMHGSNRLGGNSLSDLLVFGRRAGLGASDYVRSLPDRPKVSEVALERAEKLA
FT                   LEPFEAKDNAENPYTLHAELQESMNDLAGIIRKQNELEEVLLKIDELKRRYRNVVVEGG
FT                   RIFNPGWHLAIDMRNMLLVSECVAKAALKRTESRGGHTRDDFPQMDSNWRNKLLVCKTV
FT                   GGGDDPVIPEISVEVEPQPPMRPDLLATFELSELEKYYTAEELAEHPQRKG"
FT   gene            complement(322104..322658)
FT                   /locus_tag="Mvan_0285"
FT   CDS_pept        complement(322104..322658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0285"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rha:RHA1_ro10114 possible transposase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11134"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T4"
FT                   /protein_id="ABM11134.1"
FT                   /translation="MTQGAGSNYTNLASEPPDHGIGRSRGGLTSKIHHLVDGHGRPLVV
FT                   LVGAGQANDGPVLEHLLAHLKVERRGPGRARTRPNRLRGDKAYSSRATRQRLRRRGIVA
FT                   VIPEPSDQIGHRKRRGTHGGRPPAFDAEDYKGRNVVERNFNTVKQWRGLATRYDKLAIV
FT                   YRGAAVLRAITLWLPHLSDTP"
FT   gene            complement(322606..323001)
FT                   /locus_tag="Mvan_0286"
FT   CDS_pept        complement(322606..323001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0286"
FT                   /product="transposase"
FT                   /note="KEGG: lxx:Lxx02410 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11135"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T5"
FT                   /protein_id="ABM11135.1"
FT                   /translation="MSRFQLLTDAQWSLIEELLPARTGKKGRPFRDARQMLEGIIYRYR
FT                   CGIAWRDVPEVFGPWQTIWTWHRRMSAEGTWDLVLARLLATADQAGIIDWSVSVDSTIA
FT                   RAHQHATNITRDTGGWVELHESGERAA"
FT   gene            complement(323109..323930)
FT                   /locus_tag="Mvan_0287"
FT   CDS_pept        complement(323109..323930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0287"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mmc:Mmcs_0254 putative succinate dehydrogenase
FT                   (membrane anchor subunit) (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11136"
FT                   /db_xref="GOA:A1T1T6"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T6"
FT                   /protein_id="ABM11136.1"
FT                   /translation="MSAPTADRNATGVFSPGRAQIPQRTLRTDRWWMSPLIINLGFATF
FT                   VIYATVRAFMQNNYFVAEYGYLTPFYSPCVSTGCVPEASHFGQFLPDVWWLPYAALSLP
FT                   FLLLFRLTCYYYRGAYYRTVWQSPTACAVAEPRAKYTGETRLPLIIQNTHRYFFYIAAI
FT                   ISVINTYDAIIAFHKPDGGFGLGLGNVILVVNVILLWTYTVSCHSCRHVAGGRLKHFSK
FT                   HPVRYWMWTQISKLNTRHKMYAWITLGTLMLTDFYIMLVASGTISDLRFIG"
FT   gene            complement(323972..324208)
FT                   /locus_tag="Mvan_0288"
FT   CDS_pept        complement(323972..324208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11137"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T7"
FT                   /protein_id="ABM11137.1"
FT                   /translation="MTSLASRYGDSPATRRIVNDAERLLNDIDRLDIDAEELELVRGVS
FT                   RHPHVAERIAIPDTQYDTEFWRGVDDEGLGGTH"
FT   gene            324383..325141
FT                   /locus_tag="Mvan_0289"
FT   CDS_pept        324383..325141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11138"
FT                   /db_xref="GOA:A1T1T8"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T8"
FT                   /protein_id="ABM11138.1"
FT                   /translation="MTNDVLKARAEALLALHQPGNPVILPTVWDAWSAKLATDAGFAAL
FT                   TVGSHPLADSVGKSDREGMTFDDVLTRVAQITAAVDVPLSVDIESGYAEAPTRLIEGLL
FT                   SVGAVGLNIEDTVHSEGGRLRSSSEHAQLVGALRAAADAAGVHVVVNARTDLFLRQDGD
FT                   ESDRVDRAIARLKEAAAAGADVLYPVGVHPPEVMRRLTSELPLPVNAIARPESADPASY
FT                   GPLGVARISFGPFWQAALAERAREILARWI"
FT   gene            complement(325170..326291)
FT                   /locus_tag="Mvan_0290"
FT   CDS_pept        complement(325170..326291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0290"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG:
FT                   fra:Francci3_3746 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11139"
FT                   /db_xref="GOA:A1T1T9"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T9"
FT                   /protein_id="ABM11139.1"
FT                   /translation="MIFPTLHPGEGHIGGEHYLPSHPDEVLWGWLPNAQTRPALSVASG
FT                   DTVTIDTVSHEGILEDQGRDPVSYFAQFGVTNVLKDVIDIASSPLAHDDSCGPHIVTGP
FT                   VRVANADPGDVLKIEVLDLAMRVPYGFVSSRHGYGALAGEFPEFPDSEPVREVDQIVSM
FT                   GTICHFSWVEMLQGKPYGKIAAGHGSGRTVQFPVNPFLGIMGVARATEDPVPSVPPGTH
FT                   GGNIDIKHVVTGSTLYLPVQVEGANFFAGDPHFAQGNGEVALTALEASLRATVRLTVLK
FT                   SGDAHSAIGALTNPVVETATHWIPTGMDADLDEAMRIAVRNAIAFLNTRFGVPRDVALA
FT                   YLSAAGDFEVSQVVDAVKGVHCMIRKADWAAWL"
FT   gene            complement(326288..326725)
FT                   /locus_tag="Mvan_0291"
FT   CDS_pept        complement(326288..326725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0291"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: mmc:Mmcs_3521
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11140"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U0"
FT                   /protein_id="ABM11140.1"
FT                   /translation="MTVKQTFNFTAAEGVPPKVGPFAHATRWGDTLYVTGQMPTDPATG
FT                   TLVDGGLAEQANRVLANLSAVLAQFGATLDDALMVRVYLTDFDDFDDFNAEYVKWFKGP
FT                   LPSRTCVGTTGLAVGAAVEIDLVVGLSHPQSTPAPAPSEAS"
FT   gene            complement(326722..328254)
FT                   /locus_tag="Mvan_0292"
FT   CDS_pept        complement(326722..328254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0292"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family / amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="KEGG: bja:blr4464 probable ABC transporter
FT                   ATP-binding/permease protein; TIGRFAM: polar amino acid ABC
FT                   transporter, inner membrane subunit; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; ABC transporter related; SMART: AAA ATPase; TC
FT                   3.A.1.3.-; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11141"
FT                   /db_xref="GOA:A1T1U1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U1"
FT                   /protein_id="ABM11141.1"
FT                   /translation="MDKFLHYLTLPWLIDGMLFTLQLTLYGFTGGLFLGVLLAALQLTR
FT                   SRALTAIGRTYVVIYRGTPLILQLVFVFTALPHIGITLPPVAAGSVALAMNEAVFISEI
FT                   LRSGIKGVDPGQSLAGRALGLEPRKLMRRVIAPQAFRSMVPALGNEFISTMKNSALASV
FT                   IAVPELTLRTQQLASSTFDYFSIYFATAVMYLALTAVLSIIQLLLEDALNLDRANRSLL
FT                   SRLDFRRRTTTPTPVVTPVVPAGPQVERQEIGDTVLDIRDLHKAYGANQVLNGITMSAR
FT                   QGEVIALLGPSGSGKSTLLRTINHLESVDTGTIRIAGQTLGYDESGMPLPEGRIAKARI
FT                   DAGVGMVFQHFNLFNHMTVRENIAAPLRWIQRLGKEEAAERADALLSQVGLADKADTLP
FT                   HRLSGGQQQRVGIARALAARPRILLLDEPTSALDPELVAEVLGVIRGLAHHHGLTMIIA
FT                   THQLRFALEVADRAVFMAGGVVVEEGSADQVINRPQDPATARFVNAMQLAAG"
FT   gene            complement(328310..329218)
FT                   /locus_tag="Mvan_0293"
FT   CDS_pept        complement(328310..329218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0293"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: bja:blr4463 probable ABC transporter
FT                   substrate-binding protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11142"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U2"
FT                   /protein_id="ABM11142.1"
FT                   /translation="MKNSRTALFAVLAGVVLAGCSSTTEAATTETPSEFADLAASPACT
FT                   ELRAENPDLAGKTLTNAINPYTPGYETINPENPSEYQGFDIDLGNALGACLGFKNDYLS
FT                   VGFSELIPTVASGQADWIISNLYATEERAAGGVDFISYSKVFDGILVAKDNPKNITGID
FT                   TSLCGLTVALNKGYVEVPLVEAVGPECVATGLKAPTVSLFDSSADCTQAVLAGRADAYM
FT                   NDINTVNAFVAEHPDELASAETVMLDYTIGIGVPQGDHQFRDAIQAALTEVQASGLQDE
FT                   LAAKWKLSENAVAAPTILSVG"
FT   sig_peptide     complement(329138..329218)
FT                   /locus_tag="Mvan_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.926 at
FT                   residue 27"
FT   gene            329451..330161
FT                   /locus_tag="Mvan_0294"
FT   CDS_pept        329451..330161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0294"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: rso:RSc1078 probable transcriptional
FT                   regulatory DNA-binding transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11143"
FT                   /db_xref="GOA:A1T1U3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U3"
FT                   /protein_id="ABM11143.1"
FT                   /translation="MNAPGGEAIPPLIRRPQSVSVALAAHFERLIATGEISPGTRLPSE
FT                   RELAASMSVSRSSLREAMHELESKRLVSRTRGRGTIVLAPTASVDELLAIAGGGTEQEH
FT                   AAELRSVIEPSIAELAAHRATSANVLQLRDVLDKSHENLLQAESLRLDIEFHLLLAQAA
FT                   QNPLLTALQTLASEWTGEVRKHSHSTRHGRCASVRGHQEIFDAVRTHDGLAARQAMEDH
FT                   LRDVSELVAKATRS"
FT   gene            complement(330200..330661)
FT                   /locus_tag="Mvan_0295"
FT   CDS_pept        complement(330200..330661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP0176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11144"
FT                   /db_xref="GOA:A1T1U4"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U4"
FT                   /protein_id="ABM11144.1"
FT                   /translation="MWIPPVPCCAMGTPLAIDTALTVLAAGLIFIWALILGVWKYRQMA
FT                   TSPDHLAHPYVDIAHRAALLYAFATMLLAVFVELSAWPTWVNLTSAAVVVAFFVLAIAT
FT                   YVMHGMRRDTTNQFERIDTTVRVAMAALIVGEIGGTVVLVAGFAAAQFS"
FT   gene            complement(330688..331119)
FT                   /locus_tag="Mvan_0296"
FT   CDS_pept        complement(330688..331119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0296"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mpa:MAP3701c
FT                   Hsp"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11145"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U5"
FT                   /protein_id="ABM11145.1"
FT                   /translation="MSNVALWTRPAWNTDRFVRDFFGPATATEWAKGINPAVEVTKDGD
FT                   DAVVRVDLPGVDVDKDVNVEVDKGRLVIRGERRDQRSEEAEGRKISEVRYGAFHRSFAL
FT                   PAHVTGEAVSASYDAGVLTVRVAGAHRGAEAHRVAIESK"
FT   gene            331318..333873
FT                   /locus_tag="Mvan_0297"
FT   CDS_pept        331318..333873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0297"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: mmc:Mmcs_0258
FT                   nitrite reductase (NAD(P)H) large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11146"
FT                   /db_xref="GOA:A1T1U6"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U6"
FT                   /protein_id="ABM11146.1"
FT                   /translation="MSSTSHVVVVGHGMVGHRFVEALRSRDTGDTWRVTVLAEELDAAY
FT                   DRVGLTGYTEHWDRARLALPGNDYAGDPMVDVRLGCRVTRLDPASKSVTTSDGTRIDYD
FT                   ALVLATGSYAFVPPVPGRDLPCCHVYRTLDDLDAIRTDAMSATDGGRAPVGVVIGGGLL
FT                   GLEAANALRGFGLSAHVVEKSPGLMAQQLDQAGAALLGTMITELGITVHTGVGTDVIAP
FT                   AQRNRPVRRSEEDDSVRVTLSDGTNIDAGVVVFAAGVRPRDELARDAGLAIADRGGVLT
FT                   DVACATSDPNIYAIGEVAAVEGRCYGLVGPGYTSAEVVADRLLGGGAEFPEADMSTKLK
FT                   LLGVDVASFGDAMGRTPNCLEVVVNDAVNQTYAKLVLSDDAKTLLGGILVGDASSYGLL
FT                   RPMVGEPLPGAPLALITPAGAEGGGGLGVGALPDGAQICSCNNVTKGALTEAIGSGCCD
FT                   VPALKKCTLAGTSCGSCVPLLKQLLEAEGVEQSKALCEHFSQSRAELFELISATEVRTF
FT                   SGLIERFGSGKGCDICKPVVASILASTSSTHILDGEQASLQDTNDHFLANIQRNGSYSV
FT                   VPRVPGGDITPEQLILIGEIARDFGLYTKITGGQRIDMFGARVEQLPEIWRRLVEGGME
FT                   SGHAYGKSLRTVKSCVGSDWCRYGQQDSVQMAINLELRYRGLRAPHKIKMGVSGCAREC
FT                   AEARGKDVGVIATETGWNLYVGGNGGMTPRHAELLAGDLDDETLIRYIDRFLMFYIRTA
FT                   DRLQRTAPWVEQVGLEHLREVVCEDSLGLAEEFEAAIARHVEGYACEWKGVLSDPDKLS
FT                   RFVSFVNAPDVPDPTVTFTENAGRMVPAPVSIGMPKIGR"
FT   gene            333881..334228
FT                   /locus_tag="Mvan_0298"
FT   CDS_pept        333881..334228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0298"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: mbo:Mb0259 probable nitrite reductase [NAD(P)H] small
FT                   subunit NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11147"
FT                   /db_xref="GOA:A1T1U7"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U7"
FT                   /protein_id="ABM11147.1"
FT                   /translation="MTLLNDVKTWTTACRYDFLIPNRGVGVLLPDGAQAALFRLDDGTV
FT                   HAVGNIDPFSGAAVMSRGIVGDRGGRATVQSPIKKQAFALDDGTCLDDPDHSLPVYETR
FT                   ITPDGEVQLAS"
FT   gene            334358..334711
FT                   /locus_tag="Mvan_0299"
FT   CDS_pept        334358..334711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0299"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmc:Mmcs_2719 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11148"
FT                   /db_xref="GOA:A1T1U8"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U8"
FT                   /protein_id="ABM11148.1"
FT                   /translation="MTYVIGSACVDIVDKSCVQECPADCIYEGDRAMYINPNECVDCGA
FT                   CRIACRVDAIYYETDLPDEEMEFLEDNAAFFTMTLAGRDAPLGDPGGAAKVGRVGADTP
FT                   LVAALPPSTTPHP"
FT   gene            complement(334715..335455)
FT                   /locus_tag="Mvan_0300"
FT   CDS_pept        complement(334715..335455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0300"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mmc:Mmcs_0262 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11149"
FT                   /db_xref="GOA:A1T1U9"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1U9"
FT                   /protein_id="ABM11149.1"
FT                   /translation="MSLLLVAHGTRKQRGVSLIGDIAAQVSTALGRPVRVAFVDVLGPT
FT                   PAELLGATRHEPTVLVPAFLARGYHVSSDIPAHVAASGHDDVLVTRALGPDPALVRVLV
FT                   DRLIESGWRPNDSVILAAAGTSDPAAMRDLHTTATWLSATIGARVELAFAATGEPRIAD
FT                   AVAGLRRPGKRVVVASYLLSEGLFQDRLRDSGADVVTDPLGTHPGVARLIANRFQRAGF
FT                   DTAAEIAFQQRTFEYAPAGMQFRR"
FT   gene            complement(335452..336594)
FT                   /locus_tag="Mvan_0301"
FT   CDS_pept        complement(335452..336594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0301"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Uroporphyrinogen III synthase HEM4; KEGG: mmc:Mmcs_0263
FT                   uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11150"
FT                   /db_xref="GOA:A1T1V0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V0"
FT                   /protein_id="ABM11150.1"
FT                   /translation="MSEPDWAPLTGFRVAVTSARRADELSALLRRRGATVCSAAAIEMV
FT                   PLPDDDELRQHTRSLIASPPDIVIATTGIGFRGWVAAADGWGMATELTAALSNARIVSR
FT                   GPKATGALRAAGLPEEWSPESESSRELLHYLVEGGIAGTRIAVQLHGATADWDPFPEFL
FT                   DELRAAGAEVVPIRVYRWHPAPRNGEFDQLVAGIADEKFDAVSFTSAPAVASVLLRATE
FT                   MGLEAEVLSALRTNVHAMCVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQT
FT                   RTVRVAGHLLEIRGTCVLVDGTVKELSPSAMATIRALALRPGAVVSRVDLLRALPGSGT
FT                   DTHAVETAVLRLRTALGDKKMVSTVVKRGYRLPVDEAFAS"
FT   gene            complement(336722..337264)
FT                   /locus_tag="Mvan_0302"
FT   CDS_pept        complement(336722..337264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0302"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0265 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11151"
FT                   /db_xref="GOA:A1T1V1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V1"
FT                   /protein_id="ABM11151.1"
FT                   /translation="MRARLIHTSDLDDETREDARRMVIDAFDGDFADEDWEHALGGMHA
FT                   VISLRGDVIGHAAVVQRRLYVGDRALRCGYVEGLAVREDHRGKRLGHALMDGVEQVVRG
FT                   AYHLGGLSTTDLGKPLYTVRGWVPWTGPTSVLALDGATRTPEDDGSLYVLPGELPASVT
FT                   LDPTAPIACDWRNGDVW"
FT   gene            complement(337275..338219)
FT                   /locus_tag="Mvan_0303"
FT   CDS_pept        complement(337275..338219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0303"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: mmc:Mmcs_0267
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11152"
FT                   /db_xref="GOA:A1T1V2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V2"
FT                   /protein_id="ABM11152.1"
FT                   /translation="MNGVTLEILQPGPLALVEDLGRPGMSHIGVTRSGAADRRSHTLAN
FT                   RLVANPDDWATVEVTMGGFTARVHGGDGEGVAIAVTGADADPAVNGIPFGTNSIHYARD
FT                   GEVISLGSPRSGLRSYLAVRGGIDVEPVLGSRSYDVMSMIGPQPLRRGDVLTVGAHTDD
FT                   FPELEQAPVAAIVDDVLELKVVPGPRDDWFVDPDVLVRTNWQVTNRSDRVGMRLVGMPL
FT                   DYRWPDRQLPSEGATRGAIQVPPNGFPVILGPDHPVTGGYPVIGVVVDDDIDKVAQARP
FT                   GQTVRLHWSRPRRPFEDDGRAVNWALTPPDDRW"
FT   gene            complement(338216..338923)
FT                   /locus_tag="Mvan_0304"
FT   CDS_pept        complement(338216..338923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0304"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   mmc:Mmcs_0268 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11153"
FT                   /db_xref="GOA:A1T1V3"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V3"
FT                   /protein_id="ABM11153.1"
FT                   /translation="MSVTADAIHTVRTGGVQKILDYGDRALLLEFDGSAEVLAWTDAVR
FT                   AADLPGVEDVVPAARTVLVKLAGSRYRAPTRQRLAAVRPTAQALAESTAPDTPDAVIDV
FT                   VYDGEDLDEVARLTGLSRDEVIAAHTGRLWRVGFCGFAPGFAYLVGGDERLAVPRRPEP
FT                   RTKVPVGSVGLAGEFTGVYPRESPGGWQLIGRTSAVMWDVHRKDPALLTPGMWVRFQAA
FT                   DADARSSSAEVTS"
FT   gene            339126..339560
FT                   /locus_tag="Mvan_0305"
FT   CDS_pept        339126..339560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11154"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V4"
FT                   /protein_id="ABM11154.1"
FT                   /translation="MSISAGFSVAEIREFVVEYERVPHGQKGPWLAAQGVSNGRFRRWQ
FT                   AAVFGGDLDRGLIPRDSGAMTVPPALRKALANVDAARQERDEAELAQLRERVRQLEATN
FT                   GALGKAIGLLHEMNVDEPDTTPMTNDPDDSSTSRTNSSPS"
FT   gene            339596..340558
FT                   /locus_tag="Mvan_0306"
FT   CDS_pept        339596..340558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0306"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: cgb:cg1716
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11155"
FT                   /db_xref="GOA:A1T1V5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V5"
FT                   /protein_id="ABM11155.1"
FT                   /translation="MIELSRSTWHYRSHPRPRVANPMPHKDRAYPSRIGVADRAVIAEQ
FT                   IIAGWLAGVSVDQSFATMWDAGVLLASRRSWWRIAAVIDQSLRPVAPTRATNKTPRSAP
FT                   VLKATGPQQIWSWDITDLHSPWRGVSFKTYSIVDIFSRKIVGWRVEERECDDLAVEMFK
FT                   TAIAEHGPPAVVHADSGPAMRSTVLKDLLAGLGIGQTHIRPHVSNDNPFSESEFRTMKY
FT                   RPNYPGVFDDLNTAHAWVQAYVRWYNQHHRHSGIALFTPDEVHNGSWTRQWMHRDHILQ
FT                   AYYHAHPERFRARPHTKSPAAIVGINLPTEKDPNRLHAA"
FT   gene            complement(340595..341287)
FT                   /locus_tag="Mvan_0307"
FT   CDS_pept        complement(340595..341287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0307"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   mmc:Mmcs_0269 protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11156"
FT                   /db_xref="GOA:A1T1V6"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V6"
FT                   /protein_id="ABM11156.1"
FT                   /translation="MTDSTVDQDQHASFARVGSAYYPVLVAIFTALVIISNVTATKGVE
FT                   FGPIITDGGFIVFPLTYVIGDVLSEVYGFRAARRAIYTGFAMNALAALAFWATIYLPAA
FT                   DFYPNQEHFENVVHAYTGLIVAGLAGFLVGQTLNAWSLVLIKERTKEKYLWARLIGSTF
FT                   VGQLGDTVVFCAIAASVIGITSFSDFLTYTAQGWLYKTLVEVAILPVTYRVIAFIKHRE
FT                   PSYQPLTV"
FT   gene            complement(341300..342250)
FT                   /locus_tag="Mvan_0308"
FT   CDS_pept        complement(341300..342250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0308"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmc:Mmcs_0270 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11157"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V7"
FT                   /protein_id="ABM11157.1"
FT                   /translation="MATLVPRRRFLTMSAGAAALLTACGSEKPGAIASDGSVTVRHAFG
FT                   ETKIPKPPTRVVSAGLTDADDLLALGVVPIAVTDWFGAEPFGVWPWAQPRLGGAQPVVL
FT                   SLADGIQVEQIAGLTPDLIVATDAGLDQDTYTRLSEIAPTIAQSGSAAFFEPWRDQAGA
FT                   IGQAVLRHDDMQKLITDVDAKFTGVKDSHPQFAGKKALLLAGTLFRDSVQVSGPSWRHE
FT                   FLTQMGLTVLETDDALIPRDRIAEVLGAADVLIWTTESDQEQAALLADPAIAGIPARRH
FT                   VFTGKELAGAIAYASTLSYPVVADRLPPMLAAAVG"
FT   sig_peptide     complement(342149..342250)
FT                   /locus_tag="Mvan_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.751 at
FT                   residue 34"
FT   gene            complement(342270..342779)
FT                   /locus_tag="Mvan_0309"
FT   CDS_pept        complement(342270..342779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11158"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V8"
FT                   /protein_id="ABM11158.1"
FT                   /translation="MQVVKIAALNALLGGAALAAATQAGAQPAPVDPALPPAPPVVAAP
FT                   APGAPVPGVPAPGSHSVTVTPLDAGSIPPPAPPPVGAPVIPAVPNANFGNTGQLDFLRE
FT                   LWNMRNSAEFFQSVGPGSLDPATWQPPTPYGTPPPPPAAAPGSPPPPASAPPPVWPPVP
FT                   VPAQVP"
FT   sig_peptide     complement(342648..342779)
FT                   /locus_tag="Mvan_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.396 at
FT                   residue 44"
FT   gene            complement(342840..343448)
FT                   /locus_tag="Mvan_0310"
FT   CDS_pept        complement(342840..343448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0310"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mmc:Mmcs_0272 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11159"
FT                   /db_xref="GOA:A1T1V9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1V9"
FT                   /protein_id="ABM11159.1"
FT                   /translation="MNPAYVVVLSGFATTMALIAAIGAQNAFVLRQGIRGEHVLPVVAV
FT                   CTVSDLVLISAGIAGFGALIAAHPDIVTATKFGGAAFLVGYGLLAARRAVKPGVLTPAD
FT                   AAPARLTAVLATCLAMTFLNPHVYLDTVILLGALANEHQDSKWLFGVGAVAASALWFTG
FT                   LGFGAKRLRHLFASPKTWRLLDGVIAATMLALGISLVVS"
FT   sig_peptide     complement(343374..343448)
FT                   /locus_tag="Mvan_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.533 at
FT                   residue 25"
FT   gene            343612..343836
FT                   /pseudo
FT                   /locus_tag="Mvan_0311"
FT   gene            complement(343879..346965)
FT                   /locus_tag="Mvan_0312"
FT   CDS_pept        complement(343879..346965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0312"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmc:Mmcs_4841 MmpL"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11160"
FT                   /db_xref="GOA:A1T1W0"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR023908"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W0"
FT                   /protein_id="ABM11160.1"
FT                   /translation="MTDGTADSPSQATRSGRGANGSPDPADTREYSERLAALARFTLRH
FT                   KALVIGVWLGAAVVLALLFPQLETVVRQQSVDLIPRDAPSLQTVDRMSAAFGEEGSKTM
FT                   VFVAMEDPNGLTPTARQRYGELVSRLQSEGDHVLLVQDLLADPITEAQAVSVDRKAWYL
FT                   PVGVAGTLGDPTAAESVNAVRDIAAEVFTGSTTTVHVTGPPATFSDMIASAEHDLLLIS
FT                   IATAGVIALILLIVYRSVFTALLPLLVIGLSLAVGRGVLSALGEMGMPVSQFTVAFMTA
FT                   ILLGAGTDYTVFLISRYHEQRRAQVPADQAIIHATASIGRVILASAATVALAFLAMVFA
FT                   RLSVFAALGPACAIAVLFGFLATVTLLPPVLSLAAERGIGEPKSDRTRRYWNSVAVAVV
FT                   RRPVPLLIVSLVILLALSAAAATIKISYDDRKGQPATTASNQGYHLLDRHFRKDVVITE
FT                   FLVVENPTDMRTGKGLADLDEMASRVSQIPGVTKVSGVTRPTGERLDQAELAWQNGQIG
FT                   DKMAGAVAEGNSRKDDLAKLTGGADQLADGLAQLDSTVRTALTPLAEILTQAQSAGTQV
FT                   NQFRPLLQQLSATAPAVDQAIQSSPGLRPLANQAQNAISQLDPLVGALNTSPWCATTPQ
FT                   CAQIRDQVKILVTLRDSGFFTQIADLGDRYDPATNATVGGTLANVQNAVASLDKAFGAL
FT                   GDPADLATNLRRLQDGIGQLASGAQALATGVRTLADSNIEMLSGMSQIATQLQNSSRAA
FT                   ADSDSSSGFYLPANAFENRQFTDVAEQFLSPDGKTARFMIESSHDPYSVEAMDLASRIT
FT                   DTANTARPNTSLADATVSVAGFPAVNSDIQRLLWADFAQLAIATIIIVGVILVLLLRAL
FT                   LAPLYLLGTVVLNYLASLGIGVVVFQWGLGHEIAWPVPLLAFIILVAVGADYNMLLVSR
FT                   LREESGTNIRVGVLRTVANTGAVITSAGLIFAASMFGLMVGSVAIMIQAGLIIGFGLLL
FT                   DTFLVRTLTVPAIATLLREASWWPTKATNPRRGDPKQKA"
FT   gene            complement(347239..347880)
FT                   /locus_tag="Mvan_0313"
FT   CDS_pept        complement(347239..347880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0313"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_3200
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11161"
FT                   /db_xref="GOA:A1T1W1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W1"
FT                   /protein_id="ABM11161.1"
FT                   /translation="MSAEERHRNRRTRLIEAATELIGTRGVAAATVTAVCAESGVTSRY
FT                   FYQHFSGRDALLRAVYQQLYATFQEVIVDAIPDAGEPPEVLAYAPIRRLVSMIDNDPRL
FT                   GRILFVESATEPLLRELRSELMAGFTDLVLREARLHLDIADSAVGVAHLASTLGVGGLF
FT                   EVLRRRLDGELEFTTDELVQHCAGFLGSLGNYVLLQNTDQSATTEARPHR"
FT   gene            347985..348854
FT                   /locus_tag="Mvan_0314"
FT   CDS_pept        347985..348854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0314"
FT                   /product="metal-dependent hydrolase"
FT                   /note="KEGG: mmc:Mmcs_3199 metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11162"
FT                   /db_xref="GOA:A1T1W2"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W2"
FT                   /protein_id="ABM11162.1"
FT                   /translation="MSDDSSTRPTTRVVPKPRRVRFDMPAGTSRQHFVDGDLVMSHFVS
FT                   TLSATFPEGEDFFIRSVREYRDHISDADLKEAVKGFIAQEATHRHQHRLLNDRLQAMGY
FT                   PTEGIDRHIKKLVGRLEKRFSPRMRLAVTAALEHYTATFAEIILTSDEAQELIGDTEVR
FT                   PILLWHALEECEHKAVAFDVYETVGGSERTRVWGMRIASLLLFSELVIQTTRSLAGDRA
FT                   AYNPVRLLRSLRAFRHNPLFSSAAIERFRSYSRGGFHPDDWDSAEILECWTKELFDADG
FT                   RQQARSSV"
FT   gene            complement(348983..349885)
FT                   /locus_tag="Mvan_0315"
FT   CDS_pept        complement(348983..349885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0315"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_3221
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11163"
FT                   /db_xref="GOA:A1T1W3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W3"
FT                   /protein_id="ABM11163.1"
FT                   /translation="MTSAVQHRVRTQDGITLAADCYDHEDARPVVLLLHGGGQNRHAWS
FT                   ASARRLHACGYTVVAYDTRGHGDSDWDPAGRYDLERLATDLLAVREHFSAATAPAVVGA
FT                   SLGGMTVLGTHLLTSGASWAAVVLVDVTPRLEFQGARRVVTFMAAHPDGFGTLTDAAEV
FT                   IAAYNPHRSRPANVDGLRKVLRQRHDGRWIWRWDPAFIHSNFDFLRDESTTGTEQFDAI
FT                   SHLLIDGARRVSAPTLLVRGLLSDVVSQATVDEFQQLVPHAETVDVSGTGHMIAGDDND
FT                   AFSSAVTEFLGRSILQPPP"
FT   gene            complement(349944..350396)
FT                   /locus_tag="Mvan_0316"
FT   CDS_pept        complement(349944..350396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0316"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: mmc:Mmcs_3222
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11164"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W4"
FT                   /protein_id="ABM11164.1"
FT                   /translation="MVVAVTFAHFDQQIADQLLRSANTAGGLSTFLSFRHTELTAGRLV
FT                   AEMETRAELLTPFGNLHGGCLSAMVDHCLGVVFYPVIPAGSWVATTEFKLNLLRPVSSG
FT                   VCVAVTDIVSLGKRSGVARIDISNGDKAVCVAQGTVTVVNAAGNAQ"
FT   gene            complement(350569..351765)
FT                   /locus_tag="Mvan_0317"
FT   CDS_pept        complement(350569..351765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0317"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_4580
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11165"
FT                   /db_xref="GOA:A1T1W5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W5"
FT                   /protein_id="ABM11165.1"
FT                   /translation="MVSVQIRYDPFDASILNDPYPTYRLLRDVAPVYRAEESHTWVLSR
FT                   HADVQAAALDHSTYSSVDGIFPTPPGSDFIGSFLPMMIVMDPPRHDQLRALVSRAFTPR
FT                   RVAGLQGTITQMAAELFERLDEGSGSADFVTDFAAILPAAVIADLLGVPATDRDQFRLW
FT                   SSQLVQVDVNHGQTTDALAAAAAIYAYFTDFLADRRKNPREDLMSALANATVDGIGLTD
FT                   EEVLGFCALLLVAGYETTTNLLGNSAVVLAQHRQTRRRLAADRTLLGPAVEELLRYDSP
FT                   AQGLSRTLTRDVTLHDTTMRQGEKVLLLFGSANRDERAFPDPDVFDIERTSEHQVAFGR
FT                   GIHFCLGAALARMEARIALNALLDKVPDWEVDLESARRLRSGPIRGYTSLPITWTTPV"
FT   gene            351839..352435
FT                   /locus_tag="Mvan_0318"
FT   CDS_pept        351839..352435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0318"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG:
FT                   bpm:BURPS1710b_A0472 putative TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11166"
FT                   /db_xref="GOA:A1T1W6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W6"
FT                   /protein_id="ABM11166.1"
FT                   /translation="MRKIPRQISDRLPAAADLFAEKGLNDSKIEDVAAVTGVPKATLYY
FT                   YFAGKEDILAFLLEDLLKDISEAVTAIVHTDGTGAERLELVIRAQLRAMAQRPAVCRAL
FT                   IGELGRAARMPAIAEMINTAYQQPVETLLVEGARDGSLVAQPDARSTSIALFGAVTINA
FT                   LMYLVTENHLDETVVARTLSAVMFDGLRPRTGDQS"
FT   gene            352432..353481
FT                   /locus_tag="Mvan_0319"
FT   CDS_pept        352432..353481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0319"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_3213
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11167"
FT                   /db_xref="GOA:A1T1W7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W7"
FT                   /protein_id="ABM11167.1"
FT                   /translation="MSTYGLSVLGADLKSLAQTAQAADAAGFDAVWASEFYSRSGSISM
FT                   AAMANSTQNCRIGSSILYGVGRSPLVLATEARDLDELSNGRLVLGIGNGTKRMMSDWHG
FT                   VPDTSAPALRMEELVMLLRRIWNLHEGPVHHEGRFYRMNLTPTGDMGPSSRPIPIVTAG
FT                   VRPRMCEAAGRVADGLAGHPLFTTTYVEEIVRPAIARGAAHTGRDANDVEIISMVMCAI
FT                   HDDAEVARRELAQQIAFYSSVKSYETVLDVNGFASEGRTIREAFAQRDFPAMFAAVSEE
FT                   MIDTMGVAGTAHEVREQLRRYDGVLDHIMLYSPSVGIAAERVQQNLDSIIGECSPASMS
FT                   PGQSGPGST"
FT   gene            complement(353530..354015)
FT                   /locus_tag="Mvan_0320"
FT   CDS_pept        complement(353530..354015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11168"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W8"
FT                   /protein_id="ABM11168.1"
FT                   /translation="MRRKETAMYTQWIENLVVQRLSLHGGLVLDFDDYNEIVISCPLLL
FT                   TLPAVGTYPIEAVRIDPLRIATHERPLLNLAGAVCTQAWSSDDGGLHLSFSGGHRIDVE
FT                   PDVEQTAWELYGMRHGYMACLPRGRVRVVRHDLPDTDDANILNSATQSSAVSARQTH"
FT   gene            complement(354073..354744)
FT                   /locus_tag="Mvan_0321"
FT   CDS_pept        complement(354073..354744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0321"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_4839
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11169"
FT                   /db_xref="GOA:A1T1W9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1W9"
FT                   /protein_id="ABM11169.1"
FT                   /translation="MTFPQARSRGTTLPSEANSVATEKRAANASRSRASARRRETILDA
FT                   ALAVAAAGGYEAVQMRTVAERVGIAVGTLYRYFPAKTHLLVAALTREFRRLDSAGDWAG
FT                   GEGTPLERLERLTAHLHDRWQRDPWLTTAMTRAFAVADTRAAAELDRAADEIQILLART
FT                   LRGGEPTPADLHVAGVISDIWLANLVAFSGDRATAADTRDRIDRATRRVVTNAARPTAN
FT                   R"
FT   gene            complement(354741..355253)
FT                   /locus_tag="Mvan_0322"
FT   CDS_pept        complement(354741..355253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0322"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_4838 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11170"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X0"
FT                   /protein_id="ABM11170.1"
FT                   /translation="MPKSVLPPERLPSHTTTCMGCGPDNPHGLRLVVHRSGDAVYSDVT
FT                   FDERHIGAPGLAHGGAVAAACDDVLGFTLWIAGTPAVTRTLTVEYLRPVPLHQTHRITA
FT                   HIVSREGRALHVTATGTGEGGIARFTASAVFIVVSPEHFAAHGDVNAFGDLLEQFSRGG
FT                   GLDPGPS"
FT   gene            355357..356040
FT                   /locus_tag="Mvan_0323"
FT   CDS_pept        355357..356040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0323"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_4837
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11171"
FT                   /db_xref="GOA:A1T1X1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X1"
FT                   /protein_id="ABM11171.1"
FT                   /translation="MSDSQSVPVPDDDVDPRRIRSRTRLLDAAATLLSTGGVEAVTIDA
FT                   VTKASKVARTTLYRHFHSSSHLLAATFERLLPQVTTPAPTSGPLREQLIELLSRQAALF
FT                   NDAPLHVTTLAWLSLGPTGSNNEADDRHTSGALRARVVDQYRQPFDAILTSPKAQAELD
FT                   DFDRELALCQLVGPLAFARMTGIRTITHNDCANIVDDFLTAHRKTDSDAKESKIATSRR
FT                   AAPRV"
FT   gene            complement(356476..357384)
FT                   /locus_tag="Mvan_0324"
FT   CDS_pept        complement(356476..357384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0324"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bha:BH2806 carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11172"
FT                   /db_xref="GOA:A1T1X2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X2"
FT                   /protein_id="ABM11172.1"
FT                   /translation="MSILPVPVVADTVARVFAAAVNPAPKAAVRFADIPGRTAQVTIPT
FT                   RHGPVTATIYHPPSEVQSPPVYANVHGGGFVVGHPEQDDPWCRYLAANAGVVVVNPDYA
FT                   LAPRRRFPAAPQQIYDIVCWAADEARDWDGTRLCVGGQSAGGNLSAAAARLALENRTPI
FT                   ISLQVLHYAPLDLVTPTRDKPSAFGARAVLKPWMGEVFDTAYIPDPAQRSDRLASPAWG
FT                   ANAEDIVGIAPAVVVTAEHDRLRNEGHRYAKKLDAAGSLVEYHEVAGVDHGYNIMGGAL
FT                   GATEQVYSRIAGHVARATGSA"
FT   gene            complement(357642..358457)
FT                   /locus_tag="Mvan_0325"
FT   CDS_pept        complement(357642..358457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0325"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: sco:SCO0511 dehydrogenase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11173"
FT                   /db_xref="GOA:A1T1X3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X3"
FT                   /protein_id="ABM11173.1"
FT                   /translation="MNTTAATLSGRTALVTGSTSGLGAGIAEALADAGAHVVITGRTRA
FT                   RGEQVVTQIESQGGRAVFVPVDFAAGPGTITDLVVTATEALGGRLDILVNNVATLVQPA
FT                   PTADVTAEEITTAFGVSVATPFLLTGLIAPAMVQRGDGAIVNIGSISGIIGAAGSALYG
FT                   ATKASVHLLTKAWAAEYGPSGVRVNAVAPGPIATERTREFGDAIAPVLARVPSHRMSTV
FT                   AEVASAVVFLAGPEAANIHGTILSVDGGATAVRDEPAAVTKLGNHPHPG"
FT   sig_peptide     complement(358362..358457)
FT                   /locus_tag="Mvan_0325"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.738 at
FT                   residue 32"
FT   gene            complement(358469..359479)
FT                   /locus_tag="Mvan_0326"
FT   CDS_pept        complement(358469..359479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0326"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sme:SMb20216
FT                   putative epoxide hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11174"
FT                   /db_xref="GOA:A1T1X4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X4"
FT                   /protein_id="ABM11174.1"
FT                   /translation="MNGFSRRDFGLLATAAAGAVTLTACTSTPATAGPPPAPRNQLGPI
FT                   KQIDAGDLNVGYAEAGPPDGQPVILLHGWPYDIHSYADVTAILAAQGFRVIVPHLRGFG
FT                   TTRFRSANTVRNGQQAALAHDAISLMDALNIPDAILGGYDWGGRTANAVAALWPQRCTG
FT                   LVAVSGYIVVNLATNLEPLAPQSEYGWWYQYYFATPRGELGYRRNTKDFNRLIWTNASP
FT                   LWHFDDAAYDMAARAFDNPDHADIVIHNYRWRLSLAPGESRYDADEQRLAAKPPIEVPT
FT                   ITIGSDFDGPAKDGSTYRALYTGPYQHRVLDGIGHNVPQEAPQEFASAITDVTRQ"
FT   sig_peptide     complement(359381..359479)
FT                   /locus_tag="Mvan_0326"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.970 at
FT                   residue 33"
FT   gene            complement(359476..361044)
FT                   /locus_tag="Mvan_0327"
FT   CDS_pept        complement(359476..361044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0327"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: rpc:RPC_2481 glucose-methanol-choline
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11175"
FT                   /db_xref="GOA:A1T1X5"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X5"
FT                   /protein_id="ABM11175.1"
FT                   /translation="MGDMPIVTSPARSYDFIVCGAGTAGSVVARRLAENPAVSVLLVEA
FT                   GGTDQVPSVAAADQWPLNLGSERDWGFSAVATSHLNGRAVPLSMGKVLGGGSSINLMVW
FT                   ARGHKADWDYFAFESGDEGWGYESVLDLYRRIEDFHGDPDPDYRGTGGPVYVTPAPDPN
FT                   PLAPATIEAARTVGIPTFENQNGRMMEQSAGAAISDIRARGGRRQSVFTSYVTPVLHRP
FT                   NLDVLTCALVTRVSFDGDRATGVELVLDGQSRRIAVNTEVILSLGAINTPKVLLHSGIG
FT                   DETELRRVGIPLHTHLSGVGRNLQDHPGFDCVWEYSEPLAPRNNASEATYFATSAAGMD
FT                   APDLQTCQAEVPKSSAENIARFGLPEFGWTLFAGVVRPKSRGHLALRSADPVDPIDIHA
FT                   NMLAHPDDVKAAVAAVELCREIGNSAPLRPFAKREVMPGNLRGPDLERFVRDAASSYWH
FT                   QTCTAKMGRDAMSVVDAALNVYGVKGLRVADGSIMPRVTTGNTMAPCVVIGERAADIIR
FT                   KEHAL"
FT   gene            361122..362021
FT                   /locus_tag="Mvan_0328"
FT   CDS_pept        361122..362021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0328"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: sma:SAV7235 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11176"
FT                   /db_xref="GOA:A1T1X6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X6"
FT                   /protein_id="ABM11176.1"
FT                   /translation="MELRQVEHFLAVAGEMSFTRAAERVHVVQSALSTSIAKLERELDV
FT                   DLFDRSRQQIRLTAAGDRFLTHAYEVLRVSRAAADSVGEFRQSLMGTVEFGSLISFGPM
FT                   DVGRALGDFHRAHPFVRLRLRLSQAGASAYLGALVEGSLDLALVSVPDRFPRQLEMRLL
FT                   FAEPMVFVCRGDHAFADRGTLDLADVALEDIVGFPPEFGLRRLMEGAFRAVGVAPRTQY
FT                   EVPAGFAAIADLVRNGLGTAFMPASEARRFSDLRPVELADHVLWQVYLASRPVDHLTPA
FT                   TARLADALLDAAADARAQ"
FT   gene            complement(362247..363386)
FT                   /locus_tag="Mvan_0329"
FT   CDS_pept        complement(362247..363386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syn:sll1830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11177"
FT                   /db_xref="InterPro:IPR041289"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X7"
FT                   /protein_id="ABM11177.1"
FT                   /translation="MTPSAPHRIGDTSAVATAFGITDTDHLVPVTTDMVTVLQSMRSDP
FT                   SISILASTQPGPRPGGKDIATLRSLASQARQRLAVEGCTDAVALLDALSAMITEALGQP
FT                   ADRAIALFVNRAYSCWATLPVPVIDRCVIDPTFATRDLVRTLHHTPRHTVLLLSTDQAR
FT                   LLHGHGATLTPSPASAFPIHRRVAGKNRGPTAERPDDFLRRVDRALGAALKLNPTPLVL
FT                   AAAEPTASTFHNLSRNTARLAGTVKGNHLTTPTEGLVDLIRPVLRDYLTSRGHEALVHV
FT                   ERRARTGRVLRDIDSAWLAARWERPEMLAVEEHYYYPARLDDTGDTLIPATDVDHPDVI
FT                   DDAVDELIETVLSRGGWIALVAPGELPDNTHLALTLRSH"
FT   misc_feature    complement(363444..363570)
FT                   /note="yybP-ykoY element as predicted by Rfam (RF00080),
FT                   score 37.36; Mvan_R0004"
FT   gene            complement(363626..363964)
FT                   /locus_tag="Mvan_0330"
FT   CDS_pept        complement(363626..363964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5099 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11178"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X8"
FT                   /protein_id="ABM11178.1"
FT                   /translation="MNSALDAPHGTAGSGAAAGGSWTFLSNHAHVLLCLADDPHQTLSK
FT                   IAARVGITSRAVQLIVSDLILGGYLTRTKVGRRNHYQINPDGHLRHPLEAHHRVADLIS
FT                   ALGPTARS"
FT   misc_feature    364102..364229
FT                   /note="yybP-ykoY element as predicted by Rfam (RF00080),
FT                   score 50.71; Mvan_R0005"
FT   gene            364252..365229
FT                   /locus_tag="Mvan_0331"
FT   CDS_pept        364252..365229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0331"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   mmc:Mmcs_5098 integral membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11179"
FT                   /db_xref="GOA:A1T1X9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1X9"
FT                   /protein_id="ABM11179.1"
FT                   /translation="MVVPLWAWAAVLGVILAMLAIDLFAHRDAHVVTVREAAAWSAVWV
FT                   TLGLAFGAIVWWMWGAEFAAQYYAGYVIEKSLAVDNVFVFAIIFSYFAVPREYQHRVLF
FT                   YGVLGALVFRAVFIAAGSVLIASFAWILYIFGAFLVATGIQMALHRNETINPERSMVLR
FT                   LFRRLISVTDTYHGQKFLIRQAGRWVATPLLAVLVLVEVTDIVFAVDSIPAIFAVTQQP
FT                   FLVFTSNAFAILGLRAMYFLLADLMHRFIYLKLGLALVLVWVGVKMLLLEIYKIPTGIS
FT                   LAVVVALLAIAITASWIRTRNGATPPTETTLVDAPKIDTFHPNR"
FT   gene            365319..365759
FT                   /locus_tag="Mvan_0332"
FT   CDS_pept        365319..365759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11180"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y0"
FT                   /protein_id="ABM11180.1"
FT                   /translation="MTLIEVEPQPRVDTLVRLPGGGEARRTDYAGVVWFDGKPEVAGML
FT                   LRRAANAPKGIRTPNVEASFYLPDSLPYSGAALAGAGLSVSVALCGSGEVGAVTRAAAT
FT                   FAADPSGEPTWIQLYLQGHLGWPAGVSYRVVALTPPEAVLRW"
FT   gene            365868..366140
FT                   /locus_tag="Mvan_0333"
FT   CDS_pept        365868..366140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11181"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y1"
FT                   /protein_id="ABM11181.1"
FT                   /translation="MNCLIYPAAAALTVSAALGLAGSAIAQPDESEEPKSAVDAIAQLQ
FT                   SEGKSVHVVGAEDSPLQSCDVANVVEEEEANVVTVEVTCEDGYPR"
FT   sig_peptide     365868..365948
FT                   /locus_tag="Mvan_0333"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            366211..366615
FT                   /locus_tag="Mvan_0334"
FT   CDS_pept        366211..366615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0334"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   mmc:Mmcs_2236 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11182"
FT                   /db_xref="GOA:A1T1Y2"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y2"
FT                   /protein_id="ABM11182.1"
FT                   /translation="MTHSKTEPSMGELVSQLSEQTSRLVRDEMRLAQKEMQESAKHAGL
FT                   GAGMVGAAALLSVLGLATLIAGAVAALALALPVWLSAVIVAVVVFAAAGIAALVGKKQA
FT                   EQVPPPAAQSVDSVKSDIDEIKVARHGSRT"
FT   gene            366599..366862
FT                   /locus_tag="Mvan_0335"
FT   CDS_pept        366599..366862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0335"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11183"
FT                   /db_xref="GOA:A1T1Y3"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y3"
FT                   /protein_id="ABM11183.1"
FT                   /translation="MAAGPDPRPEPGPDAGIAELQADIEQTRGELGATVGALSDKLDVK
FT                   ARARQAVADAKQNAKSRPAVQVGALLAAGAGIGLVVWLRRRR"
FT   gene            367163..368116
FT                   /locus_tag="Mvan_0336"
FT   CDS_pept        367163..368116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0336"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mmc:Mmcs_4344 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11184"
FT                   /db_xref="GOA:A1T1Y4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y4"
FT                   /protein_id="ABM11184.1"
FT                   /translation="MSEAVIVDADNIGEAEAALSAAYTAMRLVSDRDVPSGRTRIFRTR
FT                   VGPLTVDDAEFDFHVIADMDPSEDVLLCRVRGGMLGGHLPGRSPERHGAGTVLAFGGRR
FT                   GERIYGDIDHARYDTIVLDRNLLAQVASGGLDAAGEPVDLTSLAPVSEEANRHLADVMS
FT                   HLRRDVASNAHAASQPLVTGPLLRYLAGCVLAAFPNTAAAPPRVQDSSPRLLERALAFI
FT                   DDNADKDISLGDIAAAARVTPQSVAAMFRRHLSCTPKEYLRKVRLDHAHRDLIANNPAT
FT                   ATVADIAARWGFGVVEAFAVYYRGRYGVHPETTLAS"
FT   gene            368144..368953
FT                   /locus_tag="Mvan_0337"
FT   CDS_pept        368144..368953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11185"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y5"
FT                   /protein_id="ABM11185.1"
FT                   /translation="MIEISLDEMRTWFGFGVAGNFAGHLEQAGEAADFVNVTTEGAAPK
FT                   GIFPWYAPGSDTFLGEFPLSHDAIVLPAESPEFSGPLNLQIEPEVGLACRVVWEGDTIV
FT                   TLQPFALGAFNDCSIRRPGAKKISHKKNWGPASKGVAAEFFDISDLTPDGPTATLRLVC
FT                   HLNSDGEEHDYGVDSPLIGYSYYGEVLLDWIVERLANQKGSPDTPLEDVGALMVASGHP
FT                   EHVLIGIGATRYTPLGESTYLKKGDEAIVRVYDTESDAASELRQHVE"
FT   gene            369067..370044
FT                   /locus_tag="Mvan_0338"
FT   CDS_pept        369067..370044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0338"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KEGG: mmc:Mmcs_1789 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11186"
FT                   /db_xref="GOA:A1T1Y6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y6"
FT                   /protein_id="ABM11186.1"
FT                   /translation="MGACVARQLAAGGADVRVLLRKSSSTKGVDRIDVERAVGDPFDPA
FT                   TAAAAMADRDVVYYCIVDTRAELKDPAPLFATNVEGLRKVLDVAAAANLKRFVFLSTIG
FT                   TIAVGENGETVDEDTPFNWADRAGGYIESRRAAEQLVLSYATERGLPAVVVNVSNPYGP
FT                   PDFQPRQGMFVQLAALGKLPFYVKGVGAEVVGIDDAADAMLRASLRGRVGERYIASERF
FT                   MTHRELLTTAADAVGARRPRFGVPMAVVYGFAWLADAVGSILPVQVPMSRQSAFLLAHT
FT                   SPASHAKATRELGWHPKPTENFIARAAENYVQRAGAEGAKTSQA"
FT   gene            complement(370035..370370)
FT                   /locus_tag="Mvan_0339"
FT   CDS_pept        complement(370035..370370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0339"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   mbo:Mb3092 multidrugs-transport integral membrane protein
FT                   Mmr"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11187"
FT                   /db_xref="GOA:A1T1Y7"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y7"
FT                   /protein_id="ABM11187.1"
FT                   /translation="MPGVAWTLLGGAILAEVIATSMLKSTEGFTRLWPTLACLLLYGAA
FT                   FMLLAQSISHGMQVGIAYALWSAIGTTVIVAVGVTFLGEPISTLKVIGVALVVSGVVTL
FT                   QLDGHQA"
FT   gene            complement(370372..371136)
FT                   /locus_tag="Mvan_0340"
FT   CDS_pept        complement(370372..371136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0340"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mpa:MAP1593 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11188"
FT                   /db_xref="GOA:A1T1Y8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y8"
FT                   /protein_id="ABM11188.1"
FT                   /translation="MLIHSTDKRVRTVTFDRAEAMNAFNEALYHATADALLDAASDDDV
FT                   AVVVLTGQGRAFCAGTDLQEMLDRDPSIPFTEGAHGFRRLIDNLIDFPKPLVCAVNGIA
FT                   VGLGTTLLGYADLVFMSTSARLKCPFTSLGIAPEAASTYLLPELIGRQNAAWILMSSEW
FT                   ISAEEALAMGLAWKVCEPAELMPTAFDYAERLAAQPLESLVAVKQAMGAPHAADIRAAL
FT                   ALENALLDRLVGGPANTQALNGFAAARASRER"
FT   gene            complement(371152..372288)
FT                   /locus_tag="Mvan_0341"
FT   CDS_pept        complement(371152..372288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0341"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   fal:FRAAL1666 putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11189"
FT                   /db_xref="GOA:A1T1Y9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Y9"
FT                   /protein_id="ABM11189.1"
FT                   /translation="MDFLESPEHRDLRQAVGAVTDKYGPGYFAECATAGEPTTDLWQDL
FT                   AAHGFIGISLPEEFGGGGAGMAELAIVCEETAAHGCPLLLLLVSSAISGELIARYGSAE
FT                   QRQEWLPRMASGETKVVFAITEPDAGSNTHKISTTAQRDGDDYVITGTKYYISGVDEAG
FT                   ALIVVARTAPEKLSLFLVPTDAPGLVAHRLPVGISLPEKQFTLHFDNVRLPATSLVGTE
FT                   HEGFRQVFDGLNPERITGAAVCLGVGRHAIAKAADYARVRSVWGPAIGSYQAISHPLAQ
FT                   ARIEVDLAAMMTAKAAWLYDNGHPAGEASNMAKYAAAEAAVAAADQAIQTHGGNGLSAE
FT                   YGLLPQWGLARLLRIAPVSREMILNYVAQHTLALPRSY"
FT   gene            complement(372288..374051)
FT                   /locus_tag="Mvan_0342"
FT   CDS_pept        complement(372288..374051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0342"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   mmc:Mmcs_3206 protein of unknown function DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11190"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z0"
FT                   /protein_id="ABM11190.1"
FT                   /translation="MSTRPVRIGNASGFYGDRLTAMRSLIDGGDIDVITGDYLAELTML
FT                   ILWKARQKDPETGYARTFLTQFADVVTDCADRGIKIVVNAGGLNPAGMAGQVRRIAAAA
FT                   GVDMKVAHVEGDDLMPNLRFLQDSGIAFEHLDTGIPLADSDRSPISANAYLGGWGIAAA
FT                   LRGGADVVITGRVTDAALVVGVGAWWHNWQPTDYDALAGAVAAGHIIECGPQATGGNYS
FT                   QLDEITDRRYPGSPIAELASDGGFAITKHPGTGGLLSVGTVTAQLLYEVASPAYANPDV
FT                   VAHFDTMAVTQDGPDRVLVTGTVGSPPPPTLKVAMNAIGGYRNTMTMVLTGLNIEDKAA
FT                   WAADELFEILGGKDTFDDVDVQLLRYDRPDPTSLPEATAHLRITVKDRELAKVDRAFSN
FT                   AVVELAVAGYPGFHTTTPPGSASEFGVYWPTLVPATTVEHTVMHADGTREVIPHPVRTE
FT                   PAGPEPTVDTICAPVDFGRTLRRPLGNVVAARSGDKGGNANVGVWTDTPERWDWLHAHL
FT                   SVGRLRELIPEAGGLPIRRYAFPNLKALNFVIVGYLGEGVASCTRTDPQAKGLGEYLRA
FT                   LHTDIPERFVK"
FT   gene            complement(374048..374842)
FT                   /locus_tag="Mvan_0343"
FT   CDS_pept        complement(374048..374842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_3207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11191"
FT                   /db_xref="GOA:A1T1Z1"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017518"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z1"
FT                   /protein_id="ABM11191.1"
FT                   /translation="MDHDAYTQLLADLGAESEHLTGHLRALSFPQWGLATPAAGWGIQD
FT                   QVTHLAYFDDATVMALQQPHEFRPFADALMADGMDFPDRIAANHRILAPESMLDWYADS
FT                   RAKLLDVLSKHEPRDRMPWFGPDMSAASAATARLMETWAHGQDIYDALGIEHPPSPGLR
FT                   SIAHLGVATFAFSHRIHGVEVPSHAVHVALDAPDGGLWTWGPGDSADKVRGSAEDFVLV
FT                   VTQRRHWTETDLVAEGSAAKGWLELAQAYAGAPSRRLPEVTP"
FT   gene            complement(374846..375604)
FT                   /locus_tag="Mvan_0344"
FT   CDS_pept        complement(374846..375604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0344"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_3208 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11192"
FT                   /db_xref="GOA:A1T1Z2"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z2"
FT                   /protein_id="ABM11192.1"
FT                   /translation="MSVTYTVRNGVAWLTIDRPDARNSLNKAVRDGLFDGVRRFNADTA
FT                   AKVLVLTGAGDKAFCAGGDLKEMSADGLTIPPVDFVPQFGRNIKVDKPTIAAVNGAAFA
FT                   GGFLLAQTCDLCVASTTATFGITEVKVGRGSPWAAPLPLMIPRRVVMELVLTGAPMSAR
FT                   RAHEIGFVNRLAEPSDLVDSTQALAEQIAANAPLSVAAGKATAVLTAEYPLSEAYDHAE
FT                   RLWQEVYLSSDAQEGMQAFKDKRAPVWKGI"
FT   gene            complement(375601..377598)
FT                   /locus_tag="Mvan_0345"
FT   CDS_pept        complement(375601..377598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0345"
FT                   /product="Carbamoyl-phosphate synthase L chain, ATP-binding
FT                   protein"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   mmc:Mmcs_3202 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11193"
FT                   /db_xref="GOA:A1T1Z3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z3"
FT                   /protein_id="ABM11193.1"
FT                   /translation="MTNPTITKLLIANRGEIAARIIRTARAMDVATVALYSDADRDAPY
FT                   VTLADESVHLPGTAPADTYLRADLVLAAAARTGADAVHPGYGFLSENADFARACAQAGV
FT                   IFVGPSPEAIVAMGSKIAAKDMMRAAGVPVLPGTTVESEEDQDPERLRTAAADIGFPIL
FT                   VKAAFGGGGRGMRIVRGEHELVEAVASARREAASAFGDGTVFLEKFVESPRHIEVQIFG
FT                   DSHGTVVHLGERECSIQRRYQKIIEEAPSTAVDERLRDELGRAAVAAGKALSYEGAGTV
FT                   EFVMAPDGSFYFLEVNTRLQVEHPVTELVTGIDLVRAQLLVAAGHPIPSEMLHATPRGH
FT                   AVEVRLYAEDVAAGFVPVSGTLTTLEFPTFDGIRIDAGFTSGSKVSTFYDPMLAKVIGF
FT                   GATRADACALVARALTETRVHGVTTNRDLLVGILREQEFLAGAIDTGYLERHDPAELTG
FT                   ASSSVSTLRTHALAAALAAQAGRRTDTSILPGLPSGWRTLRSQDQVVAFTAGDHTVEVR
FT                   YRFGRATVSVRIGDWEPEVQIVAASASCLDAVIDGVRRQYHLTISGATHYVDSGLGSSA
FT                   LTEVDRFPDPSANQEPGSLLAPMPGSVVRVEVDEGAEVAAGTTIVVLEAMKMEHSVRAP
FT                   AGGVVASLSVAVGTQVESGQVLAVVAEAQP"
FT   gene            complement(377609..379207)
FT                   /locus_tag="Mvan_0346"
FT   CDS_pept        complement(377609..379207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0346"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: mmc:Mmcs_3201
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11194"
FT                   /db_xref="GOA:A1T1Z4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z4"
FT                   /protein_id="ABM11194.1"
FT                   /translation="MTVLTSDVDPASDTFQFNREVQSAAVAALDEQLRLVADGGGERYV
FT                   KRHHDRGRLLARERIELLVDRDAPFMELSALAAWGTEFNVGAAIVTGVGVVSGVECMII
FT                   AHDPTVRGGTMNPYTLRKNLRALEIARVNRLPVVYLVESGGADLPTQSELFVHAGKIFH
FT                   DLTELSSLGIPTISLVFGNSTAGGAYVPGMCDYAVLVDKQAKVFLGGPPLVKMATGEES
FT                   DDESLGGADMHTRVSGLGDYFAVDETDAIRIGRDIVAHLNWHKLGPGPTQPADEPLYDV
FT                   EELLGIASGDSRVPFDPREVIARVADGSRFSEYKPRWGTSLATGWASIHGFPVGILANT
FT                   RGVLFSEESKKATEFILLANQTDTPLIFLQNVTGFMVGAEYEQGGIIKDGAKMINAVTN
FT                   STVPHITINMGGSFGAGNYGMSGRAYDPRFMFSWVNAKLAVMGAAQLAGVLSIVGKAAA
FT                   AAAGREFDREADAKRTAEIEAQIEKESHSFFVSARIYDDGVIDPRDTRSVLGMALSAAH
FT                   SNVVEGRRGFGVFRM"
FT   gene            complement(379370..380311)
FT                   /locus_tag="Mvan_0347"
FT   CDS_pept        complement(379370..380311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0347"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   bur:Bcep18194_C6742 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11195"
FT                   /db_xref="GOA:A1T1Z5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z5"
FT                   /protein_id="ABM11195.1"
FT                   /translation="MHVPIPSRILPWAGRLRLPVIAAPMTSVSTPELVIGACRSGAIGS
FT                   FPTHNAATTRELDAWLARAKSELAAEAAPVAPNLVVHRSNPRRDDDLAVLIHHKVELVI
FT                   TSVGSPAPVIEPLHNAGARVFADVASLEHAWRALDAGADGLVLLTAGAGGQTGWANPFA
FT                   FVRAVRENFDGPVVLAGGISDGRAILAAQILGADFAYLGTRFIATRQSAAGDDYRDALV
FT                   AATLDDVRLSDRVGGVPASLLSCWLDAQSTPGADGAGSGFTQKQLLANREAWSAGHSVS
FT                   GVHGVVDVADLVEELLTGYTVARRELKLVIGN"
FT   gene            380532..381557
FT                   /locus_tag="Mvan_0348"
FT   CDS_pept        380532..381557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0348"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: regulatory protein, LuxR; GAF domain protein;
FT                   sigma-70 region 4 domain protein; Sigma-70, region 4 type
FT                   2; KEGG: mag:amb1255 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11196"
FT                   /db_xref="GOA:A1T1Z6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z6"
FT                   /protein_id="ABM11196.1"
FT                   /translation="MVPGNVGFAEMADRLADASAASQRMMTATAERAGRDLGGVLNALA
FT                   LLRENTAVPDVLQQAGLEVCRTAVFDWVMVSRVAGSTWRPVVRYEMGADGRVTVDVDES
FT                   GCGVDTSDIPLMSPLVEAEVVRRRLPALVLDAGHEPRVHRPLVDRAGTTQYVVAPVVVE
FT                   GAVIGLIHASSAAPGRVLTDLDRDLLRMFADGVGLVYERAALAERSERQRCAVTEVCDA
FT                   AVRSFDEVNPIAAFGLGSEPGLVSPDGDSVPAPFAGICESRGAGRGGTRLARLTARERE
FT                   VLALLASGATNAQLADRLTVAESTVKSHVKHILHKLGAGNRAAAIACYLRESPDRERQR
FT                   R"
FT   gene            381554..382732
FT                   /locus_tag="Mvan_0349"
FT   CDS_pept        381554..382732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0349"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: gvi:glr4404
FT                   two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11197"
FT                   /db_xref="GOA:A1T1Z7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z7"
FT                   /protein_id="ABM11197.1"
FT                   /translation="MSVSMISDSARTAAGARPGGEWWAREIELVDQLRGLRERAARELR
FT                   GAVTLPAVEWDVPGRSAEAISALTHLCIDSLRRLSGGEVERAQRLCDLVLDLQRLAMDW
FT                   YLHDTAMRSQRLAECAAGLSRLRGVPSSAALLDNACQELVLRCGFHRAVLSKVESHGWK
FT                   PLMLHDRSADAGDSWFSDWINQTVPLVRDAPEAEMMSRRRPSLVHDTDTAPVYRPLIVH
FT                   AGRSRSYVVAPVLHGRDVVGFLHTDHHPLARRVDEADREVAWVFADGFSHLYERAVLLE
FT                   RLRAQRESVRELFFGAVDRIDELCESGLDTPRGAEADRCGDTDGQTGRPPVTLTEREAD
FT                   VFDLMVTGASNQEIADRLVITEGTVKSHVKHILRKYGAVNRAQAIAWALNGG"
FT   gene            complement(382739..383248)
FT                   /locus_tag="Mvan_0350"
FT   CDS_pept        complement(382739..383248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0350"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: nfa:nfa3820 putative flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11198"
FT                   /db_xref="GOA:A1T1Z8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z8"
FT                   /protein_id="ABM11198.1"
FT                   /translation="MTVSAASYRAALRRHAAGVAIITLTSDTGPVGFTATSLASVSLDP
FT                   PLVCFNITHTSSSIAALRKASSVVVHILGEHQLDLARRFSRSAEHRFSEPESWSLLDTG
FT                   EPVLTGTPTWLRASVNQLIPVGDSTLVIAQVDHIHCDDRDGTSPAPLVYHDGTFLATSP
FT                   LPAVSS"
FT   gene            complement(383245..383718)
FT                   /locus_tag="Mvan_0351"
FT   CDS_pept        complement(383245..383718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro04391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11199"
FT                   /db_xref="GOA:A1T1Z9"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1Z9"
FT                   /protein_id="ABM11199.1"
FT                   /translation="MTLPTSVQEDHDVTVHKPPRVGITHGDQVRMDSTAPSVRIRGRDL
FT                   REVAQRARSTREQQPGVDVLVDIDVMIAPTAPAARELMAAADPDLPAGTLRYVGTPTGL
FT                   AGLINDLHALGIADGAVLQPLLASVAGLIQESTLPALNTMSANVFGSPESQSA"
FT   gene            complement(383735..385234)
FT                   /locus_tag="Mvan_0352"
FT   CDS_pept        complement(383735..385234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0352"
FT                   /product="aldehyde dehydrogenase (acceptor)"
FT                   /EC_number="1.2.5.2"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_4650
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11200"
FT                   /db_xref="GOA:A1T200"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1T200"
FT                   /protein_id="ABM11200.1"
FT                   /translation="MSNHYSLYIDGKWLDTDDNYEIRSPATEELVATVAKGDVSHVDAA
FT                   VAAARGAFDEGTWRRTPPAERAALINTVAERLAARTEELAALQSRENGATIRITGALHV
FT                   GLSAAQLQYVAAIARDYEWETTGPAIEPVPAAGIVVREPIGVVAAIVPWNIPLLTTVWK
FT                   IGPALAAGNSVVLKPDEHAPLLPLELAREFDAAGLPPGILNVVTGDGEPVGAHLSGHPG
FT                   VRKVAFTGSTAVGKSILRQSADSIRRVTLELGGKGANIILDDADIEMAVDGALFACMAN
FT                   NGEACEAGTRLLIPRSRRDEILAKLLARASTLRLGDPLQPTTHVGPIISAHQRDRILDY
FT                   FEIAKAEGATVALGGGVPDGPGFDKGYWVEPTIFVDVTNNMRIAREEVFGPVLVVLTYD
FT                   STDEAIKIANDTNYGLSAGVWGSEENALQVARRLDSGMVWVNNWHVIHPAYPFGGYKES
FT                   GLGREGGPHAIDEYVEEKFISIDRSGGIENKAFAIVIDPAV"
FT   gene            complement(385249..386853)
FT                   /locus_tag="Mvan_0353"
FT   CDS_pept        complement(385249..386853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0353"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bcn:Bcen_5034 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11201"
FT                   /db_xref="GOA:A1T201"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T201"
FT                   /protein_id="ABM11201.1"
FT                   /translation="MEHLDTGMWGVLPEVLDRACTYYSDRVAIVDGDRSLTYRELWLWR
FT                   NRIANALIAAGVQKGDRVGLLMPNCLEFIPVQQAVWAAGAVLVQMPTRAAADGFRSNLA
FT                   QTDATTLLYHAKFEESVAAIRDELPKLQTVIRVGEPIAALTEAADFAAVVSAAADTRPD
FT                   VAVDEHDEAYVLFTSGSTGEPKGVVNSHYTWSYYAISAGLEIGDIRFGEVFAHGAPLTH
FT                   FTQIFVIPTFIRGGTNVMLPGLDVESLLSNIERHRVTATAVVPTIIYLLLDHAGRDRFD
FT                   IASLNTMIYAGAPMAPERLRQALDTFGPIFIQTYAGTEQGYVSCLRKHEHLAGEGESDE
FT                   DWVARLASAGRPMFAVQVTIRDDRDNVLPTGEAGEICTRQLGQMLGYLDAQRNAETVRD
FT                   GWVHTGDIGRLDERGYLYLVDRKKDMVVSGGFNVFPRQVEDVLCTHPTVAQAAVIGVPD
FT                   PKWGESVLAMVVARPGEITGTELQLELVDHVKQALGSIPAPKKILFTDELPLNPAGKVD
FT                   KKAIRKPYWQSNSRQIG"
FT   gene            complement(386869..387381)
FT                   /locus_tag="Mvan_0354"
FT   CDS_pept        complement(386869..387381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11202"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1T202"
FT                   /protein_id="ABM11202.1"
FT                   /translation="MTLDTTMAAQHAARWANALSSDTDAAVALYADDLVYDDHMDSDHV
FT                   LDTAITKDELQPRLAPFANKNPDNGVGLHTFTANEAFQLAGVNGNPAVVILWDWTGEGL
FT                   TTFRGVPTDGKTLTTRGITWHQLDADGKIARETTYWNDTPVLQELGLPIITPEYWVEGF
FT                   DPAALAQ"
FT   gene            complement(387396..387848)
FT                   /locus_tag="Mvan_0355"
FT   CDS_pept        complement(387396..387848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0355"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11203"
FT                   /db_xref="InterPro:IPR011721"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1T203"
FT                   /protein_id="ABM11203.1"
FT                   /translation="MSHTFAVKWLKAFRESPEAVVALYADDFLFEDPILGQSITSKEDL
FT                   LRVFAPYANADTENGIGINNFRIDEVVGDEKAAIYRWTWQAPTATAFVGVPTNGKVPGT
FT                   RGITFHIYDTDGRIKREESFWDVSTAVRDLGLPVDPSAVAKAPALV"
FT   gene            388050..389348
FT                   /locus_tag="Mvan_0356"
FT   CDS_pept        388050..389348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0356"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: bha:BH2178 short-chain-specific acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11204"
FT                   /db_xref="GOA:A1T204"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T204"
FT                   /protein_id="ABM11204.1"
FT                   /translation="MTGSIGTNRSTIKGVTMLEQDLTDEDFAPYFVKAQEVSQFFREIG
FT                   PKYDQENTFAYPSIEVFKKSGLGALPVPKAFGGPGGNILQVSKVVSELSKGDSAITLAY
FT                   NMHYIMVGIAGNLMSEEQNKYWLGRVADGELMFGPFSEQRAGFSGLADMQAVPQKDGGW
FT                   KLYGKKTWGTLCEAADIITTNATETDADGNLPDTFDGRVAAEKLFIGDFKVDENGVGDG
FT                   IRIEKTWDALGMHATGTQTIVFDGYFVPEDGFVSVWRAGAFGVLEWASLMFASIYLGMQ
FT                   QRILEESVKSLSKKHLGATFGAIVAADTEVKSVGHIIDGIGDMASRVECSRRVLYQTCQ
FT                   DLLDGKDKLWAPELRFPYLGLAKTFIAGNVMHMSRQAMSMVGGQSFRRGGIFERLYRDS
FT                   AASMFQPLNGDQTRTYIGQFLLESAAAQNGASS"
FT   gene            389456..389788
FT                   /locus_tag="Mvan_0357"
FT   CDS_pept        389456..389788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0357"
FT                   /product="Limonene-1,2-epoxide hydrolase"
FT                   /note="PFAM: Limonene-1,2-epoxide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11205"
FT                   /db_xref="GOA:A1T205"
FT                   /db_xref="InterPro:IPR013100"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T205"
FT                   /protein_id="ABM11205.1"
FT                   /translation="MLGDEGEWVAGPPPIPVTHCAQEAVGLLEGFRANYDLTTIDVELL
FT                   HIGMSNNVICTERVDHLIDSTGRRFISLPIAGIMRLADKPEADAVEVAYWRDYWDMRDF
FT                   LDLPTA"
FT   gene            complement(389785..390831)
FT                   /locus_tag="Mvan_0358"
FT   CDS_pept        complement(389785..390831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0358"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_1795
FT                   putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11206"
FT                   /db_xref="GOA:A1T206"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1T206"
FT                   /protein_id="ABM11206.1"
FT                   /translation="MYVDGNLGGSIDGTGGADLNVLAEQVGTAERIGYDGIWSTEVSRD
FT                   PFLPLLLAADRSTSLQLGTGVAVAFARSPMTMATVANDLNTFSQGRFVLGLGSQIQPHI
FT                   TRRFSMPWSAPADRMREYIHALQAIWHSWQTGDKLDFRGDHYQHTLMTPMFSPAANPFG
FT                   PPPVMVAAVGPKMTTVAAEAADGLLVHGFTTARYLREVTLPTVEKGLVATGRTRGDFTT
FT                   SYPGLIATGAEERDFNEALARVRHQIAFYGATPAYRAVLELHGWSELHTELHRLSKAGD
FT                   WDAMTGLIDDEVLGTFAVVGEPKDVGRDIIRRFDGLIDRFTLYTPYPLDEATRAEIVEG
FT                   IRCESRGA"
FT   gene            390980..391816
FT                   /locus_tag="Mvan_0359"
FT   CDS_pept        390980..391816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11207"
FT                   /db_xref="GOA:A1T207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T207"
FT                   /protein_id="ABM11207.1"
FT                   /translation="MGRMPADVMAHDLNLLWQNIFTWVSWAIVVAMVVIAVRMGVRQRT
FT                   PFYLIAILAAGVGAYAEPLYDVAFDLWFYDARNGEPGAGYMHFSAFGVEQPIWTHSGYM
FT                   ILYATACLYAGRRIYEGRLGRRGLFLIWGAEVLASCVFEVIGTGTDVYTYYGPYVLRIW
FT                   NYPLVIGVLEGTQVILFTVVAVLIWRQVSTAWGLLSLFVVFPMTFYAANFGLGAPLIIA
FT                   MHLDRGLATSAVIWAATLLTIGLCTFIVYGLSTFLPRPFPAPVDGRAETVAAVSTR"
FT   gene            complement(391813..392394)
FT                   /locus_tag="Mvan_0360"
FT   CDS_pept        complement(391813..392394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0360"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: tfu:Tfu_0949
FT                   putative TetR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11208"
FT                   /db_xref="GOA:A1T208"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1T208"
FT                   /protein_id="ABM11208.1"
FT                   /translation="MRTNARTRDPERKSRIMAAAADLVARKGFHAVSIAEIGAAAGITG
FT                   SGIYRHFESKSAVLVALFDRVIDELLRDEQEILNTTDDLGQALDLLIAGQVEFVVADRE
FT                   LAQVYYNEINNLPEEDSRRLRRKQRLYLEEWVHLVNESRVDLTDAEARTVVHAVIGAIQ
FT                   SPLFHNTGLPEDRLRALLTDAARAVLGLDR"
FT   gene            393026..393796
FT                   /locus_tag="Mvan_0361"
FT   CDS_pept        393026..393796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0361"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_1522 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11209"
FT                   /db_xref="GOA:A1T209"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T209"
FT                   /protein_id="ABM11209.1"
FT                   /translation="MKLATAATKPLRGVGGFFAMSIDTFVAMVRPPFAFREYVLQSWFV
FT                   ARVSVLPALMLTLPYSVLLVFTFNILLKEFGAADFAGTGAAIGTVSQIGPIVTVLVVSG
FT                   AGATAMCADLGARTIREELDAMKVMGINPIQALVVPRVLAATTVALALSATVIIAGLAG
FT                   AFFFCVFVQNVSAGAFISGMTLLTGAADVFVSLAKATLFGLAAGLIACYKGISVGGGPA
FT                   GVGNAVNETVVFTFMVLFAINVIATAVGIQFTVQ"
FT   gene            393807..394661
FT                   /locus_tag="Mvan_0362"
FT   CDS_pept        393807..394661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0362"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mtc:MT2017 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11210"
FT                   /db_xref="GOA:A1T210"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T210"
FT                   /protein_id="ABM11210.1"
FT                   /translation="MTQSAPSRPHPRWYRAAHEVAAGWNELGDQARFYAGTLRAVPDAV
FT                   RRYPGELLRLIAQMGLGTGALAVVGGTVAIVGFLTITTGALVAVQGYNQFASVGVEALT
FT                   GFASAFFNVRLIVPGTTAVALSATIGAGATAQLGAMRINEEIDALEVIGIRSVTYLAAT
FT                   RVLAGVVVVIPLYCIAVMMAFLAARTGTTVIYGQGSGVYDHYFNTFLNPTDLVWSFLQS
FT                   VAITVVVMLVHTYYGYTARGGPAGVGEAVGRAVRTSMVVAAVEIVMISLAIYGQSGNFN
FT                   LAG"
FT   gene            394665..396029
FT                   /locus_tag="Mvan_0363"
FT   CDS_pept        394665..396029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0363"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mtc:MT2018 virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11211"
FT                   /db_xref="GOA:A1T211"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T211"
FT                   /protein_id="ABM11211.1"
FT                   /translation="MTVRAGENRLHSCWWALILVAALSVFVAATAAAFTGIFRSYVPVT
FT                   LTSDRAGLVMENGARVKMRGVQVGRVAEIRGGTGPAELLLEIDPEQIARIPANVQAQIS
FT                   VTTAFGSKFVDLVPPEHPSTDRLAAGAVLMSTNVSTEVNTVFENIVDLLDMVDPAKLNA
FT                   VLSAIADAVRGQGPRMGEATTGLNEVLTALNARSDTIRGDWRSFKGFNDTYNAVAEDIV
FT                   AILDGASTTSSTVVAHSAQLDTLLLNVTGFAESGTNLLTTSKDSLVDAVNTLAPTTALL
FT                   HKYDPIYTCWLQGATWFLENGGWDVWGGANGKSIQLDIALLAGNDPYRFPDNLPRIAAK
FT                   GGPGGAPGCGSLPDATKNFPVRQLVTNTGWGTGLDIRPNPGIGHPCWANYFPVTRAVPE
FT                   QPSIRQCIPGPAIGPVPYPGAPPYGAALYGPGGTPLWPGLPPAPPPPTQEGAPAP"
FT   sig_peptide     394665..394766
FT                   /locus_tag="Mvan_0363"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.948 at
FT                   residue 34"
FT   gene            396026..397054
FT                   /locus_tag="Mvan_0364"
FT   CDS_pept        396026..397054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0364"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mtc:MT2019 virulence factor mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11212"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T212"
FT                   /protein_id="ABM11212.1"
FT                   /translation="MRGNFAAAAWRLGIFLAVCALGTFVLLSVFAQFRFGDGKTYQAEF
FT                   SNVSGLKDGDLVRIAGVEVGKVKSITVGSDAVVTVSFDTDDTVVLTDGTRAAIRYDNLF
FT                   GGRYLALEEGVGGLHEMSPGHTIPLARTEPALDLDSLIGGFRPLFRALDPEQVNELSAQ
FT                   LIGALQGQGPTIGSFLEQAAAVTNTLADRDQLIGEVVVNLNTVLGSIGQQSDRFDTAVT
FT                   SLSELVHGLAERRTDISDAVAHTNSATASLADLLAATRPPLQRVVHETDRAAAIAVADH
FT                   EYLDNLLNTLPDRYQALGRQGMYGDFFSFYLCEIVLKLNGKGGQPVYVKVAGQDSGRCT
FT                   PR"
FT   sig_peptide     396026..396136
FT                   /locus_tag="Mvan_0364"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.694 at
FT                   residue 37"
FT   gene            397051..398364
FT                   /locus_tag="Mvan_0365"
FT   CDS_pept        397051..398364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0365"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mtc:MT2020 virulence factor mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11213"
FT                   /db_xref="GOA:A1T213"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T213"
FT                   /protein_id="ABM11213.1"
FT                   /translation="MKTFSERNPVVIGAIGVAVVAVIVTMALQYQKLPFLNPGKQYSAY
FT                   FADAGGLFTGAGVEVSGYPVGKVSDISLDGPRVLVTFKILGNINLGEQTEATIRTKSLL
FT                   GTKVLNVMPRGAGKLDGPIPIERTSSPYQLPDALGDLARTVSGIDTNQLSDSLSMLAQT
FT                   FADTPPHLKTAVEGVARFAETINQHDDQMRSLLDNAAKVTAVLAERTEQVVTLVHDTNA
FT                   LLAQLRTQSEALDAIWFNISAVSEQLRGFIAENRQELKPALEKLNGVLTIVDNRKDRLQ
FT                   KAVKLLNSYAMSLGESVSSGPFFKAYVANLLPGQFVQPFIDAAFSDLGLDPNVLAPSEL
FT                   TDPQLGQPGTPALPVPFPRTGQGGPPMLNLPDAITGNPGDPRYPYREPLPAPAPGGPPP
FT                   GPPAIAPPGIASTPDPDPSAVFVPAPGEAPSVTAGAQS"
FT   gene            398361..399680
FT                   /locus_tag="Mvan_0366"
FT   CDS_pept        398361..399680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0366"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mtc:MT2021 virulence factor mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11214"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T214"
FT                   /protein_id="ABM11214.1"
FT                   /translation="MNLLWRSRSLLSVLLATILVGGLVVVVGAGGRTSQNVVVAYFENS
FT                   NGLFPGDDVRVLGVPVGRVLEIEPQPDRAKVTFGYDRAIQIPADAKAAILSPQLVTGRA
FT                   IQLTPAYTGGPVMADGAVIDQSRTVVPVEWDDFRDQLERLTELLKPTEPGGVSTLGAFV
FT                   NTAADNMRGQGGAIRDTVVKLSQTLSTLGDHSDDIFATFTNLSTVVTALHDSSGALEAL
FT                   NGNLAQVSTLLADNPDKVGLAVEALNAAAIEVKTFAEENRDVIGTTSDKLTSISSTLVG
FT                   SLDDIKQTLHIAPTTIGNFANIYEPANGALTGALAVNNFSNPIEFLCGAVQAASRLNGE
FT                   QSAKLCAQYMAPIFKNRQYNFPPLGFNFFVGAQARPNEITYSEPWMRPDYVPPAVPPAP
FT                   EPVAAEPGPLPAEAGSEPAPVPTDPAQGLTGLMVPHGGGS"
FT   sig_peptide     398361..398450
FT                   /locus_tag="Mvan_0366"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.582 at
FT                   residue 30"
FT   gene            399677..400813
FT                   /locus_tag="Mvan_0367"
FT   CDS_pept        399677..400813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0367"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mtc:MT2022 virulence factor mce family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11215"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T215"
FT                   /protein_id="ABM11215.1"
FT                   /translation="MTPLRRCLGAMLIPLTVLLATGCTQWRGLNSLPMPGTQGRGDGSF
FT                   LIQVQMPDVSNIEPNSRVRVGDVSVGTVTRIERQDWHALLTVTLDGDVDLPANATVKLG
FT                   QTSLLGSLHLELAPPTDEPPQGQLAAGSLIPLSHSGSYPSTEETLAAVSSVLNGGGLGH
FT                   VQDITEAFSTAFRGREQDLRSLIGELDTFTADLDDQTPDIIAATDSLNQLASKFAARKP
FT                   VLDRALETIPDALAELNQQKEDLINAADQFAKFSALTVDTVNQTKDNLVAQLQQIGPVL
FT                   ESLADAGPSLTRSLSLIPTFPFPNETIENWQRGDYANLTAIVDLTLSRIDAGLFTGTRW
FT                   EGDLTELEMQWGRTIGQFPSPYTQGNPLVAPYRWDQGP"
FT   sig_peptide     399677..399745
FT                   /locus_tag="Mvan_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.533 at
FT                   residue 23"
FT   gene            400814..402259
FT                   /locus_tag="Mvan_0368"
FT   CDS_pept        400814..402259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0368"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1659 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11216"
FT                   /db_xref="GOA:A1T216"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T216"
FT                   /protein_id="ABM11216.1"
FT                   /translation="MHLHRRIKIQLAIFAVIALAAMAIMVFQFMKLPAQLFGVGRYTVI
FT                   MQLSKTGGLYSTGNVTYRGTEVGRVQEVRLTDDGVEAVLSLKSGIEIPSDLEAEVHSQS
FT                   AIGEQYVALSPRNGSSRPLREGDVITRANTSVPPDINTLLSAANTGLQSIPADNLKTLI
FT                   DESFIAVGGLGPELSRIVRGSTDLSIAARKNLDPLLALIDRAQPVLDSQTDTAAEIQTW
FT                   ASHISNVTASLKERDESVAGFIDNGGPAAEEARAVLDRLQPTLPILMANLVSIGQVAMT
FT                   YQDNIEQLLVLLPQAVAVSQAGILANLNTKHPGQYISFNLNINLPPPCTTGFLPAQQRR
FT                   VPTEVDSPERPPGDLYCRTPQDSQFNVRGARNAPCATVPGKRAPTVRLCESDEQFVPLN
FT                   DGFNWKGDPNATLSGQPIPDLGPVPAAAPAQPAAQPPPLAVAEYDPATGSYIGPDGKQY
FT                   RQADLGQSAPGGQTWQTMLLPPN"
FT   sig_peptide     400814..400930
FT                   /locus_tag="Mvan_0368"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.968) with cleavage site probability 0.868 at
FT                   residue 39"
FT   gene            complement(402299..402871)
FT                   /locus_tag="Mvan_0369"
FT   CDS_pept        complement(402299..402871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0369"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_3223
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11217"
FT                   /db_xref="GOA:A1T217"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T217"
FT                   /protein_id="ABM11217.1"
FT                   /translation="MDAAERSILQRGFQASTMELIAREAGYSRAAMYRQFPSRQHLLEA
FT                   LVARKTRRHQIEIVSRMPENADLAEILVEGLVIVATELVHDPLLQTLSEQTDEGTVAHL
FT                   VAGAARLPELVEQLFEAMDDGEAGPTFRPGLRADDVGQFLVTTSLTMLLGVIPGIADSE
FT                   TARRYVQTFVLPAILADPPAPREVFGS"
FT   gene            403066..404802
FT                   /locus_tag="Mvan_0370"
FT   CDS_pept        403066..404802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afm:Afu4g13630 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11218"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T218"
FT                   /protein_id="ABM11218.1"
FT                   /translation="MDSRWTVLIGAGFVAATMSGLVVLGVPTAFAAPGETETVSATESD
FT                   TPSDAAPAETSAPDTEHEDEQSAPEHGIDAANPPLEADLEADLEAEYPDRERNGDKVIP
FT                   VEGDVTDGAVGDEGAVGDEGVVGEDVVGDEDVDVDEDIAEPAEPAVIVESDAGITPATV
FT                   TFTEEPRTDKDSPQRSLAETESVPLGATAETTPSRAPSLLNLVGSVVLNVLVGFIQLID
FT                   GPPVLPANSSVTVRTSTLNLPIGSGRSVQADWYFPETVDESTRLVYFQHGFLASGPMYS
FT                   YTAARLAERTNAIVVAPSLTSNFFAPDAAWVGGSTMHRAVAELFVGDRAALAESAGAAA
FT                   GHTITLPDKFVLVGHSAGGTLVTSAAGFMVDNGAIEHLAGVVMLDGVEPAGSRLVGDAL
FT                   AKLRGAHDRPIYLISSERYFWSRGGDMADKLQLARPDRFTGVGLKGGLHIDYMEGGNPI
FT                   VQFGEYLVGGFSLPRNIDAAADITVGWVNDLFAGTMTEGVYGAPGQHIPVVTPSGTATA
FT                   VVLPLGVPARPVWPPLLDTILTAVFDFGGRYLFVYEPLRGYQTAANPATSQQGALVGAS
FT                   RH"
FT   sig_peptide     403066..403161
FT                   /locus_tag="Mvan_0370"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            404897..405631
FT                   /locus_tag="Mvan_0371"
FT   CDS_pept        404897..405631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0371"
FT                   /product="cutinase"
FT                   /note="PFAM: cutinase; KEGG: mmc:Mmcs_5300 cutinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11219"
FT                   /db_xref="GOA:A1T219"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR011150"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T219"
FT                   /protein_id="ABM11219.1"
FT                   /translation="MSERRSTGPAASDTSVRRALVMAGVGGVLAAGLIGPGAASAQAAE
FT                   SCPDVQVVFARGTAEPAGLGRVGQAFVDDLQNELSGRTVSVYAVNYPASYDFLQSAPVG
FT                   ADDASARIQATVATCPATSIVIGGYSQGAAAVDLITADPNATFGFGRPLPPAVADHVAA
FT                   VAVFGNPSTKIGRPLTAVSPLYGANAIDLCNGADPVCSSGDDRPAHSQYVQAGLAQQAA
FT                   DFVAGRVAGHSPSDVVINASAR"
FT   sig_peptide     404897..405028
FT                   /locus_tag="Mvan_0371"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.937 at
FT                   residue 44"
FT   gene            complement(405612..406247)
FT                   /locus_tag="Mvan_0372"
FT   CDS_pept        complement(405612..406247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0372"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Resolvase
FT                   helix-turn-helix domain protein; KEGG: mmc:Mmcs_1486
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11220"
FT                   /db_xref="GOA:A1T220"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T220"
FT                   /protein_id="ABM11220.1"
FT                   /translation="MRSRGWSGRWPASDEEAINRILDAADDIVAEHGAAMRLTDVARAL
FT                   GVTRQTVYRYFPGPEAIVVACAMRAADGFIDQLAAHVRGLTDPVAAMVESVSYSVERLA
FT                   GDHQFENLLTSRRRGNVTTSLTSETAMTFARSILQRFDIDWKQHGFDETALDELAELSL
FT                   RTMHSLLVDPGEPPRDGVALRRFVARWLGPAILYPRLARAVDVISPRR"
FT   gene            complement(406240..407469)
FT                   /locus_tag="Mvan_0373"
FT   CDS_pept        complement(406240..407469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0373"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mpa:MAP4068c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11221"
FT                   /db_xref="GOA:A1T221"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T221"
FT                   /protein_id="ABM11221.1"
FT                   /translation="MVVSPTVANVFDAGLPTLTYDVFSTPAQVWPDLHDAQRTAPIAIG
FT                   PMGPEVLSYEMARAVLRDTRFTIPPGINLAAQGITSGPLFDKVMSTLLCLEGSEHQRLR
FT                   KLVSKAFTPRATERLHDTIVAVVDELVDNIAGARRCDVVADIARPYPIPIICALLGAPR
FT                   EDWRLFSDWTEDVFRAFSFSTDVATVQDDVMRAWNELDDYVDRMVAHRRRHLTDDLLSD
FT                   LIRAEDDGDRLSTSELQMLAASLLMAGTDTTRNQLAASVQALSERPDQWALLADRPELA
FT                   MRAVEETMRHSPVVCGAPRIVLDDVEFDGYLFPAGTFVFVNTFAANRDPAVYADADRLD
FT                   LTREQAPAILTFGGGVHYCLGANLARRELAEALRILAGRLSNPRRSGSAPWKPMLGMTG
FT                   PTVLELEFDA"
FT   gene            complement(407600..408571)
FT                   /locus_tag="Mvan_0374"
FT   CDS_pept        complement(407600..408571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0374"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mpa:MAP1683c hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11222"
FT                   /db_xref="GOA:A1T222"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1T222"
FT                   /protein_id="ABM11222.1"
FT                   /translation="MVLTARSDADPPGRHLDERLRRKMLLINLGLLSAVYALAVVQALV
FT                   LDSPRSDARGEIVAVALTVAGLLVSLRAPLAGWRYVVALFCISAAPILSVLFHELIAAQ
FT                   IWSVVPLMFVAIFIRTWHSATTARVVVAGIAAAAVIALLVAPAPIPVVWLAFYAVSVLG
FT                   AAEVFGLGNAALLDAAFRDPLTLVWNRAGVSRRVGRLVRQARRRSQEIAVLVFDVDDFK
FT                   RVNDQRGHAAGDRLLTDLAGRWVAEIPRSSVMGRIGGDEFVLIVGGFDETQARALADQL
FT                   TSGLPVPVTYGVAAGPPGHRALDTLFAAADRDLYERKRLRKA"
FT   gene            408663..409532
FT                   /locus_tag="Mvan_0375"
FT   CDS_pept        408663..409532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0375"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mmc:Mmcs_0354
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11223"
FT                   /db_xref="GOA:A1T223"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T223"
FT                   /protein_id="ABM11223.1"
FT                   /translation="MVDQLDTGQLAALSAVVEFGSFDAAAERLHVTPSAISQRIKALEQ
FT                   RVGQVLVLREKPCVATPAGVPLLRLAAQTALLQAEALAEMRGGSAELPRIAMAVNADSM
FT                   ATWFTEVFARLPHVLFDIRIEDQDHSAQLLREGVVMGAVTTERAPVAGCRVQPLGVMRY
FT                   VPVATEAYVQRHLPDGFTREAAERAPSLAWNRADALQDQLVRKVFRRSVARPVHYVPTA
FT                   AGFGAAVHAGLGWGMYPIQLLDASFVPITDQHLDVPLYWQCWKLDSDTVRQVTAAVDSA
FT                   ASGLLRDR"
FT   gene            409557..410321
FT                   /locus_tag="Mvan_0376"
FT   CDS_pept        409557..410321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0376"
FT                   /product="precorrin-6A synthase (deacetylating)"
FT                   /EC_number="2.1.1.152"
FT                   /note="KEGG: tfu:Tfu_0320 putative CobF protein,
FT                   precorrin-6A synthase; TIGRFAM: precorrin-6A synthase
FT                   (deacetylating); PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11224"
FT                   /db_xref="GOA:A1T224"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR012797"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1T224"
FT                   /protein_id="ABM11224.1"
FT                   /translation="MVAAVKVRILGVGMGPQHVTPEVADALRTVDYVLAAEKADDDRLL
FT                   ALRRAIVRAHGGAELVALPDPPRDRSERLSAGGYESAVSDWHDARAAQYAGVLKERGGT
FT                   AAFLVWGDPSLYDSTIRVVEKVRALLEPHVALDFDVLPGISAPQLLAARHRIVLHEVGK
FT                   PVHVTTGRRLQEAVAAGMDNIVAMLNPPPERLDFTGLDDWTIWWGANLGAPGERLVTGR
FT                   LRDVLPAVADARAAADAYDGWVMDVFLIRRDR"
FT   gene            410318..411790
FT                   /locus_tag="Mvan_0377"
FT   CDS_pept        410318..411790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0377"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="TIGRFAM: cobyric acid synthase CobQ; PFAM: Cobyrinic
FT                   acid a,c-diamide synthase; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: mbo:Mb0261c putative
FT                   cobyric acid synthase CobQ1"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11225"
FT                   /db_xref="GOA:A1T225"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T225"
FT                   /protein_id="ABM11225.1"
FT                   /translation="MTGLLIAGTTSDAGKTAVTTGLCRALARRGLKVAPYKAQNMSNNS
FT                   MVCAGDDGGVEIGRAQWVQALAARATPEAAMNPVLLKPGSDRRSHVVLMGRPWGHVSSS
FT                   DWLEGRRALAAAAHAAYDDLAGRYDVIVAEGAGSPTEINLRAGDYVNLGLARHAGLPTV
FT                   VVGDIDRGGVFAAFFGTVALLSPEDQALIAGFVVNKFRGDPALLAPGLRDLERLTGRRV
FT                   YGTLPWHPDLWLDSEDALELQGRRSARPGARRVAVVRLPRISNFTDVDAFGLEPDLDVV
FT                   FASHPSALADADLVVLPGTRSTIADLAWLRSRGLDRAVLAHAAAGRPVLGICGGFQMLG
FT                   RVIRDPHGVEGGTSEADGLGLLDIETDFVADKALRLPEGQWEATSASGYEIHHGRITPG
FT                   PGGDEFPGGVRCGPVFGTMWHGAFEGDALRARFLTETLGVPASGASFPKAREDRIDLLG
FT                   DLVEEHLDVDALLRLAEHAPPQGLPFLPPGSP"
FT   gene            411790..412527
FT                   /locus_tag="Mvan_0378"
FT   CDS_pept        411790..412527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0378"
FT                   /product="precorrin-6A reductase"
FT                   /EC_number="1.3.1.54"
FT                   /note="KEGG: tfu:Tfu_0310 precorrin-6x reductase CbiJ/CobK;
FT                   TIGRFAM: precorrin-6x reductase; PFAM: Precorrin-6x
FT                   reductase CbiJ/CobK"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11226"
FT                   /db_xref="GOA:A1T226"
FT                   /db_xref="InterPro:IPR003723"
FT                   /db_xref="UniProtKB/TrEMBL:A1T226"
FT                   /protein_id="ABM11226.1"
FT                   /translation="MRIMLLGGTSEARALAELLTAESVEVTTSLAGRVNDPRLPVGEVR
FT                   IGGFGGVDGLRAALSGYDAVVDATHPFARNISANAAAAAGDTPLLRLERPGWADRSRDS
FT                   WHWVDTHEEAAAAAAQLGRRPFLTVGRQEIARFIPDLRDRAVLARVVQAPDVALPPTWR
FT                   LLTSRGPYELPGELHLMREHRADVLITKDSGGQHTWPKMEAAAQLDVPVVVVRRPARAA
FT                   GVPTVHDATEAVAWVRNLPGASR"
FT   gene            412524..413051
FT                   /locus_tag="Mvan_0379"
FT   CDS_pept        412524..413051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0379"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="PFAM: cobalbumin biosynthesis enzyme; KEGG:
FT                   mbo:Mb0260c putative bifunctional cobalamin biosynthesis
FT                   protein CobU: cobinamide kinase + cobinamide phosphate
FT                   guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11227"
FT                   /db_xref="GOA:A1T227"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T227"
FT                   /protein_id="ABM11227.1"
FT                   /translation="MMILVTGGVRSGKSRHAEALLSDARQVTYLAPGRPADGSDPDWDA
FT                   RVAGHRTRRPAHWQTVETADVAAAVRDADGAVLVDCLGTWLTAVLDRNNLWDKGSREVH
FT                   DAVDARLTALCAALTARREAVVVVTNEVGLGVVPSHRSGVLFRDLLGTANQRVAAVCDE
FT                   VHLVIAGRVLKI"
FT   gene            complement(413061..413510)
FT                   /locus_tag="Mvan_0380"
FT   CDS_pept        complement(413061..413510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sco:SCO2460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11228"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1T228"
FT                   /protein_id="ABM11228.1"
FT                   /translation="MGAMTVRDIQVTFDCGDPGALAGFWAHVLGYVLQPPPAEFDTWED
FT                   ALAAMQVPPERWNDASALIDPDGRRPGVFFQRVPEGKTAKNRVHLDVRAAEGLDGAERM
FT                   AALERECTRLVALGATRLERHEAISLLQGGHIVMADPEGNEFCLD"
FT   gene            complement(413511..414152)
FT                   /locus_tag="Mvan_0381"
FT   CDS_pept        complement(413511..414152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0381"
FT                   /product="cob(II)yrinic acid a,c-diamide reductase"
FT                   /EC_number="1.16.8.1"
FT                   /note="TIGRFAM: cob(II)yrinic acid a,c-diamide reductase;
FT                   PFAM: nitroreductase; KEGG: fra:Francci3_2878 Cob(II)yrinic
FT                   acid a,c-diamide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11229"
FT                   /db_xref="GOA:A1T229"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR012825"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1T229"
FT                   /protein_id="ABM11229.1"
FT                   /translation="MSDDSAAALYDVINRRRDTRREFTGEPVAGDVLQRVLLAAHAAPS
FT                   VGMSQPWDFILVRSPQTLTTFRDHVAAERETFAGELSGERAETFGRIKIEGICESGLGI
FT                   VVGYDPTRAGPQVLGRHAVPDAGLYSVVCAIQNLWLAATVEGLGVGWVSFYREEFLRSL
FT                   VGMPDHVRPVAWLCVGPVAELPDVPDLERFGWRARSSLETVLHQECYRAR"
FT   gene            complement(414149..414922)
FT                   /locus_tag="Mvan_0382"
FT   CDS_pept        complement(414149..414922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0382"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: nfa:nfa50340
FT                   putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11230"
FT                   /db_xref="GOA:A1T230"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1T230"
FT                   /protein_id="ABM11230.1"
FT                   /translation="MNDRAVQFVGAGPGAADLLTVRAARFLADAELVLYPGTYLDAAVL
FT                   AHCSPDADLVDTENLDLDTIVARLVDGHRAGLRVVRLVSGDPSVYSALSEQTRRLDAVR
FT                   VPWEVTPGVPAYAAAAARVGRELTVPLVAQSVVLTRTRQRSTVMPDTESLKAFAATRAT
FT                   LVLHLAITRIRELMAEIEPEYGADCPVVVVYRASQPQELVLRGTVADIADAVQEAGLRQ
FT                   AAVILVGRALAGRPDPDAGESYLYDPARDRSGRSS"
FT   gene            complement(414958..416199)
FT                   /locus_tag="Mvan_0383"
FT   CDS_pept        complement(414958..416199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0383"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmc:Mmcs_2299
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11231"
FT                   /db_xref="GOA:A1T231"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1T231"
FT                   /protein_id="ABM11231.1"
FT                   /translation="MTESAEQFRDAPIFDADQHMYETPEALTKHLPQRYSRAVQFANFG
FT                   RHTRIVINNRVSDFIPNPTFERVAAPGAHEKFFAGENTEGLTLREMQGPAIEAPAATRN
FT                   PADRVAELDRQGVREALNYPTLASLIEHATADDPELTLAVIHALNQWMLEHWGFDYQGR
FT                   VFSTPIINLSEVDGAQRELDYVLTHGAKVALIKPGPVNGLRGWRSPALPEFDPFWRDVE
FT                   AAGLPIVLHASYPPLDDYVGKWEPPHTQNFMAMSAFRWMVLGHREIADMITSLICHGTL
FT                   TRFPKLRIASVENGSSWIFPLFNDFDELAKKMPQNFGEHPLDVFRRNIWVSPFWEGCVS
FT                   DVVNTVGWDKVMFGSDYPHPEGLAEPKGFWKYAEGMDVRRTYDFMGDNARRFMGLPIAN
FT                   PDPAAARPPALTTA"
FT   gene            complement(416276..416851)
FT                   /locus_tag="Mvan_0384"
FT   CDS_pept        complement(416276..416851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0384"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0409
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11232"
FT                   /db_xref="GOA:A1T232"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:A1T232"
FT                   /protein_id="ABM11232.1"
FT                   /translation="MTTGEQPSLRERKKTRTRETVRREAFRLFELNGYAQTTVDQIAEA
FT                   ADVSPRTFFRYFPTKESVLFSDDLLTPIIEAFLAAPAELSPVAAYRHAAAQVFAAMAGP
FT                   DFDYVIARQRLLYALPEAKGALWNEHVKAIRVLTTAIAERLDRPEDDQVRVTAGAIIGV
FT                   FMAASDDAPLDGEAFLQALDILETGLPE"
FT   gene            complement(416848..417912)
FT                   /locus_tag="Mvan_0385"
FT   CDS_pept        complement(416848..417912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0385"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   rha:RHA1_ro01362 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11233"
FT                   /db_xref="GOA:A1T233"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1T233"
FT                   /protein_id="ABM11233.1"
FT                   /translation="MSTPRRRRPTMADVAERAGVSRTLVSFILDGKPGASDETRRRVLA
FT                   IADEIGYRPDSAARLLAQGRSRTLGVMTDVRQLFQAELVTHIYPAAERLGYEVLLSANL
FT                   PDRTEATVVDSLLSHRCGALILLGPTGDQSFLEKLAQRAPVVVACRRLTGLNQQTPLAT
FT                   VRTNDAKGIRQAVDYLVGLGHRRIHHVDGGRDPGSADRSRAYKAAMRAHGLAEEIEVIP
FT                   GAHNEDAGAAAARAMLAAPTLPTAVLAGNDRCALGILDVFTRAGVDVPAQVSLMGYDDT
FT                   RLSENPRIDLSTIHQDAAEIARHAVQLAVQMLVEGPPHAMDVVLEPTLVVRGTTAPPRG
FT                   GPAARSGIADTIEG"
FT   gene            418154..419074
FT                   /locus_tag="Mvan_0386"
FT   CDS_pept        418154..419074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0386"
FT                   /product="2-keto-myo-inositol dehydratase"
FT                   /EC_number="4.2.1.44"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sma:SAV5337 putative IolE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11234"
FT                   /db_xref="GOA:A1T234"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1T234"
FT                   /protein_id="ABM11234.1"
FT                   /translation="MSTIRVGSAPDSWGVWFPDDPQQTPYSRFLDEVAESGYEWIELGP
FT                   YGYLPTDPAKLSDELAARGLKLSAGTVFEHLHQSGSRGDDAWNSVWRQIEDVAKLTAAV
FT                   GGTHVVVIPEMWRDPATGEVLEDRNLTAEQWAKKTAGMNDLGKAMFETYGVRAQYHPHA
FT                   DSHVDTEENVYRFLDGTDGRYVNLCLDTGHISYCGGDNIAIVRRAPERIGYLHLKQVDP
FT                   EVRTKVEAEDLPFGEAVKLGAMTEPPRGIPDMPPLLAEIEKLGIEVFAIVEQDMYPCEP
FT                   DAPLPIAKRTRSYLGSCGIPSVTFK"
FT   gene            419087..420118
FT                   /locus_tag="Mvan_0387"
FT   CDS_pept        419087..420118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0387"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; KEGG: sma:SAV1234 putative myo-inositol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11235"
FT                   /db_xref="GOA:A1T235"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR023794"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T235"
FT                   /protein_id="ABM11235.1"
FT                   /translation="MSEIGVAVLGVGLMGADHVARIASRISGARVAVVNDQVTEKAERL
FT                   AATITGCRAIADPLDAIADRDVDAVVLATPGPTHEKQLLACLEHRKPVLCEKPLTTDVE
FT                   TSLEVVRREAELGVRLIQVGFMRRFDDEYRALKALIDGGELGNPLVLHCVHRNPVVPGH
FT                   FDSAMTVRDSLVHEVDVTRFLFDEEIVSIQIVKPTPNSLAREGLFDPQIAILRTASGRH
FT                   VDVELFVTTGVAYEVRTELVAEKGSVIIGLDVGLVRKSAPGTWGGTITPSFKERFGQAY
FT                   DTEIQRWVDAVRSGGTTGIYTDGPTAWDGYAATAVCEAGVQALQSGQPVAVSMVDRVSI
FT                   PGA"
FT   gene            420123..420995
FT                   /locus_tag="Mvan_0388"
FT   CDS_pept        420123..420995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0388"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: rha:RHA1_ro01356 possible myo-inositol catabolism
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11236"
FT                   /db_xref="GOA:A1T236"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:A1T236"
FT                   /protein_id="ABM11236.1"
FT                   /translation="MKIALDPTPFHHDYDLLEFPALVAELGYEYLQLTPHRDFIPFFNH
FT                   PRADDTLVARFRKACASAGVGIASVLPVLRWSGPDEDAREAAVRNWKRVVQIAVDLGVN
FT                   VINTEFSGRPEKAEESERAFFRSMEELVPIFEREGIDVRIDPHPDDFVEDGMEAVRIIR
FT                   GVNSPNIGMVYVACHTFHMGGGMAEIIAAAGEKLRLVHVADTMDHHRSHGLRYITNPPG
FT                   NPVRVHQHLKIGDGDVDWDEFFGGLGKLGFYDRDDTVMVSSVFAEDEHAHDVSRYQLKT
FT                   MTEYVDKYR"
FT   gene            421104..421748
FT                   /locus_tag="Mvan_0389"
FT   CDS_pept        421104..421748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11237"
FT                   /db_xref="GOA:A1T237"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T237"
FT                   /protein_id="ABM11237.1"
FT                   /translation="MTRVDSRRRPNAAQRRHQLCDAANTLLAEDGPRGLSHLKVDRRAG
FT                   VPDGTTSFYYRTRVALLQGVADHLARYDAEAFAQAFDDVPDGAGDDLLPMLAEQVLLVR
FT                   DEPHLSRTRARLELTMLAKGDAGIAAGFQQVSESYRALTERLVTAMQNGLTAPLDRSLL
FT                   DEQVSVVLTYLSGLVFAFANGSTEPMTSRDIQRQIRAVVIGVAAERLSQTS"
FT   gene            complement(421745..422011)
FT                   /locus_tag="Mvan_0390"
FT   CDS_pept        complement(421745..422011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0390"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   nfa:nfa31330 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11238"
FT                   /db_xref="GOA:A1T238"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1T238"
FT                   /protein_id="ABM11238.1"
FT                   /translation="MVRLPLTAEQLAAGKRLGEQLRRARGERTLTDVAQAAAISPETLR
FT                   KIETGRLATPAFATIAALARVLDLSLDELAVSALARVDLKHTG"
FT   gene            422107..422895
FT                   /locus_tag="Mvan_0391"
FT   CDS_pept        422107..422895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0391"
FT                   /product="methionine aminopeptidase, type I"
FT                   /EC_number="3.4.11.18"
FT                   /note="TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24; KEGG: rha:RHA1_ro01746 methionyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11239"
FT                   /db_xref="GOA:A1T239"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:A1T239"
FT                   /protein_id="ABM11239.1"
FT                   /translation="MLELKTPQEIAAMDVTGTFIAELLDDLAGRARPGVNLLDLELRAR
FT                   TLLAERGAQSCYWDYAPSFGRGPFRNVICLSVNDAVLHGLPHDYVLADGDLLSMDIAVS
FT                   IDGWVADSARSIIVGTPRAEDRRLIAATEEALAAGIAAALPGNRLGDISAAIGAVAADY
FT                   GYPVNTEFGGHGLGRTMHEDPHVSNVGRAGRGLKLRQGLTLALEPWFAAGTDKIVYDPD
FT                   GWTIRSADGSRTAHSEHTIAITDGPALVLTRRERVTAAPR"
FT   gene            complement(422904..424316)
FT                   /locus_tag="Mvan_0392"
FT   CDS_pept        complement(422904..424316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0392"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   mmc:Mmcs_0353 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11240"
FT                   /db_xref="GOA:A1T240"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1T240"
FT                   /protein_id="ABM11240.1"
FT                   /translation="MNPVDRFFEITARQSSVATEIRGGVVTFIAMAYIIVLNPIILSSS
FT                   ADVDGNKLDFAQVSAMTSLAAGVMTILFGVVARLPFALAAGLGINSFLATTVVGSLTWP
FT                   EAMGLVVINGLIIVLLAVTGLRRLVFDAVPMQLKLAITAGIGLFILFIGLVDAGFISST
FT                   GVPSPPVGLGGGGQGSISTVPTVIFVFTLLLTGVLVAKRVRGGILIGLVIGTVIAVVVE
FT                   AIWHLGSATEKPGGWSLSVPTLSGSPFSLPDLSLVGAFSLDSFGRIGVLAAVMLVFTLV
FT                   FANFFDAMGTMTGLSREAGLSDANGTFPRLRSALVVEGAGAVVGGATSSSSNTVFIESG
FT                   AGIEEGARTGLANVVTGLLFLAAMFVAPLASIVPTEVAAAALVVVGAMMVSHLRHIDLS
FT                   EFSVALPVVLTVAVMPFSYSIANGIGVGFITWVVMRTAAGKVREVSPLLWVVAAGFAVY
FT                   FARTPLESLIGV"
FT   gene            complement(424580..425752)
FT                   /locus_tag="Mvan_0393"
FT   CDS_pept        complement(424580..425752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0393"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_5189 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11241"
FT                   /db_xref="GOA:A1T241"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T241"
FT                   /protein_id="ABM11241.1"
FT                   /translation="MADSQGAEYVFTEEQGQLRAAVRRFCADHIDETAVRAQMASEPRF
FT                   DPKVWARLGSELGVLGMSVPESHGGAGGTLVDQAVAVEQLGAALACGPLFGTVYLAIPA
FT                   LVASSQPGDLLAPLIEGIRTAAFAVPDAGGDFDADAVTVEAIPTDQGWTLTGTVQRVVD
FT                   AGAADVVLVAAAGPDGLGLYAIEADNIGVQRIPLTTLDLTRPQATVGLFHAPARLVAGP
FT                   AEAERVITHALQIGAALLAVEQVGAAQHLLDLTVDYAKNRLQFGRPIGSFQAVKHRLAD
FT                   DLVALEHARSTAYHAVWALTDGSDDPALAVSIAQATCSEALVRVATDTIQVHGGIGFTW
FT                   EHQAHLYYKRAYTDAALLGSAEAHRARVAELVLDVAPRKDAPRVATGMPS"
FT   gene            complement(425877..427073)
FT                   /locus_tag="Mvan_0394"
FT   CDS_pept        complement(425877..427073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0394"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_5188 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11242"
FT                   /db_xref="GOA:A1T242"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T242"
FT                   /protein_id="ABM11242.1"
FT                   /translation="MGTDADRVADAARRVVDEHDPKTVPIPEFLGACFDAGLSWVHFPE
FT                   GFGGLGLSRGLQAVADRILQGAGGPVPLGLNPMGYGMAAPTVREHAQTDEVRHRLLRPL
FT                   ATTEEIWCQLFSEPGAGSDLAGLATSAVLDGDTWVVNGQKVWTSLAHRAKWGLLLARTD
FT                   PDVPKHKGLTYFVIDMHADGVQTRPLRQLTGHAEFNEVYMTDARIPDAYRLGAVGDGWR
FT                   VAMTTLMNERSALGGSGSRRGAGTVSDAVALWASRPDLHTPVLRDRLTRLWLRAEAQRL
FT                   TSERSRASATVGGPGPEGSVGKLVGAELNQHIYEFCMDLLGPEGILYGSYGMQDTSSNG
FT                   DAQDWRGPIQQRFLRSRANTIEGGTSEVMRNILAERVLGLPGDLRADAGMPWKEVPRG"
FT   gene            complement(427234..427641)
FT                   /locus_tag="Mvan_0395"
FT   CDS_pept        complement(427234..427641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0395"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mmc:Mmcs_0359 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11243"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1T243"
FT                   /protein_id="ABM11243.1"
FT                   /translation="MYGNPTFHCDGADIRAHCRQLATVVTISGHLDDVNVETASHYVDR
FT                   FILTEKPFVLDLSGVDSFTREAISLLFAIDDVCASAGVDWSMIASRAVEQTLRDAGIEF
FT                   PAAGSVPEALNHFADAMVTRRQLLPLLTKTA"
FT   gene            complement(427789..429027)
FT                   /locus_tag="Mvan_0396"
FT   CDS_pept        complement(427789..429027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11244"
FT                   /db_xref="UniProtKB/TrEMBL:A1T244"
FT                   /protein_id="ABM11244.1"
FT                   /translation="MAARESFEIAGEQVPITNPDKVVFGDLGLTKLDLMRYYAAVADGA
FT                   LRGVRDRPMILKRFVKGIEQEAVFQKRAPEKRPDFVDVAELKYASGTSAKEAVLHDAAG
FT                   LIWAVNLGCVDLNPHPVRADDLEHPDELRVDLDPMPGVGWRQILDVAFVAREVLEDHGL
FT                   VAWPKTSGSRGFHIYARIHRRWPFKLVRLAAETVAREVERRAPESATARWWKEERQGVF
FT                   VDFNQNAKDRTVASAYSVRATPDARVSTPLFWDEVADCRPEEFTVRTVPRRFSERGDPW
FT                   EGMDDAAGGLEALLDLADRLGPAEKAPRGARKSADGRRVSVMPLIEIARTKTKDEAMAA
FT                   LQQWRDKYPAAAEKLEPADVLVDGMRGPSSIWYRIRINLQHVAEDARPAQEELLADYNP
FT                   WHNYTGAQQQRRD"
FT   gene            429083..430777
FT                   /locus_tag="Mvan_0397"
FT   CDS_pept        429083..430777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0397"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0361 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11245"
FT                   /db_xref="GOA:A1T245"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T245"
FT                   /protein_id="ABM11245.1"
FT                   /translation="MPKLSDLPLQAAAKLQQTVGTYLERGSAELHYARKMFEAGALKLE
FT                   PPQDIAAFVADMRRWGEFGMIPALNARRYPHRAAVIDDFGEMTFKELDDAANAVANGLL
FT                   AKGVKGGDGVAILARNHRWFLVSVYAAGKVGARIILLNSEFSGPQIKEVSEREGAKLVI
FT                   YDDEYTAAVAAAEPELGKLRSLGVNPDKEEPSGSTDETLEELIARTTSNPPPKATKHSS
FT                   IIILTSGTTGTPKGANRSAPPSLAPIGGILSSVPFKSQAVTSLPAPMFHALGFLHATIA
FT                   MMLGTTLVLRRRFKPATVLADIEKHRATAIVVVPVMLSRMLDELDKTSPKPDLSSLRIV
FT                   FVSGSQLGAELATRALKELGPVVYNLYGSTEVAFATIAGPQHLSINPATVGPVVKGMKV
FT                   RILDDNGNDVPRGQVGRIFVGNFFPFQGYTGGGGKQIIDGLLSSGDVGYFDENDLLYVS
FT                   GRDDEMIVSGGENVFPAEIEDLVSGHPEVVEATAIGVEDKEWGARLRCFVVKIEGAAVD
FT                   EDAIKAYVRDNLARYKVPREVVFLDELPRNPTGKILKRQLREMEIPD"
FT   gene            430878..431657
FT                   /locus_tag="Mvan_0398"
FT   CDS_pept        430878..431657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0398"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: sma:SAV1036 dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11246"
FT                   /db_xref="GOA:A1T246"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T246"
FT                   /protein_id="ABM11246.1"
FT                   /translation="MKIDLTGKTALVTGSTQGIGLAIARSLAASGARVAVNGRSRDRVD
FT                   EAVATLDGDVVGVAADVADAAGAQALAAELPHIDILVNNLGIFGAVPAREITDDQWRSY
FT                   FEVNVLAAARLIRHYLPGMVDRGWGRVLQIASDSAIVIPEEMIHYGVSKTALLALSRGF
FT                   AKDASGTGVTVNSVIAGPTHTAGVEDFVYQLVDKSLPWEQAQREFMRLHRPQSLIERLI
FT                   EPEEIANMVTYLASPLASATTGGALRVDGGYVDAILP"
FT   gene            432037..432252
FT                   /locus_tag="Mvan_0399"
FT   CDS_pept        432037..432252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0399"
FT                   /product="ferredoxin reductase"
FT                   /note="KEGG: mxa:MXAN_4126 ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11247"
FT                   /db_xref="UniProtKB/TrEMBL:A1T247"
FT                   /protein_id="ABM11247.1"
FT                   /translation="MRLVVDLNRCQGYAQCVPLAPEVLKMLGEEALAYDPNPDVSQRQR
FT                   VLRAAASCPVQAIVVEADPPEDRDSL"
FT   gene            432249..433643
FT                   /locus_tag="Mvan_0400"
FT   CDS_pept        432249..433643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0400"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mxa:MXAN_4126 ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11248"
FT                   /db_xref="GOA:A1T248"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T248"
FT                   /protein_id="ABM11248.1"
FT                   /translation="MTVELIGELVDSFRRTGRIVIVGASLAGLRAAEALRDGGFSGSLT
FT                   IIGDEPHEPYDRPPLSKQVLKGWVPADHTKLPRLRRVDADWRLGVAATGLDRRAKRVLL
FT                   ADGSAVEYDRLLIATGVRARQWPNPDEAALDGVFTLRTRDDAAALQAALHARPNRVLVV
FT                   GSGFIGSEMASVCRELDLAVTVAERGPAPLVGALGGVIGELAAAMQRDAGVDLRTGVSV
FT                   LGLDGDDTGHVRSARLSDGTTLPVDVVVASLGSIRNVEWLDDAGLATGFWGVACDAGCR
FT                   AFDVNGVVTDNIFVAGDVARAPHVLYEYQFMSLEHWDNAVSGGEVAANNMINLETGRRP
FT                   HLPLPSFWSGQFGVNIKGVGVCSFGDEIVFTQGSPGEYRFAAAYGRRGRIVGAVTFNHG
FT                   KWLPYYADLIERSAPFPPPPPGFDRPVLGEPMPARFPDPRVPTGIPDVVLTGHDPTDRG
FT                   AEFLRR"
FT   gene            433660..434925
FT                   /locus_tag="Mvan_0401"
FT   CDS_pept        433660..434925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0401"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mba:Mbar_A1945 putative
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11249"
FT                   /db_xref="GOA:A1T249"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T249"
FT                   /protein_id="ABM11249.1"
FT                   /translation="MTTASQAWAQAMAFAHRADPYPFFAELRKTPVARVADDLYVVTGY
FT                   YELLALAHDPRVSSDFRRSPLSSDRAPAEPADDVGAYGSEPSLIVTDPPSHDRARRQVS
FT                   RHFAPPHSPDLIPSMEPAVVALCNDLLDTAKANGRTRIDVVDDYAYPVPVMVICKILGV
FT                   PLEDEPRFHAWIFDMLAGVDLGPDATTDEGQGRAARARDAQAALRDYLAGLIEGYRGAG
FT                   GDGLLSALVNDASGPDGAMPPGQALANAVLLLIAGHDSTVNTISNCVLTFLRNPGTVEL
FT                   LRDRPELIPRAIEEVQRLQSAVQFFPSRSATADIEVGGTVIPEGAAVHLMYGAANRDPR
FT                   RFADPDTFDIFRPDNEHFGWGSGIHTCVGGPLARLEVNLALEIFLRRVHRPRLVSDPPP
FT                   YRQSQIFRGPRHVLVDVEAIGD"
FT   gene            complement(434952..435272)
FT                   /locus_tag="Mvan_0402"
FT   CDS_pept        complement(434952..435272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11250"
FT                   /db_xref="GOA:A1T250"
FT                   /db_xref="UniProtKB/TrEMBL:A1T250"
FT                   /protein_id="ABM11250.1"
FT                   /translation="MSNDRDFVEKRFSRPGEYRAAVIYTFVVVVLAAIAFAVYAFGDRS
FT                   SVFSAALVPVFLFAGGVGALLRTYRQWKGGGGWTAWQGAGWFLLLLMLLTLAVPGGAAF
FT                   SN"
FT   gene            complement(435313..437526)
FT                   /locus_tag="Mvan_0403"
FT   CDS_pept        complement(435313..437526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0403"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0366 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11251"
FT                   /db_xref="GOA:A1T251"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1T251"
FT                   /protein_id="ABM11251.1"
FT                   /translation="MPIAILEEHNDLADSVRSFVERVAPSEVLHDALENPVPNPPPYWK
FT                   PAAEQGLQGVHLAESVGGQGFGILELAVVVAEFGYGAVPGPFVPSAIASALIAANDPDA
FT                   AVLGDLASGELIAAYAIDSGLTATRHGDKLVIRGEVRAVPAAAQASLLVLPVAIESGEE
FT                   WVVLDAASLEIEPVRSVDPLRPVAHVRANAVEVGDDRVLANLSRGHARALMSTLLSAEA
FT                   IGVARWATDTAAAYAKIREQFGRPIGQFQAIKHKCANMIAETERATAAVWDAARALDEA
FT                   CGAGDDAGVRENPDSSYEFAAAVAATLAPVAAQHCTQDCIQVHGGIGFTWEHDTNVYYR
FT                   RALVLAASFGRASDYPQRVVDLATTTGMRALNIDLDPETEKLRAEIRAEVAALKEIPRE
FT                   QRAAAIAEAGWVQPHLPVPWGRASSPIEQIIIAQEFSSGRVKRPQMGIAAWIIPSIVAF
FT                   GTDEQKQRFLPPTFRGEMIWCQLFSEPGAGSDLASLTTKATKVDGGWRITGQKIWTTGA
FT                   QYSEWGALLARTDPSAPKHAGITYFLLDMKSAGVEVKPLRELTGNAMFNTVFIDDVFVP
FT                   DEMVLGEVNRGWEVSRNTLTNERVSIGSSEPPFLPSLDKFVEFLGEGQFDQIAQNHAGV
FT                   LIAEGHAAKVLNMRSTLLTLAGGDPMPAAAISKLLSMKTGQGYAEFAVSSFGTDAVVGE
FT                   PDQVTGRWAEYLLASRSTTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(437584..438540)
FT                   /locus_tag="Mvan_0404"
FT   CDS_pept        complement(437584..438540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0404"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase, NAD-binding; KEGG: sco:SCO3478
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11252"
FT                   /db_xref="GOA:A1T252"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T252"
FT                   /protein_id="ABM11252.1"
FT                   /translation="MRVLAHFVPGGPDSKVIEFLAPCRDWLDVRFCAEDDDDTFYRELA
FT                   DAEVIWHVLRPLSGEDLARAPRLRLVHKLGAGVNTIDVDAATARGVAVANMPGANAESV
FT                   AEGTLLLMLAALRRLPVLDRATREGRGWPSDPTLGETVRDIGGCTVGLVGYGNIAKQVE
FT                   RILVAMGADVIHTSTRDDGSAGWRSLPDLLSACDIVSLHLPLTDATAGLLGRDALARMK
FT                   SDAVLVNTSRGPIVDEEALADALRTGKLAAAGLDVFAVEPVPADNPLLRLPNVVLTPHV
FT                   TWYTADTMRRYLEFAVDNCERLRDGRNLVNVVNDVAG"
FT   gene            complement(438537..439673)
FT                   /locus_tag="Mvan_0405"
FT   CDS_pept        complement(438537..439673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3717c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11253"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T253"
FT                   /protein_id="ABM11253.1"
FT                   /translation="MTRTAATQMPGVTREFLGLDSSTARRAGSGGHPCQGIYHRGMGRK
FT                   PKVAMIAAHYQIDFSEHYLADYMATRGIGFLGWNTRYRGFESSFLLDHALVDIGVGVRW
FT                   LREVQGVETVILLGNSGGGSLMAAYQANAVDKHVTPLDGMRPAAGLDDLPPADGYVASA
FT                   AHPGRPDVLTAWMDASVIDENDAVATDPDLDLFNERNGPGYDAEFVARYRAAQVARNEA
FT                   ITDWAEAELARVRAAGFSDRPFTVMRTWADPRMVDPALEPTKRPANMCYAGVPAKANRS
FT                   THGIAAACTLRNWLGMWSLRHAQTRAEPHLARITCPALVINAEQDTGVYPSDARRIHDA
FT                   LGSADKTMRSVDTDHYFTTPGARSEKADTIAKWITRRW"
FT   gene            complement(439670..440308)
FT                   /locus_tag="Mvan_0406"
FT   CDS_pept        complement(439670..440308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0406"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP3718c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11254"
FT                   /db_xref="GOA:A1T254"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1T254"
FT                   /protein_id="ABM11254.1"
FT                   /translation="MSISPREELPTVRGRQTQAAIDMAARSVIARKGILATTVADIAGE
FT                   AGRSTASFYNYYDSKEAMVREWAVRFRDEARTRSLSAARPGLSNWERSYQAAAAHWNTY
FT                   RNRLAEIIAVSQMAMISDDFAEYWNEICSLPIALITSLVKQAQREGFCPEDDARLVAVA
FT                   LVSMLNQFCYTQLSGVNADASADIDDEACIKTLADIFYRTIYYPENGQP"
FT   gene            complement(440507..441769)
FT                   /locus_tag="Mvan_0407"
FT   CDS_pept        complement(440507..441769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0407"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: fra:Francci3_0130
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11255"
FT                   /db_xref="GOA:A1T255"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1T255"
FT                   /protein_id="ABM11255.1"
FT                   /translation="MLVESEDSEQIIARVAALDIGKAELVCCVRVPGRGTRRLQEVSTH
FT                   STMARSLTELANHLVESGVQRVVMEATSDYWKPVFYLLEAHGLDPWLVNARDVKHLPGR
FT                   PKTDVLDAVWLAKLAERQMLRPSFVPPPPIRQLRDLTRYRIDLVATRTAERNRVEKLLE
FT                   DACIKLSVVASDIFGVSGRAMMAALIAGERDPKVLAQLARSRMRTKIGRLEEAFNGHFN
FT                   AHHGFLLTRMLARLDGIDADIAVLDEQIEVYLAPFAAAAARLDEIPGIGAVAAAIILAE
FT                   IGTDMSVFPTAGHLCSWAKFSPGIQSSAGKTKGTASTGHGNRYLAQILGEAAIAASRTD
FT                   TFLGQRYRRIARRRGNKRALVAVGRSILVIIWHLLTDPDATFIDLGPDHYTKHLNPETK
FT                   RRNHIRQLEALGYTVTLTPAA"
FT   gene            442062..442637
FT                   /locus_tag="Mvan_0408"
FT   CDS_pept        442062..442637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0408"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mbo:Mb0280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11256"
FT                   /db_xref="GOA:A1T256"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1T256"
FT                   /protein_id="ABM11256.1"
FT                   /translation="MIKPQNTNTEFELGGINHVALVCSDMGKTVDFYTNVLGMPLVKSL
FT                   DLPGGMGQHFFFDAGNGDCVAFFWFADAPDRVPGISSPEAIPGIGDIVSAVSTMNHLAF
FT                   HVPAEKFDEYRQRLKDKGVRVGPVLNHDESEAQVSATVHPGVYVRSFYFLDPDGITLEF
FT                   ACWTKQFGDTDTTTVPKTEADRRVQVSG"
FT   gene            complement(442634..443131)
FT                   /locus_tag="Mvan_0409"
FT   CDS_pept        complement(442634..443131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0409"
FT                   /product="FadD27"
FT                   /note="KEGG: mpa:MAP3723c FadD27"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11257"
FT                   /db_xref="UniProtKB/TrEMBL:A1T257"
FT                   /protein_id="ABM11257.1"
FT                   /translation="MRAICAQSGLAARYFYESFADKDVFVGAVFDWVVADIAATTQAAV
FT                   AAAPVREQSRQGMANIVNTISDDIRVGRLLFNTRLDNPVVVRKRAESGALFALLSGQHA
FT                   GTALQVEPNERIRAAAHFAVGGVAQTLSAWLAGDLAFTPEQLAGQLGALLDQLADPTLY
FT                   RD"
FT   gene            443348..444256
FT                   /locus_tag="Mvan_0410"
FT   CDS_pept        443348..444256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11258"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A1T258"
FT                   /protein_id="ABM11258.1"
FT                   /translation="MTLDESVSAPVPLVERPVSESSVPAGPRARVSTRSDDGMLGLGLL
FT                   AGPANVIMQLARPGVGYGVLESRVESGRIDRHPVKRARTTFTYLAVSTNGTPEQQAAFR
FT                   RAVNRAHAQVFSTDESPVKYHAFDKDLQLWVGACLYKGVVDVHRLFVGEMDEETADRLY
FT                   LQGRALATMLQVPEDMWPADRAAFDRYWQESLDDVHIDDTVREFLYPIAATRLRGLALP
FT                   GPLQRQTEKLALLITTGFLPQRFREEMQLPWDAGQQRRFDRLMAALRAVNSVSPKFVRQ
FT                   FPFNVLLKDLDWRVRTGRPLV"
FT   gene            444412..446259
FT                   /locus_tag="Mvan_0411"
FT   CDS_pept        444412..446259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0411"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mmc:Mmcs_0370 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11259"
FT                   /db_xref="GOA:A1T259"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A1T259"
FT                   /protein_id="ABM11259.1"
FT                   /translation="MDIGSDTLAAAAGTVRVDQHVVSRFATCCRALGLVVHDRRRPADL
FT                   AAARSGFAALTRIAHDQCDAWVGLAAAGDDAPHVVEAVWRTSATFGVLQREIQLAPGAL
FT                   GFRYDTGLYLRFRATTRDDFALAYAVRLCDTDAYEEADELIAGLLERRPQWLEARWVRA
FT                   VLHYRTARWNDVVRMLTPLVADQSLEETPAHAARVALGTALARLGMFAPALSHLERPEG
FT                   PVVVASVDGALVKALSLRAQGEDEEAHELLQELYAANPENVQIEEALSDSSFGIPTTTA
FT                   ARIEARSNPWDPGTEPGEADFVDPGAKDRKAHLLIEAEAELAEFIGLDEVKYQVARLKS
FT                   SVAMAIRRQERGLTVAQRTNHLVFAGPPGTGKTTIARVVAKIYCGLGLLKKETVREVHR
FT                   ADLIGQHIGETEAKTNAIIDSALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMEND
FT                   RDRLVVIVAGYRKDLDTFLDTNEGLRSRFTRSIDFPSYSGKELVEIATRMAEKRDSRFE
FT                   DAARRDMERLFEYLAQATTPDVNGVSRRSLDIAGNGRFVRNLVERSEEEREYRLDHSES
FT                   DDFTDDELMTITATDVANSAGPLLRGLGLSMPQQLSDQA"
FT   gene            446256..447788
FT                   /locus_tag="Mvan_0412"
FT   CDS_pept        446256..447788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0412"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0371 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11260"
FT                   /db_xref="GOA:A1T260"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:A1T260"
FT                   /protein_id="ABM11260.1"
FT                   /translation="MSAPEEERRSFASRTPTNGNPDRVTYRRGFVTRHQVTGWRFVMRR
FT                   IASGVALHDTRMLVDPLRTQSRSVLVGALILVTGLIGCFLFSLIRPSGAAGTDAVLADR
FT                   DTAALYVRLGEQLHPVLNLTSARLIAGRPDNPAMVKSSELDQFPRGNLIGIPGAPERMV
FT                   ANTTRDAYWTVCDAATGSTAGVTVIAGRPADGGERAAALPAGHAVLAENGGRTWLLWDG
FT                   KRSPIDLADRAVTGGLGIGVDSAAPQPISVGLFNAIPEGPPLVTPAIPGAGSPSAAPLP
FT                   EPLPIGAVVVAYDADNAIRHYVVLADGLQAVSPVVAAILRNSNSYGLAQPPRLDADVVA
FT                   RIPEAAGVDNAAYPSDRVTLVDVAADPVTCAQWAKPEGAQDASLTLRTGAVLPVADGAR
FT                   TVELVSSGTPGGPADRVALPPGTGYFVDSAGSLFWISDTGVRYGIDTGSDGVDTVAALG
FT                   LTTAPLPIPSSVLSQFAVGPTLSRTDALLAHDSLAPNPAPARLETTSALEKP"
FT   gene            447785..451780
FT                   /locus_tag="Mvan_0413"
FT   CDS_pept        447785..451780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0413"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0372 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11261"
FT                   /db_xref="GOA:A1T261"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T261"
FT                   /protein_id="ABM11261.1"
FT                   /translation="MSRLIFEHRKRVPAPVVPKGTITIEPPPELPRVIPPSLLRRALPY
FT                   LIVILIVGMIVALVATGLRMISPTMLFFPFVLLLAATALYRGTDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAYADQQRAALQWSHPEPAALVSIPGTRRQWERDPHDPDFLVLRAGLH
FT                   DQPLATALRVKDTADEIDLEPVSHSTLRSLLDTQRTIHDAPAGVDLTKVARITVIGDRA
FT                   EVAGALRAWIAQAVTWHDPSVLGVAFAGTRLESDAWSWLKWLPHTDVPGQNDGVGPARY
FT                   LATEPAALHALLAPALAERAPFTGDGPTDAKHLLVVLDDPDADPGQFIGRGLAGVTVIH
FT                   RTDREPDRDQYPDPERPVLRVAARRIERWLNGSWVPFVDAADRMAPDDARHIARRLARW
FT                   DSNPHHGRSASAGGAAFTTLLGIPDASALDVAALWAPRNRDDELRVPIGVTATGEPLIF
FT                   DLKDEAEGGMGPHGLMIGMTGSGKSQTLMAILLSLLTTHPADRLIVIYADFKGEAGADI
FT                   FRNFPQVVAVISNMAEKRSLADRFADTLRGEVARREQLLLEAGRRIQNSAFNSVTEYEN
FT                   AIAEGHDLPPLPTLFVVADEFTLMLAEHPEYADLFDYVARKGRSFRIHLLFASQTLDVG
FT                   RIKDIDKNTSYRIGLKVASPAVSRQIIGVEDAYHIESGREHKGEGFLVPAPGALPIKFR
FT                   STYVDGIYEPPRVDRSIVVHAIPKPQLFSAGWVDPEPDTVIVDDGADVEVLPPRKLITT
FT                   IGEQLAQYGPRAPQLWLPPLDEPIPLRDVLERAGVGARQWRWPLGEIDRPFEMRRDPLI
FT                   FDATSAAANMVIHGGPKSGKSSALQTFVLSAAALHAPGDVSFYCLDYGGGQLRALENLA
FT                   HVGSVASPLEPERIRRTFGELEHLLRARQQHGAAAADGQYRDGYGEVFLLIDNLYAFSR
FT                   DNTDTFNARNPLLARVTELVNTGLSYGIHVVVTTPNWLEVPLTMRDGLGLRLELRLHDP
FT                   RDSNVRVVSKDAALRRPAESVPADQPGRGLTMAVEHFLFAAPATESIPALNARYPGRSA
FT                   PPVRLLPTDLSPSAFPTLYPAPERVVVGQREEDLAAVTVDFGDNPLMMVFGDAKTGKTT
FT                   LLRHLIRTIRENSRPDQVAFTVIDRRLQLVDEPIFPDNEYTPNIDRITPAMLGLSALLE
FT                   KRRPPAGLSPQELSRWDFRAGANGSGRHLHYLIIDDVDQIPDGPAISGPFAGQRPWTAL
FT                   IGLLAQASDLGLRVIVTARAAGSAHAVMTAPLLRRLNDLQATTFLLSGNPADSGKIRGH
FT                   RFARLPVGRAMLLDDRNSSGSPTFVQLVNPLAERTAARSGHSGKEYS"
FT   gene            451780..452088
FT                   /locus_tag="Mvan_0414"
FT   CDS_pept        451780..452088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0414"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mmc:Mmcs_0373 PE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11262"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A1T262"
FT                   /protein_id="ABM11262.1"
FT                   /translation="MTLRVVPEGLTAAGAAVEALTARMAAAHAAAAPVVTAVLPPAADV
FT                   VSLQAATGFSARAAEHQSVAAQGVEELGRSGIAVGESAASYAGGDAMAASSYLIARG"
FT   sig_peptide     451780..451869
FT                   /locus_tag="Mvan_0414"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.957) with cleavage site probability 0.846 at
FT                   residue 30"
FT   gene            452093..453667
FT                   /locus_tag="Mvan_0415"
FT   CDS_pept        452093..453667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0415"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0374 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11263"
FT                   /db_xref="GOA:A1T263"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A1T263"
FT                   /protein_id="ABM11263.1"
FT                   /translation="MSSPVWMALPPEVHSALLSSGPGPGSMLAAAATWQSLSAEYAAAA
FT                   AELSSILADVQAGAWEGPSSEQYVAAHTPYLAWLAQQSAAGAAAAAQHEAAAAAYSTAL
FT                   ATMPTLPELALNHTTHAVLVATNFLGINTIPIAMTEADYVRMWIQAATTMATYQAVSGA
FT                   ALAATPTATPAPFVLAPGVGEAGRAAADVTAFAAQAQAAEAGSALDLSNIIADLIRAYG
FT                   ELLRFLFEPIFDFLRDPLGNTIKLITDFLTNPAQALITWGPFLAAVAYQAVSWVGASIL
FT                   YPSLLLLPLVATTLAIVLGVGAYLLENLPAPAEDAPAEEPAASSPAPTRADQPSPAIAV
FT                   SAPPPPSSAAATVGTVATGTAPAPGAPAAATASFVPYAVAGRDPGTGFSPTVRDSTSAK
FT                   APASGIPAAASGVAASAAERRKRRRRQKDEIAGRAYADAYADYEPEPDDEPPVRQEPRI
FT                   AATERGAGPMGFAGTVSRDAAQAGGLTTLPGDPFGGGPKAPMLPGTWDPDTEPDERHNH
FT                   HDGKDSQ"
FT   gene            complement(453673..454878)
FT                   /locus_tag="Mvan_0416"
FT   CDS_pept        complement(453673..454878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0416"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: mmc:Mmcs_4926
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11264"
FT                   /db_xref="GOA:A1T264"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1T264"
FT                   /protein_id="ABM11264.1"
FT                   /translation="MTTGQVWAGVDVGKEHHWVCAVDDSGKVVLSRRLVNDEQPIRELV
FT                   AEIDELAERVSWTVDLTTVYAALVLTVLADAGKTVRYLAGRAVWQASATYRGGEAKTDA
FT                   KDARVIADQARMRGQDLPVLHPDDDLISELRMLTGHRADLVADRTRTINRLRQQLVAVC
FT                   PALERAAQPSQDRGWVILLARYQRPKAIRQSGVSRLTKVLTDAGVRNAASIAAAAVAAV
FT                   KTQTMRLPGEEVAAGLIADLAREVIALDDRIKTTDADIEGRFRRHPLAEVITSMPGIGF
FT                   RLGAEFLAAVGDPALIGSADQLAAWAGLAPVSRDSGKRTGRLHTPKRYSRRLRRVMYMS
FT                   ALTAIRCDPDSKAYYQRKRDEGKRPIPATICLARRRTNVLYALIRDNRTWQPDSPPVTA
FT                   AA"
FT   gene            455125..455418
FT                   /locus_tag="Mvan_0417"
FT   CDS_pept        455125..455418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11265"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T265"
FT                   /protein_id="ABM11265.1"
FT                   /translation="MSMLDAHIPQLVASEAAFGAKAGLMRSTIAQAEQAAQSAQAFHMG
FT                   ESSAAFQAAHARFVEASAKINALLDVAQANIGDAAASYVAEDASAASNYTVI"
FT   gene            455451..455738
FT                   /locus_tag="Mvan_0418"
FT   CDS_pept        455451..455738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11266"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1T266"
FT                   /protein_id="ABM11266.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMNSYAGALHAVGADIAAEQTALQSAWQG
FT                   DTGLTYQAWQAQWNGAMEELVRAYRAMAATHEMNTTSMAARDQAEGAKWG"
FT   gene            455748..456608
FT                   /locus_tag="Mvan_0419"
FT   CDS_pept        455748..456608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0419"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: mmc:Mmcs_0378 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11267"
FT                   /db_xref="GOA:A1T267"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A1T267"
FT                   /protein_id="ABM11267.1"
FT                   /translation="MHADAVELTAEAAWFLADTLGAGTFPWVLAITPPYSDRSQRAQFE
FT                   SEQAERLTRMGVMDADRAVDAAVARWIRLVCRPTQWLELRFVGARGAMLRGIIARDASR
FT                   TVVALRSGGLITLTEMQIDHPQALVPVLTVGLSGRSPARFPEFSLPARVGAKADDQIRR
FT                   GASVRDLLDYLGVPPSARPVVVAAFEEARTYVEIVAGRHRDGHRVSTDVGVSIVDTTAG
FT                   RVLVSPTRARDGEWISTFAPGDPIAVATAVERLTAALPDGPWFPDQPVTRDFDSRSQRE
FT                   EICHR"
FT   gene            456596..458053
FT                   /locus_tag="Mvan_0420"
FT   CDS_pept        456596..458053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0420"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0379 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11268"
FT                   /db_xref="GOA:A1T268"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1T268"
FT                   /protein_id="ABM11268.1"
FT                   /translation="MPPLDTNTLAGVVMPIVRVAVLTAAVGDEAAADRTGRITEIALPA
FT                   DLPLREIVPAVQRIVAPSDDSAGGAEQLSLAPIGGAPFSLDATLNTVGVVDGDLLALQP
FT                   VPAGPPAPRIVEDIADAAMIFSASREKPWGVANIRSGATAAVIGLTVVATALAVAHRVF
FT                   TDSLIGLFAVSAVAIGAVLGALLARASSPRLATALAAAALPSVAAAFTLAVPGDFGASN
FT                   IVLGAAGVAAWSVISITVGERAIALFTAAAASALGVLLVSAVASVWTLTPVHVGCILIL
FT                   AGLVVTVQAAQLSAMCARLPVPVIPAPGDPTPSAPPLRVLEDLPRRIRASDAHQTGFIA
FT                   AGVLLGVAGSVFAVWPGVGGDGSASPWAWLLVGATALGAVLRARVWDSASCKAWLLAQP
FT                   FLMSAVLLGIFAVTGRYDAAWWTLGAFAVLAAAWVVAALNPRIAEPQTYSLPMRRLLGF
FT                   VAAAVDASVIPVMAYLVGLFAWALNGV"
FT   sig_peptide     456596..456691
FT                   /locus_tag="Mvan_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.697) with cleavage site probability 0.506 at
FT                   residue 32"
FT   gene            458056..459417
FT                   /locus_tag="Mvan_0421"
FT   CDS_pept        458056..459417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0421"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0380 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11269"
FT                   /db_xref="GOA:A1T269"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1T269"
FT                   /protein_id="ABM11269.1"
FT                   /translation="MRAHPWALAAAVALLAASAPPAGAITPPEVDPAVPPPGGSVGPVG
FT                   AMAQRNPCVISTALPGTDPGAATPDRTALRLSEAWTHSRGEGQTVAVLDTGVKPGPRLP
FT                   DVEAGGDYVASGDGLTDCDGQGTLVAGLIAGQPGADGFSGVAPAARILSIRVSSPRYAP
FT                   RDAGEDPAVTRAMLETEAMAGAIVRAADLGARVINISAVTCVPVGENFDQSGLGAALRY
FT                   AAVDRDVVIVAAAGEGGAAGGCDSNPLSDPALPSDPRNWSGVTAVAIPAWWQQYVLSVG
FT                   SLAPDGTPSSFTMAGPWVGIAAPGEDITSVSNDEAGGLANGLPGDRDRIDPVRGTGYAT
FT                   AYVSGVAALVRSRFPDLTARQVIERLTGTAQSAARSPSNLVGAGRIDPVAALTWNVPAT
FT                   EEIGTTAARPVAAPAPPPPKDPVPRAVAFAGAGVLALVVLTVSLMSTRRKETSS"
FT   sig_peptide     458056..458130
FT                   /locus_tag="Mvan_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.796 at
FT                   residue 25"
FT   gene            459414..460301
FT                   /locus_tag="Mvan_0422"
FT   CDS_pept        459414..460301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0422"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0381 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11270"
FT                   /db_xref="GOA:A1T270"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A1T270"
FT                   /protein_id="ABM11270.1"
FT                   /translation="MTVRLTLAALFVIPAVMTYPWQTVAQRWLLGVAIAVVVVLFASWR
FT                   GRFVTAIFGRRTAILLRRGRIRDAAPSGEYATVALRLEPREAAELPLSLVAGYLDRYGI
FT                   SFDKVRVTSRIAGPGAAATWVALTLGAADNIAALSARSPAIPLRDTAELAGRRLADQLR
FT                   EAGWEVSVDDTAAGPLSGEAKERWRGVEDGRGFLAAYRIAADEPLDGLFSAVRALDADE
FT                   IWTAVEFTGDRTQPEFAAACALRTAQRPGVRASLPGLTPQHGRHAAALAAMAPGSDQRL
FT                   PGPTGLMPPVLSRT"
FT   gene            complement(460288..461481)
FT                   /locus_tag="Mvan_0423"
FT   CDS_pept        complement(460288..461481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0423"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11271"
FT                   /db_xref="GOA:A1T271"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T271"
FT                   /protein_id="ABM11271.1"
FT                   /translation="MTESHAPVDPPIPVPDVPGADATARGLPRRQDLALRQRLIVDSSA
FT                   VADLALRTSIASLLSATMVPSVSKALRRSEAAAEQDHLRFYAELAAARDPQVSFPAPQS
FT                   PPRVSSRPANPVAEWIARGNVRNIRFDSSFRAVNPALRDQCAGFVRNNVVHAQHWRHDD
FT                   GPRPTLCLIHGFMGSAYLFNGLFFSLPWFYRCGYDVMLYTLPFHGRRAEKYSPFSGHGY
FT                   FAHGMAGFAEAMAQAVHDFRSIIDYLEFTGVDRIALTGMSLGGYTSALIASVDDRVQAV
FT                   IPNVPVVTPDRTVDEWFPANKVVALRDWIAGTDTELVGAATMYSSPLNYRPLIPKDRRL
FT                   IIAGLGDRLAPPEQAEILWRHWDHCAFHWFPGNHVLHVSQPDYLRRMTRFMGAFMFD"
FT   gene            complement(461478..462413)
FT                   /locus_tag="Mvan_0424"
FT   CDS_pept        complement(461478..462413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0424"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: nfa:nfa25480 putative
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11272"
FT                   /db_xref="GOA:A1T272"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1T272"
FT                   /protein_id="ABM11272.1"
FT                   /translation="MDEPESARRIWQALELPGIVDVHTHFMPKNVMDKVWRYFDDAGPL
FT                   VGRPWPITYRSDENARLHTLRSFGVLAFTSLIYAHKPDMAAWLNQWAAGFAADTPDCMA
FT                   TATFYPEPGAAGYVSAAIESGTRVFKAHVQVGDYDPTDPLLDDVWGLIEDAGTPVVIHC
FT                   GSGPAPGRYTGPAPIRAVLAEHPRLRLVIAHMGGPEYSEFLDLCRDFEQLHLDTTMAFT
FT                   GFTEKNMPFPAGEYGRLRDMGDRILFGSDFPNIPYGYTHAMSVLTELPCVDDTWLRNVF
FT                   HDNAVRLFGATGSCPGLPSAEPHRVRKAAP"
FT   gene            462458..463222
FT                   /locus_tag="Mvan_0425"
FT   CDS_pept        462458..463222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0425"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0386 trans-aconitate
FT                   2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11273"
FT                   /db_xref="GOA:A1T273"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T273"
FT                   /protein_id="ABM11273.1"
FT                   /translation="MWDPDVYLNFADHRGRPFFDLLARVGADRPHRVVDLGCGPGNLTE
FT                   VLGRRWPDAQVQGWDSSPEMVAAARGRGVDARLGDIADWVPEPDTDVVIANAALQWVPE
FT                   HRDLLVRWAGQLEPGSWIAFQVAGNFDAPSHAAIREVARREPFTAALADMPWRDADVVG
FT                   APVEYAGLLTDAGCTVDAWETTYVHELVGETPVLDWITGTALTQVRQRLSDDAWERYRQ
FT                   AIIPLLAQAYPVRSDGRTFFSFRRVFVVAQVT"
FT   gene            463361..464980
FT                   /locus_tag="Mvan_0426"
FT   CDS_pept        463361..464980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0426"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_2855 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11274"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1T274"
FT                   /protein_id="ABM11274.1"
FT                   /translation="MFEGLVESAVRSRGAAAIGAWARMENAAAARRLFAMADLLEAKLA
FT                   DKDSAERDQWCLDNWDAVSAEVAAAQNVSPGVASNELLDAWAMRERLPRVAEVFATGAI
FT                   SYRLARTVVKRTRLIADRDARAKVDVEIAAQLTAWGSLSVAKQEAEIDDWVDRFDPSAV
FT                   VRAEGSSRSRHVDVIPAKNGSGVCYVEAVLHSHDGEALDRRLEELARSVCDRDPRTKDQ
FT                   LRSDAIGAMAAKADRLMCLCGIDDCEAAQRTPSAVVVHVIAHEDSLTDDTPFAGHGERP
FT                   PDAAVEPDVHPGEDPDEKAGQDAAEAHDLQPDGEPRQEPGSGRGKDLLAPPPATGPAKT
FT                   KPAMILGGGMLPAPLLAATVAHTATIKRLVHPGQSPPEPRYTPSQKLADFVRCRDMTCR
FT                   FPGCDVPADRCDLDHTIAYPAGPTQASNLKALCRKHHLLKTFWGWRDAQDCDGTVVWTS
FT                   PGGQVFTTHPGSRLLFPALCRPTAPVVVSSADLAPAPGRPSGLGMPRRKQTRAQARARR
FT                   IAEQRRENEALLKTVQDDAPPF"
FT   gene            464964..465917
FT                   /locus_tag="Mvan_0427"
FT   CDS_pept        464964..465917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0427"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: fra:Francci3_2527 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11275"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T275"
FT                   /protein_id="ABM11275.1"
FT                   /translation="MPHRFDKRTSVAGMRVFVTGGTGAIGGYAVPALIAAGHDVTAVAR
FT                   SDAKAAVLQRQGATAVKVSLFDRDALTAAFRGHTAVVNLASSLPTPARFMLKSAWEECH
FT                   RIRIQGSATVIDAALAAGVGRVVQESVAMIYRDGGARWIDEDWPVDRYPIAAGNHGAEA
FT                   SNRRFGENGRDAVVLRFGFFYGPGAGHSETMMRLARRRVTFQAGKPGSYMSSIHLEDAA
FT                   AAVVAALEAAPGTYNVVDDCPVTATQHSAAMAAAVGVRPWLTPPGRAALLLGDRATSMT
FT                   RSLRVNNARLRAATPWRTRYPSVWDGYRAMVGAQGW"
FT   sig_peptide     464964..465077
FT                   /locus_tag="Mvan_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.764) with cleavage site probability 0.236 at
FT                   residue 38"
FT   gene            complement(465905..466387)
FT                   /locus_tag="Mvan_0428"
FT   CDS_pept        complement(465905..466387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpa:MAP3794c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11276"
FT                   /db_xref="UniProtKB/TrEMBL:A1T276"
FT                   /protein_id="ABM11276.1"
FT                   /translation="MAVFLRKLFRIGKLPSALRAEVEAEGVLFLSEYVAVTRRFRGAVP
FT                   GLRSAGSIASYVGSLVLTNERVLGTLSSVPKLAGRTIDLRWDAPQTGAVKAELSETGLT
FT                   LDVDLDAVDPRFSGELSLHYKEHIPADVLALLPRTSLAFDPPPEYIFRAVGVAYHP"
FT   gene            466437..467102
FT                   /locus_tag="Mvan_0429"
FT   CDS_pept        466437..467102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0429"
FT                   /product="phosphoesterase, PA-phosphatase related-protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mmc:Mmcs_0393 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11277"
FT                   /db_xref="GOA:A1T277"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1T277"
FT                   /protein_id="ABM11277.1"
FT                   /translation="MRSGWLIGSAAAALGVYLLMWVGYVQGWVWLAGIDADVLNPANRF
FT                   GDGRPRWVTAWDVLCTLLGPGAFRLAVLVVIVVALVRRRFRLAVFLTVTVELSAVVTET
FT                   AKYIVDRPRPDTAMVSALSTSFPSGHALGVMVSVAALLTVVLPVVRPALRGWLVALGIA
FT                   VILVVGIGRVVLNVHHPSDVIAGWALGYAYFVACLLLVWPSVPVIERAEKPAVLDNAH"
FT   gene            complement(467056..468549)
FT                   /locus_tag="Mvan_0430"
FT   CDS_pept        complement(467056..468549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0430"
FT                   /product="phosphoesterase, PA-phosphatase related-protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG:
FT                   mmc:Mmcs_0394 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11278"
FT                   /db_xref="GOA:A1T278"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1T278"
FT                   /protein_id="ABM11278.1"
FT                   /translation="MDLLPGRRRGRGIRQIGEGLGTLDREVFEAVAESPSPLLDAVMPP
FT                   LTKAADHSKLWFAIAAGLAALGSSSAKRGATRGVVSLALTSLLTNQVAKRVWKRERPSR
FT                   LLVPLARQTRRHPTSNSLPSGHSASGAAFAVGVGLENPPLGLGLALLAGLVGMSRVATG
FT                   AHYPGDVLAGFGIGAGIAVLGARVVPPIAEARMPGAEPLRVDTPARPDGEGVTLVINPA
FT                   SGSGTGARVLDEVREALPRAEIVELGENDDVVEVLRSAAQRAEVLGVGGGDGTVATAAA
FT                   VAVDAGVPLAVFPAGTFNHFAKDIGCDTATKTVAAIKQGTVSCVDMVCLNEKQMVVNTA
FT                   SIGAYPMFVQTREKLEHRIGKPLAGIYAMFHTLRRDEPVRIAYDNKTLQTSLFFLGNSA
FT                   YLPSGFAPSRRTRMDDGLLDVRILETGRRMSRLRILTAVTLGRLERSPLYHELRVPEFA
FT                   FRSVDGPTVLALDGEVGTEVEEASFSARYRALPVFRPAR"
FT   gene            468602..469294
FT                   /locus_tag="Mvan_0431"
FT   CDS_pept        468602..469294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0431"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mmc:Mmcs_0397 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11279"
FT                   /db_xref="GOA:A1T279"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:A1T279"
FT                   /protein_id="ABM11279.1"
FT                   /translation="MALRDGTVGCMFRLPMLLCAALLAALLTPAQAVADFSPWFANSVG
FT                   PATQVLAVTGTGGSDAKLDVWERTAAGWQPVAGGVGIPAKIGEKGMSPNHFDGSMMTPK
FT                   GIYTLDFAFGTQPNPGGGLKYVQVGPNHWWDGDMKSPTYNTMQVCDKENCPFNTSLSAG
FT                   TENLDIPQYAHAVVMGVNKERIPGKGGAFFVHSTDGGATAGCVAIDDATLVTIMRWLRP
FT                   GAMIAITE"
FT   sig_peptide     468602..468706
FT                   /locus_tag="Mvan_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.766 at
FT                   residue 35"
FT   gene            complement(469298..469777)
FT                   /locus_tag="Mvan_0432"
FT   CDS_pept        complement(469298..469777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11280"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1T280"
FT                   /protein_id="ABM11280.1"
FT                   /translation="MCAAMAPMSDIDDIKQVKYRYLRALDTKHWDDFADTLTEDVIGRY
FT                   GESIGEEHHFTNRDDLVNFMRNSLGPEIITEHRCTHPEITVDGDEAQAIWYLQDRVIAP
FT                   DFNFMLIGAGFYHDRYRRTPDGWRICETGYDRTYDASMKLDALEFKVKAGRAINI"
FT   gene            469829..471577
FT                   /locus_tag="Mvan_0433"
FT   CDS_pept        469829..471577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0433"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0401 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11281"
FT                   /db_xref="GOA:A1T281"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A1T281"
FT                   /protein_id="ABM11281.1"
FT                   /translation="MSDALGLSIGTTNLAAATVGRQPVIRRSVLTLYGHSAPEVGEPAG
FT                   KTGAVVLSGFVERVGDPVPLVAADGNTYPAAQLVVEALESMAALAGAQAPSDVAISVPS
FT                   YWSPATTAALADTLEASAILSPGGSRPRLIPDSEAALTALNANPGLDRRGVAVLLDFGG
FT                   GGTSITLVDAASAFTAIGGTERYAEFAGDQIDQAVLGHVLDGVGGGVDPAQTAAVGSLA
FT                   ALREQCRAAKERLSVQTATEVTADLPGYRGEIRLTRAELEELMARPLDGVFVALEEALA
FT                   RNSIGWSSISSVALVGGGAAIPLIAQQVSQRLRVPVVTTPQPALDAAVGAALFAGYGRG
FT                   AETATVAAPEADSTYALAWSQDDSPVDDVVPYTGEIPEERPNPYALSGAYETEVVVPYD
FT                   DRDHDAGAGPRFPLSVIGVVAALALLAVGGAAIALTSVDSSDPTTPTPGNVPLSSALVP
FT                   SEAPPAAATVTVSQQTVQPPPQTTIAPPVVTTPPTTVPTTTTTTTTSPTTTTTTTTTTT
FT                   TTTTTTTTTTTTTTTTPPTTTTTQPPTTTEPPTTTQQPRTTAMTTTYLEVPFVPVPIPI
FT                   PVPDTP"
FT   gene            complement(471723..472709)
FT                   /locus_tag="Mvan_0434"
FT   CDS_pept        complement(471723..472709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0434"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rxy:Rxyl_3024 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11282"
FT                   /db_xref="GOA:A1T282"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T282"
FT                   /protein_id="ABM11282.1"
FT                   /translation="MTAPLLEVSDLVKHFPIKSGIVIEREVGRVRAVDGVSLTLGEGET
FT                   LGLVGESGCGKSTLCRAILQLTPPTSGSVKFMGQELVGMSGRELRPLRRQMQMIFQDPF
FT                   SSLNPRKRIGQIIGDPMDLHELASGADLKRRVQDLLDRVGLRPEHYNRYPHEFSGGQRQ
FT                   RIGIARALALRPKLIVADEPVSALDVSVQAQIVNLLKDLQDEFGLSYLFVAHDLGVVRH
FT                   VSDRVAVMYLGKVVEDSGTDDLYDRPIHPYSNALLSAVPIPDPRRNEARERVVLEGDVP
FT                   SPSNPPAGCRFHTRCPWASEVCASDEPAMSDYGPGHAAACHHPRNTA"
FT   gene            complement(472706..473698)
FT                   /locus_tag="Mvan_0435"
FT   CDS_pept        complement(472706..473698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0435"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rxy:Rxyl_3025 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter, C-terminal domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11283"
FT                   /db_xref="GOA:A1T283"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T283"
FT                   /protein_id="ABM11283.1"
FT                   /translation="MTREPLLRVDDLRVSFATEDGVLQAVDGVSFDLTPGEVLAVVGES
FT                   GCGKSVTAQTLTGLTRSPNTRISGSVTYRGRELTGLGDDALRDIRGEEIAMVFQDPMSS
FT                   LNPVYRVGDQIVEMIRAHRDVSKKEARERTVELLTSVGIPNPQARVRSYPHEFSGGMRQ
FT                   RVMIAMALALEPAVLIADEPTTALDVTVQAQILRLLADLNRERELAVVLITHDLGVVAE
FT                   VADRVVVMYAGQIVEDGTVDDIFYSPQHPYTWGLLGSLARLDRPRTERLAQIAGAPPSL
FT                   LDPPSGCRFAPRCAFQFDRCDQPPPLDHDGGTHLDRCWLGGDVKAEVRP"
FT   gene            complement(473695..474657)
FT                   /locus_tag="Mvan_0436"
FT   CDS_pept        complement(473695..474657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A2176
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11284"
FT                   /db_xref="GOA:A1T284"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1T284"
FT                   /protein_id="ABM11284.1"
FT                   /translation="MARFIARRLLGMVAVLFAISVIVFLIFNVVPNSDPAARIAGKNAD
FT                   PDLIARVNADLGLDQPLPVQYVTMMKQIFTGQLTSYASNRNVVEQIWEGLPATFSLCIG
FT                   AAVIWMSLAVLFGYLSAVHAGRFADRALTVLSLVGISMPVFWLAAILLYFLSFKVQLFP
FT                   TGSYVDLTEDPLDWAYHLVLPWFTLAVLFIGFYSRVLRSNMLDAMNEDYVRTARAKGLS
FT                   ERQVRIRHVLRNSMIPIVTLFGLDFGMVVGGGAILTETVYNLPGVGLYAGEAIRSLDLP
FT                   PLMAVTMFGAFFIVLFNTVVDVAYAVLDPRIRLGEAAPA"
FT   sig_peptide     complement(474556..474657)
FT                   /locus_tag="Mvan_0436"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.512 at
FT                   residue 34"
FT   gene            complement(474657..475685)
FT                   /locus_tag="Mvan_0437"
FT   CDS_pept        complement(474657..475685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0437"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mlo:mll0598 permease of
FT                   oligopeptide ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11285"
FT                   /db_xref="GOA:A1T285"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1T285"
FT                   /protein_id="ABM11285.1"
FT                   /translation="MVAVPEAPPGVPESQVQGRNPWYLAWLRLRRNKVALGCGLLFVLI
FT                   VAVCLAAPLWADYVAHTGPNDNHITDTVLIDGVETDIVAPDGTPLGPGLRGRYLLGADQ
FT                   NGRDVMVRLLYGGRTSIYIGLAAAAVTTVLAVVVALLAGYYRGWIDAVLSRVLDVIWAF
FT                   PVLLLGIALGTALAIGGLKLGVIAIAGDSIWIPILIIGLVYVPYMARPLRGEILALREK
FT                   EFVEAAVAQGMGPLRIMVGELLPNIVSTIIVFFTLNIANNMLLESALSFLGAGVRPPNA
FT                   SWGTMIADGYQMIYTAPHLTIVPGLMIVVTVLSLNVFGDGLRDALDPKARIRIEANDAG
FT                   RH"
FT   gene            complement(475685..477334)
FT                   /locus_tag="Mvan_0438"
FT   CDS_pept        complement(475685..477334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0438"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: rru:Rru_A2178 extracellular solute-binding
FT                   protein, family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11286"
FT                   /db_xref="GOA:A1T286"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1T286"
FT                   /protein_id="ABM11286.1"
FT                   /translation="MHIFRRALIIACVASLAAFGVAACGSDDSSGGGGGSGGDITVNAT
FT                   SFPDYIDPQLSYTVEGWEVLWNVYTPLLTYRHARGKEGTEVVPALAEALPDISPDGKTY
FT                   KLKLRPNMKYSDGTPIKASDFTYAIQRLFKTDSGGSVFYNVIAGATEYADGAADTITGI
FT                   TTDDGTGDITIQLTEPNGTFDNLLGLMFAAPIPQSTPLDADATNNPPPASGPFMFTTVD
FT                   APRTLTMERNPQFQTVKDAGADEVADAGVDKITLIENKNQSAQVTDIMQNKVDFMMDPV
FT                   PSDRLQEVKSRYSDRFRMEDSINTYYMFMNTERAPFNDVRVRQAINYAIDPEALNRIFG
FT                   GRLHPTQQVLPPGMPGYQEYKLYPGPDMDKARALIAEANPADRDITVWTDDEPDRKRIG
FT                   EYYHDLLTQLGFNATLKVIAGDVYWTTVGNQSTPDVDTGFADWFQDFPHPDDFFRPLLH
FT                   GDSILPTNGNNLSRANIAENNAKMDELVTKQITDEGVEQQYADLDRAYMEQAVWAPYGN
FT                   EQFTTFLSERMDFDKSYHHLLFKQDFTSFALK"
FT   sig_peptide     complement(477263..477334)
FT                   /locus_tag="Mvan_0438"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.623 at
FT                   residue 24"
FT   gene            477528..478514
FT                   /locus_tag="Mvan_0439"
FT   CDS_pept        477528..478514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0439"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: mmc:Mmcs_0382
FT                   lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11287"
FT                   /db_xref="GOA:A1T287"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T287"
FT                   /protein_id="ABM11287.1"
FT                   /translation="MPSRNLDKNVSMPVEQNTKVAIVGMGSVGTAIAYACLIRGSAGAL
FT                   ALYDVNSTKVRAEVLDLKHGSQFVPHCRISGSDDIAVTAGSAVVIVTAGAKQKPGQSRL
FT                   ELAAANVAMAQTLTPQLLAHSPEAVVIFVTNPVDVVTFAATRSVDAAPGHVFGSGTVLD
FT                   SSRFRYLIAQQADLAVGNVHGLIVGEHGDSEISLWSSVSVGGVPATEFRRDGVLVFDEQ
FT                   NRRRISTDVVNAAYEIIAGKGATNLAIGLSSARIIEAVLGDQHRVLPVSTVQQGAHGIS
FT                   GVALSLPTVVSAHGAGQVLEVPLSESESQGLQASATTLRAAQESLGL"
FT   gene            complement(478503..479246)
FT                   /locus_tag="Mvan_0440"
FT   CDS_pept        complement(478503..479246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11288"
FT                   /db_xref="GOA:A1T288"
FT                   /db_xref="UniProtKB/TrEMBL:A1T288"
FT                   /protein_id="ABM11288.1"
FT                   /translation="MGSAGHEKTVSPLPGMLPTPDVQITDAGVDATLAAAVAIINPLLD
FT                   VLWGTDPLGLKRRDDGVGWALNAADLPGTPAWDDMDADARIHWWVWRVGALNTVAVAFP
FT                   GVLGILARRLPIQDLLGFVSQAIVLCAVARELGVTDQRPQVRMLAAVLCDRDLSVVVYQ
FT                   PSTDRRLVDIPHHPLGIVSAVWNLVGLFDAIGDEVGKRPQPRGPFRYLGLLPAVGAVAA
FT                   YFGECGALARAAKMGRRWIERQSQT"
FT   gene            complement(479256..480041)
FT                   /locus_tag="Mvan_0441"
FT   CDS_pept        complement(479256..480041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0441"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: nfa:nfa54300 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11289"
FT                   /db_xref="GOA:A1T289"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T289"
FT                   /protein_id="ABM11289.1"
FT                   /translation="MTDAAPPANPFDLTGHVAVVTGGGSGIGLGMAEGLARAGATVAIL
FT                   GRSAQRLDSAAATLRSHGNPVLPVVCDVTDEQAVTDAMARIRSEFGWLDSCFANAGVRG
FT                   TFTPTLDTSLAEFREVTRVDLDGVFVTLREAARQMIGAGRGGSLVGVSSLGAVQGMPRQ
FT                   PAYAASKAGVTSLMDSLAVEFARYGIRANTIQPGWFATEMTADGMADERFRARVLPRVP
FT                   VRRWGAAEDVGGIAVYLASPASAYHTGDVLRLDGGYLKF"
FT   gene            complement(480051..481328)
FT                   /locus_tag="Mvan_0442"
FT   CDS_pept        complement(480051..481328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0442"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; KEGG: mtc:MT1794
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11290"
FT                   /db_xref="GOA:A1T290"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T290"
FT                   /protein_id="ABM11290.1"
FT                   /translation="MRKQLGRPSGSCHHDQMNAKTTCAVVGGGPAGMVLGLLLARAGVE
FT                   VTVLEKHADFLRDFRGDTVHPTTLRLIDELGLWPKFSALPHSRLERATVDVGAGRTITV
FT                   VDFGRLRQPHPYIAMVPQWDLLNLLAEAGEAEPTFTLRMCTEATGLIREGGRVVGVRYQ
FT                   DPDGPGELRADLTVGCDGRGSVLRGLAGLQVREFPVSFDAWWFRLPRPADDSIYTLVPR
FT                   IAPGKAMIVIPREGYLQIAMLIPKGTDAERRARGLDAFRADVLALLPEAATTIETITSL
FT                   DDVKHLDVRLNRLRRWHTDGLLFIGDAAHAMSPAGGVGINVAIQDAVATARLLADPLRR
FT                   GAVTERDLAAVRRRRVVPAALTQALQRQIDKRFLRPILDGDVTGPPPALVRAIERAPWL
FT                   TFVPAYLVGVGVRPERAPEFAKRRPT"
FT   gene            481487..484063
FT                   /locus_tag="Mvan_0443"
FT   CDS_pept        481487..484063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0443"
FT                   /product="acetaldehyde dehydrogenase / alcohol
FT                   dehydrogenase AdhE"
FT                   /EC_number="1.2.1.10"
FT                   /EC_number="1.1.1.1"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   aldehyde dehydrogenase; KEGG: aba:Acid345_0379
FT                   iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11291"
FT                   /db_xref="GOA:A1T291"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR012079"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR034789"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1T291"
FT                   /protein_id="ABM11291.1"
FT                   /translation="MSTTQMRRGEIDAVVDKAAAAAAEFRKLDQAQVDAIVEAMVRAGI
FT                   RAAAALAQVAIEETGFGVFEDKVVKNYVATEFLHDYLRDKKSVGVVEEDIENNIVRVAE
FT                   PIGVVLAITPVTNPTSTVLFKAIVAAKTRNAIVFRPSPYAVRCCERSVEILREAAEAAG
FT                   MPTGALQVIPDEAHEVTHYLFAHEKIDFLWVTGGPKIVALANAAGKPGLCVGPGNAPIY
FT                   IHKTADVRGAVVDILISKTFDSSVICPAEQTCVIDDEIYDAMIAEFERMGARLLTEEET
FT                   SAIARFAFGCGDKIALEALGQKAPELAARAGFSVPPTVKVLLAALPADLEELAAHPLVQ
FT                   EKLMPVLGVVRARSVDHAIDVAVLVTEHGGLGHTSAVYANDQAVVDAYSAAVRTGRILV
FT                   NAPTAVGALGGVYNNLTPTFSLGCGTWGGSRTTENVNYRQLLNIKTVAQRRTPPQWFRV
FT                   PSNTYFNAGALENLRDLDCETVVIVTDAASDERGVVDLLRGKLRTRHVQVFSEVPPEPD
FT                   ESMIRRGVQLLERVQPEVLIAVGGGSVLDAGKAMRLFFEHPEKTLDELTMPFLDPRKRV
FT                   ADYPTDRHRLQLVAVPTTSGTGSEVSPAAVLTVRGRKQTLVDYSLVPDLAIVDPVLTSS
FT                   MPPVLTADTGIDALTHALEAVVSIFASPYTDALCAQAARLIFDALPRAYRDPEDLAART
FT                   DMSNAATLAGLAFSNAFVGTNHALAHAVGAKFGIAHGRANAIFLPHVLRYNASLPSKFM
FT                   PAPGYSAYIAPDKYAQIGQLIFGGHEPEDSRGRLFLGVQDLLEQLDMPGSLKAIGVSED
FT                   AFTAALPELAMTAFEDLSNRTNPRMPLVSEISDLLRLGYYGSEAPG"
FT   gene            484063..485472
FT                   /locus_tag="Mvan_0444"
FT   CDS_pept        484063..485472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0444"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mmc:Mmcs_4258 protein of unknown function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11292"
FT                   /db_xref="GOA:A1T292"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="UniProtKB/TrEMBL:A1T292"
FT                   /protein_id="ABM11292.1"
FT                   /translation="MDLLEPLDAAMITAEALSEPLHTAAVLILCPPADAGPGYVDELYR
FT                   SALADTAELDPRFRRHPHAGLDTAGLWVWHTDEIIDMRKHLQRRTLPAGADHEALWRLI
FT                   SELHSEPLERSRPMWMAYLIDGLADGRFVYYIKVHHTVIDGVAGLAMIAGALTTDPDKR
FT                   SMRPLYAHKSPAGNGSTSRRRIPNPLSLARVALRGLTGGIETARQLAIAEISTVANSLG
FT                   SGTAALPLEAPYTRFNGRIGRERSFAGGSWPKSRIRAVQKATGVTGNDVLTTVVAGVLR
FT                   EWLLARDELPNSSLVAICPVTVRGREHSAEDDEHGNLFGLQLCPLGTDLADPLERLDYI
FT                   HRAMTWAKHQVTDRGSNATMLLLAPSIAVTVLSPIAPLAPRLRRGYNVSISSVPGPQAE
FT                   MYWNGAHLEEIYPVSTAIDGQALNVTMCSYADRVTFGYVSGRDVVPDIGSLIPLTERVL
FT                   ADLEAAVAAQS"
FT   gene            complement(485463..487352)
FT                   /locus_tag="Mvan_0445"
FT   CDS_pept        complement(485463..487352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0445"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: ccr:CC3478
FT                   outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11293"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T293"
FT                   /protein_id="ABM11293.1"
FT                   /translation="MTSRRWALWLWTLGAGACITLGAGTGVAAADTETSGGDGPSSQSD
FT                   DRDASEASSHGAPDQGTGETPDPNAGDGVDADDSSDPATVPASVELADDVVRDADDEAA
FT                   QEADAAEEVDADTEADTDVDTAADTAAEAEPAAESGSGSGSGSASTVVDETPAQPAAAD
FT                   AEPVRATAPEAANVAPAPVTGVKTGRAKLTIPVGPHDYRTRADWYLPTQADGSVAATGV
FT                   IWLQHGFLGNKASLSKLAQTLSQQTNSIVVAPNLSSFPLACAGCWINGVPMQEAVAAMF
FT                   LGDRTSLNASANTAGYLGTLPQDFVMSGQSAGGGFATAVGGYYTEDPGNNGSLRGVMMF
FT                   DGFSFGGVLTKSLAKLDDPFIPVYQIAAPPQPWNSSGASTKELVAARPGQFVGVTLAGG
FT                   SHADALIGGNALFDFFAQLVAGFSPPGNTAAVYTLATGWINDMYQGLGPNDGTGIYGDP
FT                   DQYIVMGDTAAIVLAPPPVVDIDRYLGTWYEVGSVKQFFSIGLVNTKAVYSLNPDASIK
FT                   VENSGNYFFNNGPESSIVGSALPVDPTNNKLNVRFFGPPSARPPGNYWIVDLDPDYQWA
FT                   VVTDPTGLSGFLLSRDPVVSADFYQELLDRASVNGVKGWITRTRQPAANQTQL"
FT   sig_peptide     complement(487260..487352)
FT                   /locus_tag="Mvan_0445"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.709 at
FT                   residue 31"
FT   gene            complement(487428..488291)
FT                   /locus_tag="Mvan_0446"
FT   CDS_pept        complement(487428..488291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0446"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   mmc:Mmcs_0416 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11294"
FT                   /db_xref="GOA:A1T294"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A1T294"
FT                   /protein_id="ABM11294.1"
FT                   /translation="MDRRRAMLTLGFGMAAAALPFPKAGAQPVIGDAPPPGPSGPGLPE
FT                   AAVPGLLFADEFNGPAGSPPNPAAWFIVPARETIRNPHEWDKPFNMGRYVTDQEHVFQD
FT                   GNGNLVIRATRGEGANIQEKYASAKIIGNWRGGVGTTWEARIKLNCLTDGAWPAFWLIN
FT                   DNPVRGGEVDLVEWYGNRDWPSGTTVHAKLDGTMFQTHKHPIDSAWHTWRMTWLPTGMY
FT                   FWKDYQPGMEPFFTVASNSLPDWPFNDPGYTMAPVFNIAVGGSGGREPAGGTYPAEMLV
FT                   DWIRVF"
FT   sig_peptide     complement(488211..488291)
FT                   /locus_tag="Mvan_0446"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.389 at
FT                   residue 27"
FT   gene            complement(488373..490145)
FT                   /locus_tag="Mvan_0447"
FT   CDS_pept        complement(488373..490145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0447"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11295"
FT                   /db_xref="GOA:A1T295"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T295"
FT                   /protein_id="ABM11295.1"
FT                   /translation="MEEVDLRESRRRIRSLTYGVAAATIAAVVAAVPVQGTAWADSPTV
FT                   ESTSSTTVDAAPAAPDTATEADTGEQAQPDVGAEEPAESEVDTEGPADPDDPEEPAAPE
FT                   PEDTEDVEEPGAVPGEAEGGGDPRPVQPDETEVVAVEPFSDDSDAEPDAEFSRDVVTTG
FT                   PAERTGAAVATLTPAAQLLTIEVPDTEAPALVPAPVITTTTIEAPPSAPKPLSPLAKLL
FT                   QLPGRLINAFLQVFDLTSSASTPRSPLSLGPINDLLFAAFREFERLLGLDQPPAVQPEV
FT                   PALTYDGPTTATTPTVAQFLNASAAGYVLGGAPADLVPFTVNGFQMSSTNIFSGMVAKT
FT                   WVTPQGQIIIAYQGTTGGSNLLFNPLITVSQVLADLQVIFTRTTPWAFHDALYFAKRVQ
FT                   IRAAEQGYSSENIFVTGHSLGGWEAQYVAQQIGLAGIGFEAPGINTRVPGNGADAMFVN
FT                   VGTYGSAAPYMSTDLPGLQPFMPPYVPGGGSKPHYGPIVMIGDPAAITPLRNASALWGK
FT                   SLIGSVIFLVDFLGNFFQYHLPGVQAHHLDVVPDPGMVPWMGRPSGPVHTGWGALSIQG
FT                   LMKAASDAGQLFRP"
FT   sig_peptide     complement(490023..490145)
FT                   /locus_tag="Mvan_0447"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.996 at
FT                   residue 41"
FT   gene            490327..490887
FT                   /locus_tag="Mvan_0448"
FT   CDS_pept        490327..490887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11296"
FT                   /db_xref="UniProtKB/TrEMBL:A1T296"
FT                   /protein_id="ABM11296.1"
FT                   /translation="MPKNLARALGAAALTGCGVLAAPPVVADADRPTPPLLYGFYDVSV
FT                   DFSKQTFNGAPTPMPAKTFQVEYTARCDVAGCAVSMDNSDDLSRNPGAPTVFEYRWNND
FT                   RWETSGDYPYLCDRMNPASAVQSVRSDYLIPNPDGSFSGERTITVGGAGCPGEGPGTHW
FT                   LPITVTPISPPSGHPTGPPTGPR"
FT   sig_peptide     490327..490416
FT                   /locus_tag="Mvan_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.797 at
FT                   residue 30"
FT   gene            491039..491533
FT                   /locus_tag="Mvan_0449"
FT   CDS_pept        491039..491533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11297"
FT                   /db_xref="GOA:A1T297"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="InterPro:IPR022939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T297"
FT                   /protein_id="ABM11297.1"
FT                   /translation="MADSVPALHPDVAALAPLLGTWVGEGSGEYPTIEPFGYTEEITFG
FT                   HVGKPFLTYAQRTRAADDGRPLHAETGYLRASAPDRIEWILAHPTGITEIQEGQLTADG
FT                   DGLRMELVSSSIGRSGSAKEVTDVGRSIELRGDTLTYTLRMAAVGQPLQHHLSAVLRRV
FT                   R"
FT   gene            complement(491530..492072)
FT                   /locus_tag="Mvan_0450"
FT   CDS_pept        complement(491530..492072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0450"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2,
FT                   conserved barrel domain protein; KEGG: mpa:MAP1057c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11298"
FT                   /db_xref="GOA:A1T298"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T298"
FT                   /protein_id="ABM11298.1"
FT                   /translation="MSGLLRAVRQERGMTLDDLAADTGLTKSYLSKVERGQSVPSIAAA
FT                   LKISRALEVDVAQLFSDDPEVSTISVDRAAERGADRHHAVAARMLGKEMSPFVVRPGRT
FT                   FTTHPHPTHLGQEFIFVHSGRVELSHDGRIIALEAGDCAYFDASAPHKLRQIGEDAAEV
FT                   VVVAGNAPRPGAPRRRG"
FT   gene            492162..492947
FT                   /locus_tag="Mvan_0451"
FT   CDS_pept        492162..492947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0451"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: mpa:MAP1058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11299"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1T299"
FT                   /protein_id="ABM11299.1"
FT                   /translation="MTSTMHDSKSDLMRRALDGLSRNVTESSLTLREKLAVTCRALFDA
FT                   GHDSGLAGQITARAEAPGTYYTQRLGLGFDEITAGNLLLVDEDLKVLDGEGMANPANRF
FT                   HSWIYRARPDVNCIVHTHPFHVAALSMLEVPLVVSQMDIAPLYGDCAFLPDWPGVPVGN
FT                   EEGEIISAALGDKKAILLAHHGHVVAGASVEEACSLAMLVERGAKLQLAAMAAGTIAPL
FT                   PDRLAREAHDWTLTPKRSQANFAYYARRALANHPDALDR"
FT   gene            492975..493865
FT                   /locus_tag="Mvan_0452"
FT   CDS_pept        492975..493865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0452"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mpa:MAP1059 probable dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11300"
FT                   /db_xref="GOA:A1T2A0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A0"
FT                   /protein_id="ABM11300.1"
FT                   /translation="MTTATTEIHGIIAYPVTPFTSNGEDIDTGKLAALVEQLVATGAHA
FT                   IAPLGSTGESAYLTEAEFDTVVDTTVGVVNGRVPVIVGASDLTTANTIRRGKYAQRAGA
FT                   DALMILPVSYWKLTDREIARHYASVAAATDLPIMAYNNPATSGIDMSPELLVRMFTDID
FT                   NVAMVKESTGDLSRMQRIKELTGGALPFYNGSNPLVLDALTEGAAGWCTAAPNLRPQPC
FT                   LDLYTAVRDGERSRAQEIYDDLAPLLRFIVAGGLPTTVKAGLELLGVSVGDPRAPLLAL
FT                   DDTGRAELKTLLAVA"
FT   gene            complement(494275..494340)
FT                   /locus_tag="Mvan_R0006"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(494275..494340)
FT                   /locus_tag="Mvan_R0006"
FT                   /product="tRNA-Ser"
FT   gene            494420..494668
FT                   /locus_tag="Mvan_0453"
FT   CDS_pept        494420..494668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0453"
FT                   /product="transposase IS3/IS911"
FT                   /note="KEGG: mmc:Mmcs_0845 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11301"
FT                   /db_xref="GOA:A1T2A1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A1"
FT                   /protein_id="ABM11301.1"
FT                   /translation="MRLCCPVCGQGRINNDMASNKRRRHTPDQIIRKLAEGNKLLAAGQ
FT                   ELSEVCRHLEIAESTWHRWLAQYGGRLRPAEWCMSRT"
FT   gene            494769..495830
FT                   /locus_tag="Mvan_0454"
FT   CDS_pept        494769..495830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0454"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mbo:Mb3142
FT                   probable transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11302"
FT                   /db_xref="GOA:A1T2A2"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A2"
FT                   /protein_id="ABM11302.1"
FT                   /translation="MTAAHNIDLPAVLAERLTTAHPDVLRELLATFIHTLMGAEADALC
FT                   GAGYGERSSERTNSRNGYRHRQFDTRAGSLDLAIPKLRQGSYFPDWLLERRKRAERALT
FT                   TVVATCYLLGVSTRRMDKLVETLGITSLSKSQVSVMAKELDAAVEAFRTRPLDAGPYTF
FT                   VAADALVLKVREQGRVVNVHALIAVGVNAEGYREILGIDVSTAEDGAGWLTFWRSLTAR
FT                   GLSGVRLVTSDAHAGLVAAIGATLPGAAWQRCRTHYTTNLMAITPKSSWPWVRTLLHSV
FT                   FDQPDAESVAAQYDRVIDALADKLPKVADHLEAARADLLAFTAFPKQIWRQIWSNNPLS
FT                   VNRPSGDTVQAAA"
FT   gene            495898..496947
FT                   /locus_tag="Mvan_0455"
FT   CDS_pept        495898..496947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0455"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   sha:SH1662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11303"
FT                   /db_xref="GOA:A1T2A3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A3"
FT                   /protein_id="ABM11303.1"
FT                   /translation="MRVLKSDSGYVLEGDWDGQDAANAFLNHLGGRGFSAATVRAYAFD
FT                   VANLSRFLVQQAVGLVAVDAPLVFDWIDWQGVRRTDQPTSGHRSSTPPAASTVNRRVAA
FT                   VRALFEYLVMTGVCTDNPVPSPRRGQGLRQSQRGLLGHLGPGRARSGGRLVRQPQRLPE
FT                   SLSTNDVDAFLATLATHRDRAMVLVMLLGGLRSAEARGLLLTDVDMGRRRLRVIGKGGK
FT                   ERHVPVDAAFFTELAAYLRWERPPGLATPQCFVVLRGPTTGAPVSEAGLRSLFRRHRET
FT                   SGATRVRPHRLRHTYGTELSAAGIDLLTLRALMGHVSPETTARYVHLSIEQLAAEYGAA
FT                   RATLAGARQ"
FT   gene            496944..498887
FT                   /locus_tag="Mvan_0456"
FT   CDS_pept        496944..498887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0456"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ser:SERP2507 transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11304"
FT                   /db_xref="GOA:A1T2A4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A4"
FT                   /protein_id="ABM11304.1"
FT                   /translation="MTTVLVGQPVGADEVVADYLDHVATLGLSGRAVRDRIRIARDFTA
FT                   RHRDLHAWMTLPAAERIAEIRDTGAWPLICHTIGTGRLRLDVELAAVKQLTGLGRAVED
FT                   RDPSGFATLRNAGIRLGWRSSWVETVLGECLAVVLAHHGGMVADLTGDALDDFDATLSR
FT                   TAVPPSSRRAYRARLASLRQLLFETAVIDTAPKRRRWARSHEQRFTEVEMPDPIRQTLL
FT                   RYIGVRAAVLRPKSVESLINDLLPFAEYLTAHHPDLTSLRGLDRSCIEGYLKWNRTRGW
FT                   RGQRAAAGAGRTVSAAVAQSAVLSLRNLLDDITAWGWAQAPPRRLVFAADVPKLDQPLP
FT                   RALAPDVDAAVMNAVAHLQDPFARIGLTVLRGAGLRAGELLDLELGSIIDYGPAGTWLK
FT                   VPLGKLATERMVPLSAATLAALDEWVALRGTHRPLPHPRTGVLTDFLFTRHGRRLGYTR
FT                   LRNGLLTAAESAGLHRPDGGVLMVTPHQLRHTWATELANAGMSLQALMSLLGHVTPQMT
FT                   IRYATLASPTLRAAYDEAMGKMRRQFTLTPVGKPILPDKVGWLHSEMLKTRVAHGYCAR
FT                   HESAGACPYANICETCDNYITAPEFRDTLTNQLADVQDLRTDAECRGWTDEAARHDRVA
FT                   HALTDHLHRLDH"
FT   gene            498975..499154
FT                   /pseudo
FT                   /locus_tag="Mvan_0457"
FT   gene            499316..500332
FT                   /locus_tag="Mvan_0458"
FT   CDS_pept        499316..500332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0458"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; transposase
FT                   IS3/IS911 family protein; KEGG: sco:SCO0096 noncomposite
FT                   transposon transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11305"
FT                   /db_xref="GOA:A1T2A5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A5"
FT                   /protein_id="ABM11305.1"
FT                   /translation="MVNPEVPESDSDVAARVTVEIRLRAVTEVNDGAPVGEVAERYGVT
FT                   RQTVTAWRKRYEAGGLEALADQSRRPHSSPGRISPDVEALICEMRRHHRRWGARRIAYE
FT                   LKLEIGKQAPSRSTTHRVLVRNGLVNSQEQQHKRVYKRWAREAPMHLWQLDIVGGVFLV
FT                   NGREHKMLTAIDDHSRFVVAAAVLPVPSGPAVCDAFLAAIARWGAPFEVLTDNGKQFTG
FT                   KFTRPLPAEVLFERICRDNGITARLTKRRSPTTTGKVERFHKTLRRELLDETGAFESIE
FT                   AAQAAIDEWVHAYNTVRPHQSLDMATPASLFRSRVTDPELHPPDLGHRRQIFGVLIR"
FT   gene            500389..502026
FT                   /locus_tag="Mvan_0459"
FT   CDS_pept        500389..502026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0459"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cdi:DIP0047 putative transposase (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11306"
FT                   /db_xref="GOA:A1T2A6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A6"
FT                   /protein_id="ABM11306.1"
FT                   /translation="MVAYVRKVRTASGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGIL
FT                   LERARQIAAEDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPKGAPVPAGRTAATHS
FT                   RLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLADLGAEAMSYRTIQ
FT                   RHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVTTLYFEAENEDDLRKVGYSKERR
FT                   VDPQIVVGLLVDRSGFPLEIGCFEGNTAETTTLIPVVTAFVERHDLGDTPMVIAADAGM
FT                   LSATNLAALDDAGLGFIVGSRMTKAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVN
FT                   DAAHRAEPIWDPDEHTNAWRAIWAYSAKRARRDQKTLYAQEARARAVINGERAAKSTRF
FT                   VKTAAGDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRVERSFRMSK
FT                   SDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIANVVKQLRPLRSATIAIN
FT                   GTTETFPPQVPEAQQKILASLNIPEPGH"
FT   gene            502131..503012
FT                   /locus_tag="Mvan_0460"
FT   CDS_pept        502131..503012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11307"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A7"
FT                   /protein_id="ABM11307.1"
FT                   /translation="MATPASLFRSRVTDPELHPAADLSRPDEQVSPIPLMAPPNVRSGP
FT                   LPIEMEARVPPSGVVVIAGLQQLWVGKNYAGLTVTLWIHLTSIHILLADEVIKTVSSRV
FT                   TTADLERLSLRGVRAGRPDPAGPTLPNSRCNGGPTPVEIERTANRDGIVVVRGQELALG
FT                   TGVAGTRVTLRFDVGLIHASAGNMLLKTLPNPFPINECQDIRGARPATTALPIAPPAGP
FT                   QSVQRRVAKDGVVMVAGQRLRVGRTHAGTIVTVVVEDHHFRVLDGIRELSLHARTTTKP
FT                   IRNFNAHRPRKR"
FT   gene            complement(503440..503943)
FT                   /locus_tag="Mvan_0461"
FT   CDS_pept        complement(503440..503943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11308"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A8"
FT                   /protein_id="ABM11308.1"
FT                   /translation="MTSEETEADRKVPGGAPDLPGFIATIDLFLRLEKRRKSEPMFAAV
FT                   LTDDFQIGFRGGHQWKGRDGLQVYLNQRDGIFDERLELRHVLSYVPVNEGVVELTTRLE
FT                   FYFRRWKAPALVSEEFTGSAFRTWLIRIADDEMRVKRVIIDGFANLNENARTVFAIPDE
FT                   GFDE"
FT   gene            complement(503943..504749)
FT                   /locus_tag="Mvan_0462"
FT   CDS_pept        complement(503943..504749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0462"
FT                   /product="Transcriptional regulator PhtR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mmc:Mmcs_1621
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11309"
FT                   /db_xref="GOA:A1T2A9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A9"
FT                   /protein_id="ABM11309.1"
FT                   /translation="MQKPPVAGMEHDSTGKLPQYPIESVDNALRLILLLGDRSEIRLTD
FT                   ASEYLHVASSTAHRLLSMLQYRGFVRQDPISRAYQPGPSLTNVAFAVHSRMDIPRTAAP
FT                   ILRRLADTLQETVHVGTLDGRLVRFIAALESPSAVRVISRLGGTRPAHCTSTGKVLLAG
FT                   LSDDELDQLYPDPHLEPLTEHSVRTLTELRTQLAEVRKSGFAISNQESEEGVASVAVAV
FT                   PQGGSGIRLALALNASAPSYRFRPSDVRKACSALKDAAAELARNLG"
FT   gene            505224..506678
FT                   /locus_tag="Mvan_0463"
FT   CDS_pept        505224..506678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0463"
FT                   /product="phthalate 3,4-dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1622 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11310"
FT                   /db_xref="GOA:A1T2B0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B0"
FT                   /protein_id="ABM11310.1"
FT                   /translation="MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHE
FT                   SEIPQPGDYVVRQVLQDSFIIARDSAGEVRVMFNMCLHRGMQVCRAEMGNASNFRCPYH
FT                   GWSYRNDGRIIGLPFHQEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLED
FT                   YLGDFRFYLDFYTRQGPNGLEVQGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIG
FT                   LFREPKAHKRKDGATYWAGRGGGTTYKLPEGSFEDRMSYVGYPAEMISRAKATWTEQQR
FT                   QVVGADGFMISAATCFPNISFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAV
FT                   DSDAPEAFKAASYKAYLMCFGSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLA
FT                   DDARVVDTLSSAQFHGPGYAQLGYNENNQRQLLRLWADYLDMPPLRVDPATVLTDNPQG
FT                   IEPMVQTNGGAVAGIDSESATTSVTL"
FT   gene            506675..507271
FT                   /locus_tag="Mvan_0464"
FT   CDS_pept        506675..507271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0464"
FT                   /product="phthalate 3,4-dioxygenase, beta subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1623 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11311"
FT                   /db_xref="GOA:A1T2B1"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B1"
FT                   /protein_id="ABM11311.1"
FT                   /translation="MTVDDQRTGRPMAPSVLGAHAARAQRVGDPLPFDDSRHLEAHRFL
FT                   VNEAYLLDAQDYDRWLGVLTEDIHYYMPVRITTAAGAGFDSSPGMAHFDENKYSLERRV
FT                   ARFATEHAWTEDPPSRLRHFITNVRTFLTDDADHLVVDSAELLFRSRGDVNESTLLSCG
FT                   REDLLRRDGNALKLARRTICVDESVLRMQNLAVFL"
FT   gene            507268..507573
FT                   /locus_tag="Mvan_0465"
FT   CDS_pept        507268..507573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11312"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B2"
FT                   /protein_id="ABM11312.1"
FT                   /translation="MSSNGSGEGAQSPPQPACEELSTLLAGATGDALNIANEFAEVVVR
FT                   RVTTRNGARLLIQAPKSAQWVSLDALEIEALTWQNPATLAAMVGNAGTPLILGEEV"
FT   gene            507570..508373
FT                   /locus_tag="Mvan_0466"
FT   CDS_pept        507570..508373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0466"
FT                   /product="phthalate 3,4-dihydrodiol dehydrogenase"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_1624 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11313"
FT                   /db_xref="GOA:A1T2B3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B3"
FT                   /protein_id="ABM11313.1"
FT                   /translation="MTGWLAGKRALIVGGGSGIGRATVDAFLNEDARVAVLEYDSGKCA
FT                   TLRHQLPDVPVIEGDGTTRTANDEAVQVAVDAFGGLDTLVNCVGIFDFYRRIQDIPAER
FT                   IDQAFDEMFRINVLSHIHSVKAAVPALMGQDGASIVLTESASSFYPGRGGLLYVASKFA
FT                   VRGVVTALAHELAPRIRVNGVAPGGTLNTDLRGLDSLDLGARRLDAAPDRARELAARTP
FT                   LGVALSGEDHAWSYVFLASHRSRGLTGETIHPDGGFSLGPPPQRN"
FT   gene            508434..509840
FT                   /locus_tag="Mvan_0467"
FT   CDS_pept        508434..509840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0467"
FT                   /product="phthalate 3,4-dioxygenase, ferredoxin reductase
FT                   subunit"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_1625 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11314"
FT                   /db_xref="GOA:A1T2B4"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B4"
FT                   /protein_id="ABM11314.1"
FT                   /translation="MSGLRELCRCGRGLLRHRRSGTRGGPQDGGSFRGQDPGRGGCAQL
FT                   SGGRVGSRRRMTSRVVIVGSSVGGVRTAQALRSQGYDGDIVLVGEETALPYDKPPLSKA
FT                   LLAGTSDIAAATLLTRDAAAADAIELLLGRRAIGVDVAACQVEFADDEPLRYDHLVVAT
FT                   GASARPSPWGHGSGVHVLRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARSLGLQ
FT                   VTVVDPVPVPMSRVLTEEIGGWFVDLHRDHGVHTRFGVGVENIEGERGNLKIGLTDGTV
FT                   LEADTVVVGIGAVPNDGWLMPSGLVVDDGLVCDEFCRAVTSQNIYAVGDVSRWFHRARG
FT                   VTMRIEHWTNAVDQASCVAHNILYPDELRCYEPVEYVWSDQYDWKIQFCGQTTHLGEPL
FT                   VVGDRLSDNRFTALYPDREQRLSGAAIVNWPRALIECRRALKAGSDLETVRERLELLTN
FT                   PPDTAATRSP"
FT   gene            510393..511478
FT                   /locus_tag="Mvan_0468"
FT   CDS_pept        510393..511478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0468"
FT                   /product="gentisate 1,2-dioxygenase /
FT                   1-hydroxy-2-naphthoate dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /EC_number="1.13.11.38"
FT                   /note="PFAM: Cupin domain protein; Cupin 2, conserved
FT                   barrel domain protein; KEGG: mmc:Mmcs_1628 cupin 2,
FT                   conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11315"
FT                   /db_xref="GOA:A1T2B5"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B5"
FT                   /protein_id="ABM11315.1"
FT                   /translation="MSTAESSELREFDVELEAANLRGQWIYDDMLESVVGGPKPAGVPF
FT                   LWRWHDVYAKLLKSCDVMPESLTARRNLSFINPDARGTTHTINMGMQMLKPGEIAYAHR
FT                   HTMAALRFAIQGGPGLVTVVDGEPCQMDTYDLVLTPRWTWHDHENATSENVVWLDVLDI
FT                   GLVLGLNVPFYEPYGEMRQPQREDPGEHLADRGGMLRPAWEQVKAANFPYRYPWRDVER
FT                   QLQRMAGLAGSPYDGVVLRYANPVTGGSTMPTLDCWVQLLRPGQQTEAHRHTSSAVYFV
FT                   VRGEGTTVVDGVELDWGPHDSFVVPNWSTHHFVNRSAENALLFSVNDIPTLKALDLYYE
FT                   EPELSLGTQPFPPVPANLRAR"
FT   gene            511503..512501
FT                   /locus_tag="Mvan_0469"
FT   CDS_pept        511503..512501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0469"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mmc:Mmcs_1629 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11316"
FT                   /db_xref="GOA:A1T2B6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B6"
FT                   /protein_id="ABM11316.1"
FT                   /translation="MRDTKLTVDDITGVVGIIPTPSIPTADQPGTAFSVDLDEAAKLAD
FT                   AMVRGGVDVLMTTGTFGECASLTWDELQSFVATVVDAVAGRIPVFAGATTLNTRDTIAR
FT                   GRRLGELGADGLFVGRPMWLPLDDAGIVRFYRDVAEAVPNMALVVYDNPGAFKGKIGTP
FT                   AYEALSQIPQVVAAKHLGLLSGSAFLSDLRAVSGRVRLLPLETDWYYFARLFPEEVTAC
FT                   WSGNVACGPAPVTHLRDLIRARRWDDCQALTDELEGALETLYPGGNFAEFLKYSIQIDN
FT                   AQFQAAGFMRTGPTRPPYTEVPESYLAGGREAGKNWAALQQRYASLAVSNH"
FT   gene            512520..513410
FT                   /locus_tag="Mvan_0470"
FT   CDS_pept        512520..513410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0470"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11317"
FT                   /db_xref="GOA:A1T2B7"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B7"
FT                   /protein_id="ABM11317.1"
FT                   /translation="MLVKALGYVGVESPDAKEWLAFGPEVLGMEAVEASSGSVLLRIDD
FT                   ADHRIAVHHGDRNRMLYAGWDVGSEEALEAAGELLHKRGIGFEVGTEEDCAARGVLGFV
FT                   TLSDPSGLRHELFYGQKVVPGSFRPGRAMSGFVTGAQGLGHVVLATPDLAQADRFLRGV
FT                   LGFKKSDEIYTFMDLWFYHCNPRHHSIALTPMPGVRGLHHVMVEVQSFDDVGMAYDLCM
FT                   SRNIPLSMTLGRHVNDRMVSFYVRTPSGFDIEYGWDAVTVDEETWTVAQYDRPSVWGHQ
FT                   MVAQTPPGALEAATT"
FT   gene            513456..513842
FT                   /locus_tag="Mvan_0471"
FT   CDS_pept        513456..513842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1631 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11318"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B8"
FT                   /protein_id="ABM11318.1"
FT                   /translation="MAIRFLTDDWATAVTDAANADERFRIAAKGHDVVLRVSVSQSPAS
FT                   DDYYMHFSDGSLIVGIGSPPRTPDVEAELSYETNVELSRGALNGQTATMTGQMKAVGNM
FT                   MKMMSIGKAQDRLAELESGLDIDY"
FT   gene            514011..515036
FT                   /locus_tag="Mvan_0472"
FT   CDS_pept        514011..515036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0472"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mmc:Mmcs_1632 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11319"
FT                   /db_xref="GOA:A1T2B9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2B9"
FT                   /protein_id="ABM11319.1"
FT                   /translation="MTTRSSELVPSDMKGLWGFVPACSTPDAADVNAVDTIDTDALASL
FT                   VDRLVRDGVDGIVTTGSAGESHTLSDDEYRTLITTVVETVNARVPVFVGASTLNTRDSI
FT                   RRARVIADLGADGIMSGPPMYLPQTAENAVQYYKDLAEAVPELAIMIYQNPHAFRITLP
FT                   PGAFRELAQIRNIVALKQTSMDIFNVIGAIKAVKEKMSVLVLDQLMYPAMMFGAAGAWS
FT                   IDVCMGPWPALSLRDACQRGDWTEAAAIADQMQAPFRTLGLTMEEFQAMQSAWWKMAID
FT                   TAGYGRAGAARPPFVHIPQTVVDSAHRYGERWAGLAERYHRSREAAGLPPAAANVAAAS
FT                   S"
FT   gene            complement(515912..516079)
FT                   /pseudo
FT                   /locus_tag="Mvan_0473"
FT   gene            516204..517271
FT                   /locus_tag="Mvan_0474"
FT   CDS_pept        516204..517271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0474"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   nfa:pnf2830 putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11320"
FT                   /db_xref="GOA:A1T2C0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C0"
FT                   /protein_id="ABM11320.1"
FT                   /translation="MRGVEGLRLIPGGAAPVEAVAADPVVFQRECVDAFVASWHARGFS
FT                   PVTIDNDIGLLERTLTALGCPAWEVTSEDIDRVVGELAMAGRAASTRREYVQIFKGFHR
FT                   FLQTRKAAEIEAAFGARLVCPVDEFNASRHVGDDSPAVAAPPTPERVSAFFEFLKTRIA
FT                   TARKYGPAARDYAMFRTLYHAGLRSEESALLEIPDVHFDRGPFGKLHVRFGKAAHMSGP
FT                   RPRWVPMLDGLDVLLQWFLADVRPKFPNSPVLFADESGGALHRGTIRNRLRYLMELEGR
FT                   PATERFSPHALRRACATHNYERGVDLVAIQQLLGHWTVSSTMRYVRPSATFIEDAYRRA
FT                   VTSTLAELSGEDGTA"
FT   gene            517268..517582
FT                   /locus_tag="Mvan_0475"
FT   CDS_pept        517268..517582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11321"
FT                   /db_xref="GOA:A1T2C1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C1"
FT                   /protein_id="ABM11321.1"
FT                   /translation="MRIRWRLRMAAAQREVWTGTELRRLLSERAGLELSAASVSALFTK
FT                   EPSQIKVSTLIALCTALDCTPDDLFEIDTTPVEQPAARPRPVASQPKTATARGRSMPPM
FT                   "
FT   gene            517616..519250
FT                   /locus_tag="Mvan_0476"
FT   CDS_pept        517616..519250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0476"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   rha:RHA1_ro08303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11322"
FT                   /db_xref="GOA:A1T2C2"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C2"
FT                   /protein_id="ABM11322.1"
FT                   /translation="MGKRQRDCVDCGAPVGYIGREHCCHCTRRLRAQAAKARCPGCGWD
FT                   RIVLPETDRCMLCSRRCRECGGPIKFRGETVCRPCQKRATLAAAKSTCPRCAKPGYLRE
FT                   STGWCGPCSRPRPPKYPPRICVSCGELRRHAAHGMCGRCWQRHPDRPFVRGETLAAALT
FT                   EPPGWLGDFVAYLAARHCPARACRMIATLARLLEDEHPNHPQSVLERSRRPGRSMGSLA
FT                   RALEAFFTEHGLAMATDQDQRLAAGRRQKRIDATPGPMRVAVAAFAESMLHNRDRARRA
FT                   GTRPRSDRTIESALTIVRDLAHFLEAQRGKQDWALVDVTDIEAFLAELPNTRARRLTVL
FT                   GQFFRFARNRRVVLVDPTHGMSAKRHRGFRGRTLTITQQRDLFRRWSADPAAHPHEALF
FT                   GLLAILHGVSSRELRLLQVDHIDTSDRSIRLGTRPHPVPLDPVSWNALQRSLDHRDTQR
FT                   TNNPHVIVTRGTKADRRPASEAYMSHLLDPCGLPPKMLRSTRLADLVNTIDPKLVAAAF
FT                   GMRPEGAMIYLADHLDEGRLPDHLAQP"
FT   gene            complement(519312..519605)
FT                   /pseudo
FT                   /locus_tag="Mvan_0477"
FT   gene            519727..520908
FT                   /locus_tag="Mvan_0478"
FT   CDS_pept        519727..520908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0478"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   fra:Francci3_3734 phage integrase-like SAM-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11323"
FT                   /db_xref="GOA:A1T2C3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C3"
FT                   /protein_id="ABM11323.1"
FT                   /translation="MAYPVAVSPAGGQRTWTVLGEDFATVGPVEEWIEAHRHLWSPNTV
FT                   RGYATSLAQWWSFLEQRGQSDAWCDVGVPAFTAFLSWQRNGRTVEHRLAESDQAPSAST
FT                   LEVRLAALISFYRWHQAVSGVVVAGRLLRGTPRRRPARGLLAHLDARSAPAASSLVRVR
FT                   RDRRRDRPPLLLPEQIQAILDGCAVFDAESGLWQGNLRDRFVFALLAETGMRLGEALGL
FT                   RIGEFVLGRGGTAYVQIVPRSDNPNGARVKMMRPRRVYVGADLERLFADYLTDIACRAA
FT                   ESGIALTDTSPLLVNVSRPPWLAALRETTVREKVATLRRRRIGPPGWTPHWFRHTHATA
FT                   LLLAGTPDWVVSRRLGHAHVQTTLDLYGWVRDDEALRAAANWASYASSWQVAE"
FT   gene            520905..523079
FT                   /locus_tag="Mvan_0479"
FT   CDS_pept        520905..523079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0479"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   mmc:Mmcs_5578 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11324"
FT                   /db_xref="GOA:A1T2C4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C4"
FT                   /protein_id="ABM11324.1"
FT                   /translation="MIDEHGHLHLRSAEHLDPIWRLWDELPAQWRGPVLGPGIQNWAAI
FT                   TENDWPHLDLSGLPDPFAAELAWMAHWQASDGTRVSVLAMAQLANMIRRAVVEGRDIPS
FT                   SIRAMDYDAAAVLQSWFYLSRGKRLPSARGRGRVHALFGFARHALIAASHDRPWWQLDF
FT                   WHPRCDPRIPLTDREPVANYGCSPGDIQLPWVRAAVKWHLGTMLESGALRWTTVSQERM
FT                   RSFRRFDNWLTANFDDPTDILGDPTTAVEQAAAFARWTAVAANRVTRQSDTRHLGRTVP
FT                   IRGINDDLRAVAGLLEFVAANPGEARSVLGAEPWQRVNAAHSSSWFGRVTRIPHQRGFN
FT                   DANYIDDHALAQITAALPLIGLPRTEQMTITRGDGTTLTANGLDDPQAMRMILLQILTG
FT                   RRASEIRTCDFDCLSAAPTSSGAAAGDDQSLTRFRYAQSKIDVAPDTILVDREVTEVIA
FT                   EQHRWLQAQHPDGSRRYLFARRLGNRRGDKPYPAGTYNWVLRTLSDLVQITDAKGQVVR
FT                   LSHTHRFRHTRLTRLAELGLPIHVLQRYAGHATPTMTMHYIAARDEHAEQAFLATAKLR
FT                   SDGTRIQLSSDDHDSLHLFRRADRFLPNGWCMLPPLQSCDKGNACLTCSVFVTDHTHRD
FT                   VLERQLRETSDLIDWTTTEFENRHSRPMPEDNVWLIRRHAEHHALTKLLDALNHAPDSA
FT                   THGATTKCHRPSAGPVPVPLDLTRHRRRTR"
FT   gene            523076..523519
FT                   /locus_tag="Mvan_0480"
FT   CDS_pept        523076..523519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0480"
FT                   /product="Tn554-related, transposase C"
FT                   /note="KEGG: Tn554-related, transposase C"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11325"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C5"
FT                   /protein_id="ABM11325.1"
FT                   /translation="MTDSRERRIKALTEAAKAKSQNKTRDAEQAIRRLVKRGGPITFQA
FT                   VQREAGVSHAFLYNHPELRKRIEHLRGARRKAPADQSVDTDSMLVITLTRQIAELKKQH
FT                   RQQLQALRDALERAHGENLDLRRELARRGTDPTPNVTSIATTS"
FT   gene            complement(523499..523939)
FT                   /locus_tag="Mvan_0481"
FT   CDS_pept        complement(523499..523939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0481"
FT                   /product="DNA replication protein-like protein"
FT                   /note="KEGG: mbo:Mb2969 possible transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11326"
FT                   /db_xref="GOA:A1T2C6"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C6"
FT                   /protein_id="ABM11326.1"
FT                   /translation="MTTKTATTKTAAASVASRDLTAEIGFLTRALKAPTMREAVARLAE
FT                   RARAESWTHEEFLVACLQREVSARESHGGEGRIRAARFPSRKSLEEFDFDHARGLKRDT
FT                   IAHLGTLDFVVAKDNVVFLGPVVIVGSVARWPHSACSGRCCD"
FT   gene            complement(523936..525195)
FT                   /locus_tag="Mvan_0482"
FT   CDS_pept        complement(523936..525195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0482"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mbo:Mb2968
FT                   IS1533 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11327"
FT                   /db_xref="GOA:A1T2C7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C7"
FT                   /protein_id="ABM11327.1"
FT                   /translation="MLSVEDWAEIRRLHRAEGLPIKMIARTLGISRNTVRAALASEGPP
FT                   KYERKPAGSAVDAFEDAIRVELKKTPTMPATVIAERVGWTRGMTVFSERVRELRPAYLP
FT                   PDPAGRTSYDPGDIAQCDLWFPPTTIPVGYGQTRTPTQLPVLTMVLGYSRWLSAILLPS
FT                   RRAEDLFAGWWQLIAALGAVPRTLVWDGEGAIGRNRGGRIELTRDCQAFRGVLGTKVVV
FT                   LKPAEPEHKGIIERAHDYFERSFLPGREFNGPGDFNHQFSKWLHVVNARRRRVLGCAPT
FT                   DRIGADLAAMLALPPVPPQVGWRNSTRLARDHYVRLDSNDYSVHPGVIGRRIEVVADLD
FT                   RVQVFCEGKTVAEHERVWAWHQTITDPEHREAANMLRRNRISALRPVTDSDQQVLVEQR
FT                   RLSDYDAALGIDLGEGGLVS"
FT   gene            525485..525994
FT                   /locus_tag="Mvan_0483"
FT   CDS_pept        525485..525994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0483"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1641 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11328"
FT                   /db_xref="GOA:A1T2C8"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C8"
FT                   /protein_id="ABM11328.1"
FT                   /translation="MNAVAVDRDTREAVEAFMFREAELLDGGQFREWLGLLDPDIRYVV
FT                   PVRTTREDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRTRHFVSNIRTTAG
FT                   PEADELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLARREVLLDHSTLPID
FT                   NLSVVL"
FT   gene            526117..527889
FT                   /locus_tag="Mvan_0484"
FT   CDS_pept        526117..527889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0484"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_1635 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11329"
FT                   /db_xref="GOA:A1T2C9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2C9"
FT                   /protein_id="ABM11329.1"
FT                   /translation="MGDLDVSVQECDVLVVGGGIGGVRAALRAAELGSSVILVEKAVVS
FT                   RAGPMTYVHSQYAPDHRVQGEEMTEWAREFVVGSNYLADQDWVQQYIAEAYDRVNEQIE
FT                   WGVPYSTHEDGSLKYVTVRGHNLGTTLGVDGRVCMEILKERMKAAGVRLFERVDVIDLL
FT                   TTDGCRPTAGAVCGAVGVNVVTGQCHVFTAGSVILNTGPWYPKLHYAFADHCSGEGHVA
FT                   AWRVGAEFAGMEFGQFAAWSYFNRSFFTPGQAKIQGIGGKFCNAAGEYFMDRYDPIWGD
FT                   KGGLFTIARAIMTEMVEGRGPCYLDLRHVPQADLEVLYEVSPTVRRAFTEFEVDPSTDL
FT                   LEVTPFIVLGTSSTSGPTIDLDGATTVPGLYAAGYGTACPHLMSGISGSGISSFSAVAG
FT                   YRAGTAAAARGGHAVARSVWENQAQESFAEYFAPMRRLRQVRPVDVWKAIGEATANPAF
FT                   ALFKSEARIDSALAELYRIRDRVLRYVFAPDYQELKKAHEVRAYLTLAIITCEAMKRRT
FT                   ESRGELFRIDYPYADNDEWLKWLLVRRGSGGEFDLQFSERDLPIQSWPVQAPPGRHPSP
FT                   YTVPQGYREEAAVQ"
FT   gene            527886..528176
FT                   /locus_tag="Mvan_0485"
FT   CDS_pept        527886..528176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0485"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: mmc:Mmcs_1636 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11330"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D0"
FT                   /protein_id="ABM11330.1"
FT                   /translation="MIESIDETTCDGCNVCIDSCPTGVIRLVEGDEPWSTTKWRAKIIY
FT                   PNDCHSCRLCAIDCHVDAIVVSHALVIPDPFLPGVEPLDGSRDAPPDEKKT"
FT   gene            528372..529832
FT                   /locus_tag="Mvan_0486"
FT   CDS_pept        528372..529832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0486"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_1637
FT                   aldehyde dehydrogenase (NAD+)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11331"
FT                   /db_xref="GOA:A1T2D1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D1"
FT                   /protein_id="ABM11331.1"
FT                   /translation="MISANLIINGREETSDRTIDVVSPADIRVLLGSVPDAAPGQVDEA
FT                   VAAAAMAFPEWSSRPLEERQGALLAAAGTIHDMIEEYAPILSRENGKILEESHVDLEFA
FT                   SGICGYTAGISAEILADQQIRDTGGTTLIRRRPIGPVAAITPWNFPVVLAFMKLAPALV
FT                   AGNTVVLKPAANSPLVLAEIIRALQQHFPPGVLNMVTGGDAVGEALVAHPRIRKIGFTG
FT                   GIDTGRKVMAAAARDIKRVTLELGGNDPAILLDDVDLSPETMRQIVKGAFGTTGQVCFG
FT                   LKRIYVPTRIHDRFVEAFSAAVDEIVVGPGDDPRVTMGPLNNAQQKNLVEKIVDDARSS
FT                   GATVTTLGQRLDSAAWDHGHFMMPSVVTAADPRLAIVEEEQFGPVVPVLKYDELDDVIR
FT                   LVNQSQYGLAASIWTSDEERAFLLGRRFDTGSVFINSHTFTSLDPRAPFGGAKASGLGR
FT                   EFSPASLDSYTELQTISRRIGPPGPPLS"
FT   gene            530389..530898
FT                   /locus_tag="Mvan_0487"
FT   CDS_pept        530389..530898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0487"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1641 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11332"
FT                   /db_xref="GOA:A1T2D2"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D2"
FT                   /protein_id="ABM11332.1"
FT                   /translation="MNAVAVDRDTREAVEEFMFREAELLDGGQFREWLGLLDPDIRYVV
FT                   PVRTTREDSAGWVGAIAHWNDDYTGLEMRVLRGETDFSWAESPRSRTRHFVSNIRTVAG
FT                   PEADELTVRSNLLFFRSRGDSGRWELLSAERVDVLRRTDDSLRLARREVLLDHSTLPID
FT                   NLSVVL"
FT   gene            530959..532326
FT                   /locus_tag="Mvan_0488"
FT   CDS_pept        530959..532326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0488"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1642 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11333"
FT                   /db_xref="GOA:A1T2D3"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D3"
FT                   /protein_id="ABM11333.1"
FT                   /translation="MTTETTGTADATDPYLRRALREVADGLKVGRLPARVVSDPALHTI
FT                   EMERIFGRAWVFLGHESELAKSGDFVVRHIGADSVIVCRDNSGRIQALSNSCRHRGALV
FT                   CRAEMGNTAHFQCPYHGWVYSNTGELVGVPAMSEAYPGGFDKSQWGLRHIPHVDSYAGF
FT                   IFGSVDPKAPSLTDYLGDTTFYLDLIAKKTAGGLEVIGAPHRWVMSANWKTAADNFVGD
FT                   SYHTLFAHRSMVELGMAPGDPNFASAPAEISLQNGHGVGVLGFPPTLADFPEYEGYPDE
FT                   VVDQMATSYPSPVHKDLMRRSSFIHGTVFPNLSFINVTLAQDHMSPPTPFITFRVWHPL
FT                   SHDRMEVLSWFLVERDAPEWLRDASQASYVNNFGPGGVFEQDDAEAWKAITESVQGPFA
FT                   GEGLLNYEMGMDLTPLTDWPGPGEALPSGYAEQNQRRFWGRWLEYMGQPPAFGGRA"
FT   gene            532346..533173
FT                   /locus_tag="Mvan_0489"
FT   CDS_pept        532346..533173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0489"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_1643 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11334"
FT                   /db_xref="GOA:A1T2D4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D4"
FT                   /protein_id="ABM11334.1"
FT                   /translation="MREVRPFTNRRRVSAVKAGDRRVAIVTAAAAGIGKAIALRWCREG
FT                   GCCVMADTDGEGLDAAVHELAESGAAVCGVAGDVCLSDVANSVVERALTEFGRLDTLFN
FT                   VVGGSLARNVEEISEEQWRSQIDMNLGSVFQMSKPVIPLLRQGGGGSIVNVASTAGILA
FT                   ENRCSAYSASKGGVVLLTKNMALDFARDNIRVNAIAPGGTRTPRIERFLAEHPEHASMM
FT                   VDLCAMQRFAGPDEIAAPAVFLASPEASYITGAVLPVDGGMTAGVTFRAFEAV"
FT   gene            533231..534256
FT                   /locus_tag="Mvan_0490"
FT   CDS_pept        533231..534256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0490"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /EC_number="1.1.1.103"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_1644 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11335"
FT                   /db_xref="GOA:A1T2D5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D5"
FT                   /protein_id="ABM11335.1"
FT                   /translation="MEAIVLNGTNDVGLTSVPDPAPQDGEVIIEVAATGLCGTDLHEYV
FT                   AGPTFSQPPVVLGHEVSGRIVEVGAGVDQSRIGQGAAVIPMDFCGSCHYCHRSLYHLCQ
FT                   RPGWIGFTRNGGLANYVAVPSRLAVRVPDVVDLEEAALTEPTAVAFHAVRRAELLLGET
FT                   VMVLGAGALGLTVIQCARAAGAARIFVTEPSGVRASLARDLGATLVLDPHDPGTTACIL
FT                   EETRGVGVDVVFHVAGSAEAFTQGLDCLRKQGRFMEMSSWAGAASLDVNRHLLKEIQLR
FT                   MVFGYDMFDDFPAVLALIADGKLALAPQITARVPLDRAVKEGLGGLLEGREGLVKVLVK
FT                   P"
FT   gene            534271..535356
FT                   /locus_tag="Mvan_0491"
FT   CDS_pept        534271..535356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1645 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11336"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D6"
FT                   /protein_id="ABM11336.1"
FT                   /translation="MVVAATSRGVFTVSGDGKARAWPELPGQVMAMAVQDERVAVAVHK
FT                   HGVFLATAGADHWTDLGDGLAHRDVRALAFDPHTPNALYAGTEPAHLLRWQDGIWAECG
FT                   NVLGVPEAKRWSFPIRPGIAHVRTIAVHPLEADVVYVGIEVGSLLITRDRGQTWEEIDG
FT                   LGHDIHRVVLHPEAPDRLIVTTGQDTKPYRGGKGIYRSTDRGSSWVQSNNGLGERNYTE
FT                   DAIVVHPADPDVVFLAAADGIPPKWAAVRRLVMGVINGNVYFLSPSKLRRRRGADVGFF
FT                   RSNDGGASWVRLDSEDDRGLFDMVWALEGELTEGGELLLYHGTTAGGLYVSEDEGHTWK
FT                   CLADGLGAITHIATPKKGTAQ"
FT   gene            535353..536534
FT                   /locus_tag="Mvan_0492"
FT   CDS_pept        535353..536534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0492"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1646 Rieske
FT                   (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11337"
FT                   /db_xref="GOA:A1T2D7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D7"
FT                   /protein_id="ABM11337.1"
FT                   /translation="MKLGPTMEFDHIQPAIRKRFTSAADIPKEVFSDPDVYREELTRIF
FT                   YGPYWHPIAHRAELAERNAFRTRWLADVPLLMVRDGDDRIRVFVNSCAHRGTLLEQRRC
FT                   GVAERFECPYHRWIFNNDGRFAGAPRRMQFRPDFREEDYGLRELHVVEAWGLIFVSMAA
FT                   QPPPFDDYLGDSADPLRDCMVDDGDLTLLGYQTVVFQSNWKTYIDNDPYHAPLLHSAFK
FT                   LLNWQGGSGNVLVSEPYGHMSILYDAQPYVDNGFLADPSVVTRMGDDSRARVIALRPVT
FT                   GIVRHVDTINIRYARPLGVDRTEVRYTFFGHASDSEDFARHRVRQSSNLLGPSGFISIE
FT                   DAAVYNRVQATARDGGYQRFVAGVGRPLSESSQNDEVANTGWWAHYQEVMEFC"
FT   gene            536528..537025
FT                   /locus_tag="Mvan_0493"
FT   CDS_pept        536528..537025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0493"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1647 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11338"
FT                   /db_xref="GOA:A1T2D8"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D8"
FT                   /protein_id="ABM11338.1"
FT                   /translation="MLTSSVEDRRARAAYLVDELLGAYARAVDDQDFTAWLALFATECA
FT                   YEVRAMENVREGLPLAYMMDDCRERLADRVKMIQEVWAGTVEPYDTRHFQQRTAMRELG
FT                   EDRWEVRSNVLVTYTGASGEPGILVSGYSEDVVVLDDETALFQQKFVVVDNTPPRYLVY
FT                   PV"
FT   gene            537054..537452
FT                   /locus_tag="Mvan_0494"
FT   CDS_pept        537054..537452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0494"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   mmc:Mmcs_1648 sterol-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11339"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2D9"
FT                   /protein_id="ABM11339.1"
FT                   /translation="MTAVALMSPEWARAYRDLWNDSAEIRQGAKELSMLIEWRVQDAND
FT                   QVSQLEITDGEAIYGGVQIQGRKPDFVLTATASVWHRVADGELGVANAIATRKIKFVGP
FT                   VKVAMANMAVLGAGLRLLGQVDGLVWGD"
FT   gene            537455..537973
FT                   /locus_tag="Mvan_0495"
FT   CDS_pept        537455..537973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0495"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   mmc:Mmcs_1649 intradiol ring-cleavage dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11340"
FT                   /db_xref="GOA:A1T2E0"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E0"
FT                   /protein_id="ABM11340.1"
FT                   /translation="MAASPRWQCDRAAGASGAIQFHGVITDEDGRPVPNVLIETWHAAG
FT                   DDDNAATKIGRLRCDGRNYTLPKSVITDQQGRYSMRMVPPRAPEHGAAPFIAVSVHTRG
FT                   LLDRLITRAYLPGCHLAKDPLLRRLPAERRQALIATRDDIGLRFDITLRPAHGVRVETF
FT                   VEPQQEAAT"
FT   gene            complement(538064..538618)
FT                   /locus_tag="Mvan_0496"
FT   CDS_pept        complement(538064..538618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0496"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   rha:RHA1_ro10114 possible transposase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11341"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T4"
FT                   /protein_id="ABM11341.1"
FT                   /translation="MTQGAGSNYTNLASEPPDHGIGRSRGGLTSKIHHLVDGHGRPLVV
FT                   LVGAGQANDGPVLEHLLAHLKVERRGPGRARTRPNRLRGDKAYSSRATRQRLRRRGIVA
FT                   VIPEPSDQIGHRKRRGTHGGRPPAFDAEDYKGRNVVERNFNTVKQWRGLATRYDKLAIV
FT                   YRGAAVLRAITLWLPHLSDTP"
FT   gene            complement(538566..538961)
FT                   /locus_tag="Mvan_0497"
FT   CDS_pept        complement(538566..538961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0497"
FT                   /product="transposase"
FT                   /note="KEGG: lxx:Lxx02410 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11342"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A1T1T5"
FT                   /protein_id="ABM11342.1"
FT                   /translation="MSRFQLLTDAQWSLIEELLPARTGKKGRPFRDARQMLEGIIYRYR
FT                   CGIAWRDVPEVFGPWQTIWTWHRRMSAEGTWDLVLARLLATADQAGIIDWSVSVDSTIA
FT                   RAHQHATNITRDTGGWVELHESGERAA"
FT   gene            539073..539882
FT                   /locus_tag="Mvan_0498"
FT   CDS_pept        539073..539882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0498"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_1650 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11343"
FT                   /db_xref="GOA:A1T2E3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E3"
FT                   /protein_id="ABM11343.1"
FT                   /translation="MKGFSLRSKVENLPTAADVKALKPLSIIGGLYAMTLDMFVAMFKP
FT                   PFQWREFLLQTWFVARVSMVPALTLSIPLVVLTSFTFNTLLGEFGAADFSGTGAALGAV
FT                   NQIGPFVTVLVVAGAGASAMCADLGSRTIREEVDAMRVLGLDPIHSLVVPRVLATTLVA
FT                   VLLSSVVTVTGLLGAFLFSVYFQHVTPGSFVASMTLITGLGDVLVSLVKATLFGFVAGL
FT                   IACYQGLRVQKGAAGVGNAVSETVVIAFLLLFVVNAIVTAVGFEVTK"
FT   gene            539879..540736
FT                   /locus_tag="Mvan_0499"
FT   CDS_pept        539879..540736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0499"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_1523 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11344"
FT                   /db_xref="GOA:A1T2E4"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E4"
FT                   /protein_id="ABM11344.1"
FT                   /translation="MSAGVVFRQRFPGTARSLSQWRANWRDLGDQARFYGQSISSTVQA
FT                   ATTYRAEVLRQIAAIGLGAGSLAVVGGTVAVVAFLNLSTSAALASQAYNQMSQVGVEAL
FT                   AGFTSAYVNVRLATPASSAFAFAATIGAGTTAQLGAMKINEEIDALAVMGIRPIAYLAS
FT                   TRLLAGVIVVVPLYCVALLMSFFSVRVITTAFYGQGSGVFDHYFDTFLNPQAVFFSFAV
FT                   TVAAALVIMLIHTYYGLNATGGPAGVGEAVGRATRTSLIASQMVILLVTLALYGQTGTF
FT                   NYAG"
FT   gene            540742..542088
FT                   /locus_tag="Mvan_0500"
FT   CDS_pept        540742..542088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0500"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1654 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11345"
FT                   /db_xref="GOA:A1T2E5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E5"
FT                   /protein_id="ABM11345.1"
FT                   /translation="MADGTGARRISPGWWAMLLVTGIVAAVVLSLAMFNRTFTPTVPVT
FT                   LTADRSGLMLEPNSRVKMRGVQIGRVSAVTGGDAPRIQLAIDPDQIRHIPANVEARIQS
FT                   ISLFGAKYVDLVYPPDPSPQRLSAGAVLTSQNTATEVNTVFQNVVQLIKTIDPLKLNAV
FT                   LSALAEGVRGQGDRIGEAITASNQVLLELNPRTDTVREDFRALKGVSDTYSAAAKDIID
FT                   TVAAATTTSATVTTHAQQLDTLLLNVVGLSRSGIDLLGASKDNLVKAVNLLEPTTNLLM
FT                   KYNPMLTCLFVGAKTTLDTGYADMLGGNGKSLIMDAALLLGDDPYRYPDHRPINAAKGG
FT                   EGGKPSCGSLPDVAQNFPVRQLIANTGFGTGLDWRPNPGIGFPGYANYFPVTRAVPEPP
FT                   SIRYPGGPAPGPMPYPGAPPYGAPQYGPDGTPLYPGVPVPPPPSAGPTP"
FT   gene            542146..542982
FT                   /locus_tag="Mvan_0501"
FT   CDS_pept        542146..542982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0501"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1655 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11346"
FT                   /db_xref="GOA:A1T2E6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E6"
FT                   /protein_id="ABM11346.1"
FT                   /translation="MTNKISAVLWRLGIFVVVCALGAFALIAVFAQLRFEREQRYTAVF
FT                   ANVSGLTSGDFVRIAGVEVGKVRTLTVRDDSTVAVEFGADDSVVLTDGSRAVIKYDNLI
FT                   GDRYLAIEEGAGGTTKLRPGDAIPLDRTAPALDLDAVIGGFRPLLNALDPTQVNTLTSQ
FT                   LIAAFQGQGATIGSILAQTAALTNTLADRDELIGQTIVNLNVVLGSLAGHSDQFGKAID
FT                   SLSQLVHGLQARKQDISNGVAYANEAARSIADLLAQARPPLQKAVHETDRTAIAYL"
FT   sig_peptide     542146..542241
FT                   /locus_tag="Mvan_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.883 at
FT                   residue 32"
FT   gene            543322..543798
FT                   /locus_tag="Mvan_0502"
FT   CDS_pept        543322..543798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_4886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11347"
FT                   /db_xref="GOA:A1T2E7"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E7"
FT                   /protein_id="ABM11347.1"
FT                   /translation="MTETPESRTEPTAVATEQGRGELSPGSDRPNRLTQSAAWVGIVAG
FT                   VVFIVAVIFFSGFFVGKQYGGGYRDGRGMSYPGGMMGPGGMMGPGGMMGPGGMMGPGGP
FT                   GGMMGPGGPGGMMGPGSWGPGGMMGPGSWGPGMMGPGQQPSPTTTPAVPTTPQR"
FT   gene            complement(543872..544240)
FT                   /locus_tag="Mvan_0503"
FT   CDS_pept        complement(543872..544240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11348"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E8"
FT                   /protein_id="ABM11348.1"
FT                   /translation="MRAAGAVGHRPRCWRTPAIKGRPALVRPANPIVVDGNPDPEACLC
FT                   RLDIADAVELTELLQFVNDWLASDTGRLDASLTHYVGHPGCTADELRADLDRFIFLLWQ
FT                   RRRTTLRTRIARSTPPMP"
FT   gene            complement(544279..544686)
FT                   /locus_tag="Mvan_0504"
FT   CDS_pept        complement(544279..544686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0504"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   mmc:Mmcs_4018 protein of unknown function DUF302"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11349"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR016796"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2E9"
FT                   /protein_id="ABM11349.1"
FT                   /translation="MTKLALSTTLHTSFDDAVTRTRKALADHGFGVLTEIDVKATMKAK
FT                   LDVDMADYLILGACNPPLAHQAVLSDPEIGLLLPCNVVVRADTTHGNDTVIVDAINPAL
FT                   MADLSDAPGVAQVAEQVTTKLQAVIDALDHT"
FT   gene            complement(544704..546686)
FT                   /locus_tag="Mvan_0505"
FT   CDS_pept        complement(544704..546686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0505"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: mbo:Mb2015c
FT                   probable metal cation transporter P-type ATPase G CtpG"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11350"
FT                   /db_xref="GOA:A1T2F0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F0"
FT                   /protein_id="ABM11350.1"
FT                   /translation="MSDTCCGHDDPGAERDERERGPEKLWQVSEIRAAALAGVLLLAGL
FT                   IVGWAGGPGPVTLVAEAAALVIAGVTFVPSTLKRLVAGKIGVGTLMTIAAVGAVSLGEV
FT                   GEAAMLAFLFAISEGLEEYSITRTRRGLRALLSLVPAVATVRRGGREYRVAPTELAVGE
FT                   VMVVKPGERIATDGVITAGRSALDTSAITGESVPIEAGPGDAVFAGSINGTGVLDVQIT
FT                   ATATDNSLARIVAIVEAEQARKGSSQRLADRVASPLVPAVMVAAAIIAVAGSVVGDPRV
FT                   WIERALVVLVAASPCALAIAVPVTVVAAIGAASKMGVLIKGGAALEALGRIRGIALDKT
FT                   GTLTRNQPTVITVVPADGVSGGEVMAVAAALEARSEHPLAAAILAATDQLTPARDVESV
FT                   PGAGLSGWLDGSLVRLGRPGWIQPGPLAEVIDRMQRAGATAVLVERDGAVLGAVAVRDE
FT                   LRPEAPEVIGGLRAHGYQVAMLTGDNERTARALAADAGIDDVHADLRPEDKARIIEELR
FT                   SRRPTAMVGDGVNDAPALATADLGIAMGAMGTDVAIETADVALMGQDLRHLPQVLSHAR
FT                   RSRRIMLQNIGLSLAIITILLPLALLGVLGLAAVVLVHELAEIVVIANGVRAGRTQPLA
FT                   GIPQPHGRRVSTRRATAQIGNAAHR"
FT   gene            complement(546679..547116)
FT                   /locus_tag="Mvan_0506"
FT   CDS_pept        complement(546679..547116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0506"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein, ArsR; KEGG: nfa:pnf1320
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11351"
FT                   /db_xref="GOA:A1T2F1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F1"
FT                   /protein_id="ABM11351.1"
FT                   /translation="MVLNDRCLSVLPAKTQYYRPMTMDSAGCLAGPASGVDAAVALFRG
FT                   LSDGTRLAIVGRLAHREARVADLVAELGLAQSTVSAHVGCLRECGLVAGRPQGRQVFYS
FT                   LTRPELLDLLAAAETLLAATGNAVALCPNYGTGSASGSACE"
FT   gene            547211..547474
FT                   /locus_tag="Mvan_0507"
FT   CDS_pept        547211..547474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:pnf1300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11352"
FT                   /db_xref="GOA:A1T2F2"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F2"
FT                   /protein_id="ABM11352.1"
FT                   /translation="MYDGWGWGGMGSGGWILMTVLMVLFWAAVITAVVLAIRYLTGPRH
FT                   TGAHPPGPGPARAEGLLAERFARGEIDEDEYQRRMTLLREHR"
FT   gene            547480..548259
FT                   /locus_tag="Mvan_0508"
FT   CDS_pept        547480..548259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr6585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11353"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F3"
FT                   /protein_id="ABM11353.1"
FT                   /translation="MRSHRLWLILAIAIASVILGVTTTAIWHPGGPFGRQTPVANAPYP
FT                   NAPGAWGPGSMGPGMMGPWRYPAAPPPSCSAPALPGAVVDVTLADMGAMMGPGGMMGPG
FT                   MMSRGGMMGPGMMGPGWNGPNGPGQTGYRWPGMGMMRIVVTPASVPAGPVSFRVLNTGG
FT                   LSHELVVLPLAQGQYPGWRVTGPDGKVDEAGSLGEASRTCGADKGDEQSPQYGIGPGGT
FT                   GWTTITLTPGRYELICNIAGHYWAGMYAELDVTSPPK"
FT   sig_peptide     547480..547608
FT                   /locus_tag="Mvan_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.424 at
FT                   residue 43"
FT   gene            548272..548679
FT                   /locus_tag="Mvan_0509"
FT   CDS_pept        548272..548679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO3621 serine-threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11354"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F4"
FT                   /protein_id="ABM11354.1"
FT                   /translation="MFTRRATITTATILALAGSVAIGLSGGETTTLAQPPGGVSSTSGP
FT                   ALPVQGPWDQCWGPNGWDPNCWGPGPWGPGGYGPGMTGPGGYGGPGMMGPGGYGPGTMD
FT                   PGQWGPGMMGPGQWGPGQYGPGMMGPGPWDY"
FT   sig_peptide     548272..548373
FT                   /locus_tag="Mvan_0509"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.729 at
FT                   residue 34"
FT   gene            549102..549824
FT                   /locus_tag="Mvan_0510"
FT   CDS_pept        549102..549824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11355"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F5"
FT                   /protein_id="ABM11355.1"
FT                   /translation="MDLQELVERLMKQHRSAFARLLGEIEAAYDEVVALHARRFPDPRQ
FT                   IPGGMLCGDVRATVLAMNGMDALTRTGESTREVPTSASCGPDSTLRMTSGSNTSVRLGD
FT                   SNMAMARVRKLAPDVVDGLALFLPQATPAAKPGVQLFLDDGAAEPVMGPPGLEQEYELI
FT                   VYWWPTPDKASVAGAILAAVADLNTNDERILVFTALPPAIRPKTAAEEQQAVTDYQPDG
FT                   DFNEIFGKKSTDTGDPGA"
FT   gene            549874..551118
FT                   /locus_tag="Mvan_0511"
FT   CDS_pept        549874..551118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0511"
FT                   /product="protein of unknown function DUF955"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   bbr:BB2493 putative phage-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11356"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F6"
FT                   /protein_id="ABM11356.1"
FT                   /translation="MTVEVFGARVRQARVLRQMTATAVMEHMGWRSPRQTRLEQAETAT
FT                   LDALEFEALVALLRFPARFFTTAPVSRVAARDLLFRAPKATTVTEKEYLAVFANVVGDL
FT                   VDQLNGVEKGPVVALEPLPVGTDVVTAAAKARAWLGREACEPIRYLTYDLEAAGVPVVL
FT                   RTKHSRSTGRIDWDTQDEEPAGGLTEKHLGCSARTGEFRQRPLVLMRSIDSWERSRWTV
FT                   AHEIGHLVLHRHGEVSDDQENEASRFASEFLAPAAAIAAEITDAPTLNHLMPVKLKWGI
FT                   SLGALIMHLRESKLIDEHRAAMLQRQLYTRINSETGRTWGKTEPGWDARLPEQPRLLIK
FT                   WVEACYGATSVEMLAALDLIFPADLLADILAGQRGASAPRPARVDVALAPVGGTDRGDT
FT                   VVVAASERFRSRRQA"
FT   gene            551141..552340
FT                   /locus_tag="Mvan_0512"
FT   CDS_pept        551141..552340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0512"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   mmc:Mmcs_5577 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11357"
FT                   /db_xref="GOA:A1T2F7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F7"
FT                   /protein_id="ABM11357.1"
FT                   /translation="MARTQRIALAEDTDTFTVVGPDFLPIDPAEEFLQFLRDDEASPNT
FT                   VKAYAAGLAAWWTVLEHTGTDWREISTSLFGQFLAYLRTGDLPGTARIGAPEGWLGAAS
FT                   TALRAAAVLACYRYHADAHGLVGPYQRLHTSRGKRGRSRYIPMLAGVGAARPAKDRPIY
FT                   TVRRGNRAATPVLLPAQVGLILDGCATQTGHEWSGPASGLRDRLLFAVLAETGMRLGEA
FT                   LSLRHHDFHIGAGGTPWIDIAARQDHPRGARGKTLSPRRVYIGDDLEALYSSYVWHLID
FT                   HGADLAVPDLTTHFVFVNLTAGTPFAPTRPETVYAKVDSVTSRAAGALPQGWSPHWLRH
FT                   THATALLLSGAAPHVVMRRLGHADIQTTLSTYGWVTEDAEMRTLAQWRNYVAGWKGLTP
FT                   "
FT   gene            552349..554574
FT                   /locus_tag="Mvan_0513"
FT   CDS_pept        552349..554574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0513"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   ser:SERP2507 transposase B"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11358"
FT                   /db_xref="GOA:A1T2F8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F8"
FT                   /protein_id="ABM11358.1"
FT                   /translation="MDPPPPRGAASSPVAVSSWQSQWARVPGQWRKPVYPIDTAPFQEV
FT                   FLRNQFYLRGNRAGAAHDFTPAAPPRFAEEIAWWVWWCWDQQLRKIEPSLLAWLVRTLP
FT                   AAISEHTTRTGAAPTSIAELDPTELIRQAALSFQRRNNRLPSPGSRRNISHLIEHLHLN
FT                   VSVSCTDTPWWAHDIWDLRADPRIPQRPHEPCHDQTVRLRGITPDWLREGLRFWLRSAL
FT                   TYDLLTWSSVVDRARNLGSQLGHFATTAGHLQDPLISTDPDQLRTVFLDYLDYLRSPQA
FT                   ATHSERLTSDTVASLQAQTQSFYTFMHDHAAEAATATATARWRDITLTHTALWSPINAP
FT                   KHRRRARELTWHSTADLQRMLAYLDVLAAEPKQKVVLTGPDGDLSVLAGLGDPQAARIW
FT                   LLQALTGRRASEILMLDYDPLEAIPGQDRPVGTEPDNGAFVARLRYQQTKVDGIVPTIL
FT                   VEQAIVDIIGEQQRWLTTKYPQLQSKYLFLGLKNQHRGQRPRSYTTYRAMLDKLDKCHT
FT                   LTDSAGRALRFTQTHRLRHTRATELLNDGVPFHVVQRYLGHKSPEMTARYAATLAATAE
FT                   AEFLKHKKIGAHGADIDITPHDIYEMTQLAARTDRVLPNGVCLLPPLKQCDKGNACLGC
FT                   GHFATDTTHLDELRAQLAATEALIATRRDQYRQRAGRELGDDNIWIIERHREIDSLHAI
FT                   IDRLAATADNSVAGPGTGKRLPLLQIQTRGAHQSALDKASRPRTGEQ"
FT   gene            554564..555307
FT                   /pseudo
FT                   /locus_tag="Mvan_0514"
FT   gene            555304..556632
FT                   /locus_tag="Mvan_0515"
FT   CDS_pept        555304..556632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0515"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1656 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11359"
FT                   /db_xref="GOA:A1T2F9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2F9"
FT                   /protein_id="ABM11359.1"
FT                   /translation="MKTFSERNVIVIGAIGVLLTAAIVAGALNYNKLPFVSSGKSYSAY
FT                   FDEAGGLTTGAPVRVSGAPAGQVQSITLDGQWVLVTFTVADGIRLGDRTEASIKTTSVL
FT                   GNKVLDLTTRGAGTLAGTIPVERTTSPYQLPDAIGDLTTTISGLDTGQLSASLAVLSQT
FT                   LQDTPDDLRFAVAGIARFSETLNQRDAQLRDLLAHAAKATTVLGERSNDIVRLISDTNA
FT                   VLAQLRTQSAALDEISTSISAVSRQLAGFIAENKTTLKPALEKLNGVLAILDNRKAQIQ
FT                   ESIKGLAAYAMQFGETIAAGPFFNAYLANLVPGQFIQPFVDAAFSDLGLDPNVLLPSER
FT                   TDPQVGQPGTPALPIPYPRTGQGGDPKLTLPDAITGNPGDPRYPYRESVPAPPPGGPPP
FT                   GPPAPPPPDQQAPQPPTPSPVVVPAPDEVAPGPTDSSIPQGRR"
FT   sig_peptide     555304..555387
FT                   /locus_tag="Mvan_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.609 at
FT                   residue 28"
FT   gene            556629..557975
FT                   /locus_tag="Mvan_0516"
FT   CDS_pept        556629..557975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0516"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1657 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11360"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G0"
FT                   /protein_id="ABM11360.1"
FT                   /translation="MTNSRTKLGLAIILVSLVVGGAIAVTRAAHELDRVHVVAYFDNSN
FT                   GVFVGDDVRIKGVRVGRIEAIEPQPTQVRITFWFDAKYPVPADAKAVILSPTLVTSRAI
FT                   QLTPGYTGGPTLQNNATIPRARTAVPVEFDEFRQQLERLTALLQPTEPGEVSTLGSLVN
FT                   TAADNLRGQGPAIRDAIIRLSQSVSALADHSPDIFTSVRNLSTLVSALQDSTVLIRQLN
FT                   QNLASVTGLLANEPTEVGDAVKNLNDVVGEVTAFVAANRDTIGATSDKLTSVSQALTDS
FT                   TDDIEQLLHIAPTTLSNAANLYQSAQGTLTGALNVANFSDPITFLCGAVQAASRLNNEQ
FT                   SAKLCVQYLAPIIKNRQYNFPPIGVNPFVGATVRPNEVTYSEDWMRPDYVPPQPTLPAA
FT                   TGADPDAPPPLTGPTLPAEAPVPMPDPSNRQTDPAAGLPGMMIPHGGGS"
FT   sig_peptide     556629..556715
FT                   /locus_tag="Mvan_0516"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.523 at
FT                   residue 29"
FT   gene            557972..559111
FT                   /locus_tag="Mvan_0517"
FT   CDS_pept        557972..559111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0517"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1658 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11361"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G1"
FT                   /protein_id="ABM11361.1"
FT                   /translation="MTGKRFARAAAVIMIALTVAGLSGCGFRGLNSFRLPGTQGQGQGS
FT                   YTIQAEMPDVETLQPNSRVRVGDVNVGTVTKIERRGWHALLTLALNGDVDLPANSTVSL
FT                   GQTSLLGSLHIELAPPTDVRPAGKLRAGSLIPLTSAGAYPSTEQTLASVSLLLNGGGVG
FT                   QVQDITTALTSALGGREADFRSLLTQLDTFTANVNGQIGDIIAATDSLNNLVAQFAAQK
FT                   PIIDKALETIPDALAVINAERDQLVEAVDQLGKFSALAADTVNQSQESLIQILNDMGPV
FT                   LESLANAGPALTRSLNLFTTIPFVKDNLTKWWRGDYANITTIVDLTLSRIDAGLFTGTR
FT                   FEGHLTELELQWGRTIGQLPSPYTARNPLIVPYRLDQGP"
FT   sig_peptide     557972..558100
FT                   /locus_tag="Mvan_0517"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.396 at
FT                   residue 43"
FT   gene            559111..560565
FT                   /locus_tag="Mvan_0518"
FT   CDS_pept        559111..560565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0518"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_1659 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11362"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G2"
FT                   /protein_id="ABM11362.1"
FT                   /translation="MYLSKRVRLQLAIFAMVTVVAGGSMAFAYLRLPSLLFGVGRYQVT
FT                   MKLQDAASLYRDANVTYRGTTVGRVSDVRLSDAGVDAMLSLQSDTKIPADLDAHVGSQT
FT                   AVGELFVDLVPRSGDGAPLKNGDVIPADRTSVPPDINALLRAVNTGVQAIPRDNLTTVI
FT                   DESYIAFGGLGPDLARLTRGATTLAIDTRNNLPALTTLIDDAKPILDTQTETSDSIQTW
FT                   ASNLAQVTNQLQLQDESVQGLLVNGPPAADQVRQLFERVQPTLPILLANLVSLGQVALT
FT                   YQPNLEQILALYPIEIAGLQGAALANRNTKQDYKGLFLSFNLNLNVPPPCRTGYLPAQQ
FT                   QRAPSEVDYPPKPPGDLYCRIPQESGLTNVRGARNLPCVTRPGKRAPTVKMCESDENYV
FT                   PLNEGTNWKGDPNATLSGQPVPQPPPDPPPPVPVTAPIAVAEYDPSTGSYIGPDGKQYR
FT                   QADLGQNAAGQHTWQDMLLPPKDGDP"
FT   sig_peptide     559111..559197
FT                   /locus_tag="Mvan_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.961 at
FT                   residue 29"
FT   gene            560562..561227
FT                   /locus_tag="Mvan_0519"
FT   CDS_pept        560562..561227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11363"
FT                   /db_xref="GOA:A1T2G3"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G3"
FT                   /protein_id="ABM11363.1"
FT                   /translation="MTIHTADDPAGDDPTPCSPALDDTLDVGTDKGAGGAGADSEDPEV
FT                   VDGKHQRDTSRAWRNRMPPQRLALVMGSVAAVTMGALTSWLGFQTHQAHQASEQRQQFV
FT                   QVGRQGALNLTTIDWQHADVDVKRILDSATGTFYDEFSQRSQPFIDVVNKVKSKSVGTI
FT                   TEAGLESHSRDTAQVLVAVSVKTTVGDGPEQEPRAWRMRVTVQKVGNDAKVADVEFVV"
FT   gene            561224..561883
FT                   /locus_tag="Mvan_0520"
FT   CDS_pept        561224..561883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11364"
FT                   /db_xref="GOA:A1T2G4"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G4"
FT                   /protein_id="ABM11364.1"
FT                   /translation="MRNSPAKVEPDDGDAAHSAGADAQPPSPEKTSKSASGCEAAVAPE
FT                   CLDRDDVASIADRRGTFVRMLGFWLLPSIALLLALGAAYFKYQEGTASDEDRARVETVQ
FT                   VATEATVAMLSYTPETAAEKLKAARDRLTGPFRGSYTSLTEDVVIPGAQQQRISATARV
FT                   SAAASVSVSKNRAIVMVFVDQTTTVGKDAPTETDSVVQVSLDKVGSHWLISGFEPK"
FT   gene            561951..563093
FT                   /locus_tag="Mvan_0521"
FT   CDS_pept        561951..563093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0521"
FT                   /product="Epoxide hydrolase domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Epoxide hydrolase
FT                   domain protein; KEGG: mmc:Mmcs_1662 epoxide hydrolase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11365"
FT                   /db_xref="GOA:A1T2G5"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR010497"
FT                   /db_xref="InterPro:IPR016292"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G5"
FT                   /protein_id="ABM11365.1"
FT                   /translation="MSAVRAVRPFSIHVADDVLDDLRTRLSRTRWPEAECVPDWTQGIP
FT                   LGYTRELAAYWADGYDWRSREAALNRFDQFVVEIHGVDIHFIHQRSPHQEAFPLVITHG
FT                   WPGSIVEFHNVIEPLTNPTAHGGRAEDAFHVVCPALPGYGFSGKPTNAGWGVGKIAQAW
FT                   ETLMLRLGYQRYGAQGGDWGAAITTQMGRNRGHCAAIHLNMPIAYPPAGGITDPTEEEQ
FT                   LALAALTTYQRWETGYSEQQSTRPQTVGYGLADSPVGQMAWIVEKFAAWMDCDGHPENV
FT                   LSRDELLDNVMMYWATNSGSSSARLYWESFKTLDATTRVELPTGIAAFPKEVLRAPRSW
FT                   CEPIYNITHWTTMPRGGHFAALEQPRLFVDDIRAFFESVR"
FT   gene            563256..564689
FT                   /locus_tag="Mvan_0522"
FT   CDS_pept        563256..564689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0522"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_1663
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11366"
FT                   /db_xref="GOA:A1T2G6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G6"
FT                   /protein_id="ABM11366.1"
FT                   /translation="MRTWTLPLGDATLQGQSVYDVEDPCTGDVLTQVPDCSSEDVDRVV
FT                   ATAHAAQRDWALRTPRQRGTALRALATLMRDHSEELALLDAIDGGFPLPAMRDDVTWAA
FT                   DVLELMADDALDLGGRTIPLSANLHYTLQQPYGVVARIVPFNHPVLFAGSKIAAPLMAG
FT                   NAVVLKAPDQTPLSAIRLAELAREVLPEGLFGVVTGHGATAGAALVAHPLVRRIGFIGS
FT                   PGTGRHIQRLAAEHGVKYVTLELGGKNPMIVMPDADLEAAAKSAVVGMNFTTTAGQSCG
FT                   STSRLLLHEAIADEVIDLVVDQVAAIKVGDPLVDGTDMGPVIDQAQYSKSLRAIESGRA
FT                   GGASVLTGGGRAQGVGSKGWYVAPTVLAGVAPQADVARDEIFGPVLSVLTVRDEAEAVE
FT                   VANSVEFGLTAAVWTNDVSQAHRMAAGLDAGYVWINGSSRHYWGLPFGGWKSSGVGSEE
FT                   STEELLSYTQVKAVTVTLD"
FT   gene            565005..566465
FT                   /locus_tag="Mvan_0523"
FT   CDS_pept        565005..566465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0523"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_1664 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11367"
FT                   /db_xref="GOA:A1T2G7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G7"
FT                   /protein_id="ABM11367.1"
FT                   /translation="MNETVVERLSRRHKAFVLASCCLSVLIVSIDVTIANVAIPSIRAD
FT                   LSASPSQMQWVIDIYTLMVASLLLLSGAMADRFGRRRTLQIGLTIFASASLLCSVAPNV
FT                   ETLIGARFLQAIGGSMLTPAGLSIVTQVFTGRVERARVIGIWGGVVGISMALGPIMGGI
FT                   LLEYVDWRAVFWINVPICALAVLLTAIFVPESKSVTMRHVDLIGLVLGMAFLFGLVFVL
FT                   IEGPGMGWTDTRVVVSCCLAALAFATFLRYESRRLDPFVELRFFRSIPFASATAIAVCA
FT                   FAAWGAFLFMMSIYLQGERGLSAVNTGLMFLPVAVGAFIFSPLSGRLVGRFGARPSLMI
FT                   AGALIVAATLMFAQMSDATPQWQMLVAFAVFGVGTSMVNAPVTTAAVSGMPTDRAGAAA
FT                   AITSTSRQVGVAIGVAICGPVAGAALGDTNVDFAVSAQPLWLVFAGVGVLIFTLGVYST
FT                   SKRALRSAEHLAPLIAGTDPRREAADVA"
FT   sig_peptide     565005..565112
FT                   /locus_tag="Mvan_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.600 at
FT                   residue 36"
FT   gene            566455..566934
FT                   /locus_tag="Mvan_0524"
FT   CDS_pept        566455..566934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0524"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_1665
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11368"
FT                   /db_xref="GOA:Q2FBP4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q2FBP4"
FT                   /protein_id="ABM11368.1"
FT                   /translation="MSRNPEADEVWRAMTALVTDNRDSWRRATVDQTGLPFSRIRILLR
FT                   LSRGSMTVKEVAHAVTIDPPAATVAVNDLEDRGLVMRQTIPTNRRYKVVSLTDAGWSMV
FT                   ATINAVDDPAPEALAALDGNELRALRDAIARVSAARQTLNESRGRIAQRTTLSPA"
FT   gene            567169..568560
FT                   /locus_tag="Mvan_0525"
FT   CDS_pept        567169..568560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0525"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1666 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11369"
FT                   /db_xref="GOA:A1T2G9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2G9"
FT                   /protein_id="ABM11369.1"
FT                   /translation="MSAHVLGAQIDRKVRPVDSMAPDATTMRTLENARGSILKGRLPAS
FT                   LIANAALYALELKRVFGRTWQFLCHEDEIPNAGDYVVRYIADNSIIVARQQDMTIRAMS
FT                   NSCRHRGTLLCRTESGNESAFQCPYHGWTYRNNGDLIAIPAQQAVYGAAFDKSRLGLRA
FT                   LPMLDSYAGLVFGCVSDEAPGLDEYLGDMRWYLDLMMKKSPAGLEAWGAPQRWVIDANW
FT                   KTGADNFVGDGYHTVMTHRSMCELGLLPPDNVAVSPAHVSLSGGHGAGVLGAPPGIPAP
FT                   PYMGYPEEVVSGLSEGYGDDVHGELLKRTMFIHGNVFPNLSFLNAFIAKDGESMPVPIL
FT                   TLRQWRPLDAARMEVWSWFFVERNAPEEFKQQSFETYVRTFGVGGVFEQDDAEIFQAIT
FT                   KGTRGELAGGVELNLEMGLDNLAPDPTWLGPGRPLASGYAEQNQREYWKQYFDYLATPR
FT                   RDENV"
FT   gene            568557..569099
FT                   /locus_tag="Mvan_0526"
FT   CDS_pept        568557..569099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0526"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1667 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11370"
FT                   /db_xref="GOA:Q2FBP2"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:Q2FBP2"
FT                   /protein_id="ABM11370.1"
FT                   /translation="MTTTVPQDPPQAARVSRDVREEIEDFLFDEADLLDRDEFEEWLEL
FT                   LAPNVHYFARVRQTLRRAGGPGFSERSMHLSDNYTSLKMRIQRHRTSSDWAEDPPSRIR
FT                   HYITNVRVRSGEDGDEYRVTSNALLVRTRGDEAKAETVSAERRDIIRRDETGLKLVQRE
FT                   ILLDHTTLPTHNLSFWI"
FT   gene            569206..570237
FT                   /locus_tag="Mvan_0527"
FT   CDS_pept        569206..570237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0527"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_1668 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11371"
FT                   /db_xref="GOA:A1T2H1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H1"
FT                   /protein_id="ABM11371.1"
FT                   /translation="MRAAIYHGREDVRIEELPDPSPRAGEVVIEVARAGICGTDLHEYI
FT                   AGPMHAAPGVVIGHEYSGTVVGVGSGVREFTEGDRVCGVGVFGCGECGFCKQGAEALCG
FT                   AVGFIGFAVNGALARYASLPTKALFRIPDEISLAEAAVVEPIASAYHAVRRSGLAAGGT
FT                   VFIAGAGPIGLALVQFSLAQGATQVIVSEVSATRRVAAHRVGATRVIDPLAEDAVEVVR
FT                   MLTNGNGVDISFDAAGVQPALDAALGVLRPRGRLMVVAIWEAPAGIDINRSVMREANIG
FT                   FSFCYEAQRQVPAILDLLATGAINLGELITDEIPLDAVVSQGLEELRVNRDAHVKILID
FT                   PSA"
FT   gene            570290..571543
FT                   /locus_tag="Mvan_0528"
FT   CDS_pept        570290..571543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0528"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: mmc:Mmcs_1669 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11372"
FT                   /db_xref="GOA:A1T2H2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H2"
FT                   /protein_id="ABM11372.1"
FT                   /translation="MSANMESLFDGLTILELGHVIAAPFAASLIGDFGAQVIKIEDPGS
FT                   GDMLRRSGPRKDGVPLWWKSAARNKSSVAVDLRLAEGQALVRKMVERADVVIENFRPGT
FT                   LERWGLGWEELHAANPRLIMLRISGYGQIGPESAKPGYGRVGEAMSGAVHITGHPDRPP
FT                   THFGFSLGDVTTGIMGAFAVAGALFKREAIGDRFDGECIDLALYESLFRGIDWQVILYD
FT                   QLNFVAERQGNQFQVSPSPVSDTYLSGDGVWYTVATGTVRSVQSLLELLGGTTLRNDPK
FT                   YATQELQMLHREELGEMVRQWFAENNSDIVEKACASSGVVAARIFTPAEMFSSPTFAAR
FT                   QSLVEVADQELGPVRVTGVVPRLTNFPGSVRSTGPGLGIHGQEVLTEWLGMADSEYEAL
FT                   VSSGVVGAVDVDGEVPGH"
FT   gene            571540..572706
FT                   /locus_tag="Mvan_0529"
FT   CDS_pept        571540..572706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0529"
FT                   /product="putative nonspecific lipid-transfer protein"
FT                   /note="KEGG: mmc:Mmcs_5454 putative nonspecific
FT                   lipid-transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11373"
FT                   /db_xref="GOA:A1T2H3"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H3"
FT                   /protein_id="ABM11373.1"
FT                   /translation="MSSLRDKACIVGVGHTAYRRDGTESATDLGLQLEAAHAAIVDAGL
FT                   SAGEIDGLICPINGGTAEDFIANLGLTHVRYAVTSHTGGAASVAALATAAMAVWSGVAR
FT                   HVLIPAGWCGYSGPRARGMASSADMAIGKVVRDYYAPQGAVSAVHQYALVADRYVRKYD
FT                   VPPEAMGAVAVAFRANAQLNSNAVMCGRELTMQDYLDAPPISTPFRLFDCSLETDGAAA
FT                   VVVSAADRAADSPHRPVFVMSVAEGRPFPVDEFANRADPLEIGLAEAAPRAFADAGVTP
FT                   SDIDLLEVYDSFTVNVLRQIESAGFCKPGEAADFVLDGCIAADGSLPTNLNGGLLSEAH
FT                   VQGMNNLVEAVRQLRGGLPQRQVHNAELAVVTGMGGGWGSGALAILRR"
FT   gene            572743..573201
FT                   /locus_tag="Mvan_0530"
FT   CDS_pept        572743..573201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0530"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mmc:Mmcs_1671 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11374"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H4"
FT                   /protein_id="ABM11374.1"
FT                   /translation="MRRTGPDVAAPPLPSLEGLTAQFYEHCRREELSFQRCSRCDRWRH
FT                   VPRLTCAGCGSNSWSWQRSSGRGVVFSHTVIHRALHPGFDEAVPFVCAVVEMDEGVRMV
FT                   ARIVDLVADGTAMLVDAAVEVVYVHAADDVVLPAFRLPAAEVRGNGRR"
FT   gene            573188..574234
FT                   /locus_tag="Mvan_0531"
FT   CDS_pept        573188..574234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1672 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11375"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H5"
FT                   /protein_id="ABM11375.1"
FT                   /translation="MAAADELRDRVGEKIHFRGADSVTQNDIRRKLEVFTFSCPLHDDE
FT                   AAAKAHGYLGVVAPVTMTPLWGLPPYWAPGQPSPYLVDGQEMTGNITDTLALPFSRSVN
FT                   VSSEWQYHTPLYLGDRLQGTTTIISVEQKRTRVGTGIFLQYESEYVKVSGELVARNRNT
FT                   VFNYDPDDASRPEPGTSARAQQGDRGPRTRSVDDADTSVDWNTPLQFDDVTVGAQVRGP
FT                   ALALTYQRMVMNIAADRMFSGIHHSAAAAHAAGLADIIFNTRGLETLFETGLRRWMGLR
FT                   GRLVQLGPFKMSASVHPGDVVQARWTVTGKHAQAGADVVDLEFGVFAGDRQAAQGVAAI
FT                   HLNGKKQC"
FT   gene            574265..574462
FT                   /locus_tag="Mvan_0532"
FT   CDS_pept        574265..574462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_5451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11376"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H6"
FT                   /protein_id="ABM11376.1"
FT                   /translation="MSVIKADVEVCQGYANCVVAAADVFDIGDAGTVVILDDTVAESDE
FT                   ARIVTAIRSCPVSALRLATV"
FT   gene            574710..576125
FT                   /locus_tag="Mvan_0533"
FT   CDS_pept        574710..576125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0533"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1673 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11377"
FT                   /db_xref="GOA:A1T2H7"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H7"
FT                   /protein_id="ABM11377.1"
FT                   /translation="MTLKMSTSGGSDTTARSLVDVDRGEISREIFTDASIFNRELEYLF
FT                   PRSWLFVGHASQVSAPGQFFSSRMGSDPVLLTRDAQGGVNVLLNSCRHRGMAVCRYDEG
FT                   RALQFTCPYHGWSYSMDGSLVSTPGDLHGVPQQGMAYGNGLDKAAWGLVRAAKVHNFKG
FT                   LIFACWDPAAPDFDEYVGDFHYWLDNLADAFDGTEGATEVFRGVQKWRIKSNWKFVSEN
FT                   FLGDTYHGATTHASVEQVGIGPGGRNSRRHGERQDQGGFSKGRVKTSFRTGHGASDNLA
FT                   YEIAYPEFAEEPALSEYFSQAWALRKERLEAQGRQLGGRGPATMFPNMSFSAGFPRTIL
FT                   VSHPISPTETEVWRWYLIDKNAPDDVRDWLRRYYMRYSGPGGMTEQDDMENWNYATQAS
FT                   QGVIARRYPYNYQQGLDMETPSALDQAVHSHHPIAGEVNARAFYRRWAEFTDNLSWPQL
FT                   IELAKSDERAARS"
FT   gene            576122..576676
FT                   /locus_tag="Mvan_0534"
FT   CDS_pept        576122..576676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0534"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1674 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11378"
FT                   /db_xref="GOA:A1T2H8"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H8"
FT                   /protein_id="ABM11378.1"
FT                   /translation="MSATGGEISTRQDAVEKLLLQAEIADFLYREADLLDERRYSEWLG
FT                   LLTDDYEYSVPLRANVAYDDLAQLEQTQEGHDICWFDEKKETVALRVEQLMTGLHWAEE
FT                   PVSRVSHLVTNVRIEGVDGAEVDVSCRFLVYRNRVADETDLLVGRRKDRLRRVAGDWQL
FT                   CRRRLLLDQTVLLAKNLSIIL"
FT   gene            576776..577219
FT                   /locus_tag="Mvan_0535"
FT   CDS_pept        576776..577219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0535"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mmc:Mmcs_1675 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11379"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2H9"
FT                   /protein_id="ABM11379.1"
FT                   /translation="MSTSLQPKRRADDVTALRVMTEEMRPLLVGDGYQMFDVRAPKSSG
FT                   PPPHQHPWDESYVVLEGELWVSRGGEEATLQVGEAIRVPAGVVHAYRVLSDGARWITTS
FT                   SCPGGALDFFSDVDETSNGPGDVKALIEAAKRNSVRFADPALG"
FT   gene            577309..578202
FT                   /locus_tag="Mvan_0536"
FT   CDS_pept        577309..578202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0536"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: mmc:Mmcs_1676 6-phosphogluconate dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11380"
FT                   /db_xref="GOA:A1T2I0"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I0"
FT                   /protein_id="ABM11380.1"
FT                   /translation="MRRVGVIGLGGMGSALAASLLATDHYVVCFDIRPDVLRPIVELGA
FT                   EAAADARELAGACDVVLTFLPGPSQVLEVALGSERGVLAGLADGAALLDMSTCNPEVAA
FT                   IIGQAYDAAGRRFVDCPVSRKAPNMTVLVGGPSGVLGPDADVLAAVSRTLVYCGQRGAG
FT                   YATKLLNQHIKYSWYLASAEALLIAEAMGLNAGDVADAIAECSGGDSGLTTAAAYFRHD
FT                   TESVRNRAPASTITKDSALAERMATNAGIRSRTLEPVVDFFQSVAASEFRDRAYPESTE
FT                   LLQRIRSMPPKSTSTP"
FT   sig_peptide     577309..577380
FT                   /locus_tag="Mvan_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.736) with cleavage site probability 0.276 at
FT                   residue 24"
FT   gene            578353..578871
FT                   /locus_tag="Mvan_0537"
FT   CDS_pept        578353..578871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0537"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_1677
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11381"
FT                   /db_xref="GOA:A1T2I1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I1"
FT                   /protein_id="ABM11381.1"
FT                   /translation="MTTEKLTMAQQVAAKTREAGPDHDPSSLALPLALYRAVTAFGRVA
FT                   VDELTPVDLSMSQFNVLTVLKRADGPITMGALADSISVRQASLTSVVDTLTKAGFVTRK
FT                   VNPRDRRSVVVAISKKGDQFMTEFLPGHYDFLQRLFAGINPRHRQQLLARLNELIDCLE
FT                   NYPSGQRTS"
FT   gene            579323..580222
FT                   /locus_tag="Mvan_0538"
FT   CDS_pept        579323..580222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0538"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_1679
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11382"
FT                   /db_xref="GOA:A1T2I2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I2"
FT                   /protein_id="ABM11382.1"
FT                   /translation="MLKDASICVSLLGTETRFVDVDGVRTRTIQAGEGPDLILMHGGGG
FT                   HAEAFARNVTALSRHFRVHALDLLGHGLTSGCEVAPKRKDYVSHLLGYMDQEGIDRAHL
FT                   AGESLGGWIAAWTALEHPDRVDRLIYVCGARLTLEVGADAEARTAAGRAELARVTRQFL
FT                   ADPSPANVRERMAWLFHHPDRDLTDELVALRWALYQSEESRSALTNATAPPSAATAEDN
FT                   LTAERLTSLTRPTLVLWTSHNPSATVEFGRRAAELIPGAEFALMEDCGHWPQWERPEEF
FT                   NQILTNYLQGDRESRGQR"
FT   gene            580222..581538
FT                   /locus_tag="Mvan_0539"
FT   CDS_pept        580222..581538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0539"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1680 Rieske
FT                   (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11383"
FT                   /db_xref="GOA:A1T2I3"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I3"
FT                   /protein_id="ABM11383.1"
FT                   /translation="METIGSKTGSALPIDSSAFYDEAVYQRELDSIFKRSWLFVGHESM
FT                   IPKPGDFRTTYMADDAVIVCRDKESRVRVLLNKCRHRGNKVCQFDKGNANIFHCSYHGW
FT                   SYDTAGRLRSVPLAESAYGPQFDKASMGLVSPRVATYKGLIFACWDQSAPPLEEYLGEG
FT                   LLWYLDNFLLDCDPNGLQVVPGLHRYLMPVNWKLLAENFGGDQYHFAATHGSVSALSKA
FT                   GQTARINFSIDEGQHYSVVLDGCAPHGLLQLAVGKNFYQDDLAQAETLGTEAVDWLTER
FT                   QRLQDERLATSPVQPYSFHVANIFPNFSMIGMGTAFYGRGFIMWQPRGPRLTEVWEWCL
FT                   VESSAPRAVKERMVFVLSQRQSAAGLVTPDDHENFERLSDALDTGVARDVPFNYSLGED
FT                   VEPMESLVAELPGNVRPQISEAYQREFYRHWHRTMTEPA"
FT   gene            581541..582053
FT                   /locus_tag="Mvan_0540"
FT   CDS_pept        581541..582053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0540"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1681 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11384"
FT                   /db_xref="GOA:A1T2I4"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I4"
FT                   /protein_id="ABM11384.1"
FT                   /translation="METSQLDVELRLRINEFYARETMLLDDGRLDEWLGLLAPDVRYTM
FT                   PFPESSTHPVDDDDGLPPFLLFNDDYESLKLRIARLATGLAPGETPRTITQRLVSDILV
FT                   TDVSDQELSVRSSVMVFLVRHERHESFFIGKRQDVLRRDEDSGLLLAARDITLAHSVLP
FT                   RAISIFF"
FT   gene            582090..583319
FT                   /locus_tag="Mvan_0541"
FT   CDS_pept        582090..583319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0541"
FT                   /product="4,5-dihydroxyphthalate dehydrogenase"
FT                   /EC_number="1.3.1.64"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase,
FT                   C-terminal domain; homoserine dehydrogenase, NAD-binding;
FT                   KEGG: mmc:Mmcs_1682 oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11385"
FT                   /db_xref="GOA:A1T2I5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I5"
FT                   /protein_id="ABM11385.1"
FT                   /translation="MTDVASRELGLGFLGIGQAVARIFQQYPDMSTLPYRVVAAADTRS
FT                   HSLARFATEFSGQTYTNAEQLCADPSVDVVYIATPPELHREHALMAARHGKHMIVEKPL
FT                   AMSIDDCTAMVEAAQAAGVQLMAGHTHSFDAPVRAMAELVASGELGELLMVNTWNFNDF
FT                   NRRPWPTSELRSTSGPVLNQGPHQVDIVRQIVGGVARTVRASTIWDDVRECVGGYTCHL
FT                   GFESGASATLVYDARAFFDVAELHSWVAEDGGRRSPQANQRVANNFAALSQNPDQLEVA
FT                   LEAQKEQGRYGAATTTEESQELWGYSAPGEIIHHPYFGLTVVSCERGAIRQSPDGLVVY
FT                   GQNGLQEIPVARTMRGRAAELAELHRAITEDRPVQHDGRWGRATLEVCFAILQSAYEDR
FT                   EVVLSHQVSL"
FT   gene            583339..584292
FT                   /locus_tag="Mvan_0542"
FT   CDS_pept        583339..584292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0542"
FT                   /product="Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase, class III
FT                   enzyme, subunit B; KEGG: mmc:Mmcs_1683 extradiol
FT                   ring-cleavage dioxygenase, class III enzyme, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11386"
FT                   /db_xref="GOA:A1T2I6"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I6"
FT                   /protein_id="ABM11386.1"
FT                   /translation="MGEIVAGYASSHAFTFIPPPRWEGFRIKNRQSYTVRRGKTPPRLR
FT                   KDEEPFDDAAARYAHIENGLQRLRDSIRQDRLDCLIIVGDDQNENFDGSALPQIAIHTG
FT                   DGFTVSDRFLPEARFWKSSPELSKDLSEHTVEAGFDVATVVDFRETTLHSHAHGEIVAN
FT                   ILGDHQIPVVLVFLNAVHVPSLSPKRCFALGRAIADAVRSRRPADERIGLYASGGLSHF
FT                   TAGFPWAAYDGPRVHGSIDDEFDRRTLKCLATGNGYELSKLTSEDLLNSGNIELRSWIC
FT                   AVGAVGGNTPWASVYEPIPRALMGMAVAWTNCEVTV"
FT   gene            584826..585605
FT                   /locus_tag="Mvan_0543"
FT   CDS_pept        584826..585605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0543"
FT                   /product="3,4-dihydroxyphthalate decarboxylase"
FT                   /EC_number="4.1.1.69"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: mmc:Mmcs_1684 class II aldolase/adducin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11387"
FT                   /db_xref="GOA:A1T2I7"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I7"
FT                   /protein_id="ABM11387.1"
FT                   /translation="MSSTPSGAGLDTERHAIALACRVLAARDLAPGILGHISLRVDRDR
FT                   LLIRCRGPRERGLAFTSAEDIRMVTLDGTAGGKGELDDGYQPPNELPLHTEVLRTRRDV
FT                   NAVVHAHPEAVVAADLAGLAVRPIVGAFDIPGFRLAAAGVPVYRRGVLVRNRQLAQEMV
FT                   AAMADRPVVVLRAHGLTSAADTVERAVLQAISVDTISRLSLQIASAGGTLADLPDADAA
FT                   ELPDLGNAFNETIAWRHELARLETHGLSCHPSEKRSS"
FT   gene            585788..586693
FT                   /locus_tag="Mvan_0544"
FT   CDS_pept        585788..586693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0544"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_1685 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11388"
FT                   /db_xref="GOA:A1T2I8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I8"
FT                   /protein_id="ABM11388.1"
FT                   /translation="MGRCRATRALRITGGTIVLSWLTGQVALVTGGAAGIGLAVVERFL
FT                   AEGACVGVLDRSEGDLATIGNADGRLIAVTGDVTSYADNVTAVRETVDAFGKLDVFVGN
FT                   AGIFDYFAPLVGFDGADLSSAFDEIFAVNVKGYLLGARAAVPELLKSDGPSMIFTVSNS
FT                   GFYASGGGPLYTASKHAVVGVVRELAYELAPKIRVNGVAPGGTVTGLRGIEDLGQGQDV
FT                   LSSVPGIADIMSTTNPLQYAQQPADHAGLYLLLASADNSRAVTGVVINSDGGLGVRGLN
FT                   QPSGGLELATGAMRIDVGST"
FT   sig_peptide     585788..585889
FT                   /locus_tag="Mvan_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.839) with cleavage site probability 0.607 at
FT                   residue 34"
FT   gene            586706..587596
FT                   /locus_tag="Mvan_0545"
FT   CDS_pept        586706..587596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0545"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11389"
FT                   /db_xref="GOA:A1T2I9"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2I9"
FT                   /protein_id="ABM11389.1"
FT                   /translation="MLVKALGYVGVESPDAKEWLAFGPEVLGMEAVEASSGSVLLRIDD
FT                   ADHRLAVHHGERNRMLYAGWDVGSEEALEAAGELLHKRGIGFEVGTEEDCAARGVLGFV
FT                   TLSDPSGLRHELFYGQKVVPGSFRPGRAISGFVTGAQGLGHVVLATPDLAQADRFLRGV
FT                   LGFKKSDEIYTFMDLWFYHCNPRHHSIALTPMPGVRGLHHVMVEVQSFDDVGMAYDLCM
FT                   SRNIPLSMTLGRHVNDRMVSFYVRTPSGFDIEYGWDAVTVDEETWTVAQYDRPSVWGHQ
FT                   MVAQTPPGALEAATT"
FT   gene            587669..589069
FT                   /locus_tag="Mvan_0546"
FT   CDS_pept        587669..589069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0546"
FT                   /product="benzoate 1,2-dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: mmc:Mmcs_1689 ring
FT                   hydroxylating dioxygenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11390"
FT                   /db_xref="GOA:A1T2J0"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J0"
FT                   /protein_id="ABM11390.1"
FT                   /translation="MSIVGKNDIQQLVAAGQEGLAKGRLPAGLVANAELHKLEAQRVFG
FT                   RCWQFLAHETEIPQAGDYVVRYLGGGSIIVVRGEDGEVRAMANSCRHRGTMLCRTEMGN
FT                   TSHFRCPYHGWTYRNTGTLAGVPAQKEVYGVEMDKNEWSLTQVPRLENYRGMIFGCLDE
FT                   KAEPLVDYLGDMAWYLDLITQKSKGGLEVRGEPQRWIIDSNWKLGADNFVGDAYHTLMT
FT                   HRSAVELGLAPPDPKFASEPAHISLSNGHGLGVLGVPPGQPMPPFMNYPPEVVDGLAAA
FT                   YGDQDRADMLQRSAFIHGTVFPNLSFLNVLIGRDKKSMPVPMLTFRLWRPLSHDTMEVW
FT                   SWFLVEKDADEEFKQQSYETYVRTFGISGVFEQDDAETWRSITAGTQGILAGSQTLNFE
FT                   MGMGVLTSDDTWKGPGRPLSSGYAERNQREFWGRLLELLTDSGDDASETEPKPQLLAQS
FT                   RTNTDEVA"
FT   gene            589134..589652
FT                   /locus_tag="Mvan_0547"
FT   CDS_pept        589134..589652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0547"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: mmc:Mmcs_1690 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11391"
FT                   /db_xref="GOA:A1T2J1"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J1"
FT                   /protein_id="ABM11391.1"
FT                   /translation="MVATVEQQLLLRCEMENFLFEEAELLNDGRFHDWLELCAEDIHYV
FT                   IPVRVSRERANGDGNSTTMTHWDDDYAGLELRVLRLDTEYAWAEDPPSRIRHHVSNVRV
FT                   RPGAGTDEYDVRSNLLVFRNRGDSPQHDLISAERHDVIRRSEMGLRLASRRVVLDHAVV
FT                   GTHNLANFF"
FT   gene            589701..589919
FT                   /locus_tag="Mvan_0548"
FT   CDS_pept        589701..589919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11392"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J2"
FT                   /protein_id="ABM11392.1"
FT                   /translation="MTGDHGAATTIANEFAVVTVDKIFTRNGERLEIASPRLGFRIQLD
FT                   PLELESLSWQTKESLSRFLEDPYGPGH"
FT   gene            590085..590294
FT                   /locus_tag="Mvan_0549"
FT   CDS_pept        590085..590294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0549"
FT                   /product="ferredoxin"
FT                   /note="KEGG: bxe:Bxe_C0638 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11393"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J3"
FT                   /protein_id="ABM11393.1"
FT                   /translation="MIHAEVDPRRCCGYQLCVDVAPSVFAINAAGKAEILVRDIPADLE
FT                   VNARAAAHECPSAAITVRASGSAQ"
FT   gene            590939..592171
FT                   /locus_tag="Mvan_0550"
FT   CDS_pept        590939..592171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0550"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mpa:MAP3759c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11394"
FT                   /db_xref="GOA:A1T2J4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J4"
FT                   /protein_id="ABM11394.1"
FT                   /translation="MALDQSALLEVLDALRTADAGERITQACEIVYQALIDAELTAKIG
FT                   AALHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAV
FT                   VMEAYLHGTSTRKVDDLVKALGADSGISKSEVSRICKDLDTEVGAFRDRPLGEQRFPYV
FT                   FLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRG
FT                   LAGVQLVISDAHAGLRAAIDAVLIGSAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIF
FT                   AQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAEDITAFADFPAAHWKKIWSTNPLER
FT                   LNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSETSLALLDTGEQDT
FT                   QTVAPTAALTA"
FT   gene            593000..593599
FT                   /locus_tag="Mvan_0551"
FT   CDS_pept        593000..593599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb2834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11395"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J5"
FT                   /protein_id="ABM11395.1"
FT                   /translation="MVTVEVDPVRVESRLSGGAIACPSCVGGVLGGWGFARSRQVEGLD
FT                   HPVRPRRARCRSCLVTHVLLPVTVLLRRAHGAEQIWMALSTRAEGVGHRRIAAWLQVPP
FT                   ATVRGWLRRAGQRLEPMRAWFLTVAVRTGIDVTIPDGFGCGWRDLVAALRCAVAAIGQR
FT                   FGPAGLLGAVTPAQVMAAASGSRLLAPGWPPLARGV"
FT   gene            593711..594004
FT                   /locus_tag="Mvan_0552"
FT   CDS_pept        593711..594004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0552"
FT                   /product="putative transposase"
FT                   /note="KEGG: mbo:Mb2835 putative transposase [first part]"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J6"
FT                   /protein_id="ABM11396.1"
FT                   /translation="MSLEEHKRRERANAIGLFRYQLICPALEDGLSTRQRGRLVREIAE
FT                   RRHIDPFGTQVQIARATLDRWIRRYRGGGFEALVPEPRRLATRTDTQVLGVC"
FT   gene            594059..595606
FT                   /locus_tag="Mvan_0553"
FT   CDS_pept        594059..595606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0553"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   mpa:MAP3467c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11397"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J7"
FT                   /protein_id="ABM11397.1"
FT                   /translation="MQGHSDDQRELLDAESIAGHLLKSDSMFAFLAAHRHELFPEEMFA
FT                   DLFPSQRGRPSIPAEVMASVITLQALHGLSDNETVDAVTFDLRWKAACGLPVTAGAFHS
FT                   TTLTYWRRRLAASDRPNRIFEAVKAVVTATGVLAKKTRRALDSTVLDDAVATQDTVTQL
FT                   IAAIRRVGREVSGAGEVIAAVCSAHDYTDAGKPAIAWNDKTARDQLVDGLVGDAHRLLG
FT                   HLPEQDLGPRAAEAVALLALVAGQDVEPVEGSDGTDGHWQIAQKVAGDRVISTVDPEAR
FT                   HAHKTVHRRQDGFKAHIAVEPDTGIITDCALTKASGPDNHEAVIGLALLADEHTPVRVL
FT                   GDSAYGTGDARAALAELKHVAVIKPLPLRVPVPGGFTSDDFIIDFDARTVTCPAEHTVA
FT                   IGRTGGAGFEKHCRSCPLRQQCTTAKRGRKLTISEHEPHLRAARAVARTPEWQNEYRQH
FT                   RPMVERSIAWLARGNRKVRYRGVTKNDHWLHHRVAALNLRRLITIGLIRNGTTWAIA"
FT   gene            595818..596984
FT                   /pseudo
FT                   /locus_tag="Mvan_0554"
FT   gene            596981..597796
FT                   /locus_tag="Mvan_0555"
FT   CDS_pept        596981..597796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0555"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mtc:MT2880 general
FT                   secretion pathway protein A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11398"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J8"
FT                   /protein_id="ABM11398.1"
FT                   /translation="MSIQRLQSHWGFSRMPFGRDLAPSMLHRHPGHSEAIARISWCVDQ
FT                   CAIGVITGEVGAGKTVAIRAAATALDPARHVIIYLANPTIGVRGMLTHIVAALGHTPVF
FT                   HTARLAPQAADALAAEHAERGRNPVLVVDEAHLLDNTQLEAIRLLTNHDMDSGAPFAVV
FT                   LVGQPTLRHRLRLGVLAALDQRIAVRYTLPGMTPADTADYIGHHTKIAGRSDVLFADDA
FT                   ITLIHNASRGHPRAVNNLALHALTAAFAAGHSIVGEKAARIAISETATD"
FT   gene            598276..599274
FT                   /pseudo
FT                   /locus_tag="Mvan_0556"
FT   gene            complement(599300..600304)
FT                   /locus_tag="Mvan_0557"
FT   CDS_pept        complement(599300..600304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0557"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="PFAM: Ketopantoate reductase ApbA/PanE, N-terminal
FT                   domain protein; Ketopantoate reductase ApbA/PanE,
FT                   C-terminal domain protein; KEGG: mmc:Mmcs_1695 ketopantoate
FT                   reductase ApbA/PanE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11399"
FT                   /db_xref="GOA:A1T2J9"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J9"
FT                   /protein_id="ABM11399.1"
FT                   /translation="MRVLILGAGGLGSVLGGYLANIGVDVTLVGRPAHAEAITRYGLRI
FT                   TGRRGDLVITDNLTAVDQTAKATGHFDYLVLAVKGKDTAQALAEADGLRDCVSSALSVQ
FT                   NTVEKDATLARWLGPDRVIGASTIEGGTLLEPGLVRNHLTAEVTAYFGELDGTSSARVD
FT                   DLTAAFTNAGLPAKAVGNIEQVEWEKLAQIALAAAWSVTALGAIPDASVFEGMEVREGA
FT                   MYFVALAKDLLGVYRAKGYEPMNFFAPLSRLKELDALPTADAIEFVIGQGRVMREKGNL
FT                   GHPSMYEDVLRRRKTEVDFMLAPYLAAAQELGMDTPTLRVAYQIIKTVDRFLA"
FT   sig_peptide     complement(600197..600304)
FT                   /locus_tag="Mvan_0557"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.785) with cleavage site probability 0.776 at
FT                   residue 36"
FT   gene            complement(600304..601281)
FT                   /locus_tag="Mvan_0558"
FT   CDS_pept        complement(600304..601281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0558"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   mmc:Mmcs_1696 dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11400"
FT                   /db_xref="GOA:A1T2K0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K0"
FT                   /protein_id="ABM11400.1"
FT                   /translation="MTTTTPLGSDARAWAAENLRGFYMCPVTPLTDEFELDEEGLRQNI
FT                   DAFVEMGCTGLVVGGFFAEGWNMTLAEWQRYHEVVAGATAGRLPLFTIILDHSAYQAIE
FT                   KMRFVESLGFTGAEIMNPSVQLKTDDDVVDYFDFVAPATGLALVLYRTPVSGFVYSHDA
FT                   VARIAEHANVVGIKNGTLSWTDSIALRHRFGDHLVISEPNERYWAHDAALFGGRVLYGE
FT                   LSLILYGKRRQELHQYTDLAFAGELAGALPVSAKVDAIRQVYEEVLIGRIAATGSYVAA
FT                   MPYLKAWFELLGLRAGPVRPPVKARLSAPEREVLQEKLTAAEAI"
FT   gene            complement(601556..602305)
FT                   /locus_tag="Mvan_0559"
FT   CDS_pept        complement(601556..602305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0559"
FT                   /product="regulatory protein, IclR"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: sco:SCO6669
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11401"
FT                   /db_xref="GOA:A1T2K1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K1"
FT                   /protein_id="ABM11401.1"
FT                   /translation="MAGNTSTPGTTVTSRLLNILGAFDERHKNLTLSELARRAGLPIAT
FT                   THRLAAELVAGSALQRRADGQYVVGRLIWNAGLLAPVEGQLRQVAEPFLHDVYAATLAT
FT                   VHLAVRDGDEVLYLERMMGRTSVPIVSAVGSRLPMHCTGVGKVLLAHAPEDVKHRVFAT
FT                   LTRITPYTIVSPTVLSSQMQRIHREGVATTSEEMSLGACSLAVPVIRQTDDAVVAAIAV
FT                   VVPTLKRDRQRLLGALQVAARGIGRLL"
FT   gene            602378..603175
FT                   /locus_tag="Mvan_0560"
FT   CDS_pept        602378..603175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0560"
FT                   /product="protocatechuate 3,4-dioxygenase, beta subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, beta
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   mmc:Mmcs_1698 protocatechuate 3,4-dioxygenase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11402"
FT                   /db_xref="GOA:A1T2K2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012785"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="InterPro:IPR024756"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K2"
FT                   /protein_id="ABM11402.1"
FT                   /translation="MTTLIDSNPDGAVASQSEISAEIGAIESAYQRAGVEETQPRLSYP
FT                   PYRSSLLRHPTKDLHHADPEGVELWTPCFSERDVHPLEADLTVQHSGEPIGERLVVTGR
FT                   VVDGAGRPVRRQLVEIWQANAGGRYIHKRDQHPSPIDPNFTGAGRCLTDEDGIYRFTTI
FT                   KPGPYPWKNHRNAWRPAHIHFSFFGTEFTQRMVTQMYFPGDPLLCLDPIFQAIPDQKAR
FT                   SRLVASYDHELSTHEWATGYRWDVVLTGSARTPIENLGRGAHR"
FT   gene            603175..603744
FT                   /locus_tag="Mvan_0561"
FT   CDS_pept        603175..603744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0561"
FT                   /product="protocatechuate 3,4-dioxygenase, alpha subunit"
FT                   /note="TIGRFAM: protocatechuate 3,4-dioxygenase, alpha
FT                   subunit; PFAM: intradiol ring-cleavage dioxygenase; KEGG:
FT                   mmc:Mmcs_1699 protocatechuate 3,4-dioxygenase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11403"
FT                   /db_xref="GOA:A1T2K3"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR012786"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K3"
FT                   /protein_id="ABM11403.1"
FT                   /translation="MSTLLPATPGQTVGPFFGYALPFDRCNELVPPGSPNAVQLHGVVA
FT                   DADGRGLPDALLEIWQADADGSIPNASGSLHRDGWTFTGWGRATTDEAGRYTFTTVIPG
FT                   VSEPVAAPFISITVFARGLLNRLFTRAYIPGKQLENDSLLNTLTPERRDTLIATRDRTG
FT                   LRFDIQLQGTPDKPETVFLRYPGHQR"
FT   gene            603741..604946
FT                   /locus_tag="Mvan_0562"
FT   CDS_pept        603741..604946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0562"
FT                   /product="3-carboxy-cis,cis-muconate cycloisomerase"
FT                   /EC_number="5.5.1.2"
FT                   /note="PFAM: fumarate lyase; KEGG: mmc:Mmcs_1700 fumarate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11404"
FT                   /db_xref="GOA:A1T2K4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K4"
FT                   /protein_id="ABM11404.1"
FT                   /translation="MIDLFWPGDDLAGDLMSDGAFLSAMVAVEQAWLDGLVDAGIAPRQ
FT                   ARADLTILLADGDAATIARRAGADGNPVSALVLMLRERSAEPTARWLHRGLTSQDVVDT
FT                   ALMLCTRDVLIRIGDEFAIQVRALTELAETHRDTSALARTLTQAALPSTLGAKFARWLT
FT                   GVLDAAEPIAGLIASLPVQVGGAVGSLAAATELAGSVEGAIALSDGLAATLRLAPTPPW
FT                   HTTRWQVTRIGDALVSCCDAWGHIATDVTTGCRPEIGELAEGHGGGSSTLPHKNNPVRS
FT                   VLIRRAALTAGPLGSILHTAAGATVDERSDGAWHTEWATLRTLARHTVVAAAHTSDLLS
FT                   GLRVDPPRAAANLAAAESLLSEQRSMTELTGRAALPGYTGAADRLIDSTLGRACRFVKD
FT                   AP"
FT   gene            604943..606124
FT                   /locus_tag="Mvan_0563"
FT   CDS_pept        604943..606124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0563"
FT                   /product="3-oxoadipate enol-lactonase /
FT                   4-carboxymuconolactone decarboxylase"
FT                   /EC_number="3.1.1.24"
FT                   /EC_number="4.1.1.44"
FT                   /note="TIGRFAM: 4-carboxymuconolactone decarboxylase; PFAM:
FT                   alpha/beta hydrolase fold; Carboxymuconolactone
FT                   decarboxylase; KEGG: mmc:Mmcs_1701 4-carboxymuconolactone
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11405"
FT                   /db_xref="GOA:A1T2K5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR012788"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K5"
FT                   /protein_id="ABM11405.1"
FT                   /translation="MSNPPLTAIHLGGPDDGPLLLLGPSLGTTTATLWTGVAQRLVDHV
FT                   RVVGWDLPGHGRGRRAHPFTIADLAAAVLVIADDLNVETFHYAGDSVGGCVGLQLLLDA
FT                   PQRVSSATLLCTGAAIGTPDGWLARAATVRAGGVDTMLAGAAERWFAPGFVDREPGTAS
FT                   ALLDALSHTDAESYAQVCEALAVFDVTNQLSEIVTPVLAVAGSVDVPTPPESLRRIASD
FT                   VKDGDLVVLEGVGHLAPAEAPQRVAGLIAEIVGVPQPPSKTLEDVHRAGMAVRREVLGE
FT                   AHVDRAVAGTTDLTADFQHMITQYAWGTIWTRPGLDLRSRSMITLTALVARGHHEELAM
FT                   HLRAARRNGLSNDEIKELLMQTAIYCGVPDANSAFRIAAEVLPEFDEHPGAPS"
FT   gene            606121..606819
FT                   /locus_tag="Mvan_0564"
FT   CDS_pept        606121..606819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0564"
FT                   /product="3-oxoadipate CoA-transferase alpha subunit"
FT                   /EC_number="2.8.3.6"
FT                   /note="KEGG: mmc:Mmcs_1702 3-oxoacid CoA-transferase,
FT                   subunit A; TIGRFAM: 3-oxoacid CoA-transferase, A subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11406"
FT                   /db_xref="GOA:A1T2K6"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K6"
FT                   /protein_id="ABM11406.1"
FT                   /translation="MSRTLVCHRAEEAVAGINDGATILVGGFGMAGMPTTLINALIEQG
FT                   AAELTIVSNNAGNGDTGLAALLAAGRVAKVICSFPRQADSYVFDALYRAGKVDLEVVPQ
FT                   GNLAERIRAAGAGIGAFFCPTGVGTPLVEGKETRTIDGRDYVLEYPIFGDVALIGAHVA
FT                   DQVGNLLYRKTARNFGPVMATAASLTVVEVSRVVDTGQIDPETVVTPGIYVDRVLDLSA
FT                   IPETSTEAAS"
FT   gene            606816..607538
FT                   /locus_tag="Mvan_0565"
FT   CDS_pept        606816..607538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0565"
FT                   /product="butyryl-CoA:acetate CoA transferase"
FT                   /EC_number="2.8.3.8"
FT                   /note="KEGG: mmc:Mmcs_1703 3-oxoacid CoA-transferase,
FT                   subunit B; TIGRFAM: 3-oxoacid CoA-transferase, B subunit;
FT                   PFAM: coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11407"
FT                   /db_xref="GOA:A1T2K7"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K7"
FT                   /protein_id="ABM11407.1"
FT                   /translation="MTRTVDASTRACVEHLDRGPLDRREIAAMIARDIPAGSYVNLGIG
FT                   QPTMVADFLDPAAGVVLHTENGMLGMGGEAIGDAIDPDLTNAGKIPVTETPGASYFHHA
FT                   DSFAMVRGGHLDVCVLGAFQVSERGDLANWHTGAPDAIPAVGGAMDLAIGAKSVLVMMT
FT                   LFAKDGTAKLVPSCSYPLTGLRCVNRVYTDYAVFDIDHTGGGQLRVLHTFGLSIAALEE
FT                   RLRMALSCDGRVADLRQC"
FT   gene            607671..608336
FT                   /pseudo
FT                   /locus_tag="Mvan_0566"
FT   gene            608329..608919
FT                   /locus_tag="Mvan_0567"
FT   CDS_pept        608329..608919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11408"
FT                   /db_xref="GOA:A1T2K8"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K8"
FT                   /protein_id="ABM11408.1"
FT                   /translation="MCNSTREKRPRGDQLDARRPNLGATKTVREASGRRLRHFLTLTVG
FT                   IVAVLGVQALLITPAAHGDNKRLNDGVVANVYTIQRQAGCVSDIKTSPSLQLAAQWHAR
FT                   DALTNRNVNGDVGSDGSTPQQRAEAAGFSGAVSETVAINPALAFSGIELINRWYHDPVD
FT                   FAVMSDCSNTRIGVWSENSVDRTVVVAVYGKPQ"
FT   gene            609172..609618
FT                   /locus_tag="Mvan_0568"
FT   CDS_pept        609172..609618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0568"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mmc:Mmcs_1706 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11409"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2K9"
FT                   /protein_id="ABM11409.1"
FT                   /translation="MARAGGRDSQHVGEEHLVVSSAEAHWIQTASPSQIGLLLRIPARS
FT                   IEIFLQKIPAGEASDLHRHVHESIHFVQHGSGWSEIGDQRVRWSAGSFVYTPPWIWHRH
FT                   YADDGRDVEMIVIENSRLLAAVDASQRESMGNASFADAFGANTE"
FT   gene            609630..609968
FT                   /locus_tag="Mvan_0569"
FT   CDS_pept        609630..609968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0569"
FT                   /product="protein of unknown function DUF732"
FT                   /note="KEGG: mmc:Mmcs_1707 protein of unknown function
FT                   DUF732"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11410"
FT                   /db_xref="InterPro:IPR007969"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L0"
FT                   /protein_id="ABM11410.1"
FT                   /translation="MKRVFVAVAAATAVLGVIAPPAGADTVAYLVNVHVRPGYNFPNAE
FT                   AAIGYGRTICDRVAAKMNYAQLVDQVKADFRTSDYYQGAYLINQAVNELCPAQIWQLRQ
FT                   SAAGYTYC"
FT   sig_peptide     609630..609704
FT                   /locus_tag="Mvan_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            610160..610759
FT                   /locus_tag="Mvan_0570"
FT   CDS_pept        610160..610759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbo:Mb2834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11411"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J5"
FT                   /protein_id="ABM11411.1"
FT                   /translation="MVTVEVDPVRVESRLSGGAIACPSCVGGVLGGWGFARSRQVEGLD
FT                   HPVRPRRARCRSCLVTHVLLPVTVLLRRAHGAEQIWMALSTRAEGVGHRRIAAWLQVPP
FT                   ATVRGWLRRAGQRLEPMRAWFLTVAVRTGIDVTIPDGFGCGWRDLVAALRCAVAAIGQR
FT                   FGPAGLLGAVTPAQVMAAASGSRLLAPGWPPLARGV"
FT   gene            610871..612370
FT                   /locus_tag="Mvan_0571"
FT   CDS_pept        610871..612370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0571"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: mtc:MT2879
FT                   IS1604, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11412"
FT                   /db_xref="GOA:A1T2L2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L2"
FT                   /protein_id="ABM11412.1"
FT                   /translation="MSLEEHKRRERANAIGLFRYQLICPALEDGLSTRQRGRLVREIAE
FT                   RRHIDPFGTQVQIARATLDRWIRRYRGGGFEALVPEPRRLATRTDTQVLELAASLKREN
FT                   PARTVAQVARILRTATGWAPSESTLLRHFHRCELMGPAAGQSAEVFGRFEAADPNELWV
FT                   GDALHGPRVGDRKTYLFAFLDDHSRLVVGHRFGFAEDTVRLAAALKPALAARGVPAGIY
FT                   VDNGSAFVDAWLLRACAKLGIRLVHSAPGRPQGRGKIERFFRTVREQFLVEVTDTTAED
FT                   LTAAGVDHTGALLELNRLFMAWVETEYHRRTHTETGQSPLARWETGWDRLGALPALPTA
FT                   ADLTEAFLWSEFRVVTKTATVSLHSNIYRVDPALAGRRVELVFSPFDLQAIEVRHQDRS
FT                   YGPAVAHTITRHAHPKARPETRGEAPPAATGIDYLALTAANHHAQLRDDERIGYHALYG
FT                   TQAATDDTAGDDQVLGQLSITDLEPGGRTGASADHEGEVSA"
FT   gene            612367..613182
FT                   /locus_tag="Mvan_0572"
FT   CDS_pept        612367..613182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0572"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: mtc:MT2880 general
FT                   secretion pathway protein A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11413"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J8"
FT                   /protein_id="ABM11413.1"
FT                   /translation="MSIQRLQSHWGFSRMPFGRDLAPSMLHRHPGHSEAIARISWCVDQ
FT                   CAIGVITGEVGAGKTVAIRAAATALDPARHVIIYLANPTIGVRGMLTHIVAALGHTPVF
FT                   HTARLAPQAADALAAEHAERGRNPVLVVDEAHLLDNTQLEAIRLLTNHDMDSGAPFAVV
FT                   LVGQPTLRHRLRLGVLAALDQRIAVRYTLPGMTPADTADYIGHHTKIAGRSDVLFADDA
FT                   ITLIHNASRGHPRAVNNLALHALTAAFAAGHSIVGEKAARIAISETATD"
FT   gene            613853..615646
FT                   /locus_tag="Mvan_0573"
FT   CDS_pept        613853..615646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0573"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: sma:SAV3741
FT                   ISmav2-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11414"
FT                   /db_xref="GOA:A1T2L4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L4"
FT                   /protein_id="ABM11414.1"
FT                   /translation="MTQQLPNSPNDWVIEHRYRAVRQVLDGVSKSQVAQECGASRQSVH
FT                   SWVIRYEALGVAGLADRSRRPLTSPNELSPAVVAMVCELRRTYPRWGAQRIAHELALRG
FT                   VDAPPSRSSVYRILVRHGLVAAQQQNHKRKYRRWQRDAPMQLWQIDIMGGVFLVDGREC
FT                   KVVTGIDDHSRFVVMATVVADPGARAVCAAFTATMAIYGVPSEVLTDNGKQFTGRFTKP
FT                   YPAEVLFERICRENGITTRLTKPRSPTTTGKIERFHKTLRRELLDSAGPFASIEVAQEA
FT                   IDAWVHGYNHSRPHQSLGMATPATMFRPAPIEVVPPVPVDTEPLTPDVVVPPRPRRHLP
FT                   PATEHALIEVVHAVEWEAVLTPRARLLLPGDQQFKFTAALARREVTVWASDRSIHIVLD
FT                   GTVIRTRPSRLSEHDLRDLLRRGARIAGPEPARGAATIDILTTSAVIEVARTVSRDGCI
FT                   GLGGDKVLLESTLVGQRVTLRFEGALMHVVANGRLVKTMPAPLPPDQRATLRGARPTSE
FT                   PLPPPAPPNRAMRRVAANGTITIAGQRLRVGRSYQGRTVAVAIDDTVFRVFIDGTEICT
FT                   HARRTDTDITIFKAYPRRHGT"
FT   gene            615842..617479
FT                   /locus_tag="Mvan_0574"
FT   CDS_pept        615842..617479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0574"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cdi:DIP0047 putative transposase (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11415"
FT                   /db_xref="GOA:A1T2A6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A6"
FT                   /protein_id="ABM11415.1"
FT                   /translation="MVAYVRKVRTASGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGIL
FT                   LERARQIAAEDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPKGAPVPAGRTAATHS
FT                   RLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLADLGAEAMSYRTIQ
FT                   RHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVTTLYFEAENEDDLRKVGYSKERR
FT                   VDPQIVVGLLVDRSGFPLEIGCFEGNTAETTTLIPVVTAFVERHDLGDTPMVIAADAGM
FT                   LSATNLAALDDAGLGFIVGSRMTKAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVN
FT                   DAAHRAEPIWDPDEHTNAWRAIWAYSAKRARRDQKTLYAQEARARAVINGERAAKSTRF
FT                   VKTAAGDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRVERSFRMSK
FT                   SDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIANVVKQLRPLRSATIAIN
FT                   GTTETFPPQVPEAQQKILASLNIPEPGH"
FT   gene            complement(618110..619009)
FT                   /locus_tag="Mvan_0575"
FT   CDS_pept        complement(618110..619009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0575"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_3191 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11416"
FT                   /db_xref="GOA:A1T2L6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L6"
FT                   /protein_id="ABM11416.1"
FT                   /translation="MSRFQFVADHLHAFEVKWLCAGVEVARSSFYAWLAGAEGRAARKA
FT                   ADEALAARIRMVHDEDNTYGAPRITAELNDSVPDGERVNHKRVARVMRDAGIAGYRRRR
FT                   RVKTTTPDPAKQKVPDLLKRDFTAPAPNEKYVGDITYLPLATGSNLYMATVIDCFSGRV
FT                   AGWAIAEHMRTELVEDALKAADALRGSLAGAVFHSDHGSQYTSTDFASLCEKLGVTQSM
FT                   GGVGSSADNALAESFNASLKREVLQDRSHWPDSATCRRQVFRWLVRYNLRRRHSRCRYS
FT                   SPVSYERSHAPATLPEAA"
FT   gene            complement(619006..619338)
FT                   /locus_tag="Mvan_0576"
FT   CDS_pept        complement(619006..619338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0576"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mmc:Mmcs_3190 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11417"
FT                   /db_xref="GOA:A1T2L7"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L7"
FT                   /protein_id="ABM11417.1"
FT                   /translation="MARKNYPDEFKRDAVALYRDTAGATITQIADELGITGVTLSAWCK
FT                   AAGVAIRHRNPSATTAPARGVETPDQELARLRAENKALRATEARLSTERDILRSAAKYF
FT                   AGETNW"
FT   gene            619453..620250
FT                   /pseudo
FT                   /locus_tag="Mvan_0577"
FT   gene            620480..620815
FT                   /locus_tag="Mvan_0578"
FT   CDS_pept        620480..620815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0578"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mmc:Mmcs_0845 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11418"
FT                   /db_xref="GOA:A1T2L8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L8"
FT                   /protein_id="ABM11418.1"
FT                   /translation="MRLCCPVCGQGRINNDMASNKRRRHTPDQIIRKLAEGNKLLAAGQ
FT                   ELSEVCRHLEIAESTWHRWLAQYGGMKANDAKRLKELEAENARLKKMVANQALDIDMLK
FT                   EISAGNF"
FT   gene            620920..622557
FT                   /locus_tag="Mvan_0579"
FT   CDS_pept        620920..622557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0579"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cdi:DIP0047 putative transposase (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11419"
FT                   /db_xref="GOA:A1T2A6"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2A6"
FT                   /protein_id="ABM11419.1"
FT                   /translation="MVAYVRKVRTASGAVAVQVVRKHRGQRTILAHVGSAHTDAQLGIL
FT                   LERARQIAAEDQGVLDIEVPARTQSIDTIADWRAGTLSLSPGGPKGAPVPAGRTAATHS
FT                   RLLYDVLGTVYDWLGFDVVDDAVFRDLVIARIVEPTSKADAARVLADLGAEAMSYRTIQ
FT                   RHLGKAKSNRYREQIAARCFTHAADRGGLSLLLYDVTTLYFEAENEDDLRKVGYSKERR
FT                   VDPQIVVGLLVDRSGFPLEIGCFEGNTAETTTLIPVVTAFVERHDLGDTPMVIAADAGM
FT                   LSATNLAALDDAGLGFIVGSRMTKAPGDLESHFHWHGDVFTDGQIIDTVTPRHANSTVN
FT                   DAAHRAEPIWDPDEHTNAWRAIWAYSAKRARRDQKTLYAQEARARAVINGERAAKSTRF
FT                   VKTAAGDRILDEAALARAQSLVGLKGYVTNVPATIMPAGEVIAHYHELWRVERSFRMSK
FT                   SDLRARPMFHRTRDAIEAHLTIVVTALAVAHNIQERTGLAIANVVKQLRPLRSATIAIN
FT                   GTTETFPPQVPEAQQKILASLNIPEPGH"
FT   gene            622612..622869
FT                   /locus_tag="Mvan_0580"
FT   CDS_pept        622612..622869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0580"
FT                   /product="integrase, catalytic region"
FT                   /note="KEGG: mmc:Mmcs_2595 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11420"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M0"
FT                   /protein_id="ABM11420.1"
FT                   /translation="MLRERFGVSERRACTVVGLHRSTMRLTPAPIATEEAELRAWLRRF
FT                   STDRPRWGWRRAAKMARKAGWKANNKRIRRRGLTPSVGHA"
FT   gene            complement(623033..624265)
FT                   /locus_tag="Mvan_0581"
FT   CDS_pept        complement(623033..624265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0581"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mpa:MAP3759c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11421"
FT                   /db_xref="GOA:A1T2J4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J4"
FT                   /protein_id="ABM11421.1"
FT                   /translation="MALDQSALLEVLDALRTADAGERITQACEIVYQALIDAELTAKIG
FT                   AALHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAV
FT                   VMEAYLHGTSTRKVDDLVKALGADSGISKSEVSRICKDLDTEVGAFRDRPLGEQRFPYV
FT                   FLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRG
FT                   LAGVQLVISDAHAGLRAAIDAVLIGSAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIF
FT                   AQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAEDITAFADFPAAHWKKIWSTNPLER
FT                   LNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSETSLALLDTGEQDT
FT                   QTVAPTAALTA"
FT   gene            624270..624665
FT                   /locus_tag="Mvan_0582"
FT   CDS_pept        624270..624665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0582"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mmc:Mmcs_3190 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11422"
FT                   /db_xref="GOA:A1T2M2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M2"
FT                   /protein_id="ABM11422.1"
FT                   /translation="MFLSVVILGRFTTETHAMALLHQHRHAATTYTTPRDAPYRDTAGA
FT                   TITQIADELGITGVTLSAWCKAAGVAIRHRNPSATTAPARGVETPDQELARLRAENKAL
FT                   RATEARLSTERDILRSAAKYFAGETNW"
FT   gene            624662..625561
FT                   /locus_tag="Mvan_0583"
FT   CDS_pept        624662..625561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0583"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mmc:Mmcs_3191 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11423"
FT                   /db_xref="GOA:A1T2L6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2L6"
FT                   /protein_id="ABM11423.1"
FT                   /translation="MSRFQFVADHLHAFEVKWLCAGVEVARSSFYAWLAGAEGRAARKA
FT                   ADEALAARIRMVHDEDNTYGAPRITAELNDSVPDGERVNHKRVARVMRDAGIAGYRRRR
FT                   RVKTTTPDPAKQKVPDLLKRDFTAPAPNEKYVGDITYLPLATGSNLYMATVIDCFSGRV
FT                   AGWAIAEHMRTELVEDALKAADALRGSLAGAVFHSDHGSQYTSTDFASLCEKLGVTQSM
FT                   GGVGSSADNALAESFNASLKREVLQDRSHWPDSATCRRQVFRWLVRYNLRRRHSRCRYS
FT                   SPVSYERSHAPATLPEAA"
FT   gene            625597..626169
FT                   /pseudo
FT                   /locus_tag="Mvan_0584"
FT   gene            626263..627495
FT                   /locus_tag="Mvan_0585"
FT   CDS_pept        626263..627495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0585"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mpa:MAP3759c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11424"
FT                   /db_xref="GOA:A1T2J4"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2J4"
FT                   /protein_id="ABM11424.1"
FT                   /translation="MALDQSALLEVLDALRTADAGERITQACEIVYQALIDAELTAKIG
FT                   AALHERTETRSNQRNGSRPRTLSTVAGDLELRIPKLRSGSFFPALLERRRRVDQCLFAV
FT                   VMEAYLHGTSTRKVDDLVKALGADSGISKSEVSRICKDLDTEVGAFRDRPLGEQRFPYV
FT                   FLDATYCKARVNHRVVSQAVVIATGVAADGRREVLGFEVGDSEDGAFWTAFLRSLKSRG
FT                   LAGVQLVISDAHAGLRAAIDAVLIGSAWQRCRVHFLRNVLAQVPKGSAEMVAAAIRTIF
FT                   AQPDAEHVREQLDTIAGMLGRQFPKVETMLREAAEDITAFADFPAAHWKKIWSTNPLER
FT                   LNKEIKRRTDVVGVFPNPAALLRLAGSVLVEAHDEWQVADKRYLSETSLALLDTGEQDT
FT                   QTVAPTAALTA"
FT   gene            627495..628820
FT                   /locus_tag="Mvan_0586"
FT   CDS_pept        627495..628820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0586"
FT                   /product="UDP-glucose/GDP-mannose dehydrogenase"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   mth:MTH836 UDP-N-acetyl-D-mannosaminuronic acid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11425"
FT                   /db_xref="GOA:A1T2M5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M5"
FT                   /protein_id="ABM11425.1"
FT                   /translation="MRTGRASREHATALTPLHGTSPLPQRSSLYSGPRPTNPKSHSDWT
FT                   TKRVPLTGLTRSGYEFDIPNLQVLSDPVEADVFVLCVDSPVGTTTRKADLSNLKAASES
FT                   VGRYLRSTNLVIVRSTVPVGTTRGVVARLLSESSGLVEGDFSLAFAPERTSTGMTLRES
FT                   SQIPHLVGGRDSLSAERAAEFLQSAGMRSLVMESAEAAELGKLASNAARDTALALAAQI
FT                   CAVAELHNLDVERLVNDVNHDYPRDHIKMPRPGVGGSCLTKDSYILAESLASTPLGDTL
FT                   FGLVRRINDETQAPTIRSLARHFTDHFRREFAPRILVCGAAFKGDPPTRDTRNAVSLVV
FT                   ARELMAQEYSVAVFDPFISGEEISELGFEPASIAEMNAPWNGLLLYSNHKFFSDENVVR
FT                   KLVQNVCGNGFIYDPYRWCKPTMDAIRPGTLYRTLSTEKILP"
FT   gene            complement(628890..629483)
FT                   /locus_tag="Mvan_0587"
FT   CDS_pept        complement(628890..629483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0587"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_2381 cytidylate kinase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M6"
FT                   /protein_id="ABM11426.1"
FT                   /translation="MRIVVGGWSASGKTIFARYLADLLQCEYVSASSRLVSALMLDNVN
FT                   WIRDRDSLKRLRSPEVERQVDRDLTARLSGTSRIVLDSWTGAFLSKSHDAAVWIECDLD
FT                   VRAQNAMGPDCLAAENPHKFRAIRSGLAQKDRDSVEIFRDLYGFSYDPTSEAFPINIDI
FT                   TKLISPYREHWWHERHSVLFLIATKISQHLAEQI"
FT   gene            complement(629824..629897)
FT                   /locus_tag="Mvan_R0007"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(629824..629897)
FT                   /locus_tag="Mvan_R0007"
FT                   /product="tRNA-Gly"
FT   gene            629902..630423
FT                   /locus_tag="Mvan_0588"
FT   CDS_pept        629902..630423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0588"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   KEGG: mmc:Mmcs_4181 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11427"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M7"
FT                   /protein_id="ABM11427.1"
FT                   /translation="MIRKANIRRSVRVEVAASRPHTLRGKPMKHVVTVAASVIAATFAP
FT                   ATAGATPPEGDVERTELGQGTTNAPVVIVSVGQPTTLYVQELELNGPAGSGWHTHPGPE
FT                   HTVITEGTVHVQSAPDCVPVAYPAGQSVFIPAGVPHTVRNEGPGDAHAVVTYTLPADRA
FT                   VRDDAPAACP"
FT   sig_peptide     629902..630054
FT                   /locus_tag="Mvan_0588"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.755 at
FT                   residue 51"
FT   gene            630452..631024
FT                   /locus_tag="Mvan_0589"
FT   CDS_pept        630452..631024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0589"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mmc:Mmcs_0430 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11428"
FT                   /db_xref="GOA:A1T2M8"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T2M8"
FT                   /protein_id="ABM11428.1"
FT                   /translation="MLLSDRDIRAEITAGRLGVDPFDDSLVQPSSVDVRLDNLFRVFNN
FT                   TRYTHIDPAQRQDDLTSLVEPKEGEPFVLHPGEFVLGATLERCTLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLLRLTSPAEHPYG
FT                   SSSVGSKYQGQRGPTPSRSYQNFVKND"
FT   gene            631279..632910
FT                   /locus_tag="Mvan_0590"
FT   CDS_pept        631279..632910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11429"
FT                   /db_xref="GOA:A1T2M9"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2M9"
FT                   /protein_id="ABM11429.1"
FT                   /translation="MTPTTVRMVLVEGEKADGVTVDHDVFHVDSADGSANVAEHVVSAI
FT                   QGTKESAETGGHHLRSIGVTWSDHTEATALRDALATHGIDDVMLVSEGHAAASLAQAVG
FT                   RAVGYDTTALLFVDRDTATLSVVQTDDGSVVKVLSRSLHSADAMAVLTEMAEAVAAQEA
FT                   PPQGMFVVGSGVDISSVKAHLEHLVSLPVSAPDDAELALARGAALASAAAPAFEATTVG
FT                   LAYSQDPDGTTAGSVYAGLAGADTQLAPVGAEDVVDEFAPTEMRPVDEGRKPFLLVGSA
FT                   LTSLFVIGVAALVVSLAISIRPTADQRPSPAQSAIVPSQLPAPAPAPARQEAADVPANP
FT                   PSAETIKPPIPVVQEAPQQAPRTVYVEQAPAPAVPAPAPAAPPPAPAPAAPPVVAPVVV
FT                   PPPVIVLPRPQWTPPKPAWTWPTQTVEPDEPDEPWQPPWEDDDDDKPTPTLPTQTVVPT
FT                   RPQVPTVPQVPTVPQVPQQPQWPGSGSGAGSGSGSSSGSYGGSGSYGGGRGDSGSSRGG
FT                   SGSGVPGDVNGDGCFLIFCAPGGGRG"
FT   gene            complement(632933..633916)
FT                   /locus_tag="Mvan_0591"
FT   CDS_pept        complement(632933..633916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0591"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_1630
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11430"
FT                   /db_xref="GOA:A1T2N0"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N0"
FT                   /protein_id="ABM11430.1"
FT                   /translation="MTPDVFGKVHLGYLVIESDRFADWRRFGRDAIGMHLDETLTDVMR
FT                   FRLDDNACRFLLTRGPAEDTTALGWEVGDHDTFDAIAARIHDHGVPVSDGAAEEAEIRG
FT                   VEHFIRFPGPNGLLQELYVTPRKGLQHLRLGVAGGFVTGVDGMGHVAIATKKPHQMHGY
FT                   YRTVFDARLSDYIDETISGLKFKIRFLRVNERHHSVAIASVNRLPLNPIRTRIQHCNIQ
FT                   VAELDDMASAYRRVKELGFEMALSVGQHTNDKELSFYAVTPSGFEWEVGWNPIVVDEAT
FT                   WEPTTHQGISLWGHTPEGHTIVNLLERFKAGARSVFHAEDSVPALV"
FT   gene            complement(633913..634779)
FT                   /locus_tag="Mvan_0592"
FT   CDS_pept        complement(633913..634779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0592"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: nfa:nfa4730
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11431"
FT                   /db_xref="GOA:A1T2N1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N1"
FT                   /protein_id="ABM11431.1"
FT                   /translation="MTRSDSEYRVRVGTAEISVTDTGGDGAPVVLLHGGGPGASGISNY
FT                   SRNIGALAASYRVIVPDMPGYGRSTKYVDHSDPFGYLADSIRGMLDEMGVQQAHLVGNS
FT                   YGGAAALRLALDTPHRADKLVLMGPGGIGTTRGLPTPGLKSLLGYYAGEGPSREKLATF
FT                   IRSYLVYDGPSVPDELIDLRYQASLDPQVVADPPLRRPSGLRTLWRMDLTRDKRLRRLP
FT                   NPTLVLWGRDDKVNRPAGGPMLLNMMPNAELVMTSHTGHWMQWERAELFNELVSDFLSP
FT                   DTRLASS"
FT   gene            complement(634776..636338)
FT                   /locus_tag="Mvan_0593"
FT   CDS_pept        complement(634776..636338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0593"
FT                   /product="monooxygenase, FAD-binding protein"
FT                   /note="PFAM: monooxygenase, FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: mxa:MXAN_7320 FAD-binding
FT                   monooxygenase, PheA/TfdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11432"
FT                   /db_xref="GOA:A1T2N2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N2"
FT                   /protein_id="ABM11432.1"
FT                   /translation="MDDSSTYDVAIVGYGPVGATAANLLGRRGLKVVVIERDPDIYFRA
FT                   RAISTDEEVMRIWQQIGLAEQLNAEMQPGCGADFVDADGRSFVKLLPADRGNGHPPQQF
FT                   IYQPAVDKTLRAGVDRFPNVTVLLRHECLRLVPRTDDVELMLADLSEDQFKRIRATYVI
FT                   AADGGSSAVRGQLGIGFTGSTYSERWIVIDTKVLREWPGHDRLRFHCNPARPTVDCPTP
FT                   LGHHRWEFPVRDEEDERDLLTEDAIWKVLHGQGISKDDVEIIGFACYSHHVRFADRWRV
FT                   GRIFLAGDAAHAMPPWIGQGMCAGVRDVGNLCWKLEAVLTGALSESVLDSYQAERLPHV
FT                   REVTKRAVKVGRLIIERNPLRANIRNHFFRAASRLPFFTAWLRDHRWLPDARYRAGLLT
FT                   SDRHPAVGWLIPQPWVVDEKGDRVRLDDVLAGGWTVLHIGPESLWRSWRSAGVPVIAIA
FT                   PPGSAPAPGRIVDREGTLIRWIQTKKATVVVVRPDGFVYAAAADQPLPAPPAGFTPRVR
FT                   QQA"
FT   gene            636452..637078
FT                   /locus_tag="Mvan_0594"
FT   CDS_pept        636452..637078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0594"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mpa:MAP1732c
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11433"
FT                   /db_xref="GOA:A1T2N3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N3"
FT                   /protein_id="ABM11433.1"
FT                   /translation="MTDQPKRRRRRADGELSRRRILDAATEIAAERGYEGTSIGAVSAK
FT                   CGLPASSIYWHFKDKDDLIAAVIERSFANWLTVWQLPDDVMARDRLMEVAMGTAKAVLD
FT                   SPDFLRLGLMLALERRPVEPKARAMFIQVREQAFAALATSIRDLGLDLSEEQVRHLSTY
FT                   AIAGADGLFIAKEIGGDTVDLMALFALHGQALYDTALRMIEENNR"
FT   gene            637075..637863
FT                   /locus_tag="Mvan_0595"
FT   CDS_pept        637075..637863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0595"
FT                   /product="2-oxohept-3-enedioate hydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: mta:Moth_1777
FT                   4-oxalocrotonate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11434"
FT                   /db_xref="GOA:A1T2N4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N4"
FT                   /protein_id="ABM11434.1"
FT                   /translation="MTMPRDLIEHAADLLAVADADAAPIGQLTQRYPQMDIADAYAIQQ
FT                   VNLAKRVDQGRIVVGRKIGLTSEPMQTLLGVDQPDFGYLLDDMVVPSGATLPRNRFCAP
FT                   RVEPEVAFLLDQPLRGPGITVQQVRAATAAVAAALEIVDSRIAEWKLTLCDTVADNASS
FT                   GAVVLGPWLPFTDDIDLASARASLCLNGTEIDTGLGSAVLGDPAAAVAWLANALAPFGV
FT                   ALQPGQFVMSGSFTTAAFVEPGDDASAAVSGLGTVSVTFT"
FT   gene            637871..638818
FT                   /locus_tag="Mvan_0596"
FT   CDS_pept        637871..638818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0596"
FT                   /product="acetaldehyde dehydrogenase"
FT                   /EC_number="1.2.1.10"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   KEGG: bur:Bcep18194_C7645 semialdehyde dehydrogenase, NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11435"
FT                   /db_xref="GOA:A1T2N5"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T2N5"
FT                   /protein_id="ABM11435.1"
FT                   /translation="MTPTVKCPVAILGSGDVGTDLMMKILRSDGPLTVGALVGLDPEPG
FT                   GLARAERLGVPTSAAGIDGLPAMPEFGDIGIVFDATPAGAPRAELEKAGVCVLDLNPAV
FT                   VGPHCVPAVNLEDHLDTPNLNLVTGAGQATVPIVAAVGRVGAVSYAETVTSVAAKSADP
FT                   ATRANIDESIETTTAALRTVGGARRARSIFIINPADPPILMRNTVYCLVDGDVPRGDIE
FT                   QSIAAMVERVTSYVPGYRLKQRVQFETFTATDPLHIPETGGFTGTRVTVLVEVTAGEPH
FT                   LPGYAGNLEMMTSAAKAAAERIALHRSRTAGAAT"
FT   gene            638815..639831
FT                   /locus_tag="Mvan_0597"
FT   CDS_pept        638815..639831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0597"
FT                   /product="4-hydroxy-2-oxovalerate aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="PFAM: pyruvate carboxyltransferase; DmpG
FT                   communication domain protein; KEGG: ecj:JW0343
FT                   4-hyroxy-2-oxovalerate/4-hydroxy-2-oxopentanoic acid
FT                   aldolase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11436"
FT                   /db_xref="GOA:A1T2N6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1T2N6"
FT                   /protein_id="ABM11436.1"
FT                   /translation="MIRDVYLSDVTLRDGMHAVRHQYSIEQVAMIATALDRAGVDSIEV
FT                   AHGDGLAGGTCNYGFGAHTDLEWIETVATAVKRARVATLVLPGVGTVRDLRDARRAGAT
FT                   VVRVGTHCTEADISAEHITAARELGMDTVGFLMMSHMSSPSALAAQAKLMEGYGATCVY
FT                   VVDSGGAMVMRDVAERVDALRQTLLPATEIGIHAHHNLSLGVANSITAVQHGAHRVDAS
FT                   LAGMGAGAGNAPLEVFVAAAERLDWTHGCDLHALQDAADDLVRPLQDRPVRVDRETLTL
FT                   GYAGVYSSFLRHAEAAAARYHIDARTLLEEAGRRGMVGGQEDMLVDIALDLTGADRS"
FT   gene            639913..641253
FT                   /locus_tag="Mvan_0598"
FT   CDS_pept        639913..641253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0598"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase; KEGG:
FT                   mpa:MAP3825 UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11437"
FT                   /db_xref="GOA:A1T2N7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N7"
FT                   /protein_id="ABM11437.1"
FT                   /translation="MRCTVFGTGYLGATHAAGMAELGHDVLGVDIDAGKVAKLSGGEVP
FT                   FYEPGLREMLRRNIDAGRLRFTTDYAEAAGFADVHFLGVGTPQKKGEYGADLRHVYAVI
FT                   DTLVPLLTRPAVIVGKSTVPVGTAADLSERAAGLAPEGVTVEVAWNPEFLREGFAVADT
FT                   LHPDRIVLGVQRDSQLAEPVLREMYAPLLAAGVPFLIADLQTAELVKVSANAFLATKIS
FT                   FINAISEVCEAVDADVTLLADALGHDARIGRRFLNAGLGFGGGCLPKDIRAFMARAGEL
FT                   GANHALTFLREVDSINMRRRTRMVELATKACGGSLLGANVAVLGAAFKPESDDVRDSPA
FT                   LNVAGMLQLNGATVNVYDPQAIENSRRLFPTLNYATTVVEACDRADAVLVLTEWREFVE
FT                   LDPVLLADTVRAKVVVDGRNCLDVGRWQQAGWQVFALGRFGGEPAAA"
FT   gene            641263..641586
FT                   /locus_tag="Mvan_0599"
FT   CDS_pept        641263..641586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0599"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11438"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N8"
FT                   /protein_id="ABM11438.1"
FT                   /translation="MAVYALNLFDIADRDEYLAYSKRSPAEVAKHGGRVVALGRFQESV
FT                   TGDIAPRTVLILVEWESREAFDSYRDDPELADLHAHRENGSSSYIWHLFDRLDDLRPLL
FT                   KLN"
FT   gene            641586..642917
FT                   /locus_tag="Mvan_0600"
FT   CDS_pept        641586..642917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0600"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0433
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11439"
FT                   /db_xref="GOA:A1T2N9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2N9"
FT                   /protein_id="ABM11439.1"
FT                   /translation="MAADLQQRIRWLALHGVIRGLSKVAVRRGQDPQARLIADPAVRAD
FT                   PAAFADELRGRGPVIRCRAVLMTVDHQVVNEILRSDDFRVSSLGAGLPKPLQWINRKTH
FT                   PGLLHPIEPPSLLSIEPPDHTRCRKLVSSVFTTRAVAALRERVQQTANDLLDDLERESG
FT                   VVDIVERYCSQLPVAVISDILGVPERDRRHILHFGELGAPSLDIGLSWRQYTQVHEGLV
FT                   GFNEWLGGHMDELRRNPGDDLMSQLIQASQAADEGSRLTDRELQATAGLVLAAGFETTV
FT                   NLLGNGIRMLLETPGHLETLAARPELWPNAVEEILRLDSPVQMSARFARRDVTVGGTEI
FT                   KRGELVILHLAGANRDPEVFTDPHRFDIERDNAGRHLSFSGGRHFCLGAALARAEGEVG
FT                   LRTFFERYPDARLAGQGSRRDTRVLRGWSTLPITLGTARAALGS"
FT   gene            642920..643666
FT                   /locus_tag="Mvan_0601"
FT   CDS_pept        642920..643666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0601"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   mmc:Mmcs_0434 protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11440"
FT                   /db_xref="GOA:A1T2P0"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P0"
FT                   /protein_id="ABM11440.1"
FT                   /translation="MDFRAALLEQTRAFGDLIRPADPATPVPTCGEWTLKQLYRHVGRG
FT                   NRWAAQIISERRNQPLDPREVRDGKPPDDHDAAIEWFQRGAQMVIDAVDHVGADARVWT
FT                   FIGPRPAGWWIRRRVHETAVHRADAALALGAPFELPDEFAADCLSEWIELATVDKRHPP
FT                   ALDPGQSIHLHASEEKLGPTGEWTIAHDEDGLSWSHSHSKSSVALRGPVTGLLLAAVRR
FT                   KTAADAGLEMLGDAAVWDGWLERTPF"
FT   gene            643684..644052
FT                   /locus_tag="Mvan_0602"
FT   CDS_pept        643684..644052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11441"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P1"
FT                   /protein_id="ABM11441.1"
FT                   /translation="MTTSELATVLAWHDALNAADLDTLLELSSDDIEIGDAGGAAQGHA
FT                   ALRDWAQALDVKVEPGRMYVHDGVVVVEQQTVSVTGETGSEASAFRVVHDHVTSVFRHP
FT                   DLAAALAATELTEADLTG"
FT   gene            644052..644915
FT                   /locus_tag="Mvan_0603"
FT   CDS_pept        644052..644915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0603"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: mmc:Mmcs_0436
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11442"
FT                   /db_xref="GOA:A1T2P2"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P2"
FT                   /protein_id="ABM11442.1"
FT                   /translation="MRGIILAGGSGTRLYPITLGISKQLVPVYDKPLVYYPLSTLMMAG
FT                   IRDILVITTAHDAPDFRRLLGDGSDLGVNLSYAVQDEPDGLAQAFVIGASHIGTDSVAL
FT                   VLGDNIFYGPGLGTSLQRFQNVSGGAIFAYWVANPSAYGVVEFAEDGTALSLEEKPATP
FT                   KSHYAVPGLYFYDNDVIEIARGLRRSARGEYEITEVNQTYLNQGRLSVEVLARGTAWLD
FT                   TGTFDSLLDAADFVRTIERRQGLKISVPEEVAWRVGFIDDDALEARAKTLLKSGYGAYL
FT                   LELLQR"
FT   gene            645190..646509
FT                   /locus_tag="Mvan_0604"
FT   CDS_pept        645190..646509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0604"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mmc:Mmcs_5459
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11443"
FT                   /db_xref="GOA:A1T2P3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P3"
FT                   /protein_id="ABM11443.1"
FT                   /translation="MLTVVHDAAEANESAGGAGRSLLDEIVRDGARQMLAAALQAEVAA
FT                   YVAQFADQLDEDGHRLVVRNGYHQAREVLTAAGAVEVTAPRVNDRRVDPDTGVRQRFSS
FT                   AILPAWARKSPQISEVLPLLYLHGLSSGDFGPALEQFLGSGAGLSASTITRLTAQWQDE
FT                   AATFGRRDLSGTDYVYLWVDGIHLKVRLEQTKLCLLVMIGVRADGRKELVAITDGYRES
FT                   TESWADLLRDCKRRGMTAPVLAVGDGALGFWRAVREVFPATREQRCWFHKQANVLAALP
FT                   KSAHPSALAALKDIYNAEDTDKAQLAVKAFEVDFGAKYPKAVAKIVDDLDVLLEFYKYP
FT                   AEHWIHLRTTNPIESTFATVRLRTKVTKGPGSRTAGIAMAYKLIDAAQARWRAVNAPHL
FT                   VALVRAGAVFHKGKLLERPTDITPPTPPSNGDESTGTEVA"
FT   gene            646610..648124
FT                   /locus_tag="Mvan_0605"
FT   CDS_pept        646610..648124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0605"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0199 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11444"
FT                   /db_xref="GOA:A1T2P4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P4"
FT                   /protein_id="ABM11444.1"
FT                   /translation="MAVRSDPPVHVAAEPAEGHTLKRGAIGLAGVVFMVVAFSAPITAM
FT                   TGNLPVAVGFGNGLGTPAGFAIATIVLSIFSVGFIALARHITAAGAFYTFVSRGWSRIP
FT                   GLPAGVMSMFTYMTMEAGLIGIFSVFADQAITSQFGIDLPWLVYAMIGVVVIATLSHWD
FT                   ISVAAKVLGAVLVAEIVMLTLTATASLMHHPEGMSWTSLNPATALSTNGVAGGVVGLGL
FT                   LMAFWSWVGFESTAIYGEESKNPKKIVPQATMIAVIGIGVFYTFIAWGMIVGNGPTKAV
FT                   ELSSGPTPFDLIYAPTQQYLGQWAIVVFEWLMVGGSFACALAIHNSAARYLFAFGRDGL
FT                   LPRRLGAAHPKHASPYVASLAQSVFAAVVLIVCAISGSDPYAVLFVLVAILATLCLLTV
FT                   QTMSSIATVVYFHVKKQHPETANWWRTLAAPVIGGAGMVYVIYLMASNMSAAAGTASES
FT                   LFFKMIPYILLTLLFGSIAVALYLRKARPDLYARIGSTVFDDKPTD"
FT   gene            complement(648190..648927)
FT                   /locus_tag="Mvan_0606"
FT   CDS_pept        complement(648190..648927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0606"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; protein of
FT                   unknown function UPF0074; GntR domain protein;
FT                   Helix-turn-helix, type 11 domain protein; KEGG:
FT                   mmc:Mmcs_0508 GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11445"
FT                   /db_xref="GOA:A1T2P5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P5"
FT                   /protein_id="ABM11445.1"
FT                   /translation="MTAERPSALSPVRQIPAHELVVDQMRRALELGQFRPGDRLPTERE
FT                   LSEMLDVSRTTVRTAVAVLERDGLIAVRRGRGGGFTVQAPPVDPAEMRRELRRNKRAIR
FT                   DAFDYRIIVETGATRLAAERRRAIELADLRKLLVGMEAALDAALKDQSAQRTTEFQTLD
FT                   TAFHMGIAQAAQNDRLLDAVADARRRMWLPVGAIFGRLEPNANDYHESILEAIENRDPE
FT                   LAGSRMEAHINDTRNTLESWLKR"
FT   gene            649136..649867
FT                   /locus_tag="Mvan_0607"
FT   CDS_pept        649136..649867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0607"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   tma:TM1724 3-oxoacyl-(acyl carrier protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11446"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P6"
FT                   /protein_id="ABM11446.1"
FT                   /translation="MGNKVIVTGGAGVIGQAICRRLLQGGYVPVAADLKQAVDAVDFGQ
FT                   AGLQGTLSVAMDVTDRASVDEAVASTVDDGETLFGLVNCAGILRDSFLGELDEAKLDLM
FT                   FQVNIAGMARVTDAVAPLLTEGSAIVNVGSLTGHFGRFRGASVYGATKAGIAAYTRYVA
FT                   EELASRSVRVNNVAPGVIRAPMSPSMARVSGGEEVSASYAMLKRIGEPEEVAEAVEFLL
FT                   SPRASFITAQTLLVDGGVVAW"
FT   gene            649861..651147
FT                   /locus_tag="Mvan_0608"
FT   CDS_pept        649861..651147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0608"
FT                   /product="protein of unknown function DUF1116"
FT                   /note="PFAM: protein of unknown function DUF1116; KEGG:
FT                   mta:Moth_2121 protein of unknown function DUF1116"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11447"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P7"
FT                   /protein_id="ABM11447.1"
FT                   /translation="MVSVTDLGIDPAAGFTSVDEANATAFERLDAADPWVVDVAPARDV
FT                   LPGYRDNLVLTSGAPMAWPDYTGGQREALIGGALFEGLADSRDDAIAGFDSGRIEVGAC
FT                   QDHAAVGSLAGIYTASMPVFVVENRTHGNRGFCNFYEGKEPRRLNYGCYDEGVHERLLH
FT                   VNTVLAPVVGEAIRRRGGIALKPLIARALRMGDEVHSRNAAASILFNREIMPAILDMCD
FT                   DRVPGVRETMLHLAENDYFFLRLSMAAAKASADAMVVPGSTLISAMAFSCRGFAVKLAG
FT                   LGDTWFEGPPPIHQGKLFAGHTEDEITWMGGESPITETVGLGGFAQACALSLQEYQGGS
FT                   PEVMIERNLEMYSITHGENSTYRIPQFGFRGTPTGIDARKVLQTGVLPVMDVGLAGRDG
FT                   GQIGAGVIRAPRECFADALAEHDRRFGAR"
FT   gene            651144..651923
FT                   /locus_tag="Mvan_0609"
FT   CDS_pept        651144..651923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0609"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   cvi:CV1482 2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11448"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P8"
FT                   /protein_id="ABM11448.1"
FT                   /translation="MSAAVPPPGLPLTFSGGDALVTGAASGIGAAIARTLVSAGVRTIG
FT                   VDLRAPEPDPDHPAHLQPGVAVDVRDPDLTARLTEAGSAPENLAYLVNCAGVLDNTGFA
FT                   GVGREMWMRCLDINLVGAYNTIDALSPFLRNASPAAVVNITSIEAARVIALSNPDPTPQ
FT                   YAASKAGLQMLTQTAARALAADGVRVNSVSPGFVATPMAAAHGDTTDLPPALAPRVPAG
FT                   RFAEPADIANAVAFLLSDQAGYITGSDLRVDGGFQLT"
FT   gene            651920..652984
FT                   /locus_tag="Mvan_0610"
FT   CDS_pept        651920..652984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11449"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2P9"
FT                   /protein_id="ABM11449.1"
FT                   /translation="MTETNPTATVVAYEPSLGRPARAGSWDELAKGTFRVATEHLVAGD
FT                   WDAAAALVEIAVVEAEELRDVYERWPVSTRGWIESRGVTADLVDAATARLTVMIGERAM
FT                   AGIEAEWPQFVAAVDRAALACRAQLPDAAAAVETARAVWQGVHDRAVDRVSGLIDIAVS
FT                   TVGEHSLGELWDALMADWYDVHEQRYALSNQPWEASAHQLMVAIVDGFHAHLTGTGRQG
FT                   DMEIIDEPTRIGFRFAPCGSGGRSLDARITDGTPRAGAPFGFAVTTAPHDWAWNTVGIC
FT                   SYCVHCCQLNEVMPIDRLGYPTRVIDAPTWNADNPVTECTWWVYRDPADVPDHVYERVG
FT                   RSPDRRPTRRGDVK"
FT   gene            652981..654246
FT                   /locus_tag="Mvan_0611"
FT   CDS_pept        652981..654246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0611"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mxa:MXAN_5630 glutamine synthetase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11450"
FT                   /db_xref="GOA:A1T2Q0"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q0"
FT                   /protein_id="ABM11450.1"
FT                   /translation="MTVPMTQLEVPDYDLGIRGKLVRTEKTVDPTRLAFCTILYGLSVV
FT                   DEVSDTPVSNAGNGYPDARLVPDQSTRVALPWRPGTDAVIADMVGADGAPLAMSPRNSL
FT                   RSLVDRYAELDLEPVLGFEYEFWLFQDREDPRRPLGSTENAYSLSRIAESQSLATEFID
FT                   RMHAVGIEIEMFHTELGPGFFEFTMAPAPACQAADAAVRARQYLRDLCAERGLHASFMA
FT                   KPFGDKSGAGGHVHSSLNRNGKNIFADDHGWLSAEAGHYLAGLLAGMADTTAMLNPYVN
FT                   SFKRIDPEMFTPVHATYGHDDRSTACRLILNDAKSARVEHRRPGADASPYLVATALLAA
FT                   GFLGLQENLTLPGSDAVPAPLPGDLTAAIDAFENSPWLPDLVGKAFCASFAATRRAEAQ
FT                   RYAQWLKTTITSWELTRHLEHQ"
FT   gene            654243..655622
FT                   /locus_tag="Mvan_0612"
FT   CDS_pept        654243..655622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0612"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   rxy:Rxyl_3196 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11451"
FT                   /db_xref="GOA:A1T2Q1"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q1"
FT                   /protein_id="ABM11451.1"
FT                   /translation="MNDESTRLDLDQFEKLAAAGEINTVVCATPDPYGRLVGKRLTVPA
FT                   FRSLGLSGAGINASSFIFAVDLEMNPLDLPVSNAANGWADIRLIPDLTTLRRVPWEPNV
FT                   ALVICDAYESHSDTMLSVAPRTILRRQIERARQQGLTFKFASELEFFLSATPPRQAWEL
FT                   GYQDLKMLSDYRSDYQMIQSSRDDWFIERIRNQMPGFGVSIESSKPEWGLGQQEVTLDY
FT                   CDTLEMADRHVLFKYGVKQLAHAADLTVTFMAKPKIDDVGSSCHLHVSMWSTDGEPLSW
FT                   STEPGGGMSATFGSFVAGQLTHATDIALLFAPTVNSYKRFQPDQFAGTAIALGNDNRSC
FT                   AFRLVGGGPSFRVENRIPGGDVNPYYAYSATIAAGLAGIEHELPAPGIFDGNAWNGQDV
FT                   PIVPTSMHEALRLFAECKMARTAFGDEVFDHLLASSQSELVAFDSHTVTDWEKCRYYER
FT                   V"
FT   gene            655679..656617
FT                   /locus_tag="Mvan_0613"
FT   CDS_pept        655679..656617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0613"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: reu:Reut_A1537 lipolytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11452"
FT                   /db_xref="GOA:A1T2Q2"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q2"
FT                   /protein_id="ABM11452.1"
FT                   /translation="MPIDPIAQKMLDDAKKSGRPNAHLLPVPTARQNFEDTFGALAKPQ
FT                   IHRVTDVEIPTRDGQTIPGRLYLPAEEAAALPLTVYYHGGGWLLGSIDSHDVATRLLAN
FT                   ASGSAVLSVGYRRGPESRFPTAVDDAVDALIWAAGPASGLGVDTTRLAVAGDSAGGNLA
FT                   GAVALHVRHTGAPALRHQLLVYPVTTTDLEIGFDDEYQGVMLERDEMQWHQDNYLPSPE
FT                   AATDARVSILGADLTGVPAATVILAECDPIRPQGELYAKALEAAGVPTATHLTPGMVHG
FT                   FFGLDEVFPTATEAMTFAGKQLSEALAVVDR"
FT   gene            656614..657342
FT                   /locus_tag="Mvan_0614"
FT   CDS_pept        656614..657342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0614"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG: sco:SCO1611
FT                   putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11453"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q3"
FT                   /protein_id="ABM11453.1"
FT                   /translation="MTRTALVTGAGGGIGAATVARLAADGVHVIATDVAETIPALAADV
FT                   DYVSFDLLTGDPQTLLSLIPGGALDYLVNAAGVALFDRDGSTLDVSESVWELTLGVNLH
FT                   GMRRLTVAAVPYLRAGQGKSIVNVASIAGLRNMDSPLDAYQVSKAAVVSLTRSLALQLA
FT                   PEGIRVNTVCPGAILTPMIEPLYLENPARRTNMEQRTPLGRMGFPVDIANAIRFLLSDE
FT                   ASFITATDLVVDGGWIAQTV"
FT   sig_peptide     656614..656685
FT                   /locus_tag="Mvan_0614"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.487 at
FT                   residue 24"
FT   gene            657454..658923
FT                   /locus_tag="Mvan_0615"
FT   CDS_pept        657454..658923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0615"
FT                   /product="Cyclohexanone monooxygenase"
FT                   /EC_number="1.14.13.22"
FT                   /note="KEGG: mmc:Mmcs_2024 cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11454"
FT                   /db_xref="GOA:A1T2Q4"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q4"
FT                   /protein_id="ABM11454.1"
FT                   /translation="MTTPTGHAQRVAIIGAGFSGLAAAIALRQRGIEDFVIFEQSEGIG
FT                   GTWWFNRYPGAEVDLESHVYSFSYARSDWTRTHVGWQELQEYLERVAYDWDLPRRIRFN
FT                   EKVVDVRWSDEKQTHTVTTSSGADHGEFTAVISAVGFLNIPLVPPFAREDNDFQGAMCH
FT                   TSAWIDGLDLTGKSVGVVGTGSSAVQVVTEAEKVAGDVTIFQLEPNWIVPKHSRAFTPL
FT                   ERRLNKLRPVYAWRRWALYFDYDRRQLRSSHARSTGRFNRRRHQASLEFMRRELAGRPD
FT                   LLEKVTPTFAFEGKRTVCSDTYYASLRSPKVTLVPHALKGLTRTGAVDANGDEHDLDVI
FT                   VLATGFDAANYLGNYQVYGQGGRELHSAWQGEPEAFLGMMVPGFPNFFIMYGPNTNSVP
FT                   LVHFYEAQADFAASLIKRAAKTGHRVIDVRRSAFVIYNDWLQAQLAKTVWARTSNYFRA
FT                   GTGKVVSQWPFGATPYILATKLLRRIAVRLT"
FT   gene            658949..659686
FT                   /locus_tag="Mvan_0616"
FT   CDS_pept        658949..659686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0616"
FT                   /product="peptidase C26"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: sth:STH2933 putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11455"
FT                   /db_xref="GOA:A1T2Q5"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q5"
FT                   /protein_id="ABM11455.1"
FT                   /translation="MTAKPLIAVTLNARELDWMLHWRKMFDGLQTVGAIPMAIECGSTV
FT                   LDIGDTVRRLDGLVISGGGDVDPTRWGGDPGDPTLAGVNPVRDHNEIAAFEAAWNLGIP
FT                   TLAICRGAQLVTAARGGALYADLPRDFPSAVKHRLGEEALVETAHDVELVPGSRIAEWS
FT                   QAGPRMPVNSQHHQGVRTLAAGFTAVAHAPDGLVEAFEAPERPFTAVQWHPEVNWATCR
FT                   HSHGILDGFVQSCRARMAAVDAA"
FT   gene            complement(659688..660923)
FT                   /locus_tag="Mvan_0617"
FT   CDS_pept        complement(659688..660923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0617"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: mmc:Mmcs_0440
FT                   YibE/F-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11456"
FT                   /db_xref="GOA:A1T2Q6"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q6"
FT                   /protein_id="ABM11456.1"
FT                   /translation="MTHTHSHSHSLNGPSPLGPLAARIVVGLLVAIGVATLIGAALLWP
FT                   SGGKADIPLPFQNAAGGAVTTESGHVLSSSAAVCGSPSVGAVLTSAPVPAEGEGAACVQ
FT                   ALVAIDSGPNQGANTLLEFSGGPGQPSLAVGDDIRVSRQVDDVGSTTYAFYDFERAWPL
FT                   TVLAAVFAIVIVAVARWRGLRALVGIVIAFGVLVVFLLPALRDGAPAVPVSLVASAAIL
FT                   YAVIYLAHGVSLRTSAALLGTLASLLLAAVLSWAAIELAHLTGLSEDQNNTVAAYLGNV
FT                   SITGLLLAGFIIGSLGVLNDVTVTQASTAFELAALGDGASRRAVFVGAMRVGRDHIAST
FT                   VYTLVLAYAGSALPLLLLFSVANRSLGDVLTSESVAIEIARSAVGGIALALSVPLTTGI
FT                   AVLLATPRHTSH"
FT   sig_peptide     complement(660771..660923)
FT                   /locus_tag="Mvan_0617"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probabilty 0.781) with cleavage site probability 0.475 at
FT                   residue 51"
FT   gene            complement(661194..662474)
FT                   /locus_tag="Mvan_0618"
FT   CDS_pept        complement(661194..662474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mvan_0618"
FT                   /product="L-aspartate aminotransferase apoenzyme"
FT                   /EC_number="2.6.1.1"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mbo:Mb0344c probable aspartate aminotransferase AspC
FT                   (transaminase A) (ASPAT)"
FT                   /db_xref="EnsemblGenomes-Gn:Mvan_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABM11457"
FT                   /db_xref="GOA:A1T2Q7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1T2Q7"
FT                   /protein_id="ABM11457.1"
FT                   /translation="MSLVSTHQAHWHTGSGQHARQREFTQSSKLQDVLYEIRGPIHEHA
FT                   SRLEAEGHRIFKLNIGNPAPFGFEAPDVIMRDIIAALPYAQGYSDSKGIVSARRAVFTR
FT                   YELVEGFPKFDIDDVFLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGT
FT                   PVHYLCDETQGWNPDIADLESKITERTKALVVINPNNPTGAVYSRETLEQMVELARKHQ
FT                   LLLLADEIYDKILYDDAKHISLATLAPDLLTLTFNGLSKAYRVAGYRSG