(data stored in ACNUC1104 zone)

EMBL: CP000512

ID   CP000512; SV 1; circular; genomic DNA; STD; PRO; 5352772 BP.
XX
AC   CP000512; AASX01000000-AASX01000076;
XX
PR   Project:PRJNA15708;
XX
DT   05-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Acidovorax citrulli AAC00-1, complete genome.
XX
KW   .
XX
OS   Acidovorax citrulli AAC00-1
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Acidovorax.
XX
RN   [1]
RP   1-5352772
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Kiss H., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   "Complete sequence of Acidovorax avenae subsp. citrulli AAC00-1";
RL   Unpublished.
XX
RN   [2]
RP   1-5352772
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Dalin E., Tice H., Pitluck S., Kiss H., Brettin T.,
RA   Bruce D., Han C., Tapia R., Gilna P., Schmutz J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Kim E., Stahl D., Richardson P.;
RT   ;
RL   Submitted (13-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 00eb241efff3a8b72cf3244a1499b184.
DR   BioSample; SAMN02598334.
DR   EnsemblGenomes-Gn; Aave_R0001.
DR   EnsemblGenomes-Gn; Aave_R0002.
DR   EnsemblGenomes-Gn; Aave_R0004.
DR   EnsemblGenomes-Gn; Aave_R0005.
DR   EnsemblGenomes-Gn; Aave_R0006.
DR   EnsemblGenomes-Gn; Aave_R0007.
DR   EnsemblGenomes-Gn; Aave_R0008.
DR   EnsemblGenomes-Gn; Aave_R0009.
DR   EnsemblGenomes-Gn; Aave_R0010.
DR   EnsemblGenomes-Gn; Aave_R0011.
DR   EnsemblGenomes-Gn; Aave_R0012.
DR   EnsemblGenomes-Gn; Aave_R0013.
DR   EnsemblGenomes-Gn; Aave_R0014.
DR   EnsemblGenomes-Gn; Aave_R0015.
DR   EnsemblGenomes-Gn; Aave_R0016.
DR   EnsemblGenomes-Gn; Aave_R0017.
DR   EnsemblGenomes-Gn; Aave_R0018.
DR   EnsemblGenomes-Gn; Aave_R0019.
DR   EnsemblGenomes-Gn; Aave_R0020.
DR   EnsemblGenomes-Gn; Aave_R0021.
DR   EnsemblGenomes-Gn; Aave_R0022.
DR   EnsemblGenomes-Gn; Aave_R0023.
DR   EnsemblGenomes-Gn; Aave_R0024.
DR   EnsemblGenomes-Gn; Aave_R0025.
DR   EnsemblGenomes-Gn; Aave_R0026.
DR   EnsemblGenomes-Gn; Aave_R0027.
DR   EnsemblGenomes-Gn; Aave_R0028.
DR   EnsemblGenomes-Gn; Aave_R0029.
DR   EnsemblGenomes-Gn; Aave_R0030.
DR   EnsemblGenomes-Gn; Aave_R0031.
DR   EnsemblGenomes-Gn; Aave_R0032.
DR   EnsemblGenomes-Gn; Aave_R0033.
DR   EnsemblGenomes-Gn; Aave_R0035.
DR   EnsemblGenomes-Gn; Aave_R0036.
DR   EnsemblGenomes-Gn; Aave_R0037.
DR   EnsemblGenomes-Gn; Aave_R0038.
DR   EnsemblGenomes-Gn; Aave_R0039.
DR   EnsemblGenomes-Gn; Aave_R0040.
DR   EnsemblGenomes-Gn; Aave_R0041.
DR   EnsemblGenomes-Gn; Aave_R0042.
DR   EnsemblGenomes-Gn; Aave_R0043.
DR   EnsemblGenomes-Gn; Aave_R0044.
DR   EnsemblGenomes-Gn; Aave_R0045.
DR   EnsemblGenomes-Gn; Aave_R0046.
DR   EnsemblGenomes-Gn; Aave_R0047.
DR   EnsemblGenomes-Gn; Aave_R0048.
DR   EnsemblGenomes-Gn; Aave_R0049.
DR   EnsemblGenomes-Gn; Aave_R0050.
DR   EnsemblGenomes-Gn; Aave_R0051.
DR   EnsemblGenomes-Gn; Aave_R0052.
DR   EnsemblGenomes-Gn; Aave_R0053.
DR   EnsemblGenomes-Gn; Aave_R0054.
DR   EnsemblGenomes-Gn; Aave_R0055.
DR   EnsemblGenomes-Gn; Aave_R0056.
DR   EnsemblGenomes-Gn; Aave_R0057.
DR   EnsemblGenomes-Gn; Aave_R0058.
DR   EnsemblGenomes-Gn; Aave_R0059.
DR   EnsemblGenomes-Gn; Aave_R0060.
DR   EnsemblGenomes-Gn; Aave_R0061.
DR   EnsemblGenomes-Gn; Aave_R0062.
DR   EnsemblGenomes-Gn; Aave_R0063.
DR   EnsemblGenomes-Gn; Aave_R0064.
DR   EnsemblGenomes-Gn; Aave_R0065.
DR   EnsemblGenomes-Gn; EBG00001205273.
DR   EnsemblGenomes-Gn; EBG00001205274.
DR   EnsemblGenomes-Gn; EBG00001205275.
DR   EnsemblGenomes-Gn; EBG00001205276.
DR   EnsemblGenomes-Gn; EBG00001205277.
DR   EnsemblGenomes-Gn; EBG00001205278.
DR   EnsemblGenomes-Gn; EBG00001205279.
DR   EnsemblGenomes-Gn; EBG00001205280.
DR   EnsemblGenomes-Gn; EBG00001205281.
DR   EnsemblGenomes-Gn; EBG00001205282.
DR   EnsemblGenomes-Gn; EBG00001205283.
DR   EnsemblGenomes-Gn; EBG00001205284.
DR   EnsemblGenomes-Gn; EBG00001205285.
DR   EnsemblGenomes-Gn; EBG00001205286.
DR   EnsemblGenomes-Gn; EBG00001205287.
DR   EnsemblGenomes-Gn; EBG00001205288.
DR   EnsemblGenomes-Gn; EBG00001205289.
DR   EnsemblGenomes-Gn; EBG00001205290.
DR   EnsemblGenomes-Gn; EBG00001205291.
DR   EnsemblGenomes-Gn; EBG00001205292.
DR   EnsemblGenomes-Gn; EBG00001205293.
DR   EnsemblGenomes-Gn; EBG00001205294.
DR   EnsemblGenomes-Gn; EBG00001205295.
DR   EnsemblGenomes-Gn; EBG00001205296.
DR   EnsemblGenomes-Gn; EBG00001205297.
DR   EnsemblGenomes-Gn; EBG00001205298.
DR   EnsemblGenomes-Gn; EBG00001205299.
DR   EnsemblGenomes-Gn; EBG00001205300.
DR   EnsemblGenomes-Gn; EBG00001205301.
DR   EnsemblGenomes-Gn; EBG00001205302.
DR   EnsemblGenomes-Gn; EBG00001205303.
DR   EnsemblGenomes-Gn; EBG00001205304.
DR   EnsemblGenomes-Gn; EBG00001205305.
DR   EnsemblGenomes-Gn; EBG00001205306.
DR   EnsemblGenomes-Gn; EBG00001205307.
DR   EnsemblGenomes-Gn; EBG00001205308.
DR   EnsemblGenomes-Gn; EBG00001205309.
DR   EnsemblGenomes-Gn; EBG00001205310.
DR   EnsemblGenomes-Gn; EBG00001205311.
DR   EnsemblGenomes-Gn; EBG00001205312.
DR   EnsemblGenomes-Gn; EBG00001205313.
DR   EnsemblGenomes-Gn; EBG00001205314.
DR   EnsemblGenomes-Gn; EBG00001205315.
DR   EnsemblGenomes-Gn; EBG00001205316.
DR   EnsemblGenomes-Gn; EBG00001205317.
DR   EnsemblGenomes-Gn; EBG00001205318.
DR   EnsemblGenomes-Gn; EBG00001205319.
DR   EnsemblGenomes-Gn; EBG00001205320.
DR   EnsemblGenomes-Gn; EBG00001205321.
DR   EnsemblGenomes-Gn; EBG00001205322.
DR   EnsemblGenomes-Gn; EBG00001205323.
DR   EnsemblGenomes-Gn; EBG00001205324.
DR   EnsemblGenomes-Gn; EBG00001205325.
DR   EnsemblGenomes-Gn; EBG00001205326.
DR   EnsemblGenomes-Gn; EBG00001205327.
DR   EnsemblGenomes-Gn; EBG00001205328.
DR   EnsemblGenomes-Gn; EBG00001205329.
DR   EnsemblGenomes-Gn; EBG00001205330.
DR   EnsemblGenomes-Gn; EBG00001205331.
DR   EnsemblGenomes-Gn; EBG00001205332.
DR   EnsemblGenomes-Gn; EBG00001205333.
DR   EnsemblGenomes-Gn; EBG00001205334.
DR   EnsemblGenomes-Gn; EBG00001205335.
DR   EnsemblGenomes-Gn; EBG00001205336.
DR   EnsemblGenomes-Gn; EBG00001205337.
DR   EnsemblGenomes-Gn; EBG00001205338.
DR   EnsemblGenomes-Gn; EBG00001205339.
DR   EnsemblGenomes-Gn; EBG00001205340.
DR   EnsemblGenomes-Gn; EBG00001205341.
DR   EnsemblGenomes-Tr; Aave_R0001-1.
DR   EnsemblGenomes-Tr; Aave_R0002-1.
DR   EnsemblGenomes-Tr; Aave_R0004-1.
DR   EnsemblGenomes-Tr; Aave_R0005-1.
DR   EnsemblGenomes-Tr; Aave_R0006-1.
DR   EnsemblGenomes-Tr; Aave_R0007-1.
DR   EnsemblGenomes-Tr; Aave_R0008-1.
DR   EnsemblGenomes-Tr; Aave_R0009-1.
DR   EnsemblGenomes-Tr; Aave_R0010-1.
DR   EnsemblGenomes-Tr; Aave_R0011-1.
DR   EnsemblGenomes-Tr; Aave_R0012-1.
DR   EnsemblGenomes-Tr; Aave_R0013-1.
DR   EnsemblGenomes-Tr; Aave_R0014-1.
DR   EnsemblGenomes-Tr; Aave_R0015-1.
DR   EnsemblGenomes-Tr; Aave_R0016-1.
DR   EnsemblGenomes-Tr; Aave_R0017-1.
DR   EnsemblGenomes-Tr; Aave_R0018-1.
DR   EnsemblGenomes-Tr; Aave_R0019-1.
DR   EnsemblGenomes-Tr; Aave_R0020-1.
DR   EnsemblGenomes-Tr; Aave_R0021-1.
DR   EnsemblGenomes-Tr; Aave_R0022-1.
DR   EnsemblGenomes-Tr; Aave_R0023-1.
DR   EnsemblGenomes-Tr; Aave_R0024-1.
DR   EnsemblGenomes-Tr; Aave_R0025-1.
DR   EnsemblGenomes-Tr; Aave_R0026-1.
DR   EnsemblGenomes-Tr; Aave_R0027-1.
DR   EnsemblGenomes-Tr; Aave_R0028-1.
DR   EnsemblGenomes-Tr; Aave_R0029-1.
DR   EnsemblGenomes-Tr; Aave_R0030-1.
DR   EnsemblGenomes-Tr; Aave_R0031-1.
DR   EnsemblGenomes-Tr; Aave_R0032-1.
DR   EnsemblGenomes-Tr; Aave_R0033-1.
DR   EnsemblGenomes-Tr; Aave_R0035-1.
DR   EnsemblGenomes-Tr; Aave_R0036-1.
DR   EnsemblGenomes-Tr; Aave_R0037-1.
DR   EnsemblGenomes-Tr; Aave_R0038-1.
DR   EnsemblGenomes-Tr; Aave_R0039-1.
DR   EnsemblGenomes-Tr; Aave_R0040-1.
DR   EnsemblGenomes-Tr; Aave_R0041-1.
DR   EnsemblGenomes-Tr; Aave_R0042-1.
DR   EnsemblGenomes-Tr; Aave_R0043-1.
DR   EnsemblGenomes-Tr; Aave_R0044-1.
DR   EnsemblGenomes-Tr; Aave_R0045-1.
DR   EnsemblGenomes-Tr; Aave_R0046-1.
DR   EnsemblGenomes-Tr; Aave_R0047-1.
DR   EnsemblGenomes-Tr; Aave_R0048-1.
DR   EnsemblGenomes-Tr; Aave_R0049-1.
DR   EnsemblGenomes-Tr; Aave_R0050-1.
DR   EnsemblGenomes-Tr; Aave_R0051-1.
DR   EnsemblGenomes-Tr; Aave_R0052-1.
DR   EnsemblGenomes-Tr; Aave_R0053-1.
DR   EnsemblGenomes-Tr; Aave_R0054-1.
DR   EnsemblGenomes-Tr; Aave_R0055-1.
DR   EnsemblGenomes-Tr; Aave_R0056-1.
DR   EnsemblGenomes-Tr; Aave_R0057-1.
DR   EnsemblGenomes-Tr; Aave_R0058-1.
DR   EnsemblGenomes-Tr; Aave_R0059-1.
DR   EnsemblGenomes-Tr; Aave_R0060-1.
DR   EnsemblGenomes-Tr; Aave_R0061-1.
DR   EnsemblGenomes-Tr; Aave_R0062-1.
DR   EnsemblGenomes-Tr; Aave_R0063-1.
DR   EnsemblGenomes-Tr; Aave_R0064-1.
DR   EnsemblGenomes-Tr; Aave_R0065-1.
DR   EnsemblGenomes-Tr; EBT00001576139.
DR   EnsemblGenomes-Tr; EBT00001576140.
DR   EnsemblGenomes-Tr; EBT00001576141.
DR   EnsemblGenomes-Tr; EBT00001576142.
DR   EnsemblGenomes-Tr; EBT00001576143.
DR   EnsemblGenomes-Tr; EBT00001576144.
DR   EnsemblGenomes-Tr; EBT00001576145.
DR   EnsemblGenomes-Tr; EBT00001576146.
DR   EnsemblGenomes-Tr; EBT00001576147.
DR   EnsemblGenomes-Tr; EBT00001576148.
DR   EnsemblGenomes-Tr; EBT00001576149.
DR   EnsemblGenomes-Tr; EBT00001576150.
DR   EnsemblGenomes-Tr; EBT00001576151.
DR   EnsemblGenomes-Tr; EBT00001576152.
DR   EnsemblGenomes-Tr; EBT00001576153.
DR   EnsemblGenomes-Tr; EBT00001576154.
DR   EnsemblGenomes-Tr; EBT00001576155.
DR   EnsemblGenomes-Tr; EBT00001576156.
DR   EnsemblGenomes-Tr; EBT00001576157.
DR   EnsemblGenomes-Tr; EBT00001576158.
DR   EnsemblGenomes-Tr; EBT00001576159.
DR   EnsemblGenomes-Tr; EBT00001576160.
DR   EnsemblGenomes-Tr; EBT00001576161.
DR   EnsemblGenomes-Tr; EBT00001576162.
DR   EnsemblGenomes-Tr; EBT00001576163.
DR   EnsemblGenomes-Tr; EBT00001576164.
DR   EnsemblGenomes-Tr; EBT00001576165.
DR   EnsemblGenomes-Tr; EBT00001576166.
DR   EnsemblGenomes-Tr; EBT00001576167.
DR   EnsemblGenomes-Tr; EBT00001576168.
DR   EnsemblGenomes-Tr; EBT00001576169.
DR   EnsemblGenomes-Tr; EBT00001576170.
DR   EnsemblGenomes-Tr; EBT00001576171.
DR   EnsemblGenomes-Tr; EBT00001576172.
DR   EnsemblGenomes-Tr; EBT00001576173.
DR   EnsemblGenomes-Tr; EBT00001576174.
DR   EnsemblGenomes-Tr; EBT00001576175.
DR   EnsemblGenomes-Tr; EBT00001576176.
DR   EnsemblGenomes-Tr; EBT00001576177.
DR   EnsemblGenomes-Tr; EBT00001576178.
DR   EnsemblGenomes-Tr; EBT00001576179.
DR   EnsemblGenomes-Tr; EBT00001576180.
DR   EnsemblGenomes-Tr; EBT00001576181.
DR   EnsemblGenomes-Tr; EBT00001576182.
DR   EnsemblGenomes-Tr; EBT00001576183.
DR   EnsemblGenomes-Tr; EBT00001576184.
DR   EnsemblGenomes-Tr; EBT00001576185.
DR   EnsemblGenomes-Tr; EBT00001576186.
DR   EnsemblGenomes-Tr; EBT00001576187.
DR   EnsemblGenomes-Tr; EBT00001576188.
DR   EnsemblGenomes-Tr; EBT00001576189.
DR   EnsemblGenomes-Tr; EBT00001576190.
DR   EnsemblGenomes-Tr; EBT00001576191.
DR   EnsemblGenomes-Tr; EBT00001576192.
DR   EnsemblGenomes-Tr; EBT00001576193.
DR   EnsemblGenomes-Tr; EBT00001576194.
DR   EnsemblGenomes-Tr; EBT00001576195.
DR   EnsemblGenomes-Tr; EBT00001576196.
DR   EnsemblGenomes-Tr; EBT00001576197.
DR   EnsemblGenomes-Tr; EBT00001576198.
DR   EnsemblGenomes-Tr; EBT00001576199.
DR   EnsemblGenomes-Tr; EBT00001576200.
DR   EnsemblGenomes-Tr; EBT00001576201.
DR   EnsemblGenomes-Tr; EBT00001576202.
DR   EnsemblGenomes-Tr; EBT00001576203.
DR   EnsemblGenomes-Tr; EBT00001576204.
DR   EnsemblGenomes-Tr; EBT00001576205.
DR   EnsemblGenomes-Tr; EBT00001576206.
DR   EnsemblGenomes-Tr; EBT00001576207.
DR   EuropePMC; PMC4807269; 26823466.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000512.
DR   SILVA-SSU; CP000512.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4001427
CC   Source DNA and bacteria available from David Stahl
CC   (dastahl@u.washington.edu)
CC   Contacts: David Stahl (dastahl@u.washington.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5352772
FT                   /organism="Acidovorax citrulli AAC00-1"
FT                   /strain="AAC00-1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:397945"
FT   gene            71..1498
FT                   /locus_tag="Aave_0001"
FT   CDS_pept        71..1498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rfr:Rfer_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30619"
FT                   /db_xref="GOA:A1TI31"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI31"
FT                   /protein_id="ABM30619.1"
FT                   /translation="MTEEPSRSPDFDTDTDADPGQGLWQACVEQLAQDLPEQQFNTWIK
FT                   PLVAQVAPDFSKVTLLVANRFKLDWIRAQYAGRITALLEGLYGQPVTLELALAQRESVT
FT                   RTVVRPVVQQPAAPAETPIGSAPSDEPAAAPFRSRLNPALTFETLVEGTANRMARSAAM
FT                   HVAGSPGHLYNPLFIYGGVGLGKTHLVHAVGNRLLQDKPDAKVLYIHAEQFVSDVVKAY
FT                   QRRTFDEFKAHYHSLDLLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPK
FT                   GLANIHERLVSRFDSGLTVTIEPPELEMRVAILINKARAESAEMPEEVAFFVAKNVRSN
FT                   VRELEGALRKILAYSRFNQKEVSIQLAREALRDLLSIQNRQISVENIQKTVADYYKIKV
FT                   ADMYSKKRPASIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIAGERQQ
FT                   LTELNQQLHVLEQTLKG"
FT   gene            1658..2776
FT                   /locus_tag="Aave_0002"
FT   CDS_pept        1658..2776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rfr:Rfer_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30620"
FT                   /db_xref="GOA:A1TI32"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI32"
FT                   /protein_id="ABM30620.1"
FT                   /translation="MIVLKATQDKVLAVLQSVAGIVERRHTLPILANVLIRKTGNALQL
FT                   TTSDLEIQIRTTAELGGDTGDFTTTVGARKLIDILKTMPADQTVSLESQQSKLVLKGGK
FT                   SRFTLQSLPAEDFPLVQESAAFGPAFSVPQKVLKDLLGQVSFAMAVQDIRYYLNGILFV
FT                   AEGNTLSLVATDGHRLAFASATLDVEVPKQEVILPRKTVLELQRLLSDAGGENQPHIEM
FT                   QFANNQAKFTFGGMEFVTKLVEGKFPDYNRVIPKNHKNSVTLGRAPLLASLQRTAIMTS
FT                   DKFKGVRLNIEPGTLRVASNNAEQEEAVDELDIDYGGDTIEIGFNVTYLIDALANMGQD
FT                   MVRVDLSDGNSSALMTIPENDNFKYVVMPMRI"
FT   gene            2850..5483
FT                   /locus_tag="Aave_0003"
FT   CDS_pept        2850..5483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0003"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: pol:Bpro_0003 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase, type IIA, subunit B,
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30621"
FT                   /db_xref="GOA:A1TI33"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI33"
FT                   /protein_id="ABM30621.1"
FT                   /translation="MTAENTLPEPTLPTGDSQAQSVAAPDSVPAQAAAPSDGYGEGAIQ
FT                   ILEGLEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHSDNSIS
FT                   VVDNGRGIPTGVKMDDKHEPKRSAAEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNA
FT                   LSKMLRLTVRRDGKVHLLEFSQGFVQNRILETVNGVEVSPMRVTGETDKRGTEVHFLPD
FT                   TEIFKENNDFHYEILAKRLRELSFLNNGVRIRLKDERTGKEDDFSGAGGVMGFVQFINA
FT                   SKKVLHPNAFHATGSRPAETYGGIPGTEIGVEVAMQWNDGFNESVLCFTNNIPQRDGGT
FT                   HLTGLRAAMTRVIGKYIEQNELAKKAKVEVSGDDMREGLCCVLSVKVPEPKFSSQTKDK
FT                   LVSSEVRAPVEDIVAKALTDYLEERPNDAKILCGKIVEAARAREAARKAREMTRRKGVL
FT                   DGMGLPGKLADCQEKDPALSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKAR
FT                   YEKLLTSNEILTLITALGTGIGKASADGTGKGGADDFNVDKLRYHRIIIMTDADVDGAH
FT                   IRTLLLTFFYRQMPELVERGHIYIAQPPLYKVKNGKEELYLKDGPALDTFLLRVALRDA
FT                   SVTTGGEQARTLDGETLSTLAQKHQVAEAVIERLSAFMDREALRAIADGVALNLDTVED
FT                   AEASAVALQAKLRELTTTGVPAEVAGEFDARTDKPVLRISRRHHGNIKSSIITQDFVHG
FT                   ADYAALAEAAHTFRGLLGEGAKVLRGEGERQREEKVSDFRQAMAWLIKEAERTTSRQRY
FT                   KGLGEMNPEQLWETTMDPEVRRLLRVQIEDAIEADRVFTMLMGDEVEPRRDFIETNALR
FT                   AGNIDV"
FT   gene            complement(5603..7309)
FT                   /locus_tag="Aave_0004"
FT   CDS_pept        complement(5603..7309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0004"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: pca:Pcar_2730
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30622"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI34"
FT                   /protein_id="ABM30622.1"
FT                   /translation="MNPTALRAMLESLRSLPREQAVVEFKSNLADPEKIGAYISGLANT
FT                   AALQGRDRAWLVWGVEDGSHRVLGTVFDPFGQKIGNQSLQMWLQVMTQPRADFAFHELD
FT                   CDGLRVVMLEIHSARAAPMAFQHTRYIRVDSHLVKLADYPSHEARLWNALGTSEDWTGV
FT                   VVPEATLDDLDPQAVAAARVRYAEYLVRGEPDASKHEAIRTEVAALTVPTLLNKARVTK
FT                   QGRVTRAALLLLGKDESSHFLAPADAKMTWVLRDAGNDTVTSQPFGVPFLLATEQLCAR
FT                   IRNVTLDHMPDGSLFPTPVPQYDNWVLREALHNCVAHQDYGLGGKINVVEHPDRLVFSN
FT                   LGQFIPESVAWMLEHQSPPEHYRNQWLVDAMIRLRMIEQAGSGIRRMFTTQRQRLFPLP
FT                   DYEFGQTAQGFPRVELTLQGRMLDSKFARVLMARSDLGLGQVLLLDRVQKGLTLSPSEA
FT                   RSLRDLGLIEGRAPGYFISAKMADALGQKAKYIHQRGLDDRYYQKLVLDYLQQYGQATR
FT                   TDLDALLLRKLPDVLTDVQKANKVKNLMQSMKRAGLIRPHGARSAAVWRLC"
FT   gene            complement(7309..7668)
FT                   /locus_tag="Aave_0005"
FT   CDS_pept        complement(7309..7668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0005"
FT                   /product="putative type I restriction enzyme, R subunit"
FT                   /note="KEGG: ava:Ava_3273 putative type I restriction
FT                   enzyme, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30623"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI35"
FT                   /protein_id="ABM30623.1"
FT                   /translation="MDKKNWSETDVCEKRISPAIACAGWDLITQVLREYTLRAGRVVVR
FT                   GNTAFRDKNSILRADYVLFHKPKVPLAVVGIVTRVTALRRLCADLRQRLAKRQSVQARL
FT                   AEALVETASFSSEPC"
FT   gene            complement(7754..8437)
FT                   /pseudo
FT                   /locus_tag="Aave_0006"
FT   gene            complement(8660..9289)
FT                   /locus_tag="Aave_0007"
FT   CDS_pept        complement(8660..9289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0007"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: lpp:plpp0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30624"
FT                   /db_xref="GOA:A1TI36"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI36"
FT                   /protein_id="ABM30624.1"
FT                   /translation="MSNTSSLMDLLFPAARQRVLAALLLQPQQTFHLRELARLTGSHAG
FT                   TLAREVDKLTATGLLLRSQQGNQVRYQANTSHPLFSDLSSIFRKTHGVVPALRDALAPL
FT                   ADRIRIALVFGSVARGTPSPGSDVDLLVLGDVGFVELAQVIFPLHAALGREVNPVLYTA
FT                   EEFATRARSGDAFARDILAKPKLFIQGGADEFAELAGDRAAAGPPA"
FT   gene            9395..9823
FT                   /locus_tag="Aave_0008"
FT   CDS_pept        9395..9823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0008"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   shm:Shewmr7_3669 protein of unknown function UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30625"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI37"
FT                   /protein_id="ABM30625.1"
FT                   /translation="MRSPIAIVDVDNPATWTRYRAGLCATCAANCCTMPLEVQLSDLVR
FT                   LGLVDAFEAEHEEPRHIAKRLQKARLIDHFNHKNVVFTMARRASGDCHFLDAATRRCTV
FT                   YEVRPDTCRLHPQKKSPRPGWCAYGSATQGQDGGARQR"
FT   gene            9996..10433
FT                   /locus_tag="Aave_0009"
FT   CDS_pept        9996..10433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0009"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rru:Rru_A0580
FT                   OsmC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30626"
FT                   /db_xref="GOA:A1TI38"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI38"
FT                   /protein_id="ABM30626.1"
FT                   /translation="MSEKTASVHWQGAGKTGQGQISTETGALKSYPYGFGSRFGDDRTG
FT                   TNPEEIVGAAHAACFTMAFAFACEKAGIATETLDTTARVRLAKEGEGFKIDRIALTLKA
FT                   KVPGIDDAKFQEIAAGAKANCPLSKALAGVPEITLDAQLVG"
FT   gene            10504..10764
FT                   /locus_tag="Aave_0010"
FT   CDS_pept        10504..10764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0010"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: rfr:Rfer_4119 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30627"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI39"
FT                   /protein_id="ABM30627.1"
FT                   /translation="MPPSTPKALPAIDPDRCTGCGRCVAVCAPHVLSLDTGGSPGREGA
FT                   PPLPWGPKRSVLRDPAGCTGCALCAVHCPFDAIRMERTGPR"
FT   gene            11029..12429
FT                   /locus_tag="Aave_0011"
FT   CDS_pept        11029..12429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0011"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase; homoserine dehydrogenase, NAD-binding; KEGG:
FT                   bbr:BB1926 homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30628"
FT                   /db_xref="GOA:A1TI40"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI40"
FT                   /protein_id="ABM30628.1"
FT                   /translation="MFNDPQWRPLPAAAPASGAGLRPLRVGMIGIGTVGLGTWQVLARN
FT                   QAQIAARAGRGIEIVAVAARDLARARRVLGDGAAGVELTGDPLALATHPGIDVLLEVAG
FT                   GTDAPREWVTAAMGLGKPVVTANKALLAVHGNALFAQAESRGVPLAYEAAVAGGIPIVK
FT                   ALREGAAANRVEWLAGIVNGTSNYILSRMRQAGLAFGDALAEAQALGYAEADPTFDVDG
FT                   IDAAHKTALLAANAFGMPVRFDRAHVEGIRGVDALDVAAAREWGHAVKLLGIARGQGES
FT                   VELRVHPALVPATHLLAQVEGAMNAVMLRGDAQGIALHYGAGAGAEPTASAVVADLVDL
FT                   ARQTVAQAGGPVRCTVPPLGVPVAAWVDRPVLCMDDVVTRHYLRVPLREDAEGIAPAAL
FT                   AQWLAQAGVVVERLDAWRPRGHGSDQAQLLALTRPARDGAVRDVLQRAAQADWCLGAPA
FT                   HLRVENLE"
FT   gene            complement(12460..12762)
FT                   /locus_tag="Aave_0012"
FT   CDS_pept        complement(12460..12762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30629"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI41"
FT                   /protein_id="ABM30629.1"
FT                   /translation="MSQAPRSSDQQGSDPTASARVPQRVERRIDTTQKHPAPDAEQQNL
FT                   NSPEARLPHERDQAVDMTDGHPDPEIKQAHDDLERGLKDTDRGVPAHEAYQKQKR"
FT   gene            12900..15125
FT                   /locus_tag="Aave_0013"
FT   CDS_pept        12900..15125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0013"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; DEAD-like helicases-like; KEGG:
FT                   rfr:Rfer_2033 helicase C2"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30630"
FT                   /db_xref="GOA:A1TI42"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI42"
FT                   /protein_id="ABM30630.1"
FT                   /translation="MSQQEWAAQALQSFDAVVQATEGLRSRGGQRRMAEQVAHTFARAQ
FT                   LGKVEAEDGDSAPAPPARSIAVVQAGTGVGKSLAYSVPAIAMALARGTRVLISTATVAL
FT                   QEQLVQKDLPALAARMPQPFQFALAKGRGRYVCKLKLERLAGTGEAGDEGPEDDLFAEE
FT                   EAAARAARPRHETEARMKFYATMADVLARGAWDGDRDTLESPPEPEVWSPVAAEASSCT
FT                   GKHCPAFGQCTYYDRRKALVAAQVIVANHDLLLSSIGARLLPELDNCLLVVDEAHHLPS
FT                   TALDQFACEADLSRLNWIDKLASRALRIGTLMEVEEVADIPNHSARLRAALQDAARMVM
FT                   DVYGDELRAPRPAWGGGRTASTQSSRIPAAAAPTRARVPGGALPEALVEPFSQVAHHAA
FT                   GFLDALRAIAKALRSEMRDKPDEARRLSTLYAQIGALAPRLEGVHDTAQLLLQDAPEGA
FT                   VPAAKWFTLAVDGDFIVVKAHASPVLPGNTLRNHLWSAVRGAVLTSATLTSCGQFDFFL
FT                   REAGLHGDDAVTTLEVPSPFDYALQGTLVATETQADPRQAADYTAEMVDALLSDLAMVE
FT                   AGALVLFTSRDQMRQAVDALPTAMRSTVLVQTQMPRSQLLARHRERVAAGEPSIIFGMQ
FT                   SFGEGLDLPGALCESLFITKLPFAPPDDPVGEARAEWLRGTGRDPFSELVVPATAIRLA
FT                   QWVGRAIRTEEDRAHVYCYDRRLVRTAYGQRLLKGLPPFTLQRRTAA"
FT   gene            15295..15792
FT                   /locus_tag="Aave_0014"
FT   CDS_pept        15295..15792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0014"
FT                   /product="putative general stress protein 26"
FT                   /note="KEGG: mxa:MXAN_0453 putative general stress protein
FT                   26"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30631"
FT                   /db_xref="GOA:A1TI43"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI43"
FT                   /protein_id="ABM30631.1"
FT                   /translation="MTQDSPQTTLWKLIKDIRFGMLTHRSATGQLHAHPLTTQNKDIDE
FT                   QSELYFFIPHDGELAQRLKADAQTNVTYANPEKDSYVSLSGSAGFIEDKARKEALWSPQ
FT                   AKAWFPQGIDDPNLALLVIRIQHAEYWDVKESKMTQLFKMAKAAVTGNPPNMGEHRELS
FT                   LS"
FT   gene            15831..16040
FT                   /locus_tag="Aave_0015"
FT   CDS_pept        15831..16040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30632"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI44"
FT                   /protein_id="ABM30632.1"
FT                   /translation="MSDKQQPGTGKVENDHNQQGNQEPTQRNEGQRTPQSRHDRDAHVG
FT                   SSNQVQSRQGGGGPSTGGGGRGAG"
FT   gene            16085..16750
FT                   /locus_tag="Aave_0016"
FT   CDS_pept        16085..16750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0016"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pol:Bpro_0009 DNA polymerase III, epsilon
FT                   subunit; PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30633"
FT                   /db_xref="GOA:A1TI45"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI45"
FT                   /protein_id="ABM30633.1"
FT                   /translation="MPSRIAVIDFETTGMTPSQGARATEVAIVLMEEGRPVDRFQSLMR
FT                   TGAWLPPFIIQLTGITPAMLDTAPPAESVMREAARFVGDAPMVAHNASFDSRFWAAELA
FT                   RADLPAPHAFACTVLLSRRLYPEAASHQLGRIVAHLGLPPAARAHRALADAEMAAALLG
FT                   RMQHDLRTRYGIADPGHALLASLQRCARKGMDKLLARHAMGEDLWRDAAHCEPAAPLP"
FT   gene            complement(16785..18113)
FT                   /locus_tag="Aave_0017"
FT   CDS_pept        complement(16785..18113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0017"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: sma:SAV7000
FT                   GntR-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30634"
FT                   /db_xref="GOA:A1TI46"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI46"
FT                   /protein_id="ABM30634.1"
FT                   /translation="MKTMNFDGSSAAEIADSIESHLRSGALSCGDALPAVRALASQLGV
FT                   NPNTVAAAYARLRDAGRLVTDGRRGTRVASARPPVAEAMALPAGLRDLAGGHGDRALLP
FT                   RLPSGGWQGVQLDAGSGHGGPAEVPLWREMALQWLGSQGLPHEATGVFSGTLDAVEAAL
FT                   RHHARPGDRVAVEDPCWPPMVALLHALRLKAVPLPVDAQGVQVPSAECLDGCAALVLTP
FT                   RAHNPTGCAISEPRWKALRRALHGRPHLLCILDDHWGPLSQEPLAPAAALPPLWLYVLS
FT                   VGKFLGPDVRVALAAGTPALIDALRAQQAAGARWVSRLLQALAAGLWRDALRSGQLAQA
FT                   AQAYARRRQALEFALRSQPSDPVATGATAGEGLHLWVPVRDESAVLSALAARGWAAQAG
FT                   APFRIASGPAVRISLGDLAGPEVGPLARDLADALAPAAARAVF"
FT   gene            complement(18322..18732)
FT                   /locus_tag="Aave_0018"
FT   CDS_pept        complement(18322..18732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS03064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30635"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI47"
FT                   /protein_id="ABM30635.1"
FT                   /translation="MTQLQIATVKTYLSRLHAGDTDGLIACFESEGLVHSPFLGTMRAR
FT                   EFFRKLAESSAASVITPIDLLVSAEPEAGLVRVAAYFRYDWTLNDGQIIHFTCVDVFRF
FT                   AEGSAEIQDMHIVYDTHPLREQVGDKYAPDPA"
FT   gene            19177..20940
FT                   /locus_tag="Aave_0019"
FT   CDS_pept        19177..20940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0019"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: reu:Reut_A1687 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30636"
FT                   /db_xref="GOA:A1TI48"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI48"
FT                   /protein_id="ABM30636.1"
FT                   /translation="MACPARHRFVEPVMMISKPATKYQPATKYQPTASVSLPDRTWPTR
FT                   SITQAPIWLSTDLRDGNQALFEPMNGERKMRLFEELVRIGFKEIEVGFPAASQTDFDFV
FT                   RRLIEENRIPDDVTIMVMTQSREDLIERTVQAVQGAPRAIVHLYNATAPAWRRIVFGMN
FT                   VSQVMAFIGHHVSLLKRLTDAQPATAWTLQYSPETFSATEPEVSLRACQTAIAAWGAGP
FT                   GRPIIINLPTTVENATPNVFADQIEWMHRRLAPREHIVLSVHPHNDRGTGVAAAELAMM
FT                   AGADRVEGCLLGNGERCGNVDIVTLALNMYTQGVHPNLDFSDITHVARVAEECTSLPVH
FT                   PRHPYAGDLVFTAFSGSHQDAIKKGFAAQDPAGLWEVPYLPIDPADLGRTYDSVIRVNS
FT                   QSGKGGIAFLLERERGVVMPRRLQVEFSAVVQRATDASEGEMDGDALWSLFSQTYIAAP
FT                   AQGTPGALTLHGQRLDEDGQGISLDVTIDGVRQTLQGRGNGPIDATVDAIGLPLRVDHY
FT                   EERATGAGAGAQALAIVEAALEGVPGATFGVGLDHSIVSASVQAVVAVTNRLIARRGAK
FT                   ADAVQAAPATA"
FT   gene            21112..21666
FT                   /locus_tag="Aave_0020"
FT   CDS_pept        21112..21666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0020"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: rfr:Rfer_0741 NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30637"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI49"
FT                   /protein_id="ABM30637.1"
FT                   /translation="MQSEFPLARSARGDGAAAGTSSRRVVLAAASLAAVLLLPACGTSP
FT                   SRGRRGAAPGYTYSRLTPEQSSDIAIHAMGLVGTPYRYGGNTPEGGFDCSGLIGYVYRS
FT                   LAGIPPPRTVAQLSDFGAPVEAGEERTGDLVIFGSGRPTHAGIVVEGGRFVHAPSTGGT
FT                   VKLDRFSSGYWSRQPIAFRRP"
FT   gene            21747..22889
FT                   /locus_tag="Aave_0021"
FT   CDS_pept        21747..22889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0021"
FT                   /product="3-deoxy-D-arabinoheptulosonate-7-phosphate
FT                   synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="KEGG: bbr:BB2422 3-deoxy-7-phosphoheptulonate
FT                   synthase; TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30638"
FT                   /db_xref="GOA:A1TI50"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI50"
FT                   /protein_id="ABM30638.1"
FT                   /translation="MNRTISQDAGGVASASHVHRATPQSGTHDTTRIDDTRIKAVRPLI
FT                   TPALLQEWLPASDDARALVESSRAALSRVLHGEDDRLIVVVGPCSIHDHGQAMEYAKAL
FT                   KAQADRLSAELLVVMRVYFEKPRTTVGWKGYINDPHLDGSFAINEGLEMARKLLLDVLA
FT                   LGLPVGTEFLDLLSPQFISDLVSWGAIGARTTESQSHRQLASGLSCPVGFKNGTDGGVK
FT                   VASDAILAAQAPHAFMGMTKMGQAAIFETRGNRDCHVILRGGRQPNYGAADVDAACGLL
FT                   RGTGLREQVMIDVSHANSSKQHRRQIEVAADVAAQVAAGDGRITGVMIESHLREGRQDI
FT                   VPGQPLQSGVSVTDACIGFDQTVPVLEGLAAAVRSRRSHR"
FT   gene            23127..27626
FT                   /locus_tag="Aave_0022"
FT   CDS_pept        23127..27626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0022"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: tbd:Tbd_1042 putative diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC and GAF sensor(s); TIGRFAM: PAS sensor protein;
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   EAL domain protein; GAF domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30639"
FT                   /db_xref="GOA:A1TI51"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI51"
FT                   /protein_id="ABM30639.1"
FT                   /translation="MPARTDPDYRRLVALHACAILETPAEDTFDQLARLAAHLCGAAVA
FT                   AIGFMDAGREWFKASAGMELGTLQNLAGDHSLCRLALGGRLVQVEDAQVDPVLRSHPLV
FT                   QGPSRMRMAACMPIKTTDGLTLGAVVVLDTARRALEESHREALVAIASQAMALLELRRQ
FT                   RRDVARRAQERALSEERFHLVARATADAIWDWNLTDDSMWWNEGMEVLFGVPLHTLPHD
FT                   STSWTQRLHPEDSDRVLESIHAAIEGDALHWMDEYRFRRQDGTYAWIRDRGFVIRDAQG
FT                   QGQRMVGGMTDISAQKQSALQAQRDAGAHAELVRVQQRMSALDLPMEEVLLLAARTAMD
FT                   LGDGQGAMVVLREGDRLRVRASTGPRAAPLDDTRPMLGYPLWQQLEAEQTVLHSDGSQQ
FT                   HALFATDEGQHGLLSFIAAPLRAGDTVLGMLKVNADPVFTFSQRQVAYVQILAESLGAV
FT                   LQLRSYAAQLSASELQYRSLFDAHPQPMWVYERGSLRILAVNRAMVRHYGYEEAELLRM
FT                   TTAQLWPEQERSRQEIEARALPPGVRRDAVHRRHCKKDGTPIDMEVYAGDTTFNGRAAR
FT                   QVLATDVTQRMRMERELARVGTVQRLLGACNEALVRATGETALLSEVCRIAREVGGYRS
FT                   AWVGMVRHWNGTGRQSIEPVAWAGLTAVGVETLRPSGTPDAPWTPHSPGPSGEALRSGR
FT                   PVIVRDLRQAPDADLWARPLRQLGLPAVISLPLRDAEQVFGLLTLYPEEVLETGAEETE
FT                   LLQQLANDIAFGLGSLRTRQDQQRLQAVVLKAAAAVSASTGAQFFRQLASHMCDALGAQ
FT                   AGCVTRLLPQPGGQIPRAVTLSRVEEGVVQPNAEYALEGTPSMRLVNEAECVIPEGIAE
FT                   LYPGSPVARLGAQAYVGLQLRSAEGQPIGFVFVVFREPLQQPGMVISTLRIFAARAAAE
FT                   MARQASDAHIRRQASLLDKARDAIIVRDLDHRITFWNEGAERLYGWTREEATGQSIAEL
FT                   LYQDTQEFLRATRATQEQGEWAGEIVQFHRDGRRLDVEGRWTLIQGEQGQPDAILAIDT
FT                   DIGQRKATEREIQRLAFYDSLTGLPNRMLLMDRMRHALATAQRRRQGGALLFIDLDNFK
FT                   TLNDTLGHDQGDVLLQQVAARLNTCVRSVDTVARLGGDEFVVMIEGLSTHPGELAMSAR
FT                   TVGEKILAVLATPYVLQGYHYRSTPSIGVAPFGDGRTSTVGELLKQADLAMYQAKTAGR
FT                   NTLRFFDPGMQAVVTARAELENDLRTALAREQFMLHYQPQIDRRGSVTGVEALVRWPHP
FT                   QRGMVSPGEFIPLAEETGLVLPLGRWVLHTACAQLARWQHVPGRGHLSMAVNVSSRQFH
FT                   HEAFVEDVVRAITATGAPASRLKLELTESLFVEDMETTIATMAALRSHGVGFSLDDFGT
FT                   GYSSLSYLKRMPLDQLKIDQSFVRDLLADPNDAAIVDTIIALSRSLGLDVIAEGVETAE
FT                   QRTRLEQAGCRAYQGYFFSRPLPETALEDFLVQKLPSR"
FT   gene            complement(28538..29122)
FT                   /locus_tag="Aave_0023"
FT   CDS_pept        complement(28538..29122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30640"
FT                   /db_xref="GOA:A1TI52"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI52"
FT                   /protein_id="ABM30640.1"
FT                   /translation="MHHSFTKRLVAPLAARGAFFILAVVSAAGAQAQAAPERPSVYVQG
FT                   GWAERQTDSATLGVTLPWTSWRSELWGSEVRGYWDIYASRWSYDGESGGSGHATLAGVT
FT                   PTFRLRPDSGRSPWFLEGGIGITYMDKRYHTSHKEFSTRYNFASHLGLGYSLGAQRQHE
FT                   IAIRVQHLSNAGIKRPNPGENFVQLRYAYHF"
FT   sig_peptide     complement(29024..29122)
FT                   /locus_tag="Aave_0023"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.534 at
FT                   residue 33"
FT   gene            complement(29239..29802)
FT                   /locus_tag="Aave_0024"
FT   CDS_pept        complement(29239..29802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30641"
FT                   /db_xref="GOA:A1TI53"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI53"
FT                   /protein_id="ABM30641.1"
FT                   /translation="MKGHRHDRTFPATTLRHRSHGRRTDGPAGGSVLRAAARHAGRVPH
FT                   GRRRTPAPHARPRGTRSPHGPRAEALRQKLQLTPAQQPAWDAFTAAMRPQGPRPDMAGM
FT                   AQLTTPERIDRMRALRAQHNAEADRRDDATKTFYAALTPAQQKVFDAEHVGMHGPRHKG
FT                   MHGDNGPARRHGGTAPAPAAPAPQ"
FT   gene            30029..31024
FT                   /locus_tag="Aave_0025"
FT   CDS_pept        30029..31024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0025"
FT                   /product="putative exonuclease, RdgC"
FT                   /note="PFAM: putative exonuclease, RdgC; KEGG:
FT                   rfr:Rfer_0012 putative exonuclease, RdgC"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30642"
FT                   /db_xref="GOA:A1TI54"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI54"
FT                   /protein_id="ABM30642.1"
FT                   /translation="MFKNMIIYRIAEWHAELPQLEEALARTPFVECGATQEKSVGWVPP
FT                   RGEAHGALAESVGGQWILRFMTESKMLPGSVLARKVKDKAARIEKETGRKPGKKETREL
FT                   KEEAKLDLLPMAFTKQGSMWVWIDTEARLLVLDTGSQGRADEVVSLLVEALPGLSVSLL
FT                   DTQTAPQAAMAHWLKEQEPPVGFSVDRECELKSADESKAVVRYARHPLDIDEIREHIAA
FT                   GKLPTKLAMSWDDRVAFVLTEGLQIKKVSFLDTVFEGRGQDDSGFDTDVAIATGELSKL
FT                   IPDLIEALGGEGRTGLDGPAPAPGERQAEAGGAATAQAAATADADDDAPF"
FT   gene            31079..32332
FT                   /locus_tag="Aave_0026"
FT   CDS_pept        31079..32332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0026"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   rme:Rmet_3343 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30643"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI55"
FT                   /protein_id="ABM30643.1"
FT                   /translation="MALNWVWIGFFTIAFVTAATRWALGDADVFQALLAAMFTAARSGF
FT                   EISIGLAGVMALWLGLMRVGERAGMVELLARAAGPLLRRLFPGVPQGHPAQGAMTMNFS
FT                   ANLLGLDNAATPLGLTAMRELQSLHTGPRDTASDAQIMFVVMNTAGLTLIPTSVIAIRQ
FT                   SVAVQQGLGAGFNAADIFLPTLLVTFIALIAGVLAVGLCQRLPLWRPRLLLPLAAVSGL
FT                   LGAAVWALGRLPAEQASRIAGTLGAAVILGIVMLFILAGAVRRINVYDAFIDGAREGFG
FT                   VAVQIVPYLVAILVAIGVFRAAGCMDALLAAVGAGVAALGWNTDFLPALPVGLMRVLSG
FT                   AGARGLMIDVMQAHGVDSFAGRLAAVMQGSAETTFYVLAVYFGSVGVKHTRHALACALF
FT                   ADAVGLAAAIAVGYAMLR"
FT   gene            complement(32339..32806)
FT                   /locus_tag="Aave_0027"
FT   CDS_pept        complement(32339..32806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0027"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV3258 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30644"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI56"
FT                   /protein_id="ABM30644.1"
FT                   /translation="MQRMILGIATALALTGCASVVNDTTQPMKIDTKNDKGELVSGAEC
FT                   SVTNDYGTTAVKSGVTSQVRRSGKDLDIVCKDPRHPDAVGRGISRANAGLAGNIIFGGG
FT                   IGAIIDHNKGTAYTYPTWVQLVFGQTLVFDRSTEKEGAPVAGTIPAVAKAP"
FT   sig_peptide     complement(32738..32806)
FT                   /locus_tag="Aave_0027"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.673 at
FT                   residue 23"
FT   gene            32852..33187
FT                   /locus_tag="Aave_0028"
FT   CDS_pept        32852..33187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0028"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3825 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30645"
FT                   /db_xref="InterPro:IPR021724"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI57"
FT                   /protein_id="ABM30645.1"
FT                   /translation="MKPQKRSIVATVAGQSDVPSFFEPIQDTPVTDAVQRPELPDHLSI
FT                   DPRSKFHVPAVFEHDIGIRFNGKERFDVEEYCVSEGWIKVPAGKTVDRKGRPLLLTLKG
FT                   TVEAFYK"
FT   gene            complement(33191..33715)
FT                   /locus_tag="Aave_0029"
FT   CDS_pept        complement(33191..33715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV1504 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30646"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI58"
FT                   /protein_id="ABM30646.1"
FT                   /translation="MMPPASALPFTASRSATLACLLVAATGLPGAAAAATPNGTAASAA
FT                   LECPATVQLEAPRATASGLPAGTEIVLDARPLRLTGYNFFDGPPAQGAALVPTSDKPGK
FT                   GTKGAKGAKSESTATWVFEGDYPQGKFASCDYAGGTVRLVRRMDDGAKRCTATSRTAGD
FT                   PPALQVQFRCE"
FT   sig_peptide     complement(33611..33715)
FT                   /locus_tag="Aave_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 35"
FT   gene            complement(33751..34143)
FT                   /locus_tag="Aave_0030"
FT   CDS_pept        complement(33751..34143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0030"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: stt:t2586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30647"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI59"
FT                   /protein_id="ABM30647.1"
FT                   /translation="MPYLYQNAAALEGTDKVGSKHCVALLQHYAHLPHTSNWKPGETVF
FT                   GNANIKKGTAIATFNSAGKYGSLPTGNHAAFFISQDPGGIWIMDQWLSDTQKPKVSMRY
FT                   VRPKPQRKNGDFADPSNNAAAYSVIE"
FT   gene            complement(34220..35416)
FT                   /locus_tag="Aave_0031"
FT   CDS_pept        complement(34220..35416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0031"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: eba:p2A409 beta-ketothiolase protein; TIGRFAM:
FT                   acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30648"
FT                   /db_xref="GOA:A1TI60"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI60"
FT                   /protein_id="ABM30648.1"
FT                   /translation="MTSAHRDILIASIARTAIGTFGGSLKDIPNTQLATTAVRAAIERS
FT                   GIAADAVGHVVMGNVIPTDTKDAYLSRVAAIDAGCPVETPAFNVNRLCGSGLQAIVSAA
FT                   QAIALGDCDVAIGGGSESMSRGPYFDTASRWGARMGDAKSIDYMLGILHDPWQKMHMGI
FT                   TAENVAERYRIGREAQDQLAAESQRRAAAAIAAGYFKEQIVPVEIPGRKGTATLFDTDE
FT                   HVRGGTTVEVLAGMKPAFRKDGGTVTAGNASGINDGAAAVVLVAGDRAAALGARPLARL
FT                   VGYAHAGVEPAYMGIGPVPATRAVLQRTGLSVQDMDVIEANEAFAAQACAVIQELGLDP
FT                   AKVNPNGSGISLGHPVGATGAIITTKAIAELHRTGGRYALVTMCIGGGQGIAAIFERV"
FT   gene            complement(35531..35935)
FT                   /locus_tag="Aave_0032"
FT   CDS_pept        complement(35531..35935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0032"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="TIGRFAM: Cu(I)-responsive transcriptional regulator;
FT                   PFAM: regulatory protein, MerR; KEGG: pol:Bpro_4873
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30649"
FT                   /db_xref="GOA:A1TI61"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI61"
FT                   /protein_id="ABM30649.1"
FT                   /translation="MVDPVPIGTAAARAGVSQRMVRHYEALGLLRDVARTDSGYRQYTE
FT                   RDVHTLRFIRRARDLGFSMEEIATLLGLWQDQRRASREVKRIAQAHIDDLGRRIAAMQA
FT                   MQRSLQQLVGCCQGDGRPDCPILDDLAGVN"
FT   gene            complement(36012..36209)
FT                   /locus_tag="Aave_0033"
FT   CDS_pept        complement(36012..36209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0033"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: bxe:Bxe_A3162 heavy metal binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30650"
FT                   /db_xref="GOA:A1TI62"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI62"
FT                   /protein_id="ABM30650.1"
FT                   /translation="MQHSFQVQGMTCGHCERAVVHAVRSVDTDASVQVDLPTGRVVVES
FT                   DSPREALAAAITEEGYTVAA"
FT   gene            36333..38636
FT                   /locus_tag="Aave_0034"
FT   CDS_pept        36333..38636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0034"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; copper-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; Heavy metal
FT                   transport/detoxification protein; E1-E2 ATPase-associated
FT                   domain protein; KEGG: rfr:Rfer_0024 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30651"
FT                   /db_xref="GOA:A1TI63"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI63"
FT                   /protein_id="ABM30651.1"
FT                   /translation="MADSPSPLLSFPDASTATLPEQSLDLGIGGMTCASCSGRVERALR
FT                   KVPGVRSAEVNLATERAHVVYAAAPDGAVASMEGLLRRAVRNAGYEPRAADAPEPPDAA
FT                   SPWAGFGPVAAGIALSLPLVLPMLGGLAGRDWMPPAWLQWLLATPVQFVLGARFYRAGW
FT                   HALRARAGNMDLLVAIGTSAAYGLSLWLWFTAAHGSEGHAPHLYFEASAVVITLVLLGK
FT                   WLEARAKRQTTEAIRALHALRPEAAHWIGPDGEVDVPVAELMAGDRIAVRPGERLPVDG
FT                   TVLEGHTQVDESMLTGEPLPVARGPSDAVTGGSINGDGRVVVRVTAVGAETVLARIIRL
FT                   VEDAQAAKAPIQRLVDRVSAVFVPAVLVLALCTLLGWLAAGAGLEAALIHAVAVLVIAC
FT                   PCALGLATPAAIMAGTGVAARHGILIKDAEALETAHRVDTVVFDKTGTLTLGQPRLQAF
FT                   EAAPGCDAGALLATAAALQAGSAHPLAHATLQAVRERGLSLPAAADAVQAVPGRGTEGQ
FT                   VQGTSWRMGSLRWMDALGADVPPALAARARALQDGGATVSALAERLPGGGDAVRALLAF
FT                   GDEPKPGAAAAVQALRARGLRVVMLSGDNRGAAEAMARRLGLRPGAGEVIAEVLPADKA
FT                   AQVVRLQRDGRQGPGSPGARTVAMVGDGVNDAPALAAADVGIAMGNGTDVAMHAAGITL
FT                   MRGDTALVAAALDVSRRTVAKIRQNLFWAFAYNVAGIPLAALGYLSPVVAGAAMALSSV
FT                   SVMANALLLKRWRL"
FT   gene            38740..40416
FT                   /locus_tag="Aave_0035"
FT   CDS_pept        38740..40416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0035"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rfr:Rfer_2354
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30652"
FT                   /db_xref="GOA:A1TI64"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI64"
FT                   /protein_id="ABM30652.1"
FT                   /translation="MKFDSLMRGFTIRVRMLGAIAVVLSLLGLLGGAGMLGMFRIHAMS
FT                   EEFIGHSFSEVSAMAELRGEMGNIRQYEKDMIIQYEKPEGVQKAHAAWLESLDHARKVA
FT                   ARFQDGGQDRDNQLATDIVKRLEAYRGQFASVARQLEAGGYDSATIANRMSTKAVAEFA
FT                   EADKLLAQLDSELRKEVAEVTARQQTVSEQTKWLFVLAVLITVAVVVPLTLLNMNSICR
FT                   PLVEARRMAQAIAGGDLSQRMHVEGRDEVADLQRALLGMQQGLSALVSQVRDASGSIAT
FT                   ASQEIASGNQDLSSRTEQTASNAQEAVASLSQLTATVQQTASSSQVANQLVASASGIAT
FT                   RGGSVVEQAVASMHEISASSRKIGDIIGLIDSIAFQTNILALNAAVEAARAGEQGRGFA
FT                   VVAGEVRSLAQRSAQAASEIKGLISSSVTAVNGGVRHVEDAGTAMKEIVESVQRVTDII
FT                   GEINSASAEQSAGIGQVNGSVGEIDRMTQQNAALVEQSAAAAQSLREQAARLSQVVQQF
FT                   HLDDAATAGGYGMGASGSASASGYGESAALPAGGRTALLSA"
FT   sig_peptide     38740..38871
FT                   /locus_tag="Aave_0035"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.705 at
FT                   residue 44"
FT   gene            complement(40520..40963)
FT                   /locus_tag="Aave_0036"
FT   CDS_pept        complement(40520..40963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30653"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI65"
FT                   /protein_id="ABM30653.1"
FT                   /translation="MRKIVFGTLFPVSLLFASFIATASAHATEERALREACSAFSQAGM
FT                   RDCLSKKAADSQDDLRQARNDATSALSKWDEDAQYTGRAKAELTASDKVFEKYRDAHCK
FT                   FRASLSGGGAGNSREILRSACIAELNGIRARQLRDAIAGLPLK"
FT   sig_peptide     complement(40880..40963)
FT                   /locus_tag="Aave_0036"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 28"
FT   gene            complement(40951..41694)
FT                   /locus_tag="Aave_0037"
FT   CDS_pept        complement(40951..41694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0037"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG: ecs:ECs0214
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30654"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI66"
FT                   /protein_id="ABM30654.1"
FT                   /translation="MMITQDSMKTGFERWQEGIDKAAQDERWNYWDCEIQAAVNEYNQH
FT                   LAGIAGYIPLDWYFIKSMVWVETGANSSEWKIKPMQIGVPGDPGMASLLSGNEGGDLIL
FT                   PPHWKSKLTPNSIRTIPQHNLRAGIGYLLMRMGNYEYRSLPSADGKLYEVVVSPGDSFD
FT                   KIARKNGSTVETIRRLNPHILLLRPGQMLKYQKSSVQRIIRNWRILSTQMAAQRYNGGG
FT                   DPNYARKLDYVLPLLRKGKVAVCEK"
FT   gene            complement(41967..45053)
FT                   /locus_tag="Aave_0038"
FT   CDS_pept        complement(41967..45053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0038"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: reu:Reut_B3503 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30655"
FT                   /db_xref="GOA:A1TI67"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI67"
FT                   /protein_id="ABM30655.1"
FT                   /translation="MKRLIHYALHQPLFIILGVLLFALAGVIAFKNLSVEAFPDVTDTQ
FT                   VTVIALFPGRAPEEVEKQVTLPIETALAGLPNSIRVFSHTQFGLSFTVVTYDDAANVNT
FT                   VRQQVAERLSTVDLPQGVQAEIAPNATPVGEIMRYRLKGDGLTTTDIRTIEDWTVERAL
FT                   RQVPGVADVVAMGGAIKQYEVQPDMDKLRAYKVSFQNLLDVLGRGNANAGGSYVAQGAQ
FT                   QYTIRGLGLLRSAEDIGRIVVASRGGTPVLIRDIAQVRIGAVPQLGVVGQDQDDDIVTG
FT                   IVVMRKGENPSVVLKGVKDKIAQLNERGLPPGVQIVPFYDRTWLMDKTLTTVFHNLVEG
FT                   ALLVSLVLYIFLSNLRASLAVVVIIPLALLSTFMGLKVMGVPANLLSLGAMDFGIIVDG
FT                   AVIVIENIMHRLAERGEDMNDRDRRDTIIEAAGEVGRPTLFSMLIIIAAHIPIFALQRH
FT                   EGRIFQPMALSVTTALIGSLIFSLTLVPLLAYWLLRRKLPHGDNRVVTRAKSLYAPVLD
FT                   WALERRRTVVIIALAVFGVAMVAASRLGSEFLPELDEGTTWVNFSLSPNVSTAEASRIL
FT                   RMARKALLSVPEVRTTVSKAGQPEDGTDPKTISMAEIFVDLKPEDQWRAGMTRAKITEE
FT                   MNRALSAIPGIDPAFSQPIRDNVLESISQIKGQIVIKLAGDDLAEMKRITEEIAREVKQ
FT                   VRGVARAEIDREGQVPQLLIDIDRDRAARYGLNVSDIQDVIEAALAGKAATNLWEGERK
FT                   FAVAVRLPSDERTIANLPRTPIATPDGGYVQLGDVAKIRESAGAMNIAREAGRRTTAIG
FT                   IFIAGRDMGSVVADMKARVEKNVKIPDNYQVNWSGEFENQERAMKRLSVVVPISLLLIF
FT                   VLLFDAFKSVKMASLILLNVPLALIGGFVALWAFGIPLSVSAAIGFIALSGQAVLNGVV
FT                   MLSVFQQLQAGGASVVEAVRQGSMQRLRTVLMTAMLAMLGLLPMALSHEIGSETQRPLA
FT                   IVVIGGLVTATMLTLVVLPALYVAWFGPKKGQEEPGVLA"
FT   sig_peptide     complement(44958..45053)
FT                   /locus_tag="Aave_0038"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.325 at
FT                   residue 32"
FT   gene            complement(45050..46261)
FT                   /locus_tag="Aave_0039"
FT   CDS_pept        complement(45050..46261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0039"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_3837 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30656"
FT                   /db_xref="GOA:A1TI68"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI68"
FT                   /protein_id="ABM30656.1"
FT                   /translation="MMAPLLSLPARRPSARGLLALAALGAACALLPGCGKSGAEAAATP
FT                   PEPAPPVMQAGQLRFPSGHPQLALLGTVEARAARDVAVDLPARLVWNEERTQRIYPAFA
FT                   GRVTAIQADLGQSVKAGAPLALLASPDFGQAQADTAKAQAGQSLAQQSLKRQRELFEAG
FT                   IIARKDLEQAEADAAGAQAEVARAAARTRLYGSASGVNQQLALSTGIGGVVVERNLNPG
FT                   QEVRPDQSGPALFVVTDPTSLWVQIDARETDLSSLRPGDPITLQVPAYPGATFAGKVTA
FT                   TADAIDPGTRTIKVRGVVPNADRRLKAEMLASARVQESRAGGVVVPASAIVLDGTQHLV
FT                   FVRRESGVFEPRKVELAHEGPAEVLVSAGLQPGEAVVNQNALLLARQFQSMAEDAATAK
FT                   KEAP"
FT   sig_peptide     complement(46142..46261)
FT                   /locus_tag="Aave_0039"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.721 at
FT                   residue 40"
FT   gene            complement(46334..47749)
FT                   /locus_tag="Aave_0040"
FT   CDS_pept        complement(46334..47749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0040"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   dar:Daro_1877 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30657"
FT                   /db_xref="GOA:A1TI69"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI69"
FT                   /protein_id="ABM30657.1"
FT                   /translation="MRSHPPSLSLRSGTALRIAAGLLACGGAWLAGPHPAQAQAQAQAQ
FT                   AQAQATAAMPAPSRPVPAPAMAVAPRGTGWTLSQALAAARDNSEVHQARQELAGARADV
FT                   LSADHAPLPSLTTKAGSIDLQHGPGPGNVFTRKRIDKSVGIDWTWERGDKRALRKKAAE
FT                   SMANAAEADVEDTQVQQLQAALGAYYDLLAAQDRLAEVAAIERSLADVAGMADRRVKAG
FT                   DLSVQDASRTRIEAERARADTRAAEQARDDAALALAQVTGSTGSRLQAVDTPWPPLAGD
FT                   PPATDADLAAWAETRADVRAALARAQAAQAALDGANALRKSDWTVGASIDHFPGTSTRQ
FT                   VELRVQIPLQWGYQYQGEIGRAQADYAKAQDALDNTRRLALLDLQRLRQAQESAARRAA
FT                   DYDQGVLPRARQVADSAELAYRKGAIALTDLLDAQRTLRATLLDALAARADYAKARGAW
FT                   LLRTRPQLLTGTP"
FT   sig_peptide     complement(47633..47749)
FT                   /locus_tag="Aave_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.940 at
FT                   residue 39"
FT   gene            47920..48633
FT                   /locus_tag="Aave_0041"
FT   CDS_pept        47920..48633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0041"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: csa:Csal_0727 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30658"
FT                   /db_xref="GOA:A1TI70"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI70"
FT                   /protein_id="ABM30658.1"
FT                   /translation="MRILVVEDDAVLRGVMQRSLADAGHRVDVAATLAEADHFWKVQPF
FT                   DAVLLDLNLPQDAAHASPVGSGLAVLRAARARGDRTPVLVLTARDRTEERIAGLDAGAD
FT                   DYLGKPFDLAEVEARLRALVRRTQGTDDRTSAGTLVLDRRVRRFTLHGQPFDLPAREFE
FT                   VLWELMTPPGRVVSKRSLSDKLSDFDDMLGDNALEAFISRLRKKLQGSGAGIRTLRGLG
FT                   YMLEATDASATQGDA"
FT   gene            48630..50078
FT                   /locus_tag="Aave_0042"
FT   CDS_pept        48630..50078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0042"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; Two-component sensor
FT                   kinase N-terminal domain protein; KEGG: bte:BTH_I0641
FT                   sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30659"
FT                   /db_xref="GOA:A1TI71"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI71"
FT                   /protein_id="ABM30659.1"
FT                   /translation="MSGGTPAAALPQRPAPSPPSLRARLLRHVLVPLALTWFAGTAISV
FT                   LVANGFTQRAFDRALLDDAYAIAANVRVKGGALDLALSSRELKSVLFDQAETVYFAVLL
FT                   PGGSMLSGNASLPVPPPPRDEAYRFSDISYRGRALRAVRVRVNEPQAFEVITAQTVHAR
FT                   SAMLRGVLLYSVVSQVLLLGALAFWLRRAIQSDLQPLAAFQSELAGRDARDLEPVAVQA
FT                   STRDLQHLGAAVNGLLARVAEGVRAQREFAGNVAHELRTPLAGIRALAAYGLAHKDPAV
FT                   WHEQLAGVAASEARASHLVDQLLALALADEVRGAVPRQPVALDDLARDAVLRFLPRADA
FT                   AGVDLGARGLDQPVVVQGQTVLIEGVLGNLIDNALRYGRPAQEGVGPRITVEIAHEQAE
FT                   NGTGEVVLSVVDNGPGIPQGLRTDLMQRWAQGREGERLGQGAGLGLAIVARYAELLGAR
FT                   LVLGTGPDAEGLRVGLVFVPVEPA"
FT   gene            complement(50075..50392)
FT                   /locus_tag="Aave_0043"
FT   CDS_pept        complement(50075..50392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0043"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   bur:Bcep18194_B0447 protein of unknown function DUF1099"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30660"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI72"
FT                   /protein_id="ABM30660.1"
FT                   /translation="MITCTLRYVIDPYKLAEFEHYGRLWIPLVEKFGGRHHGYFLPSEG
FT                   ANNIALAMFTFPSFAAYETYRQQSMQDAECLAAFRYAEETRCIVSYERSFFRPVFGTGP
FT                   A"
FT   gene            complement(50562..51676)
FT                   /pseudo
FT                   /locus_tag="Aave_0044"
FT   gene            51963..53009
FT                   /pseudo
FT                   /locus_tag="Aave_0045"
FT   gene            53068..53877
FT                   /locus_tag="Aave_0046"
FT   CDS_pept        53068..53877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0046"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: bxe:Bxe_C0086 ABC taurine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30661"
FT                   /db_xref="GOA:A1TI73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015859"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI73"
FT                   /protein_id="ABM30661.1"
FT                   /translation="MSLRDVSVRYAGTDQPALQGVDLDIAAGELVVALGASGCGKTTLL
FT                   NCMAGFTEPSAGSILLDGRPVTGPGAERGVVFQKHALMPWLNVIDNVALGLRLRGVSRE
FT                   TRQRLAGERLAQVGLESFAQAPVWQLSGGMQQRVGIARALASDPQVLLMDERFSALDAF
FT                   TRQSLQELVLRLWQGTGKTIFFITHDVEEALFLASRLIVMAPRPGRIARQHGLDFNRQF
FT                   LAGRPARAVKSSSAFIDGRERVLDEVAPSLAPQAAARQPEHVEHVHA"
FT   gene            53864..54784
FT                   /locus_tag="Aave_0047"
FT   CDS_pept        53864..54784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0047"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_A4207 ABC taurine
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30662"
FT                   /db_xref="GOA:A1TI74"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI74"
FT                   /protein_id="ABM30662.1"
FT                   /translation="MSMPEEALMPSLPGMAAQPRREAAAPGPTLAPAEAAPSPALRAVA
FT                   PYRLPGQGPSRGLSVACVAAFALLWWLATQLQWVKPLFLPAPQAVLLALRDAWEGRIQG
FT                   GEPLWRHLQWSAIRVFGAFVLAALTAVPVGIAMGVSRVARGVFDPPIEFYRPLPPLAYL
FT                   PLIVIWFGIDETAKILLIYLACFAPIALAARAGVRSASVEQVHAALSLGASRWQLVRHV
FT                   IVPAALPEILVGLRIAIGFGWTTLVAAEMVAATVGIGQMVLNASNFLRTDLVVAGILVI
FT                   GLVAWTFDLVMRWVEARAVPWKGRA"
FT   gene            complement(54822..55430)
FT                   /locus_tag="Aave_0048"
FT   CDS_pept        complement(54822..55430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0048"
FT                   /product="glutathione S-transferase, C-terminal domain
FT                   protein"
FT                   /note="PFAM: glutathione S-transferase, N-terminal domain;
FT                   glutathione S-transferase, C-terminal domain; KEGG:
FT                   rfr:Rfer_0047 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30663"
FT                   /db_xref="GOA:A1TI75"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI75"
FT                   /protein_id="ABM30663.1"
FT                   /translation="MKLYYSPGACSLSPHIALHEAGLAFTPVLASTKSHKLQDGTDFYT
FT                   INPLGYVPVLELDDGTRLREGPAIVQYIADQAPHKNLAPANGTLARYRLQEWLNFIGTE
FT                   LHKGHSPLFQPNTPDAYKPIVREKLMSRFQWVDEQLSGREWLTGEHFSVADGYLFTVSG
FT                   WGKHVGVDLSGLPNLQAYLARVGSRPAVQAALKAEGLQK"
FT   gene            complement(55534..55797)
FT                   /locus_tag="Aave_0049"
FT   CDS_pept        complement(55534..55797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0049"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   mca:MCA0686 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30664"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI76"
FT                   /protein_id="ABM30664.1"
FT                   /translation="MALACRPGCGACCIAPSITSPIPGMPSGKPAGVPCVQLDSQLRCR
FT                   IFGSAERPAVCASLRPSEDMCGPGREHALVWLGRLEAATLPA"
FT   gene            complement(55804..56385)
FT                   /locus_tag="Aave_0050"
FT   CDS_pept        complement(55804..56385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0050"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   pol:Bpro_0072 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30665"
FT                   /db_xref="GOA:A1TI77"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI77"
FT                   /protein_id="ABM30665.1"
FT                   /translation="MPKILVFAGSTRQQSLNRRLARAAADIAHAAGADTTLLELSDFDI
FT                   PLYNADLEARGTPADVVRLKEILHAHAGWIVCSPEYNGSYTALLKNTIDWASSPVAGHP
FT                   VWSDGTLPFRGKVVGMLSASPGGLGGLRSQSQLAPLLINLECWLAPQAFALGHAGSAFD
FT                   AQDGFVDAAHHGRVRAVVDQVLWAAGRLGT"
FT   gene            56675..58642
FT                   /locus_tag="Aave_0051"
FT   CDS_pept        56675..58642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0051"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: rfr:Rfer_0049
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30666"
FT                   /db_xref="GOA:A1TI78"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TI78"
FT                   /protein_id="ABM30666.1"
FT                   /translation="MLYPQEFDVIVVGGGHAGTEAALAAARMGSRTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRILY
FT                   KAAIRRMLENQPNLWLFQQAVDDLMVEGDRVVGAITQVGIRFRARTVVLTAGTFLDGKI
FT                   HVGLNNYSAGRAGDPPAVSLSARLKELQLPQGRLKTGTPPRIDGRSIDFSQCEEQPGDG
FT                   MPGGVNEGTLPVFSFMGSTAMHPRQVPCWITHTNERTHEIIRSGFDRSPMFTGKIEGVG
FT                   PRYCPSVEDKINRFADKDSHQIFLEPEGLTTHEFYPNGISTSLPFDVQYDLVRSMRGLE
FT                   NAHILRPGYAIEYDYFDPRSLKSNFETRQIQGLFFAGQINGTTGYEEAAAQGLFAGINA
FT                   ALQCRGESAWLPRRDEAYLGVLVNDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTE
FT                   AGRRMGLVDDARWDAFSRKRDAVARETERLKSTWVNPRNLPAEESARVLGKSIEHEYNL
FT                   FDLLRRPDVTYDALTGMDGGKYASTAVSRETLGELSAPVIEQVEIAAKYAGYIDRQKDE
FT                   VQRAFYYENLQLPQELDYMQVAALSIEVRQKLQKHRPETLGQASRISGVTPAAVSLLLV
FT                   HLKKGGFRGFTAQQADEVAA"
FT   gene            58639..59370
FT                   /locus_tag="Aave_0052"
FT   CDS_pept        58639..59370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0052"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: pol:Bpro_0074
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30667"
FT                   /db_xref="GOA:A1TI79"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TI79"
FT                   /protein_id="ABM30667.1"
FT                   /translation="MTVAADALSAPLRAGAEALGLDLSEAHLGQLLEFLALLQKWNQVY
FT                   NLTAVRDPQEMLTHHLLDSLAAVAPLQRHLRGMQDLPGSAGDGAKLRLLDVGSGGGLPG
FT                   VVFAICCPALDVSCVDTVAKKAAFIQQAAVSLRLRNLRGIHARVENLAGPFDVVSCRAF
FT                   ASLPDFVAWSQAAIAANGVWLAMKGRDPSDEITGLPPIAEVFHVEQLAVPGLDAERCIV
FT                   WMRPRKGAEAGADGVGGPALP"
FT   gene            59400..60014
FT                   /locus_tag="Aave_0053"
FT   CDS_pept        59400..60014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0053"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30668"
FT                   /db_xref="GOA:A1TI80"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI80"
FT                   /protein_id="ABM30668.1"
FT                   /translation="MFGIADYGAFVAAILLFLAIPGPGNLALVTSTGKGGVRAGMAATL
FT                   GVIAGDQVLLWMAVAGVAAMLSAVPAVFHAVQWLGAAYLAWMGGRMLLARPGSAPVIAI
FT                   QPRHYFRQAALITLLNPKAIMFYMAFFPLFVDPARHRGLLTFGVMAATIAVLSFFYGLG
FT                   VVLLTHRMAERMRARPALGRALERLAGTFLIGFGIKLAVAR"
FT   gene            60060..60830
FT                   /locus_tag="Aave_0054"
FT   CDS_pept        60060..60830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0054"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   pol:Bpro_0076 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30669"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI81"
FT                   /protein_id="ABM30669.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTSVNLAAGLAKVGQRVLLVDLDPQGNA
FT                   TMGSGVDKRALELTVYDVLLESASVQEAAVLSEQCGYRVLGANRELAGAEVELVALEQR
FT                   ERRLKSALAPVDKDFDFILIDCPPSLSMLTLNGLCSAHGVIVPMQCEYFALEGLTDLVN
FT                   TIKQVHANLNKDLQIIGLLRVMFDPRITLQSQVSEQLKDHFGDKVFDTVIPRNVRLAEA
FT                   PSYGLPGVVFDPGAKGSQAFVDFAREMVKRVRRM"
FT   gene            60845..61396
FT                   /locus_tag="Aave_0055"
FT   CDS_pept        60845..61396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0055"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   pol:Bpro_0077 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30670"
FT                   /db_xref="GOA:A1TI82"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI82"
FT                   /protein_id="ABM30670.1"
FT                   /translation="MNSMNPDDVLILPGWQNSGPDHWQSRWERRYGYRRVEQHDWMRPL
FT                   RGDWSARLEDVVGDAPRPVVLVAHSLGCILTAWWAAHTRHAGKVRGALLVGPGDVERPD
FT                   IAALLPGWTPVARAALPFPAVLVGSHDDPYCSLERARAMASDWHARFVDAGARGHLNAD
FT                   SGLGDWDEGHALLAPWTETR"
FT   gene            61426..62367
FT                   /locus_tag="Aave_0056"
FT   CDS_pept        61426..62367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0056"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_0078 ParB-like
FT                   partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30671"
FT                   /db_xref="GOA:A1TI83"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI83"
FT                   /protein_id="ABM30671.1"
FT                   /translation="MATKKPKGLGRGLEALLGPKVAEAAPGAEGGASTAAAPGAPSTLA
FT                   LDEMVPGIYQPRTRMDEGALYELAESIKAQGIMQPILVRRLAQGENAGRYEIIAGERRF
FT                   RAARIAGLAEVPVLVREVPDESAAAMALIENIQREDLNPLEEAQGLARLVKEFGLTHEQ
FT                   AAQAVGRSRSAASNLLRLLNLAEPVQTMLMAGDIDMGHARALLSLDRAAQITAGNQIAA
FT                   RKLSVREAEGLVKKIGAEFSLAPQKARKEGKSRDLKRVEEELSDLLMAEVEVRVKKRVK
FT                   RGGRTEEVGELAIQFGSLEALNGLIERLRGEG"
FT   gene            complement(62483..63469)
FT                   /locus_tag="Aave_0057"
FT   CDS_pept        complement(62483..63469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0057"
FT                   /product="integral membrane protein"
FT                   /note="KEGG: xac:XAC3588 integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30672"
FT                   /db_xref="GOA:A1TI84"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI84"
FT                   /protein_id="ABM30672.1"
FT                   /translation="MHPRTAVAAALACTAAYVAALVWADARNQVFAQLPRVAAWMPGMA
FT                   AVAFASYALRYARWRWLLRRAGHRVPAVAGFAGYLAGFAFTATPGKVGELVRARYFTRW
FT                   GVPAARTLSAFVYERAFDLLTVALLAALAVPSGRLFGIVLAFVAGLIGAVAAVAARPRW
FT                   LRRLAARMRATGWRRTARAGRMLALGLAGCRLWLTPCDMAVSFGLGLAAWMIIAASFAW
FT                   LLQGLDIALPLRAALSTYPTAMLAGAASMLPGGIGTTEATIVALLALHAVPLGTAALAA
FT                   VGIRFATLWVAVACGFAAIGWLERRPSAGVATVLPAGERATPARRKT"
FT   sig_peptide     complement(63395..63469)
FT                   /locus_tag="Aave_0057"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.780 at
FT                   residue 25"
FT   gene            complement(63480..63911)
FT                   /locus_tag="Aave_0058"
FT   CDS_pept        complement(63480..63911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0058"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rso:RSc0167
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30673"
FT                   /db_xref="GOA:A1TI85"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI85"
FT                   /protein_id="ABM30673.1"
FT                   /translation="MIAAFRSRQFLAFLVTGGVAALANFGSRIAFSHWMPFSAAVIAAY
FT                   CVGMCTAFVLARAFVFKASTQSTHKSAMFFVLVNLLAVAQTWAVSMALLQWVLPALGIT
FT                   AFAPEIAHAVGVVVPVFTSYLGHKRWSFAEQPPRRGPTG"
FT   sig_peptide     complement(63813..63911)
FT                   /locus_tag="Aave_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.899 at
FT                   residue 33"
FT   gene            complement(63908..65269)
FT                   /locus_tag="Aave_0059"
FT   CDS_pept        complement(63908..65269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0059"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: dar:Daro_1705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30674"
FT                   /db_xref="GOA:A1TI86"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI86"
FT                   /protein_id="ABM30674.1"
FT                   /translation="MNAAAFSSATSAADSAMARGQRIAVLGAGPMGLAVAYQLARDGHR
FT                   PVVFEADDRVGGMTAMFDFDGLPIERYYHFHCTSDHDFLQVLDELGLADKMRWRATRMG
FT                   YWFQKRLQAWGNPVALLRFQGLGLVAKFRYGLHAFLSTRRDDWKPLDGVEATGWIRRWV
FT                   GAEAYEVLWRRLFEYKFYEHTGNLSAAWIWSRIRRIGRSRYSLMQEKLGHLEGGSATLL
FT                   DGMAADIRAHGGEIRLSTPVTRVRMEAGRVQGVETAQGFEAFNKVVSTVPLPFVPRLMP
FT                   DLPQDVLARFAALKNIAVVCVIAKLRKPLTENFWLNVNDPEMDIPGLVEYSNLRPLPES
FT                   IVYVPFYMPGEHPKYAEPDQAFLDKVKRYLRTINPALQDSDFLAMRASRYRYAQPICPP
FT                   NYLESLPPVQLPVQGLWVADTSYYYPEDRCISESIGFGRRMARDAAQAATGSRP"
FT   sig_peptide     complement(65213..65269)
FT                   /locus_tag="Aave_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.438 at
FT                   residue 19"
FT   gene            complement(65269..66210)
FT                   /locus_tag="Aave_0060"
FT   CDS_pept        complement(65269..66210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0060"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: bxe:Bxe_A3788 putative transmembrane
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30675"
FT                   /db_xref="GOA:A1TI87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI87"
FT                   /protein_id="ABM30675.1"
FT                   /translation="MQHTTKIVLPGGAGLVGQNLVAHLKLHGYANLVVLDKHAANLEIL
FT                   RRMHPDIVAELADLAEPGDWERHFEGADAVVMLQAQIGAPQAEPFVRNNLTSTERILAL
FT                   IQRHRIPHTVHISSSVVESVAKDHYTDTKRAQEEMVLASGIPCVVLRPTLMFGWFDRKH
FT                   LGWLSRFMRKVPVFPIPGSGRYMRQPLYAADFCRIIVRCIEERRVGGVFNITGLEKVDY
FT                   IDIIRTIKSATGAKAAIVKIPYGLFYMLLKVWALFDRDPPFTADQLKALVAHDEFEVID
FT                   WPGIFGVRATPFAEAIHETFHHPEYSRVVLEF"
FT   gene            complement(66262..68028)
FT                   /locus_tag="Aave_0061"
FT   CDS_pept        complement(66262..68028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30676"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI88"
FT                   /protein_id="ABM30676.1"
FT                   /translation="MTNDESLSSTPPARRTWRQRIPFALLMVFTAVYALATAVSAWRTF
FT                   TPVPIWDMWAAALEFYIDVHRGVGWDAWWRQVNEHRLVLPKALFWMEYTWFGGQQVFLI
FT                   IMNYVLVGCGLAVFVVFLRARLPAMSGRSRFFGATLLALWLFSWVQKENLAWANQGQFF
FT                   LAQLLPLAGFYCLYRAACAPSARGWFPAACTIGVLSVGTMANGVMALPMMVLYAAVTRL
FT                   GWRRTAILAVLAAVCAGAYAVGYTSPSDHGGVFSKLRDRPLDMLSYILVYLGSPFQHFV
FT                   LKQHSPSWTPLSQAFGVLFVLLSLAPLPRALRDPRAHRLDLALLTFVAYIGGLAFATSG
FT                   GRVHFGLESALSSRYTTPTVMAWAALAILYAPRLVALRGAARVVMHVLLIALLAQMLVV
FT                   QMSDTGRKAEQHMRMTGALALQMGVHDTRRIGMLIWNEQYGARLVRGATAIGAGVFGRP
FT                   ALVDATHALGEKAEAVPARCHAFVDQVETLPGEPRFVRVQGGLLPEPGRTPFEAVRLVG
FT                   ADGTVVGYGLPDRWRKRTPPAHAPGPFGRYLMFTAYLQVPASGQLPPAVTLQAPGTPCS
FT                   AALVLAPPVPAS"
FT   sig_peptide     complement(67918..68028)
FT                   /locus_tag="Aave_0061"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.552 at
FT                   residue 37"
FT   gene            complement(68041..68805)
FT                   /locus_tag="Aave_0062"
FT   CDS_pept        complement(68041..68805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0062"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: dar:Daro_1708 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30677"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI89"
FT                   /protein_id="ABM30677.1"
FT                   /translation="MPDTSSPRTIAIVGATSAIAHQCARLWLAAGGVDRLVLIGRDGAR
FT                   LPSVAADLQVRQPGTRIEAIAADMLQPEAIAGTVRGVCADGVPDLVLIAHGNLPDQPAC
FT                   EADLAAARQALEVNGLSPALWAEAFAGAQQSRGRGRIGIIGSVAGDRGRQSNYVYGAAK
FT                   GLVERYAQGLQHRLAGTGVRVTLVKPGPTDTPMTAHLKAQGARLATPEEVAGAIVRGMA
FT                   RGAPVVYAPAKWALIMLVIRHLPRAVFHRMKI"
FT   gene            complement(68878..70185)
FT                   /locus_tag="Aave_0063"
FT   CDS_pept        complement(68878..70185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0063"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dar:Daro_1709 FAD linked oxidase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30678"
FT                   /db_xref="GOA:A1TI90"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI90"
FT                   /protein_id="ABM30678.1"
FT                   /translation="MVAVHSWGRLRAAEHALRALSEHPPARLPLPAGQHGLAYGMGRSY
FT                   GDVCLNPGGTLWATRGQDRFIAWDEATGELTCEAGVLLRDIQRTFIPRGWMLPVTPGTQ
FT                   FATVGGAIANDVHGKNHHVHGSFGDHVLALHLLRTDGLLVRCGPDLRPDWFCATVGGLG
FT                   LTGVVTQATLRLRRVAGPWLDTETLPYGSLREFFTLADASEAGWEYTVSWIDCLAGADA
FT                   RGIFMRGNHVPGPVAKPPPEPRGGKRTVQFVPPVSLVNRWSLRPFNTAYYHLHKRRAGR
FT                   ALQHYEPFFYPLDNLLEWNRIYGRRGFYQYQCVVPREGGEDAVAALLREIAASGQGSFL
FT                   GVLKTFGQRRPLGMLSFPMPGVTLALDFPNLGEPTLRLFERLDAVVASAGGRLYAAKDA
FT                   RMPRTLFEAGYPRLPEFLPYRDPRIRSAMSLRLLGD"
FT   gene            complement(70179..71648)
FT                   /locus_tag="Aave_0064"
FT   CDS_pept        complement(70179..71648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0064"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: dar:Daro_1710
FT                   UbiA prenyltransferase:PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30679"
FT                   /db_xref="GOA:A1TI91"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI91"
FT                   /protein_id="ABM30679.1"
FT                   /translation="MRPSSQPSPCADALPLVVDLDGTLLLTDMLHESALQLVRDAPWKA
FT                   LALPVWLAGGKAALKRRIAQQVDLPVAHLPYNQRLVAWLREQRAAGRRVVLCTASDQGL
FT                   ADAVAAHLGCFDAVMASDGATNLAGPAKAGALVRAFGERGFDYAGNSHADLPVWKAARA
FT                   AIVVNAQGSVARRAEAQGNVQRSFPPAPAGASAWRRALRLHQWMKNLLLFVPLLAAHRV
FT                   GDGAAWMQLFVAFLAFGLCASSVYLANDLLDLESDRQHPRKRLRPFAAGTLPAWQGVAF
FT                   VPVLAGASLWLAWATGPAFLGWLLVYFATTWAYSLVLKRWALVDCVALAVLYTLRVVAG
FT                   AAAVAQPLSFWLIASSGFLFLSLAFVKRYAELLVQQAAGKTQAHGRGYLTSDAPIVQSL
FT                   GVASGYTAVVVLALYLNSDTVFTMYRSPGLIWIAVPALAFWVSWMWLQAARGQMHDDPL
FT                   VFAFKDRASLVAGAVFVAALAAAATGPGWPW"
FT   gene            71792..72607
FT                   /locus_tag="Aave_0065"
FT   CDS_pept        71792..72607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0065"
FT                   /product="methyltransferase type 12"
FT                   /note="KEGG: rfr:Rfer_0054 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30680"
FT                   /db_xref="GOA:A1TI92"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI92"
FT                   /protein_id="ABM30680.1"
FT                   /translation="MRTASRSLFPFDDETRSMPIPLPWPLPALLAWAAAWLAFALLRGV
FT                   AGVPWWGAWLAGCVVGVLASLGGSTRWRQGFIAAGFPLSFLAAGAAQVPAWAWLAPLGV
FT                   LLLVYPLNAWRDAPLFPTPQGALGGLAAAAPLAPGASVLDAGCGLGHGLHALRRAYPAA
FT                   RLEGLEWSWPLRCLCALRCPWARVRQGDIWRASWKGYRMVYVFQRPESMARAAAKAHAE
FT                   MAADAWLVSLAFEVPGAVPEAVLRPAVGHPVWIYRAGSLPPGRGDAPAL"
FT   gene            72723..73763
FT                   /locus_tag="Aave_0066"
FT   CDS_pept        72723..73763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0066"
FT                   /product="Peptidoglycan-binding domain 1 protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein; KEGG:
FT                   mfa:Mfla_1720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30681"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI93"
FT                   /protein_id="ABM30681.1"
FT                   /translation="MSQKTFTLLAVACAAALLSGCETTNMRMGSAESKTVATGAAAGES
FT                   SANANTQLERCASPLGTVSLVENQDAGWYTILRNEYRLPPTSNLLRLLIQQSNCFVVVE
FT                   RSMAGMGAMNRERAIMQSGEMRGGSNFGQGQMVASDYGLSPEIIFSNSDAGGIGGALGA
FT                   LIGGGGGRAIGALGGALKTREASAMLTLVDNRSGVQVSVSEGSASKSDFAGFGGLFGGS
FT                   AGGGLGGYQNTSQGKVLTAAFMDAYNQMVMALRNYKAQKVQGQGLGGGGRLGVDGGMAP
FT                   SQTKAGAAMSVREAQARLNALGYDVGAPDGGMGPKTANGLRAFQKDKGLPVTGRLDAAT
FT                   TDALSR"
FT   sig_peptide     72723..72785
FT                   /locus_tag="Aave_0066"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.919 at
FT                   residue 21"
FT   gene            complement(73816..75756)
FT                   /locus_tag="Aave_0067"
FT   CDS_pept        complement(73816..75756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0067"
FT                   /product="Carboxylesterase, type B"
FT                   /note="PFAM: Carboxylesterase, type B; KEGG: ddi:DDB0183832
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30682"
FT                   /db_xref="GOA:A1TI94"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI94"
FT                   /protein_id="ABM30682.1"
FT                   /translation="MRHPHTIRGAWLALSIAAVLSGTGCSTARTDHEASAAPGSACASG
FT                   TSATFSNGASVCGSQAAVTPAGGSAVAVNTYLGIRYARADRFQPPQLTPPAGSNVPQTM
FT                   PGAFCPQPNSTVFPNQSEDCLYLNVFTPQSALGASRPLPVLFFIHGGAFVEGSGYQPSR
FT                   NGNILDGSYLAATGDMVVVTINYRLGALGFLAIDDPVENPSIAGPLTGNFGILDQQAAL
FT                   KWVQQYIGTFGGDPARVTVAGESAGAMSTGLHLFAAPGSAQLFQAAIMESNPAGSMYRT
FT                   TDRAQQMGARFHDHLCKIVNNCGTARQPLPVLRTASANQIIAAQSQVFIPRAIQGAASA
FT                   QEQKAIQALAATPVIGILGEGAPQTRDGLPWSPTLDGTVIAGQPLAGYATARSGPLPAK
FT                   PFVFGINRDEGVVFADMAYLQLDKKLFPFMVNDMALGWVWGNDRTRITGYIVQGAAPYK
FT                   APAASAPSYMDNGSAVTLSNIINDFAFRCANLAMAGRGAAANAKASPALPAFGYLFAQA
FT                   PIFNLYRDKTGAPVPACQPDAGNICHANEIPYVFNTVGHLDPQHPVPRADQALSQTMAA
FT                   AWASFVNNPSSPAPWAASGSLPTRWAPYAGLSSQLTQWNTAGDSSVSASRIDQGANCSA
FT                   LWNTIAPIAGN"
FT   sig_peptide     complement(75670..75756)
FT                   /locus_tag="Aave_0067"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.768 at
FT                   residue 29"
FT   misc_binding    75909..76183
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam (RF00174),
FT                   score 67.33"
FT   gene            76275..77156
FT                   /locus_tag="Aave_0068"
FT   CDS_pept        76275..77156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0068"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /EC_number="2.1.1.133"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: pol:Bpro_2779 precorrin-4
FT                   C11-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30683"
FT                   /db_xref="GOA:A1TI95"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI95"
FT                   /protein_id="ABM30683.1"
FT                   /translation="MPDSSAQANGACDTAVPGPGTVWFVGAGPGDPDLITVKGRSLVER
FT                   AGAILFAGSLVDETATRWAPPGCTIADSKSMTLDQMAAWLVLQAQKHRTVVRLQTGDPA
FT                   LYGALVELVQPLDAAGVPVRVVPGVSSAMASAAAAVESFTLPEVTQTVVFTRVEGRTPM
FT                   PSGESLAELARHRCTLCIFLSITLLHKVQAGLREAGWPDDAPLLVVHKASWPGEERIVR
FT                   CTVADVRERCREAQVVSQAMIIASPTLGARHWPELARSKLYDPGFTHRFRRAADVPAAA
FT                   PQAATNTPEPQR"
FT   gene            77153..78259
FT                   /pseudo
FT                   /locus_tag="Aave_0069"
FT   gene            78256..78975
FT                   /locus_tag="Aave_0070"
FT   CDS_pept        78256..78975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0070"
FT                   /product="precorrin-8X methylmutase"
FT                   /EC_number="5.4.1.2"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   pol:Bpro_2777 precorrin-8X methylmutase CbiC/CobH"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30684"
FT                   /db_xref="GOA:A1TI96"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI96"
FT                   /protein_id="ABM30684.1"
FT                   /translation="MSTVNTVTEQLTRAGQAIEHDSFAIIDAEAGPHAYTAQQWPIVRR
FT                   MIHANADFEFNGLTDFHPEAVEAGMAAMLRGGAPVVADVEMICSGLSQPRLAHFGMRTH
FT                   QFISDADVIARAQAEDTTRAVQAMRKAHRLGLLQGAVVGIGNAPTALIELVRLIREEGV
FT                   RPALVVGMPVGFVSAAESKDLMAEVAEVPWIVIRGRKGGSTLVVAALHALLALAEARQK
FT                   QQPQQPAQGPARSATGG"
FT   gene            78983..80110
FT                   /locus_tag="Aave_0071"
FT   CDS_pept        78983..80110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0071"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   pol:Bpro_2776 cobalamin biosynthesis protein CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30685"
FT                   /db_xref="GOA:A1TI97"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TI97"
FT                   /protein_id="ABM30685.1"
FT                   /translation="MMEKTVRRGTRTGFTTGACSAAAARAAVLGLVEGAVPEAVDCLLP
FT                   NGDVVRFAVNDGACEAGQAAHAMVIKDAGDDPDCTDKAHLTADVRVLPGRAGEVVLCGG
FT                   FGVGTVTMAGLGLEVGGPAINPVPRRNIEENVRAVGGPLLANAGIEVTISVPQGVEMAR
FT                   KTLNARLGILGGISILGTTGIVKPYSTSAYRASVVQGVQVAATLGHGVVVLTTGGRTEQ
FT                   FAMKERPELPAACFVQMGDFLRYALDEAVAQGLREVVIGGMVGKLTKIAQGETITHANR
FT                   AEVDTQLLAELAARVGAPPDVCAEIAAAETARFGAERMQALGLGEPFHHALAQAVVQTL
FT                   TAPDRYGDRFHLTVLVCDFDGSKITEAASGPAATA"
FT   sig_peptide     78983..79063
FT                   /locus_tag="Aave_0071"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.970 at
FT                   residue 27"
FT   gene            80113..81456
FT                   /locus_tag="Aave_0072"
FT   CDS_pept        80113..81456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0072"
FT                   /product="precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating)"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: pol:Bpro_2775 precorrin-6y
FT                   C5,15-methyltransferase, subunit CbiE; TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30686"
FT                   /db_xref="GOA:A1TI98"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI98"
FT                   /protein_id="ABM30686.1"
FT                   /translation="MTTTNLLEKDPQPCRVIGVLDDGAASLSATALALLRRADLVIGGT
FT                   RTLALLEDDIAPQAVRRDLTGCLSSVPGWIAEARAAHQACVVLATGDPLCHGIASYLAS
FT                   RLCIQALEVMPNVSTLQLACARLGLAWQDARIVSVHAKDAGEWTVGAEPAHGLYALAQA
FT                   VRQHDRLAVLTSPDNTPARIARLLVAEGLGDDFQISVAERLCTPDERVWADMAPAAAAA
FT                   QDFADPNVVLLVRTRQRPDAVRFGLPDAAYHQRQPDKGLITKQEVRAVSLARMQLRAAS
FT                   RVWDIGAGSGSVGLEAARLCPQGHVWAMEKNEGDVEIARRNVRDFGVSNHTLVHGKAPE
FT                   GLDAWPDPDAVFIGGSGGELAELIALCLKRLRPGGWLVMNFVTLENLAAATQALQAAGA
FT                   AWDVLQLQAARSKPILHMHRMAAENPVWIVCAQAGSVGTAAVAVEEGA"
FT   gene            81453..82352
FT                   /locus_tag="Aave_0073"
FT   CDS_pept        81453..82352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0073"
FT                   /product="cobalt-factor II C20-methyltransferase"
FT                   /EC_number="2.1.1.151"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: pol:Bpro_2774 precorrin-2
FT                   C20-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30687"
FT                   /db_xref="GOA:A1TI99"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1TI99"
FT                   /protein_id="ABM30687.1"
FT                   /translation="MTAEHTTITSAPRPQDTHTPPTRGPLGRLIGVSLGPGDPGLITRA
FT                   AWAQLQRTDAVWTYPARSTKTPSYAFDIVQRAGLAPPATHQTLLFPMTHDGDKLARAWM
FT                   RAADTVLPWLQAGQDVLFLVEGDASTYATFGHLARTVRALDARIEVPVIAGVNAFTAAC
FT                   ATRGMPLAEQDDTIAIVPAAYGVSAVDRLLPDFDTLVLMKVKPLMDDLIDWLERRGLLP
FT                   NTQFIERVGAPDERCVAGTDLPALRGTKVSYLSLMVVKNPHRIRGERIKGCLKKTLPAA
FT                   STASVVDQPLSDEPELAE"
FT   gene            82349..83140
FT                   /locus_tag="Aave_0074"
FT   CDS_pept        82349..83140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0074"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: pol:Bpro_2773 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30688"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR021745"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA0"
FT                   /protein_id="ABM30688.1"
FT                   /translation="MNTPATPDVVLSAPAQPAGEVRVCLVAITRHGAAQAAQLARDVPQ
FT                   AHVCTAAKFAAAFEGLPNTVRAYEGALRDEIAPLFAQYDQLVFFVSLGAVVRLIAPVLK
FT                   SKDEDPGVTVVDDAGQFVIPVLSGHVGGANEWSERIAALIGATPVLTTASDVGKTIPVD
FT                   ILGRHLGWRVEAPKINITRVSAHVVNGEPIAVVQEAGSRQWWNRPTPLPANITCLDGWS
FT                   GVEPGRFQAVLWITHDEVAPERWAAWHERLVVYRPPVEAAA"
FT   gene            83137..83595
FT                   /locus_tag="Aave_0075"
FT   CDS_pept        83137..83595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0075"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: dar:Daro_1686 cobalamin (vitamin B12)
FT                   biosynthesis CbiG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30689"
FT                   /db_xref="GOA:A1TIA1"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA1"
FT                   /protein_id="ABM30689.1"
FT                   /translation="MSTAHGVRPAPRLAIGLGCDRGTPEATVEACLREALAQVGAQVAQ
FT                   VAVAASIEAKHDEAAFLSLAARHGWPLRWYAAAQLAAVPVPNPSETVLRYMGTPSVSEA
FT                   AALLAAGAADASALLVEKHRLRGPDGRNATVSIARIAPAPQGTSDSGG"
FT   gene            83651..84319
FT                   /locus_tag="Aave_0076"
FT   CDS_pept        83651..84319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr3274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30690"
FT                   /db_xref="GOA:A1TIA2"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA2"
FT                   /protein_id="ABM30690.1"
FT                   /translation="MHIEIGILSQDKIAYASVAATALLGAHALPLLKSPTAWLRTLLAA
FT                   FFFSVLMQVWHMPIGPSELHFVGAMPIYLLFGFIPTLFGFGLGLLAQALVFEPQDLAHL
FT                   AINFLSLAVPLVAVHHGVGKRLARISVANVLKLDAMYYAGVTLMVGFWLSISSDPAPVA
FT                   DWALFAASYLSLVAVEPLLTIAITLGATRLRGRRWLAACIDEGTLQRIAAPGATAATAA
FT                   "
FT   gene            84365..85354
FT                   /locus_tag="Aave_0077"
FT   CDS_pept        84365..85354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0077"
FT                   /product="precorrin-3 methyltransferase / precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating)"
FT                   /EC_number="2.1.1.131"
FT                   /EC_number="2.1.1.132"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: pol:Bpro_2767 precorrin-3B
FT                   C17-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30691"
FT                   /db_xref="GOA:A1TIA3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA3"
FT                   /protein_id="ABM30691.1"
FT                   /translation="MLVGIGPGSTDHMTARARAAIAEADTIIGYVTYIKLVADLIEGKE
FT                   IIRKSMTEELDRAIEALARAREGKKVALISSGDAGVYGMAGPTFEVLFQAGWTPPEVDE
FT                   NGVPDPEGIEVEIVPGASALNSCAARVGAPLTHDFCAISLSDLLTPWPTIARRLDAAAM
FT                   ADFVVALYNPKSGRRTRQIEEAQRLFLRHRSPDTPVAIVKSAYRRRERIEFATLATMCD
FT                   ADIGMLSTVLIGNSNTIVQHGLMVTPRGYANKYDVEGGGATREGERPGRSLSTGLNGWL
FT                   ENLQLDHAAGESIEALALRHRLPADYIRDTLAQPLVIAEAAATTEDEA"
FT   gene            85351..85743
FT                   /locus_tag="Aave_0078"
FT   CDS_pept        85351..85743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2766 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30692"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA4"
FT                   /protein_id="ABM30692.1"
FT                   /translation="MSTDTPENTTAAATPEGVRVVVKPKIGSYRRHILICTGPRCAQEG
FT                   QAQALFDSLGEKFKAAGLNDGDLRVKRSRVSCFAACKGGPVMCVQPDGTWYYDVTPANM
FT                   DRIIEQHLVGGQPVEDLVFHQGPTGG"
FT   gene            complement(85837..86145)
FT                   /locus_tag="Aave_0079"
FT   CDS_pept        complement(85837..86145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30693"
FT                   /db_xref="GOA:A1TIA5"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA5"
FT                   /protein_id="ABM30693.1"
FT                   /translation="MATPGRRFPFLARHWFGALCALLGLAPLVLLLAWWPLATLLECSG
FT                   NEGSGMHCAAAPGLSDMAYTVFMAGAWGSLFTLPAALSLYLVGAGLRWLLGRPGDSR"
FT   sig_peptide     complement(86044..86145)
FT                   /locus_tag="Aave_0079"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.637 at
FT                   residue 34"
FT   gene            complement(86162..86380)
FT                   /locus_tag="Aave_0080"
FT   CDS_pept        complement(86162..86380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30694"
FT                   /db_xref="GOA:A1TIA6"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA6"
FT                   /protein_id="ABM30694.1"
FT                   /translation="MNATRLVALALIVAGALGLAYGGFSYTKDTTVVKLGPLEISAKEQ
FT                   ERVNVPLWLGIGAIAVGGLLLVVGGRK"
FT   sig_peptide     complement(86297..86380)
FT                   /locus_tag="Aave_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.909 at
FT                   residue 28"
FT   gene            complement(86503..87132)
FT                   /locus_tag="Aave_0081"
FT   CDS_pept        complement(86503..87132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0081"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30695"
FT                   /db_xref="GOA:A1TIA7"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA7"
FT                   /protein_id="ABM30695.1"
FT                   /translation="MTSTARTLHSYEPRSGHRLPHDPFNAIVGPRPIGWISTRSAAGVL
FT                   NLAPYSFFNAFNYVPPIVGFASIGAKDTLANVQATGEFVWNLATRDLAEAMNQTCAAVP
FT                   PEVDEFTLAGLTPLASERVAPPRVAESPVTFECRCTQVLQLQGADGVQVPTWLVLGEVV
FT                   TIHIDTALLKDGVYDTASAGHILRAGGPADYFSVGPEQKFKMYRPR"
FT   gene            complement(87190..88104)
FT                   /locus_tag="Aave_0082"
FT   CDS_pept        complement(87190..88104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0082"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: bte:BTH_I1991 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30696"
FT                   /db_xref="GOA:A1TIA8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA8"
FT                   /protein_id="ABM30696.1"
FT                   /translation="MPSTALSASGDGPRPARAPRTQRALSYVDSLTPHLFVPSAARPVR
FT                   AKARHLSADTQVLPHSHPWAQVAVSTTGAIRLTVAQGTYIVPPSRALWIPPGVEHTVTM
FT                   VESADLRTLYLYQPRGHCGPGVPRAEQAPWRQCRVLEVSDLLRALVREMPCEPDDAPPP
FT                   SGEALHRERLLSALLLDELRRAPVVRLGVDLPRDKRLRHLCEAMLADPTRHEALADWAR
FT                   DTGASPRTLARLFRTELHTTFTQWRQQVILAQAVALAATRRPMGQIAAELGYSPSAFSA
FT                   MVRRTVGMAPGRFLGTQAGSRSG"
FT   gene            88169..89440
FT                   /locus_tag="Aave_0083"
FT   CDS_pept        88169..89440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0083"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_1946 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30697"
FT                   /db_xref="GOA:A1TIA9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIA9"
FT                   /protein_id="ABM30697.1"
FT                   /translation="MTSINAPTATLRQDARTIGLIGLAHGSSHFFHLLLPPLFPFLIAE
FT                   FGYSYSELGLLVSVFFVISGVGQALSGFIVDRVGARPVMFFALSSFVLSGLVASIATGY
FT                   AGLMAAAALAGLGNAPFHPVDFTILNKRVSPQRLGHGFSVHGISGNLGWATAPVFMAGI
FT                   TAATGSWRAACLCGGLLALVILSIMVLNRDALDDRRGKAAPAAGKPGAATAPAGAPAEH
FT                   PMAFLRLPSVWLCFSFFFWTTCSLSVIQSFAGPTLQKMYGLPLSVTSMVVTGYMLCGAA
FT                   GMVVGGFLAGRVARLERTITVCLLATAVLLVAAGTGLLPGMAAMVFVALAGVGTGLAGP
FT                   SRDMLIKRAAPPGATGRVYGTVYSGLDLGFCMAAPVFGAMLDAGMTSGIFYGSAAALVL
FT                   GVASAGVVGIGVAARARAQRMAVA"
FT   gene            89484..90404
FT                   /locus_tag="Aave_0084"
FT   CDS_pept        89484..90404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30698"
FT                   /db_xref="GOA:A1TIB0"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB0"
FT                   /protein_id="ABM30698.1"
FT                   /translation="MPGVLIEQLHGGNCLRVCVRPRLLAAAMLLAGGLLAVLPWIVAVP
FT                   WVADPQARARLASEGPWAVAVLVLWGVLVCGGGIALLRFAPRSREARLSRLEGTGEALR
FT                   HFRGAPSVRDMGVILSHIDAIWLRRVPHGRGGLRREELVLRCVHGGPRVLAWVVLPRAG
FT                   APSRLEAAARAAGGFLGVPVALEGEPLPPRSAALRRQIRSLPKVAEPPVDTPRLRLPGR
FT                   CMAAAGAALAALFAAWLAWQVAGAVQTGHLVIHPRAGGARHYDWNAAPGPFAIQLVFTA
FT                   ALAALCALIAWLAAKVALGGGNRSA"
FT   gene            91292..91858
FT                   /locus_tag="Aave_0085"
FT   CDS_pept        91292..91858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0085"
FT                   /product="AvrPphB putative peptidase"
FT                   /note="TIGRFAM: cysteine protease domain, YopT-type; KEGG:
FT                   bja:blr2140 hypothetical protein; Cysteine peptidase;
FT                   MEROPS family C58"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30699"
FT                   /db_xref="GOA:A1TIB1"
FT                   /db_xref="InterPro:IPR006473"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB1"
FT                   /protein_id="ABM30699.1"
FT                   /translation="MSTSVFAYQTAELEQANVEGICVGLVTEWLRRPNQSPSGRMAALA
FT                   RDTPSHAQAALRQQKYQQDKDALRAQGMGAADADMRAQNGVLREAGLRPADNEDIYRSD
FT                   ALSDVARAVSTNGTRHLLGLYFTDGTAHTVATSAAGGKVTLFDPNFGEFEAPPRRMGGL
FT                   MQSLSNRYERPNGHILMAVSVQSMH"
FT   gene            complement(92460..92864)
FT                   /locus_tag="Aave_0086"
FT   CDS_pept        complement(92460..92864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmb:BruAb2_0840 HdeA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30700"
FT                   /db_xref="GOA:A1TIB2"
FT                   /db_xref="InterPro:IPR010486"
FT                   /db_xref="InterPro:IPR036831"
FT                   /db_xref="InterPro:IPR038303"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB2"
FT                   /protein_id="ABM30700.1"
FT                   /translation="MRVLARLSVLTLSSLAAAAAMAQTPSPAAPSAAATNPAAATAPAA
FT                   KARKPLVKTTCSDYVGMDETVKPKFIYYAVGHTQGGKKEAVFEEDAIEKIKPELDQYCS
FT                   VHLTKSAYAKVMASSMASEGSAAHGHSKAK"
FT   sig_peptide     complement(92796..92864)
FT                   /locus_tag="Aave_0086"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.891 at
FT                   residue 23"
FT   gene            complement(93019..93462)
FT                   /locus_tag="Aave_0087"
FT   CDS_pept        complement(93019..93462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30701"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB3"
FT                   /protein_id="ABM30701.1"
FT                   /translation="MHTTRSPDGLHRAALRFEGEIRFGPEYFRLAIDGREVPHRIFGRP
FT                   LCWSPDSRVVVAQEWLTTDDGEGPVTCAALIDVQAWAIARLEVAVKGFAEDFRPDDAGT
FT                   LRYRMRFPAMGEVFDVAMETSAVHAWTGIDVQPRPQAPHSQPL"
FT   gene            complement(93500..94108)
FT                   /locus_tag="Aave_0088"
FT   CDS_pept        complement(93500..94108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0088"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: sme:SMc01203 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30702"
FT                   /db_xref="GOA:A1TIB4"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB4"
FT                   /protein_id="ABM30702.1"
FT                   /translation="MHLHAPQAAFLAGLLAYQAIRTIYQRRARAAGPSRASYSSRQDKA
FT                   LIALVAIGQMVLPLAYIFTPWLDGASHDVAPDVLPYAGALVWAAGLWVFWRAHAELGTW
FT                   WSITLEIRHDHQLVQRGVYRAVRHPMYAAFLLFGVAQALLLPNAIAGPAALVAVAILCI
FT                   VRIPREEAMMCEVFGQAYRDYMRTTGAVIPRLVPRRRIA"
FT   gene            complement(94453..94953)
FT                   /locus_tag="Aave_0089"
FT   CDS_pept        complement(94453..94953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30703"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB5"
FT                   /protein_id="ABM30703.1"
FT                   /translation="MADRFTIDRFLVKLKQLYWQSTLAAEEATQYWADVATTSQSPLAP
FT                   LAHVPGVFSALWLPDVAPTTATVLGTAGYGFAALPKHLIHFTTPAGAAGIAHSGLIHAS
FT                   RAGAHGIFGPGVYMARVGLPLNMMIKEGATIPIHLATPAGTVRILPYFVYVRWGSHALR
FT                   IAK"
FT   gene            complement(95203..95526)
FT                   /locus_tag="Aave_0090"
FT   CDS_pept        complement(95203..95526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0090"
FT                   /product="protein of unknown function DUF1294"
FT                   /note="PFAM: protein of unknown function DUF1294; KEGG:
FT                   dps:DP2067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30704"
FT                   /db_xref="GOA:A1TIB6"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB6"
FT                   /protein_id="ABM30704.1"
FT                   /translation="MLLAGYGLGHPPRWTLWLYLGASVVTFLAYAIDKSAARRGAWRIA
FT                   ERKLHWLALVGGWPGALVAQQVLRHKSTKAEFRTVFWATVVLNLTGFYFLASPYARVLW
FT                   QRF"
FT   gene            complement(97864..98676)
FT                   /locus_tag="Aave_0091"
FT   CDS_pept        complement(97864..98676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0091"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30705"
FT                   /db_xref="GOA:A1TIB7"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB7"
FT                   /protein_id="ABM30705.1"
FT                   /translation="MPRKPYPTDVSDEEWSFAAPYLSLMDQRAPQREHDLREVFNALRW
FT                   LVRAGAPWRMLPNDLPPWEAVYQQTRRWLEAGCFEAMVSDLRSIIRVAQGRQGQPSAMV
FT                   MDGRTLQSSCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHVTPANEQERAQVQRLC
FT                   GDVQQATGHSVKLGWADQGYTGEVAAEAARDNGIDLQIVKLPEAKKGFVLLPRRWVVER
FT                   SFGWLARFRRLTRDYERLPEVLGGLHFLVFAVLMLPAAARVLAAAGSS"
FT   gene            99216..99434
FT                   /pseudo
FT                   /locus_tag="Aave_0092"
FT   gene            99449..99970
FT                   /locus_tag="Aave_0093"
FT   CDS_pept        99449..99970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0093"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cvi:CV0957 TIS1421-transposase protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30706"
FT                   /db_xref="GOA:A1TIB8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB8"
FT                   /protein_id="ABM30706.1"
FT                   /translation="MELGEHRWLVGAKPPGGQETGPNPTDRGKLGSKRHIVVDARGIPL
FT                   VVLVSGANRHDSMMFEKCTNALPAIKGLRGKPRCRPSRLHADKGYDYARCRAYLKKRGI
FT                   ASRIARRGVESRERLGRHRWVVERTHGWFAGFGKLRIRFERRLDIHEALLKLAAAIICA
FT                   RLWTGGVSRS"
FT   gene            complement(99984..100307)
FT                   /locus_tag="Aave_0094"
FT   CDS_pept        complement(99984..100307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0094"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: bbr:BB0411 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30707"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB9"
FT                   /protein_id="ABM30707.1"
FT                   /translation="MTSQERVAPCFFAVLFTDRPYQGDVRAAHLQAHIAWLEQHKEIIP
FT                   VGGLLRQEMGQTPKGGLWVAEADSKEQIEELLKSDPFFIAGLRQSHEILHWCKANADRK
FT                   ALF"
FT   gene            complement(100304..101728)
FT                   /locus_tag="Aave_0095"
FT   CDS_pept        complement(100304..101728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0095"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30708"
FT                   /db_xref="GOA:A1TIC0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC0"
FT                   /protein_id="ABM30708.1"
FT                   /translation="MNAPTATAHLLPEIRLRPVPQAFMDALQARFGTQCSLAQAVREQH
FT                   GRDEGSMQAPPPSAVVFAESTQDVADAVRLAAQHDVPVIPYGAGSSLEGHLLAIQGGIS
FT                   IDVSRMNRLLSVDADDLTVTVQPGITRKQLNEAIKDTGLFFPIDPGADASIGGMAATRA
FT                   SGTNAVRYGTMRENVLALEVVTAAGEAIRTGTRAKKSAAGYDLTRLLVGSEGTLGVITE
FT                   VTLRLYPLPEAVSAAICSFPSIEAAVRTVIQTIQLGVPIARVELIDAHTVRMVNAHSKL
FT                   GLREEPMLLMEFHGSPAGVQEQAETVQSIAQEWNGNAFEWATTPEERTRLWTARHNAYF
FT                   AAVQSRPGCRAISTDTCVPISRLADCLLDSVTEADASGIPYFLVGHVGDGNFHFGYLID
FT                   PDSDDERMVAERLNHQLVARALAMGGTCTGEHGVGIHKMGFLLDETGPGAVGMMRAIKQ
FT                   ALDPKNILNPGKIFEM"
FT   gene            complement(102010..102450)
FT                   /locus_tag="Aave_0096"
FT   CDS_pept        complement(102010..102450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30709"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC1"
FT                   /protein_id="ABM30709.1"
FT                   /translation="MFPRQPAALDRFIDVRQEPRLFRVVRQQADTVAHGGQQRAKFLPR
FT                   LAVDRGDTTLHGHDNLVRRGVRTDVEQRMDRLDGVHGVSGGERNSLLERRPASPAQRGP
FT                   VAPGQQVRYLLLHIFGQIAEPPGCAPGIATGADGPFPPILYG"
FT   gene            complement(102629..103027)
FT                   /locus_tag="Aave_0097"
FT   CDS_pept        complement(102629..103027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0097"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="PFAM: Calcium-binding EF-hand-containing protein;
FT                   KEGG: pol:Bpro_0112 acid shock protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30710"
FT                   /db_xref="GOA:A1TIC2"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC2"
FT                   /protein_id="ABM30710.1"
FT                   /translation="MPATQQRRPTITFDARSVMLFAAIAVGSAAAHAQTSPTTSSAGTH
FT                   STPSHSGTTSMGAHGLSAAGSNRATFGGTSPATSASASFDRADADKDGKLSAQEAARLP
FT                   AISQHFKELDTNHDGALSRTEFEAGAKS"
FT   sig_peptide     complement(102926..103027)
FT                   /locus_tag="Aave_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 34"
FT   gene            103185..103781
FT                   /locus_tag="Aave_0098"
FT   CDS_pept        103185..103781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0098"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pol:Bpro_0113
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30711"
FT                   /db_xref="GOA:A1TIC3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC3"
FT                   /protein_id="ABM30711.1"
FT                   /translation="MGNRLTQIATRTGDDGRTGLGDNSRVSKHSARPHAMGDVDELNSH
FT                   IGLLLCEPLPEDVRTLLGDVQHQLFDLGGELSIPGFELLKEGALAQLDAALARYNATLP
FT                   RLQEFILPAGTRAAAQAHVCRTVARRAERAVVALGEAEGLRPAPRQYLNRLSDLFFVLA
FT                   RVLNRMQGGDDVYWRSDRMARAAAQDESRDALPGA"
FT   gene            complement(103867..104289)
FT                   /locus_tag="Aave_0099"
FT   CDS_pept        complement(103867..104289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0099"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: rfr:Rfer_0061
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30712"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC4"
FT                   /protein_id="ABM30712.1"
FT                   /translation="MPIWKQPIDLHSLNHPATPNAVTHLGIEFTEIGDDFLRARVPVDE
FT                   RTKQPFGLLHGGVSVVLAETLGSVGAYYASPEGCRAVGLDINANHLRAATEGWVTGTAR
FT                   PIHIGRTTHVWQIDMANGAGELTCVSRLTMAILAPR"
FT   gene            complement(104393..105916)
FT                   /locus_tag="Aave_0100"
FT   CDS_pept        complement(104393..105916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0100"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   rpb:RPB_0503 acetyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30713"
FT                   /db_xref="GOA:A1TIC5"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC5"
FT                   /protein_id="ABM30713.1"
FT                   /translation="MSSPEPSRIQCPVLRDKLMTAEQAAALIPNGARVGMSGFTGAGYP
FT                   KVVPPALAARIETLHAAGEPFSIGLWTGASTAPELDGALAKVGGVNMRMPYQSDPTCRA
FT                   QINAGKMQYVDAHLSHVAPYVWFGFWGRLDVAVIEVAGVLPDGRLIPSSSVGNNKTWLD
FT                   QADRIILEVNAWQPEGLDGMHDIYYGTDLPPNRVPIPLVKPGDRIGEPYLRCDPAKVVA
FT                   VVPTHSPDRNSVFNPPDDTSQRIAGHIIEFLQHEVRHGRLPPTLLPLQSGVGNIANAVL
FT                   AGLDAGPFQHLTAYTEVLQDGMLDMLRSGTLDSASATALSLSPAATEEFTRNIGFYRER
FT                   IVLRPQEISNHPELIRRLGLISMNGMIEADIYGNVNSTHVMGSSIMNGIGGSGDYARNA
FT                   YLSIFMTPSLAKGGSISCIVPMASHVDHTEHDVQILVTEQGLADLRGLSPSQRSEVVIE
FT                   RCAHPDFRPALRDYVARARASGCGLHTPHLLGEALSWHERYVRTGTMRA"
FT   gene            106089..106814
FT                   /locus_tag="Aave_0101"
FT   CDS_pept        106089..106814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30714"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC6"
FT                   /protein_id="ABM30714.1"
FT                   /translation="MPAPSLCPSCRQPAENHRFAARDGGELHIDLCFACQGLWFDPQEN
FT                   TRLAPAAVLELFELLHRHRGDAHRPLGERTQCPRCAKALEPGFDLGQGGRYRTYRCAAR
FT                   HGRFSTFGAFMVEKGFVRHLSSLEIEALAERVGTIACTACGGAVDIRNDHACPYCRSAL
FT                   SLLDPQAVDKALERHARAAQAAAGPARPEALADALIAMERERERERRERQREAFTSTTS
FT                   ERFDLLAAGVELVWSLLKR"
FT   gene            complement(106832..108133)
FT                   /locus_tag="Aave_0102"
FT   CDS_pept        complement(106832..108133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0102"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: pol:Bpro_0117
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30715"
FT                   /db_xref="GOA:A1TIC7"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC7"
FT                   /protein_id="ABM30715.1"
FT                   /translation="MSTPSSSYFTRWRLASPAEGAVVAPDERLPWGHTAAMGVQHVIAM
FT                   FGATVLAPILMGFDPNLAILMSGLGTLIFFLVTGGRVPSYLGSSFAFIGVVIAATGYAG
FT                   QGPNANIAVALGGIIACGLLYTVIGAIVQAVGTGWIERCMPPVVTGAVVAVIGLNLAQV
FT                   PIKNMAANNFESWMQAVTFVCVGLVAVLTRGMLQRLLILVGLIAASVLYALLTNGLGLG
FT                   KPMDLSGVLAAPWLGLPRFAAPAFSAPAMLLIAPVAVILVAENLGHIKAVTAMTGRNLD
FT                   RYMGRAFIGDGIATMASGAVGGTGVTTYAENIGVMAATKIYSTAVFLVAGLIALVLGFS
FT                   PKFGALIQAIPLPVMGGVSIVVFGLIAVAGAKIWVDNRVDFSDNRNLIVAAITLIIGTG
FT                   DFTLKFGDFALGGIGTATFGAIGLYALLNLRRGR"
FT   gene            108395..109768
FT                   /locus_tag="Aave_0103"
FT   CDS_pept        108395..109768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30716"
FT                   /db_xref="GOA:A1TIC8"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC8"
FT                   /protein_id="ABM30716.1"
FT                   /translation="MPASRAAPGGGPRRGARTVLGRALRWTLGGVAAAAALVAVAGAAV
FT                   WWWLPSDEELARRAGDGAGDLLGVPVVVDRLEWHLLPAPRVVLHGVHTEQEAPVSADRI
FT                   VADARWSDLLRLRLALARLRLEGAAIPQLSLSQFKVRDAEEDGPAGFGPFTLAEVPVEH
FT                   AEWQGVRWIGRQGRDLAYGGSVDFGPAWRPVRGLLEREGASPPTRLAIEREGEDRWRAD
FT                   VTAGGRTERGELRLQESGERYRVTGSLDFSGVDVVGLMDAFERRSIVSGRASGHTDLIA
FT                   EGDDPAAAMRALQTRTSFTVARAKLLTFDLEAAIRSAGSDKGGTTQLDSLTGIVRTEAD
FT                   PGGTIVRYSDLKATSGVLTATGDAVVQNQRVSGHVAVDLVDGIVGVPLEFGGTVKDPTL
FT                   SLPPAALAGAAVGTVVAPGVGTALGARIGETVRRIFGGEDRQEPPAPRRLPPVRRDPD"
FT   gene            complement(109823..111691)
FT                   /locus_tag="Aave_0104"
FT   CDS_pept        complement(109823..111691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0104"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: rfr:Rfer_2225
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30717"
FT                   /db_xref="GOA:A1TIC9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIC9"
FT                   /protein_id="ABM30717.1"
FT                   /translation="MQFLRRLSLGSRLALGFGLLLLLLAIITGLGIARMSTLDHTSQQI
FT                   TTELYAKANASQRMGYLVLDIARAARNIIILEDQAQMASNKTVIDKNTAEFATTIAQLR
FT                   QLEMAPEIRSLIDAVDAKSKEYLAFTTDVTALGLSNQNLEGQKLLFGPRYKSQGELLAL
FT                   LAQLVKQYEGEMRQATASAHDTFVQSATVLGVVALVAVLAGIAGAVMITRSITVPMARA
FT                   VDVAHAVAEGDLTRTVDDSGRDEAALLLQSLQTMNGNLTRVVHQIRQASDSIATGSSQI
FT                   ASGNADLSQRTESQASSLQQTAASMEEMSATIRQNADTARTASQLASTASQAASRGGDV
FT                   MGQVVATMQDISGSSSKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRALAGRSAEAAKEIKNLIGQSVEKVGAGTRLVDEAGATMSDIVQQVQRVSDLIAEIDA
FT                   ATREQSEGIGQVNAAVSQLDQATQQNAALVEESAAAAGSLQQQAVRLTEAVGVFRLSGM
FT                   AERAAPAPAPVHVPAATPQASAARPAARPSPAASPALGGGKAPAAQLGSTPSAPSRPAQ
FT                   QPAPRAAKAPAGPVAAPKAPALPAAATRPAAKPAAHSNADDDWTTF"
FT   sig_peptide     complement(111590..111691)
FT                   /locus_tag="Aave_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.813 at
FT                   residue 34"
FT   gene            complement(111851..113761)
FT                   /locus_tag="Aave_0105"
FT   CDS_pept        complement(111851..113761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0105"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: eba:ebA5328 conserved
FT                   hypothetical protein, predicted radical-SAM emzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30718"
FT                   /db_xref="GOA:A1TID0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID0"
FT                   /protein_id="ABM30718.1"
FT                   /translation="MPDSACRVLAVIPPMTQLNTPYPSTAYLTGFLRSRGVAAFQEDLA
FT                   LALVLRLLSPEGLKNVAERVQGMPEKRRTPAVQSFAAQQDRYLATVGPAIAFLQGRDST
FT                   LAHRIVGRHYLPEGPRFASLDVYVDDEGGDPLGWAFGTLGLQDKAKHLATLYLNDLADV
FT                   LRDAVDERFEFVRYAESLAGSQPTFDPLADALAAPPTLVDALLQQLTHGAVERHRPSVV
FT                   LLSVPFPGSVYAAFRIAQAIKARYPHIATVLGGGFVNTELRELSDPRVFDFFDYVTLDA
FT                   GERPLLALLEHLEGRRGRQRLVRTFVRGEDGAVQYVNMMEADVAFAEVGTPTWDGLPLD
FT                   KYLSLLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVGLDYIGRYEGASAQVLADR
FT                   IQAIVAETGQTGFHFVDEAAPPKALKALATELIERNAGISWWGNVRFEKTFTPELAGLL
FT                   ADSGCIAISGGLEVASDRLLQLMKKGVSVDQVARVTRAFSEAGILVHAYLMYGFPTQTV
FT                   QDTVDALEYVRQLFANGCIQSGFFHRFACTVHSPVGQNPQEYGVTLAPLPPGGFAKNDV
FT                   AFIDPTGVDHDALGIALRKAIYNYMHGIGLDEDVRSWFSFKVPKTTVARHRIERALAAR
FT                   M"
FT   gene            complement(113788..114351)
FT                   /locus_tag="Aave_0106"
FT   CDS_pept        complement(113788..114351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0106"
FT                   /product="putative carbonic anhydrase, family 3"
FT                   /note="KEGG: mfa:Mfla_2479 putative carbonic anhydrase,
FT                   family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30719"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID1"
FT                   /protein_id="ABM30719.1"
FT                   /translation="MPLSPYLDATPTMDEGVFIHASAQVIGDVHLGRDASVWCNAVLRG
FT                   DVHRITVGEGSNVQDLSMGHVSHRHAGKPDGSPLVIGSHVTIGHSAILHGCRIGDECLI
FT                   GMGSIVMDDAVIGDQVMLGAGSLVPPGKVLERGSLYIGRPAVRQRALTPQEIAYLRYSA
FT                   EHYVRVKNNYLATPQPPLPAALPG"
FT   gene            complement(114435..114830)
FT                   /locus_tag="Aave_0107"
FT   CDS_pept        complement(114435..114830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll2220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30720"
FT                   /db_xref="InterPro:IPR016540"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID2"
FT                   /protein_id="ABM30720.1"
FT                   /translation="MTRPRIALASLPSRYAVARLAPSSAFPDWADGDGFVSITRTSEEL
FT                   SVVCRQERVPTHVQAERDWKAFRFVGPFAFGATGIVLSVIQPLSEAGIGVFVVSTFDGD
FT                   HLLLQERDAAAGQALLLAAGHTVLPET"
FT   sig_peptide     complement(114774..114830)
FT                   /locus_tag="Aave_0107"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.778 at
FT                   residue 19"
FT   gene            115108..115489
FT                   /pseudo
FT                   /locus_tag="Aave_0108"
FT   gene            complement(115561..116184)
FT                   /locus_tag="Aave_0109"
FT   CDS_pept        complement(115561..116184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0109"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: xcb:XC_0243
FT                   transcriptional regulator TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30721"
FT                   /db_xref="GOA:A1TID3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID3"
FT                   /protein_id="ABM30721.1"
FT                   /translation="MTAADALPRLTDRKREAIVQAAIAEFRESGFSGTSMDRVAAAAGV
FT                   SKRTVYNHFPSKDELFSAILDQLWNRSHALPDLRHDADRPLRQQLLELIGGKMQLFNDP
FT                   SFMDLSRVVMAEMLHTPERAKAMAERLSSREEGLPAWIRDAQEAGRLRADADPLYAAHL
FT                   LMGQLKTHAFWPQLILGQPPLDAAQQAQVLADAVDMFLGFYARG"
FT   gene            116287..117339
FT                   /locus_tag="Aave_0110"
FT   CDS_pept        116287..117339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0110"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30722"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID4"
FT                   /protein_id="ABM30722.1"
FT                   /translation="MARPSAYSHAAPIDPSPLRLPTSADGRFRNAARPRRMGWLKGLQV
FT                   MLRMAFGKPAGTVPDRPVPVRALTREVLLAAPDMSLWRLGHSTVLLKMQGGFWLTDPVF
FT                   SERASPVPFAGPRRFHAPPLRIEDLPPLRGVVLSHDHYDHLDRAAILALVPKVEQFIAP
FT                   LGVGDRLVGWGVPADKVRQFDWWQGTTFAGVQLVCTPAQHFSGRGLSDGNRTLWASWVL
FT                   IAGSTRVFFSGDSGYFDGFRVIGERYGPFNLTLMETGAYNADWPDVHMQPEQSLQAHLD
FT                   VQGRHCLPIHNGTFDLSFHAWTEPFERIGALAAARGVPLLTPVMGERVDIRLPAATQPW
FT                   WRDAAAPAAY"
FT   gene            complement(117605..118924)
FT                   /locus_tag="Aave_0111"
FT   CDS_pept        complement(117605..118924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0111"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: rme:Rmet_3186 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30723"
FT                   /db_xref="GOA:A1TID5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID5"
FT                   /protein_id="ABM30723.1"
FT                   /translation="MTQSIIELHGVGKTFRSSDGRERPVLQNVDFTLREGEIVALLGQS
FT                   GSGKSTLLRIMAGLVPADEGDVRYRGQPLHGPARAISMVFQSFALFPWLTVQQNVELGL
FT                   EARGVPQAERAVRAEAAIELIGLAGFEGALPRELSGGMRQRVGIARALVTQPDVLLMDE
FT                   AFSALDVLTGERLREDILQLWRSGSMPTKAMLVVSHNIEEAVMMADRVLIFASDPGRIR
FT                   CQLSIQLPRPRDPDSHHVRALIDEVYALMTAGAARHASAAGGAAAEPAPATLTDRLPAA
FT                   DVARMDGLLELLAEPPFDGRADLPRLAEETSLTDAELLPVAHAVAQLGLAALASGDLQI
FT                   TPLGRRYVEGAHGLRQQIFGQQLLAHVPLVAHIRHSLEQEPAGELPDAPFLRLLSEQLD
FT                   AQEAESVLRTAITWARHGEVFEYDFRTGVMRLPTGEETSS"
FT   gene            complement(118960..120696)
FT                   /locus_tag="Aave_0112"
FT   CDS_pept        complement(118960..120696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0112"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rme:Rmet_3185
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30724"
FT                   /db_xref="GOA:A1TID6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID6"
FT                   /protein_id="ABM30724.1"
FT                   /translation="MKNQASREFFPRQVVDAGPNRWDWALLPLVLAGVVLLAYGAAQMA
FT                   RPFEMGDVIPLSLDPWQLPYYLLRTTLRMFIALGASLVFACVFAVLAAKYRLAERVLVP
FT                   LLDILQSIPILGFLSITVTGFIALFPGSLLGVECAAIFAIFTSQAWNMAFSLYQSLRTV
FT                   PAELQEAARVFQLSGWQRFWRLELPFAMPGLLWNMMMSMSGGWFFVVASEAISVSHQDI
FT                   KLPGVGSYIALAIEARDLPTIGWAIACMLVAILLYDQLLFRPLVAWADKFRFEEGSADA
FT                   APRSWLLDWLRRARATQTVAGWCQRQLGRTLTLFRRSHDGTSIRARPPAPSARAERVWD
FT                   AVLAAGVLFAIARLVQFVHTEVGWHEVVHVFTLGGYTLARVMVLIALAAVVWVPIGVWI
FT                   GMNPRWAGRLQAVAQFLAAFPANLFFPVAVMLAVHWKLNPDVWLSPLMILGTQWYILFN
FT                   VIAGASSIPNELRLAAQNLGLSGWLQWKRYLLPAVFPSFVTGAITASGGSWNASIVAEY
FT                   VTWGDTTLQARGLGSYIAQMTAAGDFPRIALGIGAMVVFVMGLNHFVWRRLYRLAEDRM
FT                   HF"
FT   gene            complement(120827..122143)
FT                   /locus_tag="Aave_0113"
FT   CDS_pept        complement(120827..122143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0113"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase,
FT                   FAD-binding; KEGG: xcc:XCC2647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30725"
FT                   /db_xref="GOA:A1TID7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID7"
FT                   /protein_id="ABM30725.1"
FT                   /translation="MPATSSVPPAPPSPAVAAHHCDVLIVGGGPAGLSLAVSLAQAGFT
FT                   ATVVERQPDATLAEPAPDGREIALTHPSADTLRRLGSWQRLLPHEIGRIHAAHVHDGPA
FT                   GGGQPLRLQAGRGPGHLGWIVPNHALRRTAHAAALATPGVRLLAGRQVAHVAVSEDAAE
FT                   LQCASASGEPDGAAPLRLRARLLVAADSRFSATRRQLGIGAASTDFGRTVIVCRMHHAL
FT                   AGDGTAHECFGYARTLAILPLPPDPGTGEALCSVVVTTRTDDATALLALPPADFAAQVQ
FT                   AQFGDRLGAMRLAGERHAYPLVAVYARRFSGHRCALLGDAAVGMHPVTAHGYNLGLAGV
FT                   ERLTAALVHARDTGRDIGDAGLLERHYARAHHRHAWPLYEGTNAIVRLYTDDRPLPRLL
FT                   RRVVLQGARRLAPVQAAIVGQLMGTAPETGAWASGPAGH"
FT   gene            122304..125381
FT                   /locus_tag="Aave_0114"
FT   CDS_pept        122304..125381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0114"
FT                   /product="putative CheA signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: xom:XOO_2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30726"
FT                   /db_xref="GOA:A1TID8"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID8"
FT                   /protein_id="ABM30726.1"
FT                   /translation="MIPRTAGNSAPYRPQARRAEPHEPAGSTTPAQDDGALSGPSMDAL
FT                   RRALPARATASGARRRHAGVLPPRAVLPFHVPQPPCISSAMLENPAAPHAADHEDGSDE
FT                   SDFQVIADDGPAARVAAQRTAFIARAVEQAGSERDISAMVRLADAAASQAAALQRLPGT
FT                   ADVIRALGGYRVPPEFQQLHRRLLDAAIAWRAAGEQYGAAQAIFRKLHPGADADDARIH
FT                   AAQAACEAAERQLLARHQVLGAARRSRFHPALNSRLQADIQAHLVQCLRQACDYVDADA
FT                   AAGPGTPPRYELDIVLCRELAGMTRAAALRLEHLQTGAMSVPEFPELPAADRELRQKEW
FT                   TSRFTADAEALEAMARRLRAAWGDVLPDTLPETQAAADALRAAPSKAVRAPAWREASLR
FT                   RSFGLLLDSLGPLRSQAESAAAESGLLPGLRQLERLRRLCNLLHTAASLPRVLERSLDQ
FT                   WTAAEREGSAATVATLRERATAQAQAHEREAQALLDEAFLALWQSGAALLGAAGRSGFP
FT                   GEVPALDLSQLASWARAAGALLKALPLPAAAEGIGGAEGRLPKETRLQGFFALANACEL
FT                   LGPPPAGTLPAMQRAERLRAVARSALAAAQGAMAEPLRTLARQCDAAHVRCLSAAVRTH
FT                   AADVSRLFAQSRPTLEEAADRLGAELLQGWDFAFMPALVPEGEAAQATVTHAHSADGAP
FT                   AESGLLESLRSIAREVDALHRPSIPRPQEMPPEDVQAHLGAKATLDAMACAARASCTLL
FT                   ALWQEIPSLLLPASVSSRTSRAAEFAQRAISVDLDAPAPAAEHAAGTDAKSALSLAREV
FT                   RRRGLQMNTALKVMQHVFQARSNALQRVQDLRRLSPAKLNSKVEAIQSPFASAARLVSD
FT                   REAALQSEIQGDESERARSERQRLTDWCAMLDWRMRLESMLVVSRIYAAVQNKEIEGAV
FT                   PGSRLALGLQMNRTTLHELVTQLTDQNKTALQLQPLRENRPLMGAALGASLAAIRQLKD
FT                   CDERTQALALPGKPGAGGSRAGAGGSKQGGQRRGAP"
FT   gene            complement(125410..126897)
FT                   /locus_tag="Aave_0115"
FT   CDS_pept        complement(125410..126897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0115"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: pol:Bpro_2298
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30727"
FT                   /db_xref="GOA:A1TID9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1TID9"
FT                   /protein_id="ABM30727.1"
FT                   /translation="MTTPDTLQSIDARTGQPGGDAWDASTPAAIDAAVAAAAQAADAFA
FT                   ARSAADRAGLLRALADALESQRETLVPIADRETALGPARLNGELDRTAFQLRGFATELE
FT                   RGAAHAVVDDPAVAGAPPAGRPHLTRVRVPVGPVAMFSASNFPFAFSVLGGDTASALAA
FT                   GCPVVVKAHPAHPELSRRTARLARQVVAAQGLPEGVFQFVEGGSVATGVQLVQAPAIAA
FT                   VAFTGSFKGGTALARVAAERPRPIPFYSELGSVNPLVALPAALQTRGAALAETLAGSIC
FT                   LGAGQFCTSPGVIVVRRDAPGDAFVQTLADKLQALAPHAMLSAGIRAHFDHGVSAWKAH
FT                   GKVRPLVDGTAAPGATPRPFLAEVQAVDFIADAALHEEVFGSAALVVRTGSARETIDVL
FT                   RAVGGSLTVTLWGADDDTEDNRALVRAATQVAGRVLFAGVPTGVAVTAAQHHGGPYPAS
FT                   TAPFTTSVGYAAMDRFLRPVALQDAPGWLAARNGVPC"
FT   gene            127084..128736
FT                   /locus_tag="Aave_0116"
FT   CDS_pept        127084..128736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0116"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR;
FT                   SMP-30/Gluconolaconase/LRE domain protein; KEGG:
FT                   sme:SMa0717 putative calcium binding transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30728"
FT                   /db_xref="GOA:A1TIE0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE0"
FT                   /protein_id="ABM30728.1"
FT                   /translation="MASSSSEGTAALEKALDLLEAVGASQDGLSQAELAQRFALPRTTA
FT                   YRLLATLVARGLLRRDPVRRVYCLGMRCFEMARQAYAMPDLAAAAALELRALRDLTGET
FT                   SYLAALDGREVVSLERCDGAHSERSSSALGQRKPVHCTSQGKAILSALPAADRETLLRG
FT                   LSLKAVTPRTITDRRRLQAELRVTAARGYAIDDEEIVPGVRCVGAPIVDAQGEVHGALS
FT                   VAGPAWRLTPERLELLGPELAEAARRVGAQLGRTRAPVADTMACALAGPWAFHGAHPHW
FT                   CAEANLLYWADSLAPALRAWSPQAAPDGEPREAGAAPLPAGTDQALAECDEPIAGVLVH
FT                   GPQDVSLAGARGAVRWRPGAAQPEPWPAWPDGAAVRAACLGGADADGESVWIAMETAGG
FT                   GSAVGRLQAAGNVEVLWRLAEALQCLRWRAGDGALLATVPDTGAILHMHPDSPGVVRRL
FT                   VTVPKGSGRVSGLAFDAEGGVWTALRDGWSVVRFLPDGGLDRVAALPVPCPTDVAIGGA
FT                   EGRTLFVTTARQPVALDLLANAPLSGRLFALPL"
FT   gene            129026..129853
FT                   /locus_tag="Aave_0117"
FT   CDS_pept        129026..129853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0117"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: bcn:Bcen_2142
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30729"
FT                   /db_xref="GOA:A1TIE1"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE1"
FT                   /protein_id="ABM30729.1"
FT                   /translation="MNTFRLGALALSLILAGCATNGSTGSSSSAGSALGSVLGAAGSGG
FT                   TGSSTESKIGAAADVFKAVTVSDDELKSVSQQFRAYEERTEKVAPAKNKYAQRLARLTK
FT                   KHVNEDGMKLNFKVYLANEVNADATADGSIRVYSGLMDMMNDQELLGVIGHEIGHVKLQ
FT                   HSLAAMRTAYLASAGRKAASAAGGVGRLADSDLGALGEKLVNSQFSQSQETAADDYGLA
FT                   FMKKHKYKVSAMESAFRKLAAQSGGKGGALDEMLSSHPDPAGRADRMRDMASK"
FT   sig_peptide     129026..129118
FT                   /locus_tag="Aave_0117"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.350 at
FT                   residue 31"
FT   gene            129969..130208
FT                   /locus_tag="Aave_0118"
FT   CDS_pept        129969..130208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30730"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE2"
FT                   /protein_id="ABM30730.1"
FT                   /translation="MRVDIYRRPEADGKHSYLVVPEGRPIPQEAINTDWSCQERGHELD
FT                   ESAAHWNDYGIPEPARQLDEKQYAITSVKELKED"
FT   gene            130284..132467
FT                   /locus_tag="Aave_0119"
FT   CDS_pept        130284..132467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0119"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: pol:Bpro_0120
FT                   acetoacetyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30731"
FT                   /db_xref="GOA:A1TIE3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE3"
FT                   /protein_id="ABM30731.1"
FT                   /translation="METTTPPPRSAAAAAAAHAPFVPQIRLYQEWLHARHGLRFGDYEA
FT                   LWRWSVTDLDAFWQSIWDYFGLESPTPHTAVLARNTMPGAEWFPGAQVNYARQALRHAD
FT                   AAHAAGQPAIISRNERGEHRELSWPELRRQVAALALHLRAQGVGPGDRVAAYLPNIPEA
FT                   MVALLATASLGAIWSVCAPDMGTAAVLDRFRQIEPKALIAVDGVTYGGRDLDRRGVLAE
FT                   LRAALPTLEHVVVVDQLGTAGTIAGCVEYTQATARDDAGVASFEPLWLPFDHPLWIVYS
FT                   SGTTGLPKPIVHGHGGMVLVALLLKGLHNDIGPSHVPNSFGERYHWYSSTGWVMWNAQA
FT                   SGLLSGTTCVIYDGNPGGSRERPDWGTLWRFAAETGVTFFGAGAAFYANCMKAGIDLAA
FT                   CGDLSRIRALGTTGSPLSPEVQEWGTAQFARIQARAGNAASSEPIWWDNISGGTDFCGA
FT                   FIGGHRELPQVPGEMQCRMLGAAVESWDEAGRPVTGAVGELVCTQPIPSMPLYFWGDAP
FT                   AGAPALPGDPQGPRYLASYFDMYPPGHGRRPGGGDGPASMGAVWRHGDWLRVGPEGRCV
FT                   IYGRSDATINRHGLRMGTSELYRAVEALPEVLDSLVVDLEYLGRESHMPLFVALREGAA
FT                   LDDALRERIAAAIRTALSPRFVPDEIVQVAEVPRTLTGKKQELPIKKLLLGQPLEKVVN
FT                   RDAMANPGCLGWYEDFARRHLARTAAVAGAPGA"
FT   gene            complement(132477..133436)
FT                   /locus_tag="Aave_0120"
FT   CDS_pept        complement(132477..133436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0120"
FT                   /product="arginase"
FT                   /EC_number="3.5.3.1"
FT                   /note="TIGRFAM: arginase; PFAM:
FT                   Arginase/agmatinase/formiminoglutamase; KEGG: rfr:Rfer_3884
FT                   arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30732"
FT                   /db_xref="GOA:A1TIE4"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE4"
FT                   /protein_id="ABM30732.1"
FT                   /translation="MVNAPFPRPVTLIGVPTDVGAARLGAAMGPDALRVAQLGPALERL
FT                   GLEVEDLGNLHGPPNPRGERTAEGLRNLAECEAWNRSTHDAVFGQLQAGRLPVMLGGDH
FT                   NLAIGSISAVARHCRETGKRLRVLWLDAHSDSNTPEISPSGNVHGVPVASLCGLGPPAL
FT                   AALGGPGPALRGAQMCQIGLRSVDAAEKRMIHELGLEVYDMRAIDELGMREVMRRALAG
FT                   LEDDDGAHLHLSFDVDFLDPEIAPGTGTTVRGGPNYREAQLCMEMIADTGRLASLDIVE
FT                   LNPALDIRNQTAELVVDLVESLFGKSTLVRAPAPAGRR"
FT   gene            complement(133498..134646)
FT                   /locus_tag="Aave_0121"
FT   CDS_pept        complement(133498..134646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0121"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   rfr:Rfer_3883 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30733"
FT                   /db_xref="GOA:A1TIE5"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE5"
FT                   /protein_id="ABM30733.1"
FT                   /translation="MDRTHTFRPALRRTGSTEFLDAPRAAELVGSTGVIACLRAIAQAI
FT                   EADFARWNDFDKTARTAAHSPRGVIELMPVADTRPGGGYAFKYVNGHPANTQDGLPTVM
FT                   AFGALADVDTGLPVFLGELTLTTALRTAATSAVAARRLARQDSRCMALIGNGSQAEFQA
FT                   LAFFGLLGVRELRLYDTDPAATRKLVRNLGPYARDGLRCVPCASAREAVRGADIVTTAT
FT                   ADKARAAIVQADMLEPGMHLNAVGGDCPGKTELAPEVLRAGAVFVEYEPQTRIEGDLQQ
FT                   MPADFPVTELWRVLAGTAPGRVSPGQVTVFDSVGFALEDYSALRTMRALGQAAGLLDRI
FT                   ALVPDLADPKDLYAQLRPWLPEGAPGAAASAPRAPTFAHEAA"
FT   gene            134688..135215
FT                   /locus_tag="Aave_0122"
FT   CDS_pept        134688..135215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0122"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family;
FT                   Helix-turn-helix, type 11 domain protein; KEGG:
FT                   pol:Bpro_0400 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30734"
FT                   /db_xref="GOA:A1TIE6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE6"
FT                   /protein_id="ABM30734.1"
FT                   /translation="MHQSKSPGLTAIAQKAGVMAAFVDTMDNIDRQLIAALRHNARASV
FT                   ATLATRLGVSRGTVTNRIRKLEDAGTIVGYTVRLRPEGETGGLQAWMSISIEGNDARRV
FT                   TASLLGEPSVLSLHATNGQWDLLAELQVASLAELAQALERIRLIKGIRNTETSIHLETL
FT                   RASPQQAPGARR"
FT   gene            135315..135938
FT                   /locus_tag="Aave_0123"
FT   CDS_pept        135315..135938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0123"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="TIGRFAM: CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: rfr:Rfer_2496
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30735"
FT                   /db_xref="GOA:A1TIE7"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE7"
FT                   /protein_id="ABM30735.1"
FT                   /translation="MTPQAPKRFSMIREFHLADWFTLGNAVCGVGALFSSMTFMETGDV
FT                   RHVYFAAALVLAALVFDVLDGRVARWRQKSSAMGRELDSLADVISFGVAPAIIAYACGM
FT                   QGLYDRIVLAFFVACGVSRLARYNVTAETLSEGSGKVKYFEGTPIPTSIVLVGLMALAA
FT                   SLGAVRENLWFGKLLVGGFTLHPFVLLFAVSGSLMISRIRIPKF"
FT   gene            136276..137049
FT                   /locus_tag="Aave_0124"
FT   CDS_pept        136276..137049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0124"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: rfr:Rfer_0036 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30736"
FT                   /db_xref="GOA:A1TIE8"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE8"
FT                   /protein_id="ABM30736.1"
FT                   /translation="MAVDTVGQARTSFDLKSAQLPVVAVALRTTDADAFAADLAARLGE
FT                   DPGFFDNDPVLIDLSAVREEAAPIDFPALMALLRQHRTQPVAVRGGSAAQMEAALAAGL
FT                   VAAPEAPPARAAQSPAAAESPAREVVREVVREVEVVREVPAPAPGTVVVDKPLRSGQQV
FT                   YARGSDLVVMAVVSFGAEVIADGNIHVYAPLRGRAIAGARGDTSARIFSTCLEPQLVSV
FT                   AGIYRTTDTELPDNVRGKPAQVRLDGEKLIIEPLA"
FT   gene            137089..137904
FT                   /locus_tag="Aave_0125"
FT   CDS_pept        137089..137904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0125"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; KEGG: rfr:Rfer_0035
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30737"
FT                   /db_xref="GOA:A1TIE9"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIE9"
FT                   /protein_id="ABM30737.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLNQALIKDKQCENLFVLAASQTRDKDALTQEGVEK
FT                   VLNDLAAMDFEYIVCDSPAGIESGALMAMHFADEALLVTNPEVSSVRDSDRILGMLGSK
FT                   TRRAIEGKEPVKEHLLITRYNPGRVQDGQMLSLEDIQDILRIELIGVVPESESVLQASN
FT                   QGTPAVHLQGTDVSEAYKDVVARFLGEDKPLRFIDAQKPGFFKRIFGGR"
FT   gene            137908..138174
FT                   /locus_tag="Aave_0126"
FT   CDS_pept        137908..138174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0126"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: rfr:Rfer_0034 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30738"
FT                   /db_xref="GOA:A1TIF0"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TIF0"
FT                   /protein_id="ABM30738.1"
FT                   /translation="MASFLSFLLGEKKKTASVAKERLQIILAHERNGRNASEPDYLPAL
FT                   QRELVAVISKYVKISPEDLKVQLERQDNLEVLEVKIELPDTVR"
FT   gene            complement(138207..138728)
FT                   /locus_tag="Aave_0127"
FT   CDS_pept        complement(138207..138728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0127"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: pol:Bpro_0126 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30739"
FT                   /db_xref="GOA:A1TIF1"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF1"
FT                   /protein_id="ABM30739.1"
FT                   /translation="MTRPLPRPALASPPSFSPREFRDALGMFATGVTIVTAQDAAGGLV
FT                   GLTASSFNSVSLAPPLVLWSLGRTAGSMNALAAGSHYAINVLAADQKALAERFASRGVD
FT                   RFAGVAYTLGVAGAPLIEGAVATFECFNRSRYDEGDHVIFVGEVERCAHRPGVPPLLYH
FT                   GGRFYTEHPL"
FT   gene            138855..139643
FT                   /locus_tag="Aave_0128"
FT   CDS_pept        138855..139643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0128"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr6083
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30740"
FT                   /db_xref="GOA:A1TIF2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF2"
FT                   /protein_id="ABM30740.1"
FT                   /translation="MALLPTFTTLGAGPTVLMLHDADGGHLTFAPQVETLAGSGYRAVA
FT                   WDMPGYGRSAPIEPYSFKGLAQSCIALLDALQCTQGTTLVGHGLGAMVAVEVALRAPRR
FT                   VGRLVLCAGGPALDGEGLDTWVAPRVAALEDDQAMERVAELLVPRQTGTGALPEGARLA
FT                   GHAMGQVHRSAFRRALELLPAFARDAADLAHLSMPTLLVSGAQDRCMPPEALQALAHVL
FT                   PDARHLSLPNVGHWPQLEDPDGFDGALLDFLGSSAPRTIH"
FT   gene            139643..140917
FT                   /locus_tag="Aave_0129"
FT   CDS_pept        139643..140917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0129"
FT                   /product="peptidase M14, carboxypeptidase A"
FT                   /note="SMART: peptidase M14, carboxypeptidase A; KEGG:
FT                   tcx:Tcr_1751 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30741"
FT                   /db_xref="GOA:A1TIF3"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF3"
FT                   /protein_id="ABM30741.1"
FT                   /translation="MAARTNGTSGVPAIPRRPGFLSPWLMPPAAALALALLGVSVWDPR
FT                   AFLAGGQAGAGTASDAVVAIGRGHLGTGEGGAGYHSVVVLGAPAERSGDAAAFPAAPRA
FT                   SSGAQPRTGPASAPGRSDGAAASASGAMTTRALAPAQVPVPLPPPGAAQSVAACKLLLP
FT                   RLPTVDRPLCESTRLSESGAHSRKGLPIYWRDVTPAPAAGGAAGPEPLRVLVLGAIHGD
FT                   EPTSASLAMRWIGFAAQPQPALRQPVHWRFIPALNPDGMLARPATRVNARGVDLNRNFP
FT                   TPNWERDAPVYWEKRTRRDPRRWPGPKPLSEPESRFLHEQMEGFRPDLVVSIHAPYGVL
FT                   DYDGPLPPPSRLGRLRLDQLGIFPGSLGHYGSVRQGMPVVTIELQHELRMPEDSQVRQM
FT                   WVDLLRWMDTHLAATDTPAAGTPAR"
FT   gene            complement(140922..141491)
FT                   /locus_tag="Aave_0130"
FT   CDS_pept        complement(140922..141491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0130"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: dar:Daro_1812 NAD(P)H
FT                   dehydrogenase (quinone):NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30742"
FT                   /db_xref="GOA:A1TIF4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF4"
FT                   /protein_id="ABM30742.1"
FT                   /translation="MPSSSPHLLFLNASTREPGHIGNTEWLARQAAATLPAGTAQTWLH
FT                   LARLDLPPFVDLRHTTGTYPAPEGDLRTLLDATLAASEIVFVSPVYWFSIPSTLKTYLD
FT                   HWSAWMRVPGLEFKERMAGKALSLVTTSGDRAKAQPMIDSVQLCAQFLGMRYRGALWGK
FT                   GGPPGAVQAEAAAVREAASFLAAPLS"
FT   gene            complement(141536..142870)
FT                   /locus_tag="Aave_0131"
FT   CDS_pept        complement(141536..142870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0131"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0148 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30743"
FT                   /db_xref="GOA:A1TIF5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF5"
FT                   /protein_id="ABM30743.1"
FT                   /translation="MKTIVLGAGIIGISTAWHLLERGHDVIVVDRQPDASLETSYANAA
FT                   QISVSYCEPWANREAPWKALKWMFDKEAPLLFRPQLDWDQWRWSLKFLAQCNDAAFARN
FT                   VQQIVALGAYSHAALKDMVRSTGIEYHRLERGIAHFYTDQKSFDAAGKAVDLMRQYGVQ
FT                   RRLVSRDELLQIEPAFRAYGDRITGGTYTSTDESGDARVFTQALARRCAERGAQFLFGH
FT                   DVLRLQRTGDAIDTVTVRSREPGSAAQELRADAFVVACGSYTAPLLRTVGVDLPIYPGK
FT                   GYSATFPLLKPEGAPMVSTIDDGKKIAMSRLGNFLRVAGTIELGGFDLSLDSPVARARC
FT                   HMLSRRIAEILPGVCDTRTPEEGGDPQYWTGLRPATPTNIPFIGRTRVGKLWVNAGHGT
FT                   LGWTHGAGSGKAMAELLSGERPAMDFGFLGFGTQGRQASGTPVTA"
FT   gene            142960..143877
FT                   /locus_tag="Aave_0132"
FT   CDS_pept        142960..143877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0132"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0149 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30744"
FT                   /db_xref="GOA:A1TIF6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF6"
FT                   /protein_id="ABM30744.1"
FT                   /translation="MSTFDPAALECLAAIVEEGGFERAAQRLNVTQSAVSQRLRALEAQ
FT                   VGSVLIVRSRPLKPTSAGQLLLKHTKQLRLLRADLERDLQELAPSAPGGAREDERIAIA
FT                   INADSIATWALDALHDLARQRLPIEIIVDDQDFTQEWLRSGQVLGCVTTLRQALRGCKV
FT                   VPLGAMRYVAVASPGLAAHHLPQGLTPHNFRDVPFLSFNRKDDMQSEFIMRAFGLKRVA
FT                   LHHLFVPSSEGQVRAAIAGWGAGVVPELLARPALASGALVDLAPGHALPIQLYWHCWNL
FT                   ESEVLDSLTEALTATAARTLAAAP"
FT   gene            143978..144553
FT                   /locus_tag="Aave_0133"
FT   CDS_pept        143978..144553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0133"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pol:Bpro_0153
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30745"
FT                   /db_xref="GOA:A1TIF7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF7"
FT                   /protein_id="ABM30745.1"
FT                   /translation="MHEARAQAIVAAAGRLLGEKGFEAMTLDEVAAEVGVAKASLYKHF
FT                   AGKEDLCATAMARAVERLREFLEGLPQGLPPLDCLERLLRWLLSLQLTDELPLLLSRNS
FT                   GLQRPLKECAAYQSALQCVSARVMEWITAAQGEGLLSRMLPAEVILYSIYARSADPLLS
FT                   MLRDQGGHTDEQIVDWAVQTCFDGLKSR"
FT   gene            complement(144664..145089)
FT                   /locus_tag="Aave_0134"
FT   CDS_pept        complement(144664..145089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0134"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30746"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF8"
FT                   /protein_id="ABM30746.1"
FT                   /translation="MKILLAVDGSAYTKKMLAYLATHDELLAGGTHDVTAITVQSPLPP
FT                   RARAALGKDVVEKYYADEAEKVIGPVAKFLARHGITAKRLVKTGPVGETIAKAADAGKF
FT                   DLLVMGSHGHGALGQLVMGSVSTQVLASSRVPVLLVR"
FT   gene            complement(145212..146063)
FT                   /locus_tag="Aave_0135"
FT   CDS_pept        complement(145212..146063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0135"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pol:Bpro_0155
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30747"
FT                   /db_xref="GOA:A1TIF9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIF9"
FT                   /protein_id="ABM30747.1"
FT                   /translation="MKIQLLSDLHLEAHPAFQPSPAPEADLLVLAGDIGSYQTGSRLAD
FT                   DDFGLARFSPLPQHAGWPVPVLFVPGNHEYDLHDFDAARDRLRATCDRLGLQWLDRETV
FT                   VLQGVRFVGTTLWSDFDALALGKSDGGVDMARLLRHREKAFRAANFYLRKTGGTRDGEP
FT                   FLAETMREEALRCQDWLRGALQAPFDGPTVAVTHFAPSLRSADPRYGLVPGTAGFCNAL
FT                   DDLLPLARVWMHGHLHAPSDYTAQGTRPDGSAWACRVVANPLGYAGKGEQETFRPHFTV
FT                   TV"
FT   gene            complement(146060..147061)
FT                   /locus_tag="Aave_0136"
FT   CDS_pept        complement(146060..147061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0136"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30748"
FT                   /db_xref="GOA:A1TIG0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG0"
FT                   /protein_id="ABM30748.1"
FT                   /translation="MQPINFRSLDLNLLRVFDEVMAERNLTRAAAKLALTQPAVSNALR
FT                   RLREVVGDDLVVRSGQGVEPTPRALALWPPVRQALAQLQQSLAPGAFDPASANSTFVLA
FT                   LADATGATLIPPLVEIVEREAPGVSLRVVPLTTRDPRSLLDDESTDMAVGYFPAVMADL
FT                   TARAQTDSVIAYDSLRLYDGEYVCVMRQDHPLAREPLTLDQYCAARHLLVSFSGKPYGF
FT                   IDEALTALGRERRIVLTVNQFFTAGRVVATTDLLTVLPRHFVGVASLGGELVWRPLPMP
FT                   LPTVHVDALWHRRKRHDAAHVWLRGAMARSAQHTAARPPATAAAPAPENPEA"
FT   gene            147188..147619
FT                   /locus_tag="Aave_0137"
FT   CDS_pept        147188..147619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30749"
FT                   /db_xref="GOA:A1TIG1"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG1"
FT                   /protein_id="ABM30749.1"
FT                   /translation="MTNFVHIEYRTEHPGVARAEQAAATLKSAFEGARGASSLLLAAVV
FT                   AAVLVVANQFIDTWGEGHTLAAWMVLWLIAFAALALLAGPVRRAAAMLRAGFHAWKEAR
FT                   RREAEDEKTWNAALHDARIMADLSRAMNGIAVDNIRRYY"
FT   gene            complement(147863..149725)
FT                   /locus_tag="Aave_0138"
FT   CDS_pept        complement(147863..149725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0138"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pol:Bpro_0160 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30750"
FT                   /db_xref="GOA:A1TIG2"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG2"
FT                   /protein_id="ABM30750.1"
FT                   /translation="MNAPTMQGLDLQAPAYVKNARLLAWVADMAALCKPARIHWCDGSQ
FT                   EEYDRLCQQLVDAGTFKKLNPAKRPGSYLAWSDPSDVARVEDRTYICCEKKEDAGPTNN
FT                   WMAPAEMRATLQPLFDGCMAGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMKIMT
FT                   RMGRAVYDVLGVEGDFVPCVHTVGAPLQPGQQDVSWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASTMGRDQGWLAEHMLILGVSSPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPKAFEGWKVTTIGDDIAWIKPQADGSLRAINPEAGYFGVAPGTNYHTNPNCMAS
FT                   LDRDVIFTNVALTDDGDVWWEGMEKDTGKLPDHLIDWQGKDWTPQIAKETGAKAAHPNA
FT                   RFTVAATNNPALDQAWDDPKGVKIDAFIFGGRRSTTVPLVTEARDWTEGVYMAATMGSE
FT                   TTAAAFGAQGVVRRDPFAMLPFMGYNMSDYFQHWLNLGEKLSASGATLPRIYTTNWFRK
FT                   DAEGKFVWPGYGENMRVLKWMIDRIEGRATGQETAFGVAPQYGEINWTGLDFSSEQFDT
FT                   VTRIDKAAWAEELKLHTAHFDQLAYHLPEQMLKTKAALEKRLAA"
FT   gene            complement(149992..150699)
FT                   /locus_tag="Aave_0139"
FT   CDS_pept        complement(149992..150699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0139"
FT                   /product="preQ(0) biosynthesis protein QueC"
FT                   /note="TIGRFAM: exsB protein; PFAM: ExsB family protein;
FT                   KEGG: bcn:Bcen_2505 ExsB"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30751"
FT                   /db_xref="GOA:A1TIG3"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TIG3"
FT                   /protein_id="ABM30751.1"
FT                   /translation="MRAGHALVLFSGGQDSTTCLAWALERFERVETIGFDYGQRHHVEL
FT                   EARTAVLAALRGRFPAWSARLGDDHMVDLAVLGQISDTALTRDTAIQMTEAGLPNTFVP
FT                   GRNLLFFQLAAAVGYRRGLHTLVGGMCETDFSGYPDCRDDTLKALQVALSLGMGQRFTI
FT                   ETPLMWIDKAETWEMARQLGGDELVQLIVEDTHTCYHGVRGALHAWGHGCGECPACALR
FT                   RAGHERWTAQHTA"
FT   gene            complement(150787..150939)
FT                   /locus_tag="Aave_0140"
FT   CDS_pept        complement(150787..150939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30752"
FT                   /db_xref="GOA:A1TIG4"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG4"
FT                   /protein_id="ABM30752.1"
FT                   /translation="MAHDTTTTPHAGEQHAPDGVEAVVPFMPIVLPVAGGVLMLLLAFI
FT                   AVYMA"
FT   gene            complement(151062..152666)
FT                   /locus_tag="Aave_0141"
FT   CDS_pept        complement(151062..152666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0141"
FT                   /product="periplasmic glucan biosynthesis protein, MdoG"
FT                   /note="PFAM: periplasmic glucan biosynthesis protein, MdoG;
FT                   KEGG: xcc:XCC4145 periplasmic glucan biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30753"
FT                   /db_xref="GOA:A1TIG5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG5"
FT                   /protein_id="ABM30753.1"
FT                   /translation="MQKPQRRHFLRTLGHGAALATAGGLGLNWTQAFAALKPLGQPQAF
FT                   DFAALKGQARALAAKAYEPPKDTIPPSVSKLDWDQYQSIQFRGDHALWADEKLRFQAKF
FT                   FHLGLFFKKPVRMFELADGKAQELAYDPEMFNYGKSGLKPGDLPPDLGFAGFRLNFHTD
FT                   PVRDVAAFLGASYFRAVGGEWQYGLSARGLAIDTGMQRPEEFPDFTAFYLERPAPGSNT
FT                   VVVLALLDSPSIAGAYRFAITPGDTQVMEIDAALYPRKAIERLGIAPCTSMFQHGENDR
FT                   RMANDWRPEIHDSDGLQMWRGNGEWVWRPLTNPPALQFNAFADQGPRGFGLVQRDRNFD
FT                   HYQDDGVFYERRPSLWVEPKSDWGAGSIQLVEIPTIDETFDNIVAFWNPDRKPQAGEEL
FT                   LIGYRLFWGAHPPAQSPLARCVATWTGLGGVVGQPRKYFSWRFAVDFAGENLVALGRGA
FT                   KVEPVITASRGKIEITSARPQDAIQGWRAMFDIKPEDDSTAPITIRMFLRGENGAPLTE
FT                   TWLYQWVPPAPADRRLS"
FT   sig_peptide     complement(152562..152666)
FT                   /locus_tag="Aave_0141"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.991 at
FT                   residue 35"
FT   gene            complement(152775..153983)
FT                   /locus_tag="Aave_0142"
FT   CDS_pept        complement(152775..153983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0142"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: pol:Bpro_0165
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30754"
FT                   /db_xref="GOA:A1TIG6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG6"
FT                   /protein_id="ABM30754.1"
FT                   /translation="MAHMLTLPDIQAAAARLQGQVLDTPCVESRTLSQIVGAQVFLKFE
FT                   NLQFTASFKERGACNKLSQLSPEEQRRGVIAMSAGNHAQGVAYHAQRLGLAAVIVMPRF
FT                   TPGVKVERTRGFGAEVVLHGDTLEEARAHAYALAEERGLTFVHPYDDEAVAAGQGTVGL
FT                   EMLQAVPDLDCLAIAVGGGGLIAGIATAAKALKPGIEIIGVQTSRFPAMVNAVKGTQHP
FT                   QGTSTIAEGIAVGTPGQVTREVIARLVDDLLLVDEGDIEQAVLMLLEIEKTLVEGAGAA
FT                   GLAALLRHPERFRGKRVGLVLCGGNIDPLLLAAIIERGMVRSGRLARVKVSARDIPGVL
FT                   ARITATVAEAGANIEEVHHQRAFTMLAAQNVEIELVLQTRGREHVQQVLACLRQASMEA
FT                   ELL"
FT   gene            complement(154065..157616)
FT                   /locus_tag="Aave_0143"
FT   CDS_pept        complement(154065..157616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xom:XOO_2877 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30755"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG7"
FT                   /protein_id="ABM30755.1"
FT                   /translation="MEQDSDTDSEASFDVVVDDGAIRAARQARMADITQALANTRTPEA
FT                   LNAMVARATEMGWQASQCTLPGGEEVSQALRPTYRHRTDGFMEVKQALRHIEAAANAWE
FT                   AAAEHQQAALCARELLLPQAGPDLLDQLLWQSQTVARRLRAQEKTLEALLLLRQFPYAG
FT                   AAGKCRIHDEAAARLREACSLRMNELPAELPAAVADIDAALHRELADISPRMAGLLDAI
FT                   GPDGKLPGVPSRMPPPGSDARQAEAIEEAWLATYAHSCAALEDAARALLARSHPSEISS
FT                   PAAAVKAGALTHPEAREGRATLRRNAALHKTMAPLLAGLQPPPDGAATRRKAGQGAPPQ
FT                   APWLHALEAFGEWNLVLQRVENARRTLQAHSASWSPAQREASRDAIDSVQARLAAAQAN
FT                   ASEQGREALVQSLAHLARQGIHASQEMPGSDPSAARHALAGAAEAARHAREALERSGLH
FT                   ARMAPVCTAIAQACEAMAHVPRTAAEARDHAARLQAAERQARAAAWEELAPDMHRLADL
FT                   CGTACEGALRGAAEMEAQVADQARAQREGALQAAMEAALEQPPRPAEGVDDGRNRPPMP
FT                   WQRPGDVVAALHQGLQAAQQAQSTLEEHLAGWTVAQRQESGEAVGALRARLDTARAAAL
FT                   ENAISALQQSFKEIWRAAAPLLSADTEERSLPSGARSLAGKALAAAGEFHRTLHGIDGQ
FT                   ELPERARIASIARAFAPLSTTSDALRMPLDTSAQAMARADVLDTAARQAREAAHSDFKV
FT                   PLQHWARWCDGLRTDAISFALLHGMKAIDFLCKASEADLNAATSQLSDRMLTIHELAFD
FT                   LPLHFTADGSIATSTQASPPPVVPSEDLEMARCTAAIAQRAAELRASLLPVPPGTLPEM
FT                   AQDYQASRNSLSETAYAARVTSGLLPLFHEASQAIAQAPADQQPRVARQFARKALTYQQ
FT                   DAANALGDYLESSMRLSSRSARRAAMIDGANLRQSERLVTLMQRSLDGLGHLLECRSIA
FT                   IGVHARAAIRHRDVRDGLMTIADRYERATQKIQDSLEHMEQRLEAESRLPGYADIAQGE
FT                   KANMAGAFGMLIWRGKFESTIVQAMLAADWLARFLGPDLPLRTASDLSACTELIQFLQG
FT                   DLSAQNQFALRQLRDDGNAHLVRKMLKVSLECIQRLKAFQEAIAAREQAPAAAAATGSS
FT                   STAPAPGPAKTRQRRGR"
FT   gene            complement(158023..159690)
FT                   /locus_tag="Aave_0144"
FT   CDS_pept        complement(158023..159690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0144"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bcn:Bcen_2938 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30756"
FT                   /db_xref="GOA:A1TIG8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG8"
FT                   /protein_id="ABM30756.1"
FT                   /translation="MAQATHEVFNQYAELADYDLLATDAALQEALQRAGAAHALPALGD
FT                   YARRLGSAGTHALAELANRHTPILHRFDSRGRRADRVEFHPAWDALMALYRGEGLVSMP
FT                   FDSDRPGRWSAWAAGFYLHGQVEQGTLCPATMTQAAIPLLRKEPALWARLGDRLHSRTH
FT                   DPREAPAHEKAGIWLGMGMTEKQGGSDVRANTTVATPLGAGGRGGEYRLRGHKWFFSTP
FT                   QSDAHLVVARTGEGGPFACFYVPRRLQDGTLNGVHVQRLKDKVGNRSNASAEVEFHDAW
FT                   GVLMGEEGRGIPTIIEMATYTRLNCVAGSAAILRQATVQAIAYARRRHAFGKALAEQPL
FT                   MRTVLADLALESEAALALLMRLAEAFERDADGTATPADRAWKRVMTPAAKFWVCKRGVE
FT                   MAGEAMEVFGGNGYVQEGVMARLFLEAPVNSIWEGSGNVMCLDVLRALARDTEAAHALL
FT                   EEFAPAAQGEPRIGATLRELQALLALPPQELEGMGRLAAQRLVLAAQACLLRRHAPAAV
FT                   ADAFIATRLGDAGGGRVAGAIDARAIAVDAILQRACPA"
FT   gene            complement(159772..160695)
FT                   /locus_tag="Aave_0145"
FT   CDS_pept        complement(159772..160695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0145"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, MarR; regulatory protein,
FT                   LysR; LysR, substrate-binding; KEGG: reu:Reut_B5865
FT                   regulatory protein, LysR:LysR, substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30757"
FT                   /db_xref="GOA:A1TIG9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIG9"
FT                   /protein_id="ABM30757.1"
FT                   /translation="MDWTHRLRLRQLQMLLSLAQTGNMSQSAQQLHTAQPALSKWLREL
FT                   EDDLGMVLFERHARGLRPTPQGEALIAHARRIEAHLDSARDDMQALRDGGSGLVVVGTS
FT                   GASASDVVPMAVLRLLEWLPRAQVRLAESTMNVLMQQLAMGELDVVVGRSAPELHDTHI
FT                   HAETLYMEPIHLVARPQHPLLQRTEGPIDWPDLMAWRWLVWPRGTPIRNALENALVAAG
FT                   HALPPGSVESNSVTLNLTLLGHSDMIGLASHRAALRFSHMGALRVLPVRLSGFGSVSMY
FT                   WRENTTDRTAVATMLRALREVSGPVS"
FT   gene            160851..161963
FT                   /locus_tag="Aave_0146"
FT   CDS_pept        160851..161963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0146"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.4"
FT                   /note="TIGRFAM: gentisate 1,2-dioxygenase; PFAM: Cupin 2,
FT                   conserved barrel domain protein; KEGG: reu:Reut_B5864
FT                   gentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30758"
FT                   /db_xref="GOA:A1TIH0"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR011960"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH0"
FT                   /protein_id="ABM30758.1"
FT                   /translation="MDTTLARPAAQGATPAAAPASAPPHRTPSPERQAYYDRIAGHDMA
FT                   PLWESLHSLVPREPRPQAVPAFWKYDDVRPLVMQAGEVISAEEAVRRVLILENPGLPGR
FT                   SSITSTLYAGLQLILPGEVAPSHRHTQSALRFIVEGKGAYTAVNGERTTMHPGDFIITP
FT                   SWTWHDHGNPAVDEGGEPVVWLDGLDIPLIGHLDAGFAENYPEAVQPVSRAEGHSFAAF
FT                   GHNMAPVRHRAAGPTSPIFSYPYDRSREALDRLFRQGELDAWDGVKLRYVNPATGGWPM
FT                   PTMATFLQLLPAGFQGRTYRGTDATVFSVVEGQGTARIGGSTFQFGPRDTFVAPSWAPV
FT                   QLAATQDAVLFSYSDRPVQVALNLHREHRM"
FT   gene            162127..162825
FT                   /locus_tag="Aave_0147"
FT   CDS_pept        162127..162825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0147"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bur:Bcep18194_B1888 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30759"
FT                   /db_xref="GOA:A1TIH1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH1"
FT                   /protein_id="ABM30759.1"
FT                   /translation="MAFVFPVPPTVAVPVVGTSDAFAVRRVYCVGRNYAAHAREMGFDP
FT                   DREPPFFFCKPADAVLPVAYGETLRLPYPVRTDNFHYEAELVVAIGKAGSDIARENALE
FT                   HAWGYAVGLDMTRRDRQMEMRQMGRPWEIGKAFDASAPIGPIHRASDVGHFEQAGLWLT
FT                   VNGADRQRSDVSHLIWSVAETIADLSTYFRLEPGDLIYTGTPEGVGPVVRGDRMVVGVE
FT                   RLGELAVDVV"
FT   gene            162841..163482
FT                   /locus_tag="Aave_0148"
FT   CDS_pept        162841..163482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0148"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   glutathione S-transferase, N-terminal domain; KEGG:
FT                   rso:RSc1085 putative gst-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30760"
FT                   /db_xref="GOA:A1TIH2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH2"
FT                   /protein_id="ABM30760.1"
FT                   /translation="MQLYSFFNSSTSYRVRIALALKGLPADYHGVNIRTGEHRAADYAE
FT                   LNAARVVPTLVDGDFTLGQSMAILDYLDQRHPEPRLIPLEPRQRARVLELANVIACDMH
FT                   PVNNLRILKYLQGPLALSAAQKDAWYAHWAAEGFAAVERLLVRHGGEGPWCFGDQPTLA
FT                   DVCLVPQVANALRAGCDLAPHARVMAVHRHAAQHPAFSAARPQAQPDYQP"
FT   gene            163588..164913
FT                   /locus_tag="Aave_0149"
FT   CDS_pept        163588..164913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0149"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bcn:Bcen_4217 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30761"
FT                   /db_xref="GOA:A1TIH3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH3"
FT                   /protein_id="ABM30761.1"
FT                   /translation="MTPSMAAGIPAADRAAFGPLQLRVTLLCAIVAMLDGFDTQSIAYV
FT                   APRIAEDWGLKASEFGPIFAAGLFGLMAGAFLLSPAADRWGRKKVILLSTCIFGLFALL
FT                   TAWATSMNELLAYRFITGVGLGAAMPNIIALTSEYAPQRLRATLVTVMFCGFPLGSTLG
FT                   GLISSWLIAHFDWHSVFVLGGVLPLLLLPVLALLLPESLRYLAASGAAPARYEPIARSA
FT                   YPGEDPATVMAGLRGEAAGVQGGFSVFELFRHGRLHTTVLLWLAFFLNLLVMYFLVNWL
FT                   PTLLKSAGLPLEKAILSTAMLNLGGVVGALVLGRLIDRFSAYTVLGAAYAASAGFIALI
FT                   AFSGQNLTGLLAGAALSGFGVVGAQIGCNALAAAIYPTHIRATGVGWALGVGRIGAIVG
FT                   PLAGGSLLAAAWTPSSIILVAAVPAVLAAVAVVLLGQARRGA"
FT   gene            164925..165863
FT                   /locus_tag="Aave_0150"
FT   CDS_pept        164925..165863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0150"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: rme:Rmet_4320 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30762"
FT                   /db_xref="GOA:A1TIH4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH4"
FT                   /protein_id="ABM30762.1"
FT                   /translation="MHDGLRTWTTDAVPPAQRADYWVGAVCDCFLDMEVEPGQRHAFSA
FT                   TLTSVPCGGLRVNRVSGSGQRVRRTQQAIRRGDGDNFYYLLCKDSAPCHVAQDGAGAAR
FT                   LLPGDLALVDSRRRYLLDFPDVVDTVSIQIPIGWLDTWLPAADRWLGRRVDGATGWGRV
FT                   LSAYVGQLCAERPERLAALQAEHLGGLLSLACGPVPEAPPRTGLLPRIEQCVRERFCEP
FT                   GLTAAHVADDVGVSLRTLHRVLSSGGTTFAVLLMRERMAVAQRMLHAPSHRHVTVAEIG
FT                   RRAGFLDPSHFARACRQWCGRTPAQERARAA"
FT   gene            complement(165897..166880)
FT                   /locus_tag="Aave_0151"
FT   CDS_pept        complement(165897..166880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0151"
FT                   /product="ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   bur:Bcep18194_B2555 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30763"
FT                   /db_xref="GOA:A1TIH5"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH5"
FT                   /protein_id="ABM30763.1"
FT                   /translation="MTASTTRDARLLLLTKDHVEQLLQPEGVLAAVREAFVLLSERAGR
FT                   VFPVVRERLETGGIFGIKSGDVPSQGLLGFKAAGFWPSNRALGGEPHQATILLIDPATG
FT                   RPTCLIDGNAITTARTGAAGGHGLALLARPDSRRLCLFGTGVQAAVQLTYALRLLPHLR
FT                   DVRYVTADGRPDPAFEQRFAGQCLLRHSTDRNADVAASDVVITATPGGGPLFDLDAVRP
FT                   GTHLNCVGADTRGKREAPQGLLDKVRIYVDDEAQARQIGEMQWAPGAACTEIGDVMRGS
FT                   ASVDRQPEDITLFDMTGLALQDLTVARLVQEQAGAAGLGLPVAWPW"
FT   gene            complement(166877..168004)
FT                   /locus_tag="Aave_0152"
FT   CDS_pept        complement(166877..168004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0152"
FT                   /product="L-threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: bja:bll7236 putative threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30764"
FT                   /db_xref="GOA:A1TIH6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH6"
FT                   /protein_id="ABM30764.1"
FT                   /translation="MTTSLYIDPASGRTYPLDVPRWCSDDRKPLLVTPQPGMSRDDIDR
FT                   TCRSQWRYRASLPLDVARPISMGEGCTPLVQKEWGAHRPYFKLEWFHPTGSFKDRGTTV
FT                   MLSVLRQQGVDAVLEDSSGNGGASVSAYGAAGGMRVKILAPAYASKPKIAQMRAYGAEV
FT                   QLVDGPRQACEDEAVRQSAHIFYSSHNWQPFFLEGTKAIGYEIWEDLNFRAPDNIVMPA
FT                   GAGSNVLGCFMAFSELLRAGQIAKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTV
FT                   AEGTAIAHPLRLRELVSAVQVTGGATVALQEQAIVDAFRKAARTGLLPELTSATAIAGL
FT                   DHLIQAGTVHESEETVVILTATGIKNADAIAEMFA"
FT   gene            168138..168770
FT                   /locus_tag="Aave_0153"
FT   CDS_pept        168138..168770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0153"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: bps:BPSS2061
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30765"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH7"
FT                   /protein_id="ABM30765.1"
FT                   /translation="MKKKAHTAEQQAILEQVQHIASALGETFAPFTEVVLHDLRSPKHA
FT                   ILAIHNNLSGRKVGDPATELGLARIADDQYPQVLANYANQFADGRRAKSTSIGIKDSEG
FT                   HYFAALCLNVDMTVFRGIATMIEQFSAIGEDGRKETLDTGNAEALRDRIDRFAMTLATT
FT                   PRALRTEQRRELLQTLKGEGFLEIKRSMDTVAQHLGVSRATVYNDIR"
FT   gene            168874..169602
FT                   /locus_tag="Aave_0154"
FT   CDS_pept        168874..169602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0154"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: aci:ACIAD1426
FT                   salicylate esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30766"
FT                   /db_xref="GOA:A1TIH8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH8"
FT                   /protein_id="ABM30766.1"
FT                   /translation="MADTYVLVHGAWHTGETLAATAKYLRARGHTVHCPTLPGNRPGDG
FT                   TAPLGLQDAIDGLVQFLESNDLKDVRLVGHSYGGMLLSGAADRVPERIRRLVYVNAFVP
FT                   LPGESLADMAPPYYRAMFESIAAANGGGVQLPYEVWRESFINDADAELARTTYALLHPQ
FT                   PLRCLTDPITLSQPTAALALGKSYLNCREDTALPHSLPWHPRLSERLGLFRYVEASGSH
FT                   EALFTDPEGFARGIERAGRD"
FT   gene            169644..170411
FT                   /locus_tag="Aave_0155"
FT   CDS_pept        169644..170411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0155"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: mlo:mll6127 outer
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30767"
FT                   /db_xref="GOA:A1TIH9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIH9"
FT                   /protein_id="ABM30767.1"
FT                   /translation="MQAIARHSRAATAFAAAVGSLIPALPAQAQAQTQTQQSAQAAQAA
FT                   QAAQAAATRTPSADLSAPSPWRIYAGAAHIGFSTSAEVRAGGQLVPGANAEADSNISLG
FT                   FGAIYDFHPGWSAEIALGLPPTTALKGTGTLSSAGTLGKVKYGPAVLSVRRHLWEDGPV
FT                   RPYIGAGINYTLVLESRDGFVSNLDVKNGVGPVLQAGFEVPIDPRWSFFVDAKKIWLKT
FT                   TATGTLPALGGAPAHAKVRLDPLVVTAGVSYRF"
FT   sig_peptide     169644..169733
FT                   /locus_tag="Aave_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.630 at
FT                   residue 30"
FT   gene            171086..171298
FT                   /locus_tag="Aave_0156"
FT   CDS_pept        171086..171298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0156"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   KEGG: noc:Noc_0665 excisionase/Xis, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30768"
FT                   /db_xref="GOA:A1TII0"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII0"
FT                   /protein_id="ABM30768.1"
FT                   /translation="MNTATDSVMTVKEVADYLRVNQRTVYRLAVDRKLPGFKVGTTWRF
FT                   KRADIDRWIDAQAASSLPEPGAGIS"
FT   gene            171326..174562
FT                   /locus_tag="Aave_0157"
FT   CDS_pept        171326..174562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0157"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SMART: DEAD-like
FT                   helicases-like; KEGG: cte:CT0906 DNA-dependent ATPase, SNF2
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30769"
FT                   /db_xref="GOA:A1TII1"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII1"
FT                   /protein_id="ABM30769.1"
FT                   /translation="MKLVQNSGSDRVIDLLLPHLVSGSRLGCVTPSFSLHAFAELREAL
FT                   NGLGQVQLVLPADNEQLELLGGEGDRAQRNRLQARWLANQCAQWLTQKAEVRRAHGRVP
FT                   QGAAVLTGAGDEPAQVVLGSFALSSEGLGLAPGNPLNLIQASESPEEARTLARWFDQQW
FT                   SALRHQPDGEQSLVDALKGMAAHRAPFEVYALILHHLLGNRDEALDEDRIVKAATGIRN
FT                   TVIWKKLFKFQRDGVVGAIDKLARFGGCIIADSVGLGKTFEALAIIKYHELRNDRVLVL
FT                   APKRLRDNWTLYKANDRRNILAADRLNYDVLNHTDLSRDGGQSGDIDLAHVNWGNYDLV
FT                   VIDESHNFRNKKSPKQGSETRYHRLMRKIIREGVKTRVLMLSATPVNNRLSDLRNQIAF
FT                   ATEGDDTALQDHGIASIEQTTRKAQIQFNRWLELPEEERVPGRLVEMLGFDYFTLLDHL
FT                   TIARSRRHIERYYGTEETGRFPERRAPINIKADVDTAGQFRAIRDINLEIRRLNLASYA
FT                   PMRYVLPHKAEAYDAKYSTEIRGGESIFRQADREESLIHLLRVNVLKRMESAVSSFALT
FT                   IQRQLKDVETTLARIEEHASDAGEVEELDIADVDIDDPVFEQLLVGRKVKVLLSDVDLH
FT                   RWKQDLIEDRNRLDNLLQAAQQVDAARDAKLAKLREVIERKCREPINVVGGKANRKIIV
FT                   FTAFSDTAQYLYAQLAPWAKEKLGLDAGLVTGSAGIQSTLPGLRKSMSSILSAFAPRSK
FT                   ERPAELADEGEIDLLIATDCISEGQNLQDCDWLINYDTHWNPVRIIQRFGRVDRIGSPN
FT                   QSVQLVNFWPNMELEEYIGLEQRVSGRMVLLDVSATGEENLIEQQSGNPMNDLEYRRKQ
FT                   LLKLQDTVIDIEDLSSGVSITDLTLTDFRIDLAEFLKEHPGVLEGAPLGTYAVTSTIDA
FT                   DIPPGIVFCLRAEGAAAAKCEASDYPLAPTYLVHVGDDGAVLLPYPQAKRVMDRLKRVA
FT                   LGRELPDEGTCAHFDRQTRQGEDMRHAQKLLAAAIASVVGKAEERAVASLFAPGGTHAM
FT                   KGEFAGANDFEVLAFMVILPGSTQPQGGAA"
FT   gene            174559..175338
FT                   /locus_tag="Aave_0158"
FT   CDS_pept        174559..175338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cte:CT0907 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30770"
FT                   /db_xref="InterPro:IPR025503"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII2"
FT                   /protein_id="ABM30770.1"
FT                   /translation="MSDAVNALHDAIVASLALPASCRVDQRVPKKMLAEHGGATAADRR
FT                   LLTDGIEEAHWLAAIKPATTAIPTWRDEVREYLELAVLSMAARPTYAQPAQLQRLAELV
FT                   HRAVPYLVLLIVSTPDAVAMSLSHKRTAQNEAGRVVLDGDVVSFQFSDELPDGLLDALA
FT                   LGQQPQQDLKALYQGWMDTLLAAQVARVTGHFSMDPTTDQAAMRRIALIEHQQLEAEAA
FT                   RLRALAGKESQIAKRVDQNLALQRLQAELAAVRARLQ"
FT   gene            175361..177367
FT                   /locus_tag="Aave_0159"
FT   CDS_pept        175361..177367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0159"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   bpm:BURPS1710b_0259 type III DNA modification
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30771"
FT                   /db_xref="GOA:A1TII3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII3"
FT                   /protein_id="ABM30771.1"
FT                   /translation="MTNSNMQKIVATAPETQSADLVAGNIAQLKALFPELVTEGSKGVA
FT                   INLDVLKALVGDAKVTDAEEKYGLNWHGKRRARQLALTPSTGTLRPCPEESVDWDSTQN
FT                   LMIEGDNLEVLKLLQKSYAGKVKLIYIDPPYNTGKDFVYPDNFQNGIQNYLELTGQTES
FT                   GVKVSSNTEASGRFHTDWLNMMYPRLKLARQLLKEDGAIFVSIDDIELPRLKIALDELF
FT                   GEDNLIAQFVWRSDGNFDNQAKVKVCHEYIVAYAKSAPNFAHPPVVDPSTPTDSKIFRP
FT                   QIRNTIVKNGPKNPPSEILLPAGFPADFDDGVIEGRTEGWPIYKGAAVIRGGRLIAPAL
FT                   VESGWSSKDLLLEFVANGCLPIFDGKGQSTSFVISRTGAIEVIKERTDTKSHVISVLTG
FT                   FGGTQKATSQLEELGAFFNGYPKPLELIRYLTKMVPGNDGIFLDFFAGSAPLGHVIYEQ
FT                   NAEDEGTRRFVLVQLPEQLSPDSDVQKAAVAYCDKLGKPRTVAELTKERLRRAAKKFSA
FT                   NKGEATGDNGFRVFKLDTSNVKGWTTQVPDLNQALLEHQEHLLPNRTEQDLLYELLLKL
FT                   GLDLCVPIQQQMIASKSVHAVGAGVLLACLAEGITAAEVETLAEGIVQWHQQLAPVGDT
FT                   TCVFRDSAFADDVAKTNMAAILQQHGIQNVRSL"
FT   gene            177370..178008
FT                   /locus_tag="Aave_0160"
FT   CDS_pept        177370..178008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE1363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30772"
FT                   /db_xref="InterPro:IPR029494"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII4"
FT                   /protein_id="ABM30772.1"
FT                   /translation="MAVPDRPKLYHICHVDRLPSIIASGGLLSDAAVVQVAAPGTVIGM
FT                   NHIKQRRMTELQLTSHPGLYVGQCVPFYFCPRSVMLYLIHRQNADLAYKGGQGPIVHLE
FT                   ADLHTTVAWANGQGLRWAFTLSNAGARYFEDRADLGRLGEVDWDAVAARNWSAQKEGKQ
FT                   AEFLLERGFPWQLIERIGVLSQPIATQVAHALPVGGHRPPVQLMPAWYY"
FT   gene            178023..179084
FT                   /locus_tag="Aave_0161"
FT   CDS_pept        178023..179084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0161"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   neu:NE1364 Appr-1-p processing enzyme family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30773"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII5"
FT                   /protein_id="ABM30773.1"
FT                   /translation="MIELTSGDILKDDSDAIVNTVNCVGIMGRGIALQFKNAWPENFKA
FT                   YKAACDREEVQPGRMFIYDTEQLAAPRYIVNFPTKRHWKGKSRMQDIDAGLEALVRDVA
FT                   RLGIRSIAIPPLGSGLGGLEWDEVRPRIEAAMQALPDVRVRIYEPKGAPAADKMQHSRE
FT                   VPRMTAGRAALVELMNRYVQGLLDPTISLLEVHKLMYFMQEAGEPLRLSYVKAPYGPYA
FT                   ENLRHVLQKIEGHMVAGYADGGDDPTKPLTVVPGAVEEAGAFLGEHVDTRARFDRVGDL
FT                   VEGFETPFGLELLATVHWVASHTVAGGGVEDVVRETHAWNDRKKQFTPRQIGIALNVLD
FT                   AKGWLPAAEQVGA"
FT   gene            179081..182077
FT                   /locus_tag="Aave_0162"
FT   CDS_pept        179081..182077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0162"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: type III restriction enzyme, res subunit;
FT                   KEGG: cte:CT0911 type III restriction system endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30774"
FT                   /db_xref="GOA:A1TII6"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII6"
FT                   /protein_id="ABM30774.1"
FT                   /translation="MKLHFEPDLDYQKQAIESVCDLFRGQEVCRTEFTVTMRLPEQQLT
FT                   LGVAETDLGVGNRLTLLDDQLLKNLQDVQMRNGLAPAGTLASGDFTVEMETGTGKTYVY
FT                   LRTIFELNKRYGFTKFVIVVPSVAIKEGVYKSLQITEEHFKALYAGVPVDFFLYDSAKL
FT                   GQVRNFATSSAIQVMVVTVGAINKKDVNNLYKDSEKTGGEKPIDLIRATHPIVIVDEPQ
FT                   SVDGGLSGAGKTALDAMNPLCTLRYSATHADKHHMVFRLDAVDAYERKLVKQIEVAAAT
FT                   VEDAFNKPYVRLVAVTNKRGRISAQLELYVQEAAGPKLREESVSDGDDLQQVTKRAIYA
FT                   DFRVGEINTAKGSEFVELRYPGGEVALAIGQAHGGVDELAVQREMIRRTIREHLEKEKL
FT                   LRPKGIKVLSLFFIESVDRYRKLDAQGQAVKGDYARIFEEEYRRAAKLPSYQSLFAEVD
FT                   LTTAAEEVHNGYFSIDKKGGWTDTADNNAAGRENAERAYNLIMKEKERLLDFATPLKFI
FT                   FSHSALKEGWDNPNVFQICALREMGSERERRQTIGRGLRLCVNQAGERVRGFDVNRLTV
FT                   IATESYEDFAENLQKEIEADTGIRFGIVEPHQFAGIPVAGADGQVTAFGVEQSRLLWEH
FT                   LKAAGQIDAKGKVQDSLKQALKDGTLALPDAFAAQRTQVLELLRKVSGRLEVKNADERK
FT                   TVALRKDADGKAITLGEEFKALWDRIKHKTTYRVQFDNAKLLQDCTKALRDAPPIPKAR
FT                   LQWRKADIAIGKAGVETKEQKDGAYTVGLDESGIELPDLLTDLQDRTQLTRRSLVSILT
FT                   ESGRLDDFRRNPQQFIEQTAEQINRCKRLALVDGIKYQKLGDQQVYAQELFEQQELTGY
FT                   LKSMLLDTAKSIHEHVVYDSATERDFAQALEFNQDVLLYAKLPNWFKVPTPLGNYNPDW
FT                   AVLLQKDGVQRLYFVVETKSSLFADDLRDKEWAKIECGRAHFAALATGENPARYLVARS
FT                   LDDVLQTVN"
FT   gene            complement(182070..183368)
FT                   /locus_tag="Aave_0163"
FT   CDS_pept        complement(182070..183368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0163"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0979 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30775"
FT                   /db_xref="GOA:A1TII7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII7"
FT                   /protein_id="ABM30775.1"
FT                   /translation="MELEDIDLNLLVVFQQLLVTRKVSQAAENLGLTQPAVSNALARLR
FT                   RLLGDELFLRTAHGMQPTPYADQLAESVSYALAMIHGALNHKLGFDPATSRRVFKVGMT
FT                   DIGEIYFLPRLLERLAQVAPGVRLATVRNSATDLKDAMEAGKIDLAVGLLPQLKAGFFQ
FT                   RRLFRQPYVCLFRQGHPLHRRRRIGLEDFAKAQHVVVVSEGTGHGKVDELLERMGVARD
FT                   VRLTVPHFVAIGHILQATRMIATVPEKMAQSMAGPFGLAYAPHPVKLPQVAINLFWHTK
FT                   YHRDPGNQWLRGWWWRCLRRGSEGARRPRRSAFGIRDLEAIAALLFPSSTGHVAMSPIG
FT                   WLRSFIFEYGRSLSLKPARRDSKAPWSAVRQSLSIALGTCPAAVRRNGLLQVCRIAVTS
FT                   TKSVGSRRLPLAWGHSLETPSSYPLTRPGQTVS"
FT   gene            183480..184475
FT                   /locus_tag="Aave_0164"
FT   CDS_pept        183480..184475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0164"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: pol:Bpro_0980 oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30776"
FT                   /db_xref="GOA:A1TII8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII8"
FT                   /protein_id="ABM30776.1"
FT                   /translation="MELHIEPLGRVLPVAPGANLLEVLRAHQIPVSYSCMAGRCGTCRC
FT                   KVIAGEVLDSGQALRMPPLGGDGGAQYVMACQTVLSESCTIEIPEPDEVVVHTARTLKA
FT                   TVTAVETLTHDIRRLRLKPAKPLDFSPGQYAQLQFGPGLARPYSMAGLPHDGELEFHVR
FT                   LVEGGLVSTHVASVLAVGDAVRVSGPLGSAYLRRKYEGPMLCVAGGTGLAPILSIVRGA
FT                   LEAGMPNPIHVYAGARSARDVYGLQWLADLQQRHPRLQVHAVVAAADAAPGQRTGLVTD
FT                   AIAQDWPSLEGWRAYLCGSPPMVEAVSLLARQRGIAPEHLYADAFYASTP"
FT   gene            184498..185763
FT                   /locus_tag="Aave_0165"
FT   CDS_pept        184498..185763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0165"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: pol:Bpro_0983 Rieske
FT                   (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30777"
FT                   /db_xref="GOA:A1TII9"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1TII9"
FT                   /protein_id="ABM30777.1"
FT                   /translation="MSTPHPVFPLQPVWESPGTHRVPFAAYTSEEIYRRELERFFYRGH
FT                   WCYVGLEAEVPNPGDFKRTAIGERSVILVRGEDMQLHVVENVCAHRGMRFCRERHGNRK
FT                   EFVCPYHQWSYRLDGALQGVPFRRGVKQDGKVHGGMPADFKLEEHSLTRLKVAVRGGVV
FT                   FASFDHGVESLEDFMGPVILGYFDRMFNGRKLKILGYNRQRIPGNWKLMQENIKDPYHP
FT                   GLLHTWFVTFGLWRADNKSELKMDARHRHAAMVSTRGEAKKQSDVSNVSSFKAGMQLED
FT                   PRFLDIVPEPWWGGPTAVMTTLFPSVILQQQVNSVSTRHIQPVGHDAFDFVWTHFGYED
FT                   DTDEMTERRLRQSNLFGPAGFVSADDGEVIEFSQQGFEQKPFHRALVELGGHEVGDTDH
FT                   MVTETLIRGMYEYWRGVMEKED"
FT   gene            185768..186256
FT                   /locus_tag="Aave_0166"
FT   CDS_pept        185768..186256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0166"
FT                   /product="aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: pol:Bpro_0984 aromatic-ring-hydroxylating
FT                   dioxygenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30778"
FT                   /db_xref="GOA:A1TIJ0"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ0"
FT                   /protein_id="ABM30778.1"
FT                   /translation="MSMKTPIDFADWFALQQLYADYASALDAADWDRWPGFFTEDCVYR
FT                   LQPRENHERGLPLATLSFDSQGMLKDRVYGIRETLFHDPYYQRHVIGAPRVRAAGEGRW
FT                   ECEANYAVFRTKLSEPSAVFNVGRYLDVVVRTPQGLRFARKECIYDSEMIPNSIIYPI"
FT   gene            186268..186597
FT                   /locus_tag="Aave_0167"
FT   CDS_pept        186268..186597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0167"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   reu:Reut_B4721 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30779"
FT                   /db_xref="GOA:A1TIJ1"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ1"
FT                   /protein_id="ABM30779.1"
FT                   /translation="MTAIDTGWTEAAELGDVPEDDVIGVTVGGRDVALYSVEGEVFATD
FT                   NLCTHGNARLCDGFLEGHEIECPLHQGRFDVRDGSALCAPLTRGLRTYPVRIEQGKVYL
FT                   QLEGA"
FT   gene            complement(186648..188114)
FT                   /locus_tag="Aave_0168"
FT   CDS_pept        complement(186648..188114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0168"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   reu:Reut_B3725 chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30780"
FT                   /db_xref="GOA:A1TIJ2"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ2"
FT                   /protein_id="ABM30780.1"
FT                   /translation="MGKAKRGRDLSPSAQQALQTIACRADALLLAICALGAIVALWIGF
FT                   VYGRPGTAAIWGGALMALAAWAYLAVRGSLLGRLALVTAGIGLVALHIQLSLGATEMHF
FT                   GVFVFLAFVLAYRDWRPVVFAAVLIAVHHIAFDRLQLAGGPVYCLTEPDFGRVLVHAAF
FT                   VVVQTAVEVAITLRTRADAIESAELQYLCRPQQDGQLSLDVRGVPVDSAAARALQAALL
FT                   RLNGVVTDVHQAAAGLAAAAGEIATGNRDLSQRTERTASHLQDAAASMGQLDGAVQHSV
FT                   QEAVAARRLTQEATQVAEHCGGVVTEVVATVQDIHSSAGRIADIVGVIDGIAFQTNILA
FT                   LNAAVEAARAGEQGRGFAVVASEVRSLAGRSAEAAREVRALIAASVQKAERGSRLATDA
FT                   GEHMQNVVDCARRASEVVGAISTSVEGQSGELGRVNASVTELDHMTQQNAALVEQSSAA
FT                   AASLLEQAGRLRSVVDGFQFQPERLLAAAR"
FT   gene            complement(188452..189669)
FT                   /locus_tag="Aave_0169"
FT   CDS_pept        complement(188452..189669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0169"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   psb:Psyr_2232 major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30781"
FT                   /db_xref="GOA:A1TIJ3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ3"
FT                   /protein_id="ABM30781.1"
FT                   /translation="MAFFMADVRDGLGPFLATYLQTQRIDQTMIGIVMSAGGLAGMLAT
FT                   PVAGAWADRIRAKRMLVAIAALAILGASAVAFGTRSPGMLVLSQVLTGVAGALLAAGLA
FT                   ALTLGLARRQGLRHQTGRNEAYSHAGNIVSALGAAAFAHWLGAPWMLVVMTAMAVGALA
FT                   CLMAIRDRDIDQVAARGGEPAPEARTDAAPAAASAGAPAAPEGWRAFLSHRALWLFGLA
FT                   CALFHLGNAAMLPLLNQRLAATVPDSAPLLWTGIAIVVAQLTMVPVALWVSRSRRLDLQ
FT                   VFIYIAILALPVRGILAWAIPDAWANIPVQILDGLAAGALGVATPLMVERYVRGSGRYN
FT                   TALGLVMTLQGVGASLSPAIANSVVGAQGHFGLAFAVLAGCAMLALPVFWFAQRQAERH
FT                   PAPHPA"
FT   gene            complement(189812..190366)
FT                   /locus_tag="Aave_0170"
FT   CDS_pept        complement(189812..190366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30782"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ4"
FT                   /protein_id="ABM30782.1"
FT                   /translation="MSQPQETVEVWSLEGRFQHLLHSPRGEVEGVLIDVDGVTAQFTFG
FT                   KHDECAVRAAEALKPGQALVLEGSVAPPPRHGEASHEVYAFERLVSIDGEPAAPEEAVR
FT                   RAEGRVARIHHARHGEPNGVVLDTGDFIHLRPDGYAALQLQPGDAVEAAGPARPLRGAQ
FT                   GHVIEARTVNGKPLPAQPHHG"
FT   gene            complement(190402..191148)
FT                   /locus_tag="Aave_0171"
FT   CDS_pept        complement(190402..191148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0171"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV0233 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30783"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ5"
FT                   /protein_id="ABM30783.1"
FT                   /translation="MRPNTLTRAGLAALLLACAGAQAQPAPPAPGAVPPPPGAVPPPPV
FT                   AGQPPGPIGQPAAVEQASHSGAVQRWLLNPNGEADGLLLQDGAQVAFPPHLSDTLTSWL
FT                   RPGDAVDVAGWHYSGVPVLRISAISSQGRTVQDTPPSPGQMPPPPPQRPALVELQTDGR
FT                   VATVLLNTRGDAHGLLLDNGVIVRFPPHVAASIGNLLQTGATVSARGWGTRNALGTALE
FT                   ATQLGSSASTLQEVFRGPAGGPPRRP"
FT   sig_peptide     complement(191077..191148)
FT                   /locus_tag="Aave_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(191310..192686)
FT                   /locus_tag="Aave_0172"
FT   CDS_pept        complement(191310..192686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0172"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: xac:XAC0226
FT                   two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30784"
FT                   /db_xref="GOA:A1TIJ6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ6"
FT                   /protein_id="ABM30784.1"
FT                   /translation="MARILAVDDDAAFRESLVETLQGLGHEVHEAASGDEALRQAGRHR
FT                   YAAIFLDHRMPGMDGLETLAALAARVPELPPVVVLTAYASGSGTIEAMRLGAFDHLTKP
FT                   VGRAAVIEVLERALRSRAEADAAPPAPAARAGADEADGELIGVSEAMREVHKRIGLAAA
FT                   SEAPVLVQGETGTGKELVARALHRHSARSAGPFVALNCAAIPKELLESELFGHVKGAFT
FT                   GAATDRPGCFRAADGGVLLLDEIGDMAPDVQAKLLRALQEGEVTPLGSHRPVKVDVRVV
FT                   AATHRDLTAAVREGRFREDLRYRLDVLQIALPPLRERLADIVPLAEHFLRRAAAPQPAK
FT                   RLAPDAARALLAHGWPGNVRELRNAMERVQALQRGPVVGAADLDLGPPPASAAASGTDD
FT                   GALPQDWLDVPLPEAVERLERQLIAHALEQARGNRSLAARRLGIHRQLLYSKLAQYGME
FT                   "
FT   gene            complement(192671..194158)
FT                   /locus_tag="Aave_0173"
FT   CDS_pept        complement(192671..194158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0173"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: xom:XOO_3970 two-component
FT                   system sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30785"
FT                   /db_xref="GOA:A1TIJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ7"
FT                   /protein_id="ABM30785.1"
FT                   /translation="MRTSSTRIPPVRSLRIQLTLFWTLLLGACALVAVVLTVLYQSGSG
FT                   AQVAAGRTRVAQACTDVAGRYAQSAPGVAADAPREDLLRVLLHMVLLEAPRVEGGAWSA
FT                   SGGMLAYAYPTYEGSGVKSDVPSAEEPLIVEMARQASAGRQPLVNLVRGSREVLIVAAC
FT                   PLAAHPGTAVWTMTRVHAGAIAAQDSLRAGIAILALLVAVSGAWLGWMLQRGLRQVQRL
FT                   EDALAQAGGDTVPVLQRTGIRELDRIVEGFNSFGARLQEARERLREALAQQHRDMRLTA
FT                   LGRMTASVAHEIRNPIAAMRLKADNALAAPPARHADALAAIGTQIDRLEGLVQSLLTLV
FT                   QPLQLEPHPVDLPAWLQERLDTARAAAEARGVRLSLRGDVPATAVFDPVHAARAIDNLL
FT                   DNAVRHAPRGGEAVLSAQVDAARSLCVIAVEDDGPGVPEALRAQLFEPFATGRTDGNGL
FT                   GLALAREVALAHGGDLHYAPREGGGARFLLELPWHAS"
FT   sig_peptide     complement(194009..194158)
FT                   /locus_tag="Aave_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.446 at
FT                   residue 50"
FT   gene            complement(194235..195299)
FT                   /locus_tag="Aave_0174"
FT   CDS_pept        complement(194235..195299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0174"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pol:Bpro_0172 5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30786"
FT                   /db_xref="GOA:A1TIJ8"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ8"
FT                   /protein_id="ABM30786.1"
FT                   /translation="MQPLHYTRARQLPGILAERIAILDGAMGTMIQRFKLGEAQYRGEG
FT                   YSGPDGAGDRFKDFPRDVKGNNELLSLTRPDVIRDIHERYLAAGADLIETNTFGATTIA
FT                   QEDYHMADLAREMNLASARLARAACDKYSTPDKPRFVAGALGPTPKTASISPDVNDPGA
FT                   RNVDFEQLRAAYYEQTQALVEGGADVLLVETIFDTLNAKAALFAIDEYFEASGERLPLI
FT                   ISGTVTDASGRILSGQTVTAFWHSVRHARPLAIGLNCALGATLMRPYIQELNRVAEDTF
FT                   ISCYPNAGLPNPMSDTGFDETPEVTSRLVHEFAAEGLVNIVGGCCGTTPDHIAAIGRAV
FT                   APVPTRKLFYPEAA"
FT   gene            complement(195453..196361)
FT                   /locus_tag="Aave_0175"
FT   CDS_pept        complement(195453..196361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0175"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bbr:BB1096 LysR-family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30787"
FT                   /db_xref="GOA:A1TIJ9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIJ9"
FT                   /protein_id="ABM30787.1"
FT                   /translation="MKLHLLRYFTVLAEELHFGRAAERLAITQPPLSSGIKALEDELGV
FT                   KLFDRSSKHVALTPAGAAYLAEARVVLDRVARAGDTARAVAAGRRGRLDIGFTGSMVYR
FT                   DMPAIVRAFGERAPGIEVHLREMSSGEQTEALLHRQLHAGFINASVVPAPLRCLPLAHD
FT                   HFVACLPQGHALAGTAPVDLHALAGETFVMFARDVAPANHDNVIALFHRAGIHPHTRHA
FT                   ARQWLTVVALVAMRMGVALVPASMAQAAVQGVRFVPIAHLEHPTVGVLAWHEEGTNPAL
FT                   QAFLDVASAASQQHRPASEGS"
FT   gene            complement(196388..197551)
FT                   /locus_tag="Aave_0176"
FT   CDS_pept        complement(196388..197551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0176"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   bbr:BB3131 probable acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30788"
FT                   /db_xref="GOA:A1TIK0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK0"
FT                   /protein_id="ABM30788.1"
FT                   /translation="MDFALSPEQEQIRGAIERVCAPFDADYWLAKDREGGFPHDFHQAL
FT                   ADAGWLGIAMPEAYGGAGLGISEAALMMHAISATGAGLSGASAVHMNIFGLHPVVVFGT
FT                   EEQKARWLPPLIRGRDKACFGVTEPNTGLNTLGLKTRAVREGDHYVVHGQKVWISTAQV
FT                   ASKILLLARTTPLEECRGTEGLSLFYTDLDRSTVEVREIEKLGRKCVDSNQVFIDGLRI
FT                   PVEDRVGEEGKGFQYILHGLNPERILIASEAVGLGRAALARAAGYAQEREVFGRPIGQN
FT                   QGIQHPLAQSWMELEAAHLMVQKAAWLYDRHQSCGAEANAAKYLAAEACYHACERAILT
FT                   HGGMGYAREYHVERYLRESWIPRLAPVSPQLILCFIAEKVLGLPKSY"
FT   gene            complement(197551..197997)
FT                   /locus_tag="Aave_0177"
FT   CDS_pept        complement(197551..197997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0177"
FT                   /product="Cupin 2, conserved barrel domain protein"
FT                   /note="PFAM: protein of unknown function DUF861, cupin_3;
FT                   Cupin 2, conserved barrel domain protein; KEGG:
FT                   rme:Rmet_4456 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30789"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK1"
FT                   /protein_id="ABM30789.1"
FT                   /translation="MTPTTTVPTTTAMTTPDAPSRYLVRAAQVPGYQPANHHHTVNQRL
FT                   IGPETVGARQMEVLLGTLHKGGGALPHAHPGIEQACYLLEGTARAEVEGEAFDMVPGDM
FT                   CFFPADRMHVFTVTSDTPVKLLVIYSPPYGESPDKVIRPAGKGA"
FT   gene            complement(197994..199292)
FT                   /locus_tag="Aave_0178"
FT   CDS_pept        complement(197994..199292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0178"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: bbr:BB4256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30790"
FT                   /db_xref="GOA:A1TIK2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK2"
FT                   /protein_id="ABM30790.1"
FT                   /translation="MGDVAERTCSTEHEMTEASSFAASPPRTGPLAGVRVLDLTSVIMG
FT                   PFATQILAQLGAEVVKVETPEGDNMRHVGPMRHAGMGHIFLHANAGKQSIALDLKHPDG
FT                   REAALRLAEGCDVLISNVRPQALARLGLDHGAVSARNPRIIHVSCCGFDQDGPDAARPA
FT                   YDDLIQGATGIPWLMQRYGAPEPSYAPTTLSDRVTGLHAVYAVTAALYAREKTGRGQAV
FT                   VVPMFEAMAQFVLGDHMAGLTFEPPLGEPGYARLLTAHRKPYATADGMLCVLIYNDKHW
FT                   RSFFAAIGEDGDGGLAHDPRFATHGARAAHIDAVYAEVARILRTRTTAAWRAVLDAADV
FT                   PNMPMNSPADLLGNAQLRATGFLHDTEHPSEGPMHAMAHPTRWSATPPARDLPPAPRLG
FT                   EHTRSLLAGAGYTPAQIDALLAQGACLAAGDTA"
FT   gene            complement(199321..200268)
FT                   /locus_tag="Aave_0179"
FT   CDS_pept        complement(199321..200268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0179"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bpa:BPP1897
FT                   IS1002 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30791"
FT                   /db_xref="GOA:A1TIK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK3"
FT                   /protein_id="ABM30791.1"
FT                   /translation="MNSHKHARLTRAGRALLVDRVLQQNWTMRQASEAAGVSLRTGYKW
FT                   MARFRNEGPDGLLDRSSRPHRSPQACPPEQVQLFEQQRRQRLPLWRIARETGRSLATVA
FT                   RHMDRIGLSRLASLEPPQPVRRYERASPGELLHIDTKRLGRIHGVGHRITGDRTQNRNR
FT                   GIGWDAVHLAIDDHSRVSFAQVLADETALSCVQFLRDAVAYYANIGVRIERVMTDNGSG
FT                   YKNAFRAACEELGIRHIRTRPYTPKTNGKAERFVQTSLREWAYARPYESSAQRTAALQP
FT                   FIDGYNWCRPHSALGHQPPITRIPGVNNLVRLNS"
FT   gene            complement(200469..201452)
FT                   /locus_tag="Aave_0180"
FT   CDS_pept        complement(200469..201452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0180"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_B4520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30792"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK4"
FT                   /protein_id="ABM30792.1"
FT                   /translation="MRFSLSRALRRACGAMAALAATAALAQAPDYPDAPITLIVPFAAG
FT                   SGTDAVARTVGQKLAERLKQPVLVDNKPGANAQVGAQLAARAMPDGYTLFMTTNTSHSA
FT                   NPALYASLKYDPIKDFTPVARVGELPFALVVSPALPVKSLPEFLDYARARPGTLSYATP
FT                   NSTSLVAMESIKHIAKVDILGVPYKSSPQALTDLLGGQVQAYVVDLGSGKTMLTGDKVR
FT                   TLGITTAKPSPLLPGVPPIGQTVQGFDLTSWNGIFGPAGMPPAVVQRLNTELQAVLADR
FT                   DTQDKLAQIGFQVWPSKTPEEFAQYVAQQLAHWRTLIRQAGIEPTP"
FT   sig_peptide     complement(201372..201452)
FT                   /locus_tag="Aave_0180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            201563..203680
FT                   /locus_tag="Aave_0181"
FT   CDS_pept        201563..203680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0181"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: rfr:Rfer_0459 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30793"
FT                   /db_xref="GOA:A1TIK5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK5"
FT                   /protein_id="ABM30793.1"
FT                   /translation="MVAALPACGTEHNRHLACVQRSGSAGTPSCPAPCPAPLPRGHPRR
FT                   HRPESSTALSPAHFVLHDVFGYEHFRGPQQAIVEHVIAGGDALVLMPTGGGKSLCYQVP
FT                   AIVRRDAGKGVAIVVSPLIALMHDQVGALHEAGVDAAYLNSTLDWQQTQELERRVARGD
FT                   ITMLYAAPERLTTPRFLELLDGLHQRGQLSMFAIDEAHCVSQWGHDFRPEYRALTVLHE
FT                   RYPGVPRIALTATADALTREDIVERLQLEGAQHFVSSFDRPNIRYTIVEKREPLAQLLR
FT                   FIEREHPEDAGVVYCQSRKRVEEMSAALVDAGLKSLPYHAGLPPEVRQENQDRFLREEG
FT                   IVMVATIAFGMGIDKPDVRFVAHVDMPKNIEGYYQETGRAGRDGLPADAWMAYGLQDVV
FT                   NQRRMIDESPAGEEFKQVMRGKLDALLGLAEATDCRRVRLLGYFGEVYGEPSSAAGPPQ
FT                   GASGPLGGQRGHEVPSVGATCGNCDNCLNPPAVWDGTDAARKLLSTIYRVHEASGLTFG
FT                   TGHIMDIVRGKDTEKVKQFGHDRLSTFGLGKDYTEAQLRGVLRQLLATGAVGLHKVMLE
FT                   SGHSFDTLSLTEGSRPVLKGQVPVMLRESAAAPPARRTRRTAAPPVAAANLDPDAQVRF
FT                   INLKAWRAEVAREHNLPAYVIFHDATLAAIAERRPASLADLQGISGMGAKKLEAYGEDV
FT                   LRVCRQGAAVS"
FT   gene            complement(203708..204691)
FT                   /locus_tag="Aave_0182"
FT   CDS_pept        complement(203708..204691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0182"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sal:Sala_0174
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30794"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK6"
FT                   /protein_id="ABM30794.1"
FT                   /translation="MEKLERETPGQFGLYVKRLDNGETFAWQADRRWYLASSAKLPLAI
FT                   AVLQEVQQGRLRLDQELRVEERDKIDGSGALVWQPVGTQHSVETLLRRMLMDSDNTAAN
FT                   LLIRTIGPDTFNTRARALMGARNVGPLTNFTQVRQDVYAELHPRAREIAPMELVRVAAA
FT                   PMGSQRVQALARTLQVQKDDLKVKTMEEAYDRYYAWGTNTATLAGYGGMLEKLVRGQLL
FT                   TPPHQQMLYKDLKFDTYDAYRLEAGLPRTVRFIHKTGTQYHRACHMGVIDPQDGGAQAI
FT                   VVATCAEDMDEMRQAGRLFEQLGRAITRTLLKDRPATGPGAAQASG"
FT   gene            complement(204738..206048)
FT                   /locus_tag="Aave_0183"
FT   CDS_pept        complement(204738..206048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0183"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: gvi:gll0595 probable
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30795"
FT                   /db_xref="GOA:A1TIK7"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK7"
FT                   /protein_id="ABM30795.1"
FT                   /translation="MPQLPATTHLRFRPYRPLRPLRLLACATSALWHIATGTAHAQAAD
FT                   APPAALPAPASAPAWVQPLERALARAEADSGVRIGVHVRDLETGASASLHGTEPWYLAS
FT                   SIKVPVAIAVLRGAERGDFTLDTPLTLRAADYVDGAGPTNGRPVGTPLTVRYLLEQMII
FT                   YSDNTASDMLIGLVGIGTVNAVVQSLVPRGFGRITTLADVRRHVYGVLTPAASHLSGTD
FT                   FLALRQQQRLHGDAAARSALATLLRVPERSLAPADLASAYESYYATGLNSGRLDAYADL
FT                   LQALVEGRALDARHTAYLLSVMERVKTGPQRIKAGLPPGARFAHKTGTQRARTCDSGLV
FT                   TVPRALPERRVLVVACTRGEPSTARSDRALRQVGIALCQSGLLSDGRSHEPRCPTLPPR
FT                   ASGATAAPAGGEAPAARPHGAGGGAAPAAGGAGDDDA"
FT   sig_peptide     complement(205923..206048)
FT                   /locus_tag="Aave_0183"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 42"
FT   gene            206190..207098
FT                   /locus_tag="Aave_0184"
FT   CDS_pept        206190..207098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30796"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK8"
FT                   /protein_id="ABM30796.1"
FT                   /translation="MPDIALQRIHRTRLLQIWRSAGWPCRDTVEIDLLAAGMLRLVPEP
FT                   GGHEVLRLTDAGIACLAQARQRSARALSAHDRLAMRFAEQLLSAGRIVWRELSLRAAVE
FT                   ALPQPSPAPLPPLSPAAPGRGAPAGLWDGEEAQDGACLPPPAVARVWRMARPDLFSIRH
FT                   TSVPAYLQPMVHEVKASRADLLSDLRHAAKREAYQWLCEECYYVFPAGIAEPEEIPEPF
FT                   GVWVLHGAIESGRFELLRPARHARCPLPFAVWMALCRATPLHSEGEPAQALLGEEGGAP
FT                   ASGMPADVRAEAAAPAPSAAP"
FT   gene            207110..209506
FT                   /locus_tag="Aave_0185"
FT   CDS_pept        207110..209506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0185"
FT                   /product="helicase c2"
FT                   /note="SMART: DEXDc2; helicase c2; KEGG: pfo:Pfl_2690
FT                   DEAD_2"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30797"
FT                   /db_xref="GOA:A1TIK9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK9"
FT                   /protein_id="ABM30797.1"
FT                   /translation="MQTATEPATEPADPGASGADRAQPWGYTIAVRELCEFTAKQGDLD
FT                   LRFTPAPTAREGMAGHAAVAARRAAGSPGYEAEVPLEGVCGLLRVRGRADGFDAVAGRV
FT                   DEVKTFKGRLDRQPAAHRALHWAQARVYGWLLCASRGLPGLTVSLVYLDIGTQKETVLS
FT                   EDWTAQALRAHFEALCGRFVDWAAQEVAHRAARDAALRTLAFPFAGGFRAGQRPLSEAV
FT                   YRAAAAGRCLLAQAPTGIGKTVGTLFPLLKAAPGAGIDKVFFLAAKTSGRQVALDALAR
FT                   IVAAPQESHQAPAAPLTLPLRVLELVAREKSCEYPGSACHGDACPLARGFYDRLPAARA
FT                   DALRPPACGAPAPLDQARVRDAALRHGVCPYYLGQELGRWADVVVGDYHYYFDMGGLLH
FT                   GLAQAGQWRVALLVDEAHNLVERGRRMYSAELLPESLLQARRSATAATVPAVKKALDRV
FT                   RRGWMALDREQPADYAVLEAFPGKLLAALQQCSVALGEHFAEHPEQMDAALQTFHLEVL
FT                   QLLRMAELLDAHSIVDVSRPAQGAAPVGSVVCVRNLVPAPFLGPRLQAAQSGTLFSATL
FT                   QPMDYYADLLGLPQDHARADVASPFRAAQLQVHVARHISTRYAHRAASVQPIADLMARQ
FT                   FAERPGNYLAFFSSYDYLQQVAQVFAQRHPGVPHWCQSRRMQEAGQRAFLERFTEDGEG
FT                   IGFAVLGGAFAEGIDLPGRRLIGAFLSTLGLPQVNPVNEQVRERMDRLFGAGYDYAYLY
FT                   PGLQKVVQAAGRVIRTPEDEGVVHLIDDRFARAQVRRLLPAWWSI"
FT   gene            209654..210520
FT                   /locus_tag="Aave_0186"
FT   CDS_pept        209654..210520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30798"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL0"
FT                   /protein_id="ABM30798.1"
FT                   /translation="MVFKQCAAVALLACAAGAHAYEPQAGTWVMTSEENGKPGRGLSVD
FT                   VQNGTLVLQMYAYESSGQPTFYLAVGAVADNRVTARLNRYTGGRYFGGPALSGTEAGSP
FT                   GDVTIRFTSGTTGFITFPNEPEKPISRFNFGYPQKPSSLAGIWTFTSVGSEGTRADAVL
FT                   LDTPLQGSVNGNGLLASSDGLFGCEHQVSGTLAGSVVCVRVGSSGTLQRAYVMNYSIHD
FT                   GEGYSQAAGSNAQQFLVARRVATARGDGTGIALKSAGSAEGNAPAASLQAALRSHVEAV
FT                   ALQAPAP"
FT   sig_peptide     209654..209716
FT                   /locus_tag="Aave_0186"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            210639..211745
FT                   /locus_tag="Aave_0187"
FT   CDS_pept        210639..211745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0187"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /note="KEGG: cjk:jk0177 putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30799"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL1"
FT                   /protein_id="ABM30799.1"
FT                   /translation="MPSSSIDPLLPPQGALARLFAEAALQRQGMLLGTDRGGDTAPSTP
FT                   APPHAPGAAAPPRPLPSTERVSVSPEARARADAALGPGPAAAPRPGAAVPGTTGHGSPG
FT                   AGRPPAGLPGLAMPAPAAGTAPVDGAREAWPARGVGSPMRSLLGMLVHRMAEAGGPALR
FT                   VVAAQPWTADMARALRAAMSAHGGPAALQTWRVGQGRVQAEGGERGFAFTLQVPSAWAA
FT                   RGAAAGADAGLAGAAASAGAQALAVPFPGRQVRLESGVFALVLHPARDGPGTPGRTSAL
FT                   LSLEFQPPPQQGLYGREWMQPALRADPWLQMAALEASGWRREDEEAEAAAHRGAVPPCD
FT                   QPGCPYEGRAPCEQPFCLALRVEPRRPA"
FT   gene            complement(211910..213211)
FT                   /locus_tag="Aave_0188"
FT   CDS_pept        complement(211910..213211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0188"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase, C terminal;
FT                   Glu/Leu/Phe/Val dehydrogenase, dimerisation region; KEGG:
FT                   pol:Bpro_3239 Glu/Leu/Phe/Val dehydrogenase, C terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30800"
FT                   /db_xref="GOA:A1TIL2"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL2"
FT                   /protein_id="ABM30800.1"
FT                   /translation="MSNTAGTLVQHPVPSYLQADHLGPWGNYLQQVDRVTPYLGGLARW
FT                   VETLKRPKRILVVDVPIELDNGTIAHFEGYRVQHNLSRGPGKGGVRFHQDVTLSEVMAL
FT                   SAWMSVKNAAVNVPYGGAKGGIRVDPKKLSRGELERLTRRYTSEIGLLIGSSKDIPAPD
FT                   VNTNGQIMAWMMDTYSMNVGATATGVVTGKPVDLGGSLGRVEATGRGVYTVGVEAAKLT
FT                   GLPVEGARVAVQGFGNVGGIAGKLFAEAGAKVVAVQDHTGTILNKNGLDVPALLAHVKQ
FT                   TGGVGGFAGAEAMAKEDFWGVDCEILIPAALENQITKDNAGQIKAKLVIEGANGPTTTE
FT                   ADDILADKGVLVLPDVIANAGGVTVSYFEWVQDFSSFFWSEDEINARLVRIMQEAFAGI
FT                   WHVAQEHKVTLRTATFIVACQRILHAREMRGLYP"
FT   gene            complement(213347..214249)
FT                   /locus_tag="Aave_0189"
FT   CDS_pept        complement(213347..214249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL3"
FT                   /protein_id="ABM30801.1"
FT                   /translation="MQRRARKTLFRSFLPWLGLLIAGSIGGPASAADTTGFSMSYSSYG
FT                   TTYGISGQEPAAAGRYPVYIHISGTGEPYQSNWSLAAVNTAAAKGFVAASVQYDNSSFG
FT                   DCSVIGSRARAIFDARNLQSAIAQVCSRGKADCSKGVVTGGLSQGSIISVLAHDYDSRV
FT                   VASFGQGTGATYSPYYNLSSCIANGNHSLPSDRLRIINGEHDMFVGGNESIARDSATLV
FT                   TGLTCPGAQSCGGRNGSGWYIVKDSEVQDGYADHCFMGYGGYYGTQCTGLLVDSGYLYG
FT                   NSGWELNPTLDWLKSFVKQ"
FT   sig_peptide     complement(214154..214249)
FT                   /locus_tag="Aave_0189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 32"
FT   gene            complement(214430..215317)
FT                   /locus_tag="Aave_0190"
FT   CDS_pept        complement(214430..215317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0190"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   pol:Bpro_4050 protein of unknown function DUF344"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30802"
FT                   /db_xref="GOA:A1TIL4"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL4"
FT                   /protein_id="ABM30802.1"
FT                   /translation="MEFAPPFSRIDPALARQWAGWQPKEFASLPALRKGLPAPLPLERF
FT                   DPGAKPFSSGEKAMDKAAVEALAEELDGLQNLFYADRRYKLLVLLQGTDTSGKDGTVRG
FT                   VFGRMSALGVRAVGWKAPTEAERAHDYLWRIHAQVPAAGETVVFNRSHYEDVLVPVVQG
FT                   WITPEQHAQRLAHINDFERMLAETGTVIVKFMLHISKEEQRERLQARLDDPAKHWKFEM
FT                   GDIAARRQWDDYQRAYATLLAATHTPWAPWTIVPADSKTHRNLMIATVLREVLRKLDLR
FT                   YPEGDPALARFTIE"
FT   gene            complement(215415..216893)
FT                   /locus_tag="Aave_0191"
FT   CDS_pept        complement(215415..216893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0191"
FT                   /product="Amidase"
FT                   /EC_number="3.5.1.4"
FT                   /note="PFAM: Amidase; KEGG: bja:blr7282 putative amidase
FT                   AmiC"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30803"
FT                   /db_xref="GOA:A1TIL5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL5"
FT                   /protein_id="ABM30803.1"
FT                   /translation="MGLAMGWDEWAAHDAVGLAGLVRQGEVTPVELAAQAAAGVAKVNP
FT                   ALSAVVEVFADAVADPQQAGMQAGGPLAGVPFFMKDLGPTLAGRLQEQGSLFMRGHRPT
FT                   EDAWLTQQMRRAGLNLMGRTTTPEFGVCSSAENPAVYVTRNPWNTGYTTCGSSAGTAAI
FT                   VAAGVVPMSHATDGGGSIRIPAGFNGNIGLKPSRGVFSIAPHASDITGYVSTQGCHSRT
FT                   VRDTAAFVDACRGGAPGEFMPYWTAPEPYTELIRRDPARLRIALSHEWGDYRATPAIVA
FT                   ELEKAGRFLEGLGHQVEWALPQVDLRAAFRAQTTCYISNFAQVINGLLERRGLERPPAD
FT                   LIEPINIRIWEAGRGLPYAERHRMQAVFNTTARGFGAFFEDWDILLTPITARPTPPVGT
FT                   TEYLTTSGNPDVLDWFDNLWRFFAYTPLSNLCGIPAISLPMGAQDHGLPFGIHAQARQG
FT                   HDGLLLQLAAQIERALDGRWNGGRRPGVHVAQPQ"
FT   gene            complement(217000..219132)
FT                   /locus_tag="Aave_0192"
FT   CDS_pept        complement(217000..219132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0192"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor, plug;
FT                   KEGG: mfa:Mfla_2387 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30804"
FT                   /db_xref="GOA:A1TIL6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL6"
FT                   /protein_id="ABM30804.1"
FT                   /translation="MPRRAPLARAVLALAASLSAQHVAHAQEAATAPAAPTATLQEVRV
FT                   QDATDGSGYQGAQRQTAATRTDTPLVETPQAVRVVPRQLLEDLGARRLADTVDFVSGVT
FT                   RMNDFGGTWDNYAIRGFSNTEGGSLLNGFASGRGYGPQRDAATIERVEFLKGPAAALYG
FT                   SSEPGGTLNVVTKKPQFTAARTAGLQIGTLGMRRATLDLTGPATQNLAYRLNVAAEDGA
FT                   SRTGLVDNRKYVVAPAFAWTLGADTVLQYEAEIIRIRTPLDRGVVQVNGNALALPADRF
FT                   LQEPDRGNLHVNGDTHQLTLDHDLGGGWRTRLGGTYRETEFHGNAVDFGTGQIGLLAAN
FT                   GRTLSRTDSWRTLPSRDVSVQAELEGKFSTGSLRHTVLAGLESWRLYMGQDIRYSAQKY
FT                   PIDIYDPVYGTVPRGPLVQGYLQDDRLRATGLFLQDQIDLTPRWKLMAGLRFDRFHEDF
FT                   VNWMTNARQNQQHSSATPRVGLSYMVTPDSSVYVSYGRSFRPNAGTDAAGNSFDPQEGK
FT                   AWEAGAKWQSPDQRLNASMAVFDIRKTNVLTRDPANGNFSVAAGEVRSRGIETDVAGKL
FT                   DAHWRLTANAAFTDTEVLRDNNPALVGKRLLGVPRVSAGLFAIREDRLASGGRYGVGAG
FT                   LVHVGERTGTATDTYRLPAYTTARLTGYWQIDPRTRLTLDIHNLFDKHYAAASWNAIAV
FT                   IPGMGRQVVAGVQVKF"
FT   sig_peptide     complement(219052..219132)
FT                   /locus_tag="Aave_0192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(219381..219803)
FT                   /locus_tag="Aave_0193"
FT   CDS_pept        complement(219381..219803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0193"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypn:YPN_1485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30805"
FT                   /db_xref="InterPro:IPR025145"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL7"
FT                   /protein_id="ABM30805.1"
FT                   /translation="MTRCNPPTTLRGPVTARVLHALLWLGACQIAAAMPPDTTTRCGWF
FT                   DNPTPGNASLVDKDGEWTIGMQGGHQAEGDWPTFPKARWVATGAGSAGYGCACLKLSAR
FT                   ADTREVTHIFSARAQPLSVCRKDKALTGKEPENPLE"
FT   gene            complement(219800..220231)
FT                   /locus_tag="Aave_0194"
FT   CDS_pept        complement(219800..220231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30806"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL8"
FT                   /protein_id="ABM30806.1"
FT                   /translation="MLTLLGMIERDTNINDVRQAAYMLATVMWETTSPVTVTKVATNKK
FT                   GQPLLDKNRQPVVLKQKNWLMTMAPVAEIGHGKGRQYHEPVKVKLLPDGGARITGQDGD
FT                   QFSVTAAGDVSPLTKGAKMGTRDGGAATTPTPTPATATP"
FT   gene            complement(220384..221355)
FT                   /locus_tag="Aave_0195"
FT   CDS_pept        complement(220384..221355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0195"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mfa:Mfla_0402 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30807"
FT                   /db_xref="GOA:A1TIL9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIL9"
FT                   /protein_id="ABM30807.1"
FT                   /translation="MAFSSDSVNVFLAVLDHGSFSAAARALSRVPSAVSMTIAHLEAEL
FT                   DVRLFDRGGREPQPTAAARALEPQARLLAAQLRQLNAQALALTQGLEERLTIAIAPELL
FT                   TGPWTEALAALTAEYPQLQAEVLAAPQADAMALLHAGRAQLALVFERSSLDGREGFQEV
FT                   GSETLVAVIAPQHPVMQAAAGAPLSEAHLTTTRQIVVAGRDLAQTDPRFVFARHHWRTD
FT                   NHLAALRLIEAGLGWGWQPRELVEPGIQAGTLMEMPFDNLSNGVELWVDVVWSKERPQG
FT                   LGARRFVEWLRQAAQAPAGRGGGGGTGLQKLHPAKQRHGPAP"
FT   gene            221428..221892
FT                   /locus_tag="Aave_0196"
FT   CDS_pept        221428..221892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0196"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   bte:BTH_II1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30808"
FT                   /db_xref="GOA:A1TIM0"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM0"
FT                   /protein_id="ABM30808.1"
FT                   /translation="MLSTSAPSVARSSGLQGPLRRVVYVTLYELIAIAFATFGMMWATG
FT                   QGAGHSGAVAAIASGIAIVWNVAFNWAFERWESRQAVRGRSMARRVAHAIGFEGGLAMV
FT                   LVPVLAWWFGIGLWEAFVMDMGLLLFFLGYTFVFNWVFDRVFGLPASARH"
FT   gene            complement(222166..222681)
FT                   /locus_tag="Aave_0197"
FT   CDS_pept        complement(222166..222681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30809"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM1"
FT                   /protein_id="ABM30809.1"
FT                   /translation="MNDSPMQKTAEASPDTSEAPIQEARLWSDGRWTAEVIKNEDDDGW
FT                   AVSMTLRGESEPALVGPWTMGRDKKNPKPLDVTAFHTLVKTASEVLRRHEQQLHAQLHK
FT                   EVTVGSGADLVRVALRIVPDEEYPYAMLTAHDASGQLLGEARVEANFKLSQGSALAWVE
FT                   SDYSSSGR"
FT   gene            complement(222681..223607)
FT                   /locus_tag="Aave_0198"
FT   CDS_pept        complement(222681..223607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0198"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rme:Rmet_5606 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30810"
FT                   /db_xref="GOA:A1TIM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM2"
FT                   /protein_id="ABM30810.1"
FT                   /translation="MELRQLRYFLSVAETEHLTQSADALFVTQSTLSHGLRQLEAELGL
FT                   PLFDRLGRGLKLSQAGMAFRSHAARALQELEAGRMALADMAGLQAGTLTVGVIPTFLTH
FT                   LVPDAVAAFSADYPGVQVVVRDLRGGPIEEQLIAGRLDVGISFHPAHREEIEAEPLFEE
FT                   RLQLVVHAGHALARRRTLRTRELAGVPLALLPRSFATRRMIDAAFAQAGVVPVVRVEME
FT                   SVDALLHACRGGPLATIAAERAAGQAGPDMRAITLTEPATVRRAGVLWRRGASRSAAAR
FT                   EFVARLRPIVGATATAARRPAACRTMR"
FT   gene            223732..224961
FT                   /locus_tag="Aave_0199"
FT   CDS_pept        223732..224961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0199"
FT                   /product="muconate cycloisomerase"
FT                   /EC_number="5.5.1.1"
FT                   /note="TIGRFAM: muconate and chloromuconate
FT                   cycloisomerases; PFAM: Mandelate racemase/muconate
FT                   lactonizing enzyme, N-terminal domain protein; Mandelate
FT                   racemase/muconate lactonizing enzyme, C-terminal domain
FT                   protein; KEGG: bur:Bcep18194_C7044 mandelate
FT                   racemase/muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30811"
FT                   /db_xref="GOA:A1TIM3"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR013370"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM3"
FT                   /protein_id="ABM30811.1"
FT                   /translation="MTAIPSAGLRIERIEARILDIPTIRPHKFSFGAIHRQSPVVVQLW
FT                   LADGACGFGEAATIGGPSWNEESPETILHAITQYLGPAVAGQDAGRFEQLLARMDAVCK
FT                   GNRFAKSAVEMAAIDAVARSLGLPAWQLLGGKQHESLPLAWTLASGDSARDVEEAERML
FT                   EARRHRIFKLKIGARAPQDDVAHVTRIARGLDGRAGMTVDINQAWDGNTARRYVPQLID
FT                   AGVSLIEQPVAQWNVEALRQLTAGLPAGALVMADETVCTPQDAMLLARQGACHVFSLKV
FT                   AKHGGLLRTRAVAAVAEAADIGWYGGTMLETSLGSAASAHVFATLPGTHHNCELFGPQL
FT                   LVDDIVATPMTVRDFALQLPDGPGFGVEVLPEALRRFDRAREGLAPVHVDMGRQAAAPA
FT                   AEPAPAAPSA"
FT   gene            225025..226074
FT                   /locus_tag="Aave_0200"
FT   CDS_pept        225025..226074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0200"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   rme:Rmet_4876 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30812"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM4"
FT                   /protein_id="ABM30812.1"
FT                   /translation="MPSIRAHALPSAHAPTRRRVLALAAGGAVAAAAALAGVLPAPAHA
FT                   QQADAAAWPAKPVRWVVPFPPGGAMDVIARTLGERAGRTLGQPFVIENRPGAGGNIGAD
FT                   AVAKSPADGCTIMITSIGMATNKALYAKLSYDPVKDFAPVSLLAIVPNVLVVNANSPDR
FT                   TVADVIAHAKREPGKLTYASAGNGTSIHLAGEVFASMARLNLLHVPYKGSGPAMTDMLG
FT                   GQVDLMFDSITSAAPHIQSGKLRALGVTSARRSATLPGVPTIAEAGVPGYEVSPWFAVF
FT                   APAGTPAPIVQKLNAALLDAMKQPETRARFDAIGAEPIGSTPAQLATHLDKEMARWGTL
FT                   IKDRNIRMD"
FT   sig_peptide     225025..225162
FT                   /locus_tag="Aave_0200"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 46"
FT   gene            226204..226938
FT                   /locus_tag="Aave_0201"
FT   CDS_pept        226204..226938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30813"
FT                   /db_xref="InterPro:IPR022118"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM5"
FT                   /protein_id="ABM30813.1"
FT                   /translation="MHITHAVAHHRNMNAAREGGAAVQAPAARAKSASHGNAMPLTPGR
FT                   KNLAEAQAPGIRPRKGILDIAAGKPRTLGGGHFQSAGSSSSSGGSKLVVPYIPQNGTRG
FT                   CWEATMNMLRAYFGQPPLDKGQLAYLYDAEGVPKELNGPLDYATRNRKAKLKNIPVPAG
FT                   KSWDADKIRALLDQHGPLEARIESPNDELVAHAIVLTGIDEDGDVICHDPELGPGQKVS
FT                   IAMLNAAFDWSSHRMALTAYGG"
FT   gene            complement(227006..227362)
FT                   /locus_tag="Aave_0202"
FT   CDS_pept        complement(227006..227362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30814"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM6"
FT                   /protein_id="ABM30814.1"
FT                   /translation="MHGILLLRTILPERAAAASPHSRPAASPHAPCQATRPEAPQMIDW
FT                   IPVVFIVFKVLVFGTCMFFAIKWHYDQSGRKMDRRALLLATCKLGAAFLLALAVVLWLT
FT                   FALARHLGMDLSLP"
FT   gene            complement(227409..227585)
FT                   /pseudo
FT                   /locus_tag="Aave_0203"
FT   gene            complement(227632..228651)
FT                   /locus_tag="Aave_0204"
FT   CDS_pept        complement(227632..228651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0204"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bcn:Bcen_5605 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30815"
FT                   /db_xref="GOA:A1TIM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM7"
FT                   /protein_id="ABM30815.1"
FT                   /translation="MNKSDESTPAMMTFKQLEALYWIGQLGGFAPAARKLHTTQSAISK
FT                   RVHELEQVFDTALFDRSQRSARLTEKGEEMFMLARKLLRERDAAVEQFGKPGVIERRLR
FT                   IGVTELTAMTWLPRLVGLVRAHYPKVTLEPDVDGSLPLRDKLLADALDLVIVPDAFADS
FT                   RLPAKPVGQVESAWMCRPGLVQPPAPGRPVRLHDLAAHRLLVQGNASGTGRIYDGWMRE
FT                   RGVEPADTLVVSNLIALAGLTISGLGVSYLPRHCLAPLVAAGMLAEIEVQPPLPPVPYV
FT                   AMVRGEQRSALVASVIMLAQSCCDFTRVFQAGVDVASAEPGRMESRPGPFRQGRGASA"
FT   gene            228783..229700
FT                   /locus_tag="Aave_0205"
FT   CDS_pept        228783..229700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0205"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: eba:ebA4561 putative ABC transporter, glutamate
FT                   receptor; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30816"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM8"
FT                   /protein_id="ABM30816.1"
FT                   /translation="MTSRRLFSSSSLVAVLGACLLAHGAAASAQEIDTLARIKQTGVIH
FT                   IGNRDSSIPFSYSPKGGGDPVGFSNDICLKIVEAVKAKLGLPALRVQYTLLNSLNRIPL
FT                   MQNGTVDLDCATTTNSVVRQQMVAFAPSHFVAGITVAVKKNSGINSLSDLAGKTVATVA
FT                   GSTSVQLLRTYKRAEALDVRELSGKDTADAFLLLANGRADAYVLDDVQLAGLIASSPNP
FT                   GEYRMLRDVVLRQEPYGIMFRKNDPQFEALVDETVTQLMKSGEMERLYARWFTQPIPPN
FT                   NVNLNFPMTDAVREAYRNPSKKGV"
FT   sig_peptide     228783..228872
FT                   /locus_tag="Aave_0205"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 30"
FT   gene            229700..231085
FT                   /locus_tag="Aave_0206"
FT   CDS_pept        229700..231085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0206"
FT                   /product="aminotransferase, class V"
FT                   /note="PFAM: aminotransferase, class V; KEGG: bcn:Bcen_5603
FT                   aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30817"
FT                   /db_xref="GOA:A1TIM9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIM9"
FT                   /protein_id="ABM30817.1"
FT                   /translation="MAGHDAISARYPQGLLFPEAVMREVRGRFLQVDHDHAGRPRLYFD
FT                   NAGGSFRLKAAVERFAQIDAVPDNTERIHPVARELQAIQATGTDDLRMMLNAEGGSVHA
FT                   ALTASGAMFEMVRAIALNVPGTNMVTTVLEHPSSYDAMERYARETGRELRVAPSNPATG
FT                   GVDVDAIVRLVDEGTTLLNVIYASNISGAKLDLERIVAAARAVKPDLYIVVDAVQHAPH
FT                   GLIDLQKTPVDGINLAPYKFFGCRGSGLAWLSDRAAALPHHKLSAKPEGFWDLGSSSPW
FT                   QFAVVTEIADYVCWLGCQALKELPELVAVLDAGADAGEPPRRALFAAGIERIMLHERGL
FT                   LARLLDGDGAARPGLRGMPGVQVFLDHPDLTLRDLIIAIGIDGVDCTRAVHEYGLRGVT
FT                   VYERSVASLYSRRMLESFGLAGAVRVSPLHCHTAQDVDAFLRVTEDIVRVHAALATREA
FT                   AAL"
FT   gene            complement(231095..231610)
FT                   /locus_tag="Aave_0207"
FT   CDS_pept        complement(231095..231610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0207"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /note="PFAM: Ureidoglycolate hydrolase; KEGG: bcn:Bcen_0165
FT                   ureidoglycolate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30818"
FT                   /db_xref="GOA:A1TIN0"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN0"
FT                   /protein_id="ABM30818.1"
FT                   /translation="MSGAVVLPVRPLTAEAFAPYGQVIAPGGNGTRQIPINDGRCMRHH
FT                   DLARPFAAGPGTVALSLFDAAATALPARLTLMERHRLGSQSFAPFGAALQLLAVVADAG
FT                   IAPEALGPEHLRAFVTDGRQGLQLAPGVWHHPLLSLQAGLWLVADRIAAEVDCDVVRIH
FT                   AWGVDCGL"
FT   gene            complement(231607..232344)
FT                   /locus_tag="Aave_0208"
FT   CDS_pept        complement(231607..232344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0208"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: rso:RSc2106 probable amino-acid ATP-binding
FT                   ABC transporter protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30819"
FT                   /db_xref="GOA:A1TIN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN1"
FT                   /protein_id="ABM30819.1"
FT                   /translation="MPLVDVCAVHKYYGDNHVLKGVDLRVESGQVVAIIGRSGSGKSTL
FT                   LRSINGLESINDGQIVVDDAVLKGSQATPAQLRALRLNVGMVFQQFNLFPHLTAGENVA
FT                   LSPVVVKGTKKAEARQLAREMLAKVGLAEKYDAYPDQLSGGQQQRVAIARALAMQPKVL
FT                   LCDEITSALDPELVNEVLAVVRQLATEGMTLIMVTHEMRFARDVGDQLVFMHQGRVHEC
FT                   GPARELFAQPRTPELAGFIGAVQ"
FT   gene            complement(232331..232984)
FT                   /locus_tag="Aave_0209"
FT   CDS_pept        complement(232331..232984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0209"
FT                   /product="amino acid ABC transporter membrane protein 2,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2105
FT                   probable amino-acid transmembrane ABC transporter protein;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30820"
FT                   /db_xref="GOA:A1TIN2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN2"
FT                   /protein_id="ABM30820.1"
FT                   /translation="MIADIPLLPILLKLAEGLWATLLLSLMAFALGGAAGLVVLFARVG
FT                   RHPGLQRVSRTYIQVFQNTPLLMQMFLVFFGASMAGFDVSPWAAAAIGLTLYTSAYLAE
FT                   VWRGCVQAIPRGQWEASSSLAMGYFQQMRHVVLPQAVRLAVAPTVGFSVQIVKGTAVAS
FT                   IIGFEDLTKLGSMLANATFQPFLIYGLVAAGYFLLCWPLSACASHLEKKLYAAR"
FT   gene            complement(232981..233667)
FT                   /locus_tag="Aave_0210"
FT   CDS_pept        complement(232981..233667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0210"
FT                   /product="amino acid ABC transporter membrane protein 1,
FT                   PAAT family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2104
FT                   probable amino-acid transmembrane ABC transporter protein;
FT                   TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30821"
FT                   /db_xref="GOA:A1TIN3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN3"
FT                   /protein_id="ABM30821.1"
FT                   /translation="MAYAFDFGAVFDYSGQLAQGAAFTLGLTAAGAVLGGAIGVAGGVC
FT                   RAWRIAPLNWLFKLYVEAIRNTPFLVQLMFVFFGLPSLGLQLNEWQACLLTTVVNLGAY
FT                   LTEIVRAGIQETPRGQLEAASALGMGRWACFRHVVLRPALQKVWPALSSQIVIVMLGTS
FT                   VVSQIAAQDLTFAANFIQSRNFRAFETYIVVTALYFALALLLRQALAWIGQHVIVARRA
FT                   PAGDAA"
FT   gene            complement(233724..234548)
FT                   /locus_tag="Aave_0211"
FT   CDS_pept        complement(233724..234548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0211"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: ionotropic glutamate receptor; KEGG: rso:RSc2103
FT                   probable amino-acid-binding periplasmic (pbp) ABC
FT                   transporter protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30822"
FT                   /db_xref="GOA:A1TIN4"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN4"
FT                   /protein_id="ABM30822.1"
FT                   /translation="MTRTATSPSTARRGALHALLAATAFAAAALGGAASARADVLANIQ
FT                   KAGVVRVAIPQDFPPFGSLGTDLKLQGYDIDMANLVAKELGVKVELVPVTSTNRIPYLT
FT                   TGKADLVISSLGKNAERAKVIDFTQAYAPFPKSVYGPKEAAIKGPADLAGKTIGVTRGS
FT                   TEDLSLTKLAPASATIKRYEDNNATAQSYLTGQVQLVTLGNIVANAVNERTRLRQLDAK
FT                   FAVEDTPCYVGVAKGEDALLRKVDAIITKARSDGRLNDMSQRWMKMPLPATL"
FT   sig_peptide     complement(234432..234548)
FT                   /locus_tag="Aave_0211"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 39"
FT   gene            complement(234545..235312)
FT                   /locus_tag="Aave_0212"
FT   CDS_pept        complement(234545..235312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0212"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; Helix-turn-helix, type 11 domain protein; KEGG:
FT                   rso:RSc2102 probable transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30823"
FT                   /db_xref="GOA:A1TIN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN5"
FT                   /protein_id="ABM30823.1"
FT                   /translation="MHRIPSSVAQTLQQQILSGHYASGSPLPAQRELAQRLGISRASLR
FT                   EALSVLETLGLVDILPGRGVMVRGPHASGERTHRAFATPEMGTLSPRQLIELRLVLEPG
FT                   WTALAAGRADAGAHHQLQWLQQQQSEALRRNDLLSAAEADLHFHLLLAQWSGNPGLIAM
FT                   ARQLEPAIAHSLRLPFARTGADDEPAREHGAIVQALRAGDATASAQAMHAHLLSAARRG
FT                   GIDMDAPEAPAAGAPASFRLVPPSPPFPEGVFQ"
FT   gene            235564..236331
FT                   /locus_tag="Aave_0213"
FT   CDS_pept        235564..236331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0213"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pol:Bpro_4259 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30824"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN6"
FT                   /protein_id="ABM30824.1"
FT                   /translation="MTKADSLLSRRCLLGQGCALAGALLAGCGTPAHTERGEVQAADIE
FT                   PTELAQSDVNRMATLGMRANLDSLYRLMDKLYRRNPAEWRKGQAPGQLPGRILAAQRVR
FT                   DAIEQRQPWAPLQGRRDIAALAYSLSPGFTGDRVAAVIHATADMIVTAHGGKTRFFLID
FT                   GLDAQHLYNAARNVEIAVWLIAQRQGPDGRPLLLADEIGPDVRNVSFEREFGKIIARLD
FT                   LLAGVVAEKYRRAAISYVQNLVGGTFLQFLPVR"
FT   sig_peptide     235564..235668
FT                   /locus_tag="Aave_0213"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.705 at
FT                   residue 35"
FT   gene            236529..239252
FT                   /locus_tag="Aave_0214"
FT   CDS_pept        236529..239252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0214"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: rfr:Rfer_0466
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; Methionine synthase, B12-binding module,
FT                   cap domain protein; Vitamin B12 dependent methionine
FT                   synthase, activation region; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30825"
FT                   /db_xref="GOA:A1TIN7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN7"
FT                   /protein_id="ABM30825.1"
FT                   /translation="MSAPHSLPPMKLSGLEPVSIGEGTLFVNIGERTNVTGSKAFARMI
FT                   LNGQYEEALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFLQLIASEPDIARVPIMVD
FT                   SSKWDVIEAGLRCIQGKGIVNSISMKEGVEKFKHEARLVKRYGAAAVVMAFDEVGQADT
FT                   YARKIEICERAYRVLVDEVGFPPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQN
FT                   LPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIKAGMDMGIVNAGMVGVYDDLEPT
FT                   LRERVEDVVLNRRPDAGERLVEIAETAKSGAKDESRKLEWRNAPVRERLAHALVHGITD
FT                   FIVEDTEEAYREILAGGGRPLHVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKSA
FT                   VAHLIPYIEEEKRQDELAGRDVRSKGKIVIATVKGDVHDIGKNIVTVVLQCNNFEVVNM
FT                   GVMVPCHEILARAKVEGADIVGLSGLITPSLEEMQYVAGEMQKDDHFRVRKIPLLIGGA
FT                   TCSRVHTAVKIAPHYEGPVVYVPDASRSVSVAQSLLGDGAQSYVDELNADYDKVRQQHA
FT                   NRKQTPMWPLAKARANRTPVNFSTYQPQPPRLLGRRVFKNFDLGELARYIDWGPFFQTW
FT                   DLAGPYPAILDDEVVGEQARRVFADGQAMLRKIIEGRWLSASGVLALYPANSVGDDIEF
FT                   YTDASRTEVAMTWYGLRQQTEKQVIDGVMRPSRCLADFVAPKESGIADYAGLFAVTAGL
FT                   GVEKKEQAFIDALDDYSAIMLKGLADRLAEAFAECLHQRVRTDLWGYAAGEQLTNEEMI
FT                   AEKYQGIRPAPGYPACPDHSAKTDLFRVLQCEEIGMGLTESLAMTPAASVSGFYIGHPE
FT                   STYFNVGKIGEDQLHDMAERRGMDEKVLERLLAPNL"
FT   gene            239418..239714
FT                   /pseudo
FT                   /locus_tag="Aave_0215"
FT   gene            complement(239716..239883)
FT                   /pseudo
FT                   /locus_tag="Aave_0216"
FT   gene            240192..241898
FT                   /locus_tag="Aave_0217"
FT   CDS_pept        240192..241898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0217"
FT                   /product="Alpha,alpha-trehalase"
FT                   /EC_number="3.2.1.28"
FT                   /note="PFAM: glycoside hydrolase, family 37; KEGG:
FT                   xcb:XC_0631 periplasmic trehalase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30826"
FT                   /db_xref="GOA:A1TIN8"
FT                   /db_xref="InterPro:IPR001661"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018232"
FT                   /db_xref="InterPro:IPR023720"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN8"
FT                   /protein_id="ABM30826.1"
FT                   /translation="MIPAAPSCRTPLLSLVLGLLLGTAGTTAMAEAVPATTLTAPATTL
FT                   TAPAPPPQTPDLAYPELFQAVQQHELFDDQKHFVDALPLRDPALINADYLAQRQQPGFD
FT                   LRRFVAANFEESDPVQTGAIRQDTGLREHIDALWPRLVRRQVEVPPYSSLLPLPHPYVV
FT                   PGGRFREVYYWDSYFTMLGLVESGEQEHSRQMLDNFAYMIDTYGHIPNGNRTYYLSRSQ
FT                   PPFFSYMVQLQAKVEGDAAYARYLPQLQKEYAYWMEGAETLAPGSAHAHVVRLADGSLL
FT                   NRYWDARDTPRPEAWLHDVRTAAEAKDRPAAEVYRDLRAGAESGWDYSSRWLGDRKTLA
FT                   SIRTTAIVPVDLNSLLYHLETTLALACAKNPDVAGCNTDYAALASARKTAIDKHLWSDA
FT                   GYYADYDWQQRRLRGQVTAAALFPLFVGAASPARAKRSADTVQAQLLRPGGLATTSLHT
FT                   GQQWDEPNGWAPLQWIAVDGLRRYGQDALAQCIGTRFLTRVQALFAQQHKLVEKYAVDG
FT                   QAKGGGGGEYALQDGFGWTNGVTLLLMDLYAAPAAARAASHAQAQTEAVAP"
FT   sig_peptide     240192..240284
FT                   /locus_tag="Aave_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.947 at
FT                   residue 31"
FT   gene            242186..242527
FT                   /locus_tag="Aave_0218"
FT   CDS_pept        242186..242527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30827"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIN9"
FT                   /protein_id="ABM30827.1"
FT                   /translation="MLPHVSVDALLADQGHPCATHPVTLRPVTALLPKRHSRAIVGEKN
FT                   AQPLHSSPHDMTSHPRPTVPSLLGRFLLAACTLAFGLLLAGCGGSGSDASNGFIAHCGN
FT                   PDTHCAPKP"
FT   gene            242595..244907
FT                   /locus_tag="Aave_0219"
FT   CDS_pept        242595..244907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0219"
FT                   /product="Phospholipase C"
FT                   /EC_number="3.1.4.3"
FT                   /note="PFAM: phosphoesterase; protein of unknown function
FT                   DUF756; KEGG: bcn:Bcen_5326 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30828"
FT                   /db_xref="GOA:A1TIP0"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP0"
FT                   /protein_id="ABM30828.1"
FT                   /translation="MTRAFSYNKHSSNMTVDSSKRKFLSGVLGTGAAAATLTAFPPAIR
FT                   RALAIEANNATGTIQDVQHVVLLMMENRSFDSYFGTFKGVRGFGDRFAVPTPNGRNVFY
FT                   QTYTKTTPASTYVPFRLDEAQGNAQRAGSTPHTWVDSQAAWDHGRMSRWPDAKLPLSMG
FT                   YYETAEVSFQRALADAFTLCDHYHCGMHTGTIANRLFYWTGTNGPNGISPLDGSRVRVA
FT                   GLNNQFNGGNDVGASTEGWTWTTYADRLEKAGVSWKVYQSLIDNFGCNEMMGFRHWRAE
FT                   IEKMPADRKPLYVAKTDITQPQDLAGPTYDPAIDDALSPLAKGFGNTMPQGFLETFRED
FT                   IRQGRLPAVSWIIAPSVYSEHPGPSSPAQGGWYVQEVLDALTANPEVWSKTVLLINYDE
FT                   NDGFFDHLPSPAVPSRNADGSLAGACTLSAADVAVEYHDFQPATSSQPAADGKPYGPGP
FT                   RVPMWVVSPWSRGGWVNSQVFDHTSTLMFLEKRFGVAEPQISAYRRAVCGDLTSCFNFV
FT                   NPNTEALPTLAGRTSKTAVDARIAAQVRAAKLPQPAAATDAALPVQAPGVRPSRALPYE
FT                   LHATAQANAGAGTVTLLFANTAKTGSPAAVFHVYDRKHLDAIPRRYVVEAGKTLNGVWN
FT                   VAADGGAYDLWVLGPNGFHRAFAGDLAQQASAGMPEVQVCYELCDPPQVRVKLYNRGTA
FT                   AIGFTAEARAYRSDGPWTRTVQPGAVEELAWALGDSGNWYDFTVRCSAAPAFVRRFAGR
FT                   VETGRHSVSDPAMGQGA"
FT   sig_peptide     242595..242714
FT                   /locus_tag="Aave_0219"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.525 at
FT                   residue 40"
FT   gene            complement(244923..246410)
FT                   /locus_tag="Aave_0220"
FT   CDS_pept        complement(244923..246410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0220"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: bja:bll6496 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30829"
FT                   /db_xref="GOA:A1TIP1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029150"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP1"
FT                   /protein_id="ABM30829.1"
FT                   /translation="MKRDFLPSDSTGRFLALLALTMIAAQVVAFVFLHFSNRRIAMNSV
FT                   DAALEAGAQTFEYTAAMRRESRRVASELISRDYGLQNIIFNETNRDTVESALYNQLART
FT                   GAELIVLTDLDGTLRARSSVSGFLRERDAALDHRLELLVASVREASRNMRTMDGEDGKP
FT                   VLHNWVKVTVRAPVPVAHIYLAFRITHAGAQQFARMTQLQMAFLSHDAEAHYIVHASTL
FT                   PVSIPMDGIGRHAKDQRPFSASDPDGAGYRVKVITLDDSGPLPVSAVVAKPFAPVMSPF
FT                   LKLEALFAFSVLMSAVISIVAVKVVASRVVTPLEDVAQKDALTGLANRRTFDARLLRAE
FT                   QDLQRSGTGFAVMLMDLDKFKSVNDTYGHDAGDVVLKEAAARIQKIIRSSDTLARLGGD
FT                   EFAILVRTDDPQTLSHIATAIVEVVRQPIPLQPGLAAEVGTSIGIAFAPAHSRRGAEVV
FT                   HWADQAMYTAKRRGGGFAMAESAKSAAEASLDIASQR"
FT   sig_peptide     complement(246321..246410)
FT                   /locus_tag="Aave_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.986 at
FT                   residue 30"
FT   gene            246645..247649
FT                   /locus_tag="Aave_0221"
FT   CDS_pept        246645..247649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0221"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: pol:Bpro_1517
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30830"
FT                   /db_xref="GOA:A1TIP2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP2"
FT                   /protein_id="ABM30830.1"
FT                   /translation="MRCNGRMPSPFLTRCLEGAKRVIQPIMPLVRAVNLWLDADGLRMS
FT                   AAMSFYGMLSLAPLLLLLVGVLGWWIDKSYLETNLIAQVQSVMGERGAEVVKLALSSAR
FT                   EPSEGRLASIAGFVLLLSGATGVFVELQSALERLWTSGHPPATDNKAWWRMASLRLRGL
FT                   AYVLAIGFLLLISLVVSTAIHVVANWASARLPFASGPLLQLVNELVAFGIAVLLFVGLM
FT                   RIGTGPKPPMACLVFGAVVGAILFTVGKQLLALYLATAAVVSAYGAAGSLVVLLMWIYF
FT                   SSAVLLFSASCARALQEARAEHMGQRVDAAHAENVPASTSPKPPAPAAAAGAR"
FT   gene            complement(247671..248537)
FT                   /locus_tag="Aave_0222"
FT   CDS_pept        complement(247671..248537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0222"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   xcb:XC_1361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30831"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP3"
FT                   /protein_id="ABM30831.1"
FT                   /translation="MARTFYPDDLAQARELAFASRQFPAIELNGSFYALQRPSSYAAWS
FT                   RDTPEGFVFTVKAPRFITHILRLRSPRAAIANFLASGLLSLGPRLGPILWQLPPSLPFD
FT                   AGLLEDFLSLLPRDTRQGLELAREREPRMRGREWLEAEGPHWRMRHALEVRHSSFATPE
FT                   CIALLRRHGVALVVADTGGRWPELGDVTADFMYLRLHGAEALYVSGYSDDRIAAWARRI
FT                   RAWHRGAAPRDVALAGPAAGAPAPPAGGRDVFCFFDNTAKLHAPRNALELARVLRLSPD
FT                   TLRPAAR"
FT   gene            248775..249584
FT                   /locus_tag="Aave_0223"
FT   CDS_pept        248775..249584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0223"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: pol:Bpro_0175 17
FT                   kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30832"
FT                   /db_xref="GOA:A1TIP4"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP4"
FT                   /protein_id="ABM30832.1"
FT                   /translation="MSLVVRSNSSAAGPFVAGGSAKWLWAAIGALGVSVLALGATLVVQ
FT                   NRDRAPDVASAAQPAAALAPDAQSAAAANPSADPAVAQRSQGRPAAVAQAPAQQFAQRA
FT                   PSPGYAPQPAYSGAPQGQQQVAMQRAAAPACMTCGRVESVQAFQQAAPATGIGAVAGGV
FT                   IGGVLGNQVGKGSGRTVATVLGAVGGGYLGHTVEQRTRTTTAYQIRVRMDDGSVRTFTR
FT                   SQPVAEGTAVRVEGRSFRVDNGQYGSGYGGGYSAQAPHSVRVADNGY"
FT   gene            complement(249679..250452)
FT                   /locus_tag="Aave_0224"
FT   CDS_pept        complement(249679..250452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0224"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   rfr:Rfer_0084 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30833"
FT                   /db_xref="GOA:A1TIP5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP5"
FT                   /protein_id="ABM30833.1"
FT                   /translation="MSAFNEERVLSVHHWTDRLFSFTTTRDTSLRFSNGHFTMIGLKVD
FT                   GKPLLRAYSIASANYEEHLEFLSIKVPDGPLTSRLQNIQVGDSIVVGRKPTGTLLIDYL
FT                   LPAKRLYLISTGTGLAPFLSVIRDPDTYEKFEEVVLVHGVRQVNELAYHDFITQELPKH
FT                   EFLGEMVAKQLKYYPTVTREPFRNQGRINDLIENGKLFTDLGVPPLDPLVDRVMLCGSP
FT                   EMLASLKAILEKRDFEEGNTTKPGDFVIERAFVEK"
FT   gene            complement(250686..251642)
FT                   /locus_tag="Aave_0225"
FT   CDS_pept        complement(250686..251642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0225"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_0910 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30834"
FT                   /db_xref="GOA:A1TIP6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP6"
FT                   /protein_id="ABM30834.1"
FT                   /translation="MNPFDRMHTFVRVAELASFTQAAEALGIPKASASTAVQQLETQLG
FT                   TRLLHRTTRRVQLTQDGQAYYERCKDLLADVDELQSMFQHADGEGAGGGGLRGRVRIDM
FT                   STGMARNVVVPRLPELLARHSGLEVELSSTERRVDVVREGFDCVLRTGAVVDASLVARP
FT                   LGPARLVNCASPAYLRAHGTPQTLEDLGDHRLVHFVNTLGARSGGFEAMVDGTLAAIPM
FT                   QGALTVNNAEAYIAGCLAGLGIIQVPRLGVVDLLAQGALVEVLPQHAAPPMPLTLMYAT
FT                   RRNLPRRVRAVMDWLAEVVGEHLGQDAAATNGEAAPP"
FT   gene            251765..252573
FT                   /pseudo
FT                   /locus_tag="Aave_0226"
FT   gene            complement(252844..254622)
FT                   /locus_tag="Aave_0227"
FT   CDS_pept        complement(252844..254622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0227"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: reu:Reut_B3731
FT                   histidine kinase, HAMP region:bacterial chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30835"
FT                   /db_xref="GOA:A1TIP7"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP7"
FT                   /protein_id="ABM30835.1"
FT                   /translation="MRNLSIGTRLAGGFALVLGLMALMTVFGLWRLHSVAQATHDMTQQ
FT                   PLANERMISDWYRYVDSAARRTTAIVKSSDPSLAAFFAEDSAMTTRESAQLVEKIEPQL
FT                   DSTEEKAVWADIAKARSAYLASRDQAVKAKAEGRTEEAERLLTQVYLPATKAYVALIQQ
FT                   LLDLQRRDIDATAAHIQDIHAQSRLLLTVLGLLALALGAACALWLTRGIVRPLSEAVRV
FT                   ARAVAASDLTSHVTVTSGDETGQLLQALKDMNTSLAQVVGRVRAGTDSIATASNEIDAG
FT                   NQDLSSRTEEQASSLQQTAAAMEQLTSTVRHNADNARQASQLASSAAGTATRGGQVVAG
FT                   VVDTMGAINESSRKISDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRA
FT                   LASRSAAAAKDIKALIGDSVTRVAEGSSQVEEAGRTMDEIVQSVQRVNDLVAEISAASE
FT                   EQSRGIDQVHQAVSQMDQVTQQNAALVEEAAAATGSLKAQAGQLSQAVSVFRIPAGTQA
FT                   ATAAAAAPAAMPRPVRQPAAAVTPRAAPAAMPPAAAPRPAAATARAPAAAPALPRTAAP
FT                   APSPAARGSDDDWETF"
FT   sig_peptide     complement(254512..254622)
FT                   /locus_tag="Aave_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.705 at
FT                   residue 37"
FT   gene            complement(254773..255759)
FT                   /locus_tag="Aave_0228"
FT   CDS_pept        complement(254773..255759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0228"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_3194 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30836"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP8"
FT                   /protein_id="ABM30836.1"
FT                   /translation="MKHSPSPLRRALLGATVLAACAAAPALAQDYPAKTVRLIVPFAPG
FT                   GTTDIVARVVSQSLGTTLGQPVVVDNRAGAGGVVGATEIARAAPDGYTLGVATVSSVAS
FT                   APAINPAVKYNPLTDFTSIINMAATPNVLAVHPSFPAKDFKSFMTEVKAHPGKYAFATS
FT                   GTGGIGHLQMELFKSLSGLGLEHIGYKGAGPALNDAVAGQVPMIFDNLPSALPFIKEKR
FT                   LIAIAVAAPQRLPSMPDVPTFKEVGFEPVNRMAFYGIHGPKNLPREVVDKISQAVKKTL
FT                   EDPAVRQRIEDTGSLVVGNTPEEFTAQTKAEYELYKGVVAKQKLKLD"
FT   sig_peptide     complement(255673..255759)
FT                   /locus_tag="Aave_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            255957..257894
FT                   /locus_tag="Aave_0229"
FT   CDS_pept        255957..257894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0229"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: dar:Daro_2150
FT                   ATP-binding region, ATPase-like:histidine kinase A,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30837"
FT                   /db_xref="GOA:A1TIP9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIP9"
FT                   /protein_id="ABM30837.1"
FT                   /translation="MACPIVRFSAIDALSTGVALGGPAFATHHNPCRTRWLRLKPDRSL
FT                   LIPGLAVLACVCVGALVYRATLDTQLSLQQHAAAQRLDFAAQSLESLLHRNEALPALLA
FT                   LDGGLGRALRDSRPDNLATANAFLGQAAGLADVEAAYLMDAGGQTVAASNWRLPSSFVG
FT                   QNYRFRPYFEAAMQGRTGRFYGVGATTGKPGYFIAAPLPAAALARGVVAVKISLDAFEA
FT                   SLAASGDTVLLADRDGVVFVSTEAQWRYRTLAPLGTQALARLENAQQYGRHALRPMDHG
FT                   LGAWPDGGAPIRLQHAGLEREFSVATRGVGPLGWQMLLLADRYPVRQEALVAGLAGGLC
FT                   AALLLGMLFYQRLDQQGQAERRASAARLQAAHDMLETQIAQRTTDLTAANAALQLRVSE
FT                   LQHAETILRGTRDAAVQAGKLAVLGQMAAGMSHELNQPLAALQTLSDNAVALDRQGRRE
FT                   DVAENLQLIGQLAARMGRIVRQLKSFVRKETPVLQPCRVRDALDHALLLLAQRCTAVQA
FT                   RIDVQPFDAGLRVMADPTRLEQVLVNLLRNGLDAVQDRPVREVRFAPASDDGWVRLRVS
FT                   DTGGGIAPEVRGRLFEPFFTTKAGEGLGLGLAVSRIIVEGMGGTLTVEDIPEGGGAGFT
FT                   VTLALARPDA"
FT   gene            257925..259304
FT                   /locus_tag="Aave_0230"
FT   CDS_pept        257925..259304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0230"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor,
FT                   interaction domain-containing protein; helix-turn-helix,
FT                   Fis-type; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: dar:Daro_2148
FT                   helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30838"
FT                   /db_xref="GOA:A1TIQ0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ0"
FT                   /protein_id="ABM30838.1"
FT                   /translation="MTDAPLPAAPAGTTRPVYLIEDDAMVRRAYGQALELAHIPVRAFP
FT                   HGQAALDAFGQDPPAVVVTDICMPGLDGMELLRLLRQRDADLPVVLVTGHGDVAMAVEA
FT                   MRDGAYDFIEKPFSSERLLLTVRRALERRALSDELQRLRACGGADALAGLVGQSAGMAE
FT                   VRRLVSALAPLDVDVLLHGETGAGKEVVARALHAASGRTGPFVAINCGALPEAIIESEL
FT                   FGHEPGAFTGATRRRIGKIEYANGGTLLLDEIESMPPSLQLRLLRVLQEREIERLGSNQ
FT                   PVPVTARFVAAAKADLKQLAERGQFRADLYYRLHVVAIDIPPLRDRPQDIPLLMAHFLA
FT                   QSAARHGRPVPGWSDRDLAGWLAHGWPGNVRELRNAAERLCLGLPVQPLEAGGESAPSL
FT                   AGRVEAFERKLLRDTLALTQGNVARAAELLQMPRKTVYDKLQRHGLAPGSAGIAPRDGE
FT                   R"
FT   gene            complement(259330..260883)
FT                   /locus_tag="Aave_0231"
FT   CDS_pept        complement(259330..260883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0231"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: rfr:Rfer_0471 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30839"
FT                   /db_xref="GOA:A1TIQ1"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ1"
FT                   /protein_id="ABM30839.1"
FT                   /translation="MSLALVQSRALLGLQAAAVTVEVHLANGLPSFTLVGLADVEVKEA
FT                   RERVRSALQNAGLEFPHNKKITVNLAPADLPKDSGRFDLPIALGILAASGQIDGTLLAG
FT                   HEFAGELSLSGELRPVRGALATSLALRSAGGRARMVLPPGSAEEAALVPGTEVYRARHL
FT                   LDVVARFLPPQAAAGAGAGPDSGTGDGWCRVEGMPPMAAAPADDLADVKGQAAARRALE
FT                   IAAAGGHGLLMVGPPGSGKSMLAHRFAGLLPAMSVDEALESAAVASLAGRFTPTAWGAR
FT                   PTAAPHHSCSAVALVGGGSPPRPGEISIAHHGVLFLDEFPEYARSALEALREPLETGRI
FT                   TIARAARRADFPARFQLVAAMNPCPCGYLGSGQRACRCTPDQIDRYQAKLSGPLLDRID
FT                   LHVEVPALPTDQLLAAAPGEPSASVRERVAAARERALVRQGKPNQALQGREIDVQAGLQ
FT                   DDAARFLQSAAARLGWSARSTHRTLKVARTIADLAGETSVGPAHVAEAVQYRRVLRQAA
FT                   "
FT   gene            261125..261850
FT                   /locus_tag="Aave_0232"
FT   CDS_pept        261125..261850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30840"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ2"
FT                   /protein_id="ABM30840.1"
FT                   /translation="MTRVLKSLSIALLAAAPVWASAQLTGNVSLTTNYKFRGQDQDTSK
FT                   VKAVKPAIQGGFDYTFGESGFYLGNWNSSVDWLPGNSIEMDFYGGYKFKAGGMDLDVGA
FT                   LTYVYPGNTTGNTTELYGAATYGPVTAKYSHTVSKDYFRWAGAKTSSSRGRNTGYLNVA
FT                   FAREVAPGTTFKAAVGYTRFAGDIKDLGVPNYVDYSVGGAYDFGSGLSLSAAVAGANKK
FT                   NFFGPVNKNRLIVTLTKTL"
FT   sig_peptide     261125..261187
FT                   /locus_tag="Aave_0232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.886 at
FT                   residue 21"
FT   gene            261903..262241
FT                   /locus_tag="Aave_0233"
FT   CDS_pept        261903..262241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0233"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pol:Bpro_0183 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30841"
FT                   /db_xref="GOA:A1TIQ3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ3"
FT                   /protein_id="ABM30841.1"
FT                   /translation="MKMVTAIIKPFKLDEVREALSDIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVADDLVERVIEAIEGAARTGKIGDGKIFVGHLEQVVRIRT
FT                   GETGKEAL"
FT   gene            262510..263730
FT                   /pseudo
FT                   /locus_tag="Aave_0234"
FT   gene            264256..265227
FT                   /locus_tag="Aave_0235"
FT   CDS_pept        264256..265227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0235"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rfr:Rfer_0479 senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30842"
FT                   /db_xref="GOA:A1TIQ4"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ4"
FT                   /protein_id="ABM30842.1"
FT                   /translation="MDWRTGSLEPDALGESPFWHPLETRLYWVDIAGCALARWEPDTGR
FT                   IDRWAMPCEPGCIAPARTAGVASGLVIALRDGIYRAREWGGALVPVATLPYDPATQRAN
FT                   DGKCDALGRFWVGTLHEPPAGQPREAVGALYCIDGRGSASAPVVRRMLDGVMTANGLAW
FT                   SPDGRRLYWADTPAHTVSAWDCDAHGEPQGSPRVFHSFPPKPAQWRPGDPGYAGRPDGA
FT                   VVDAEGHYWTAMYEGGRLLRLAPSGEIVAEVPVPVVCPTMPCLGGVGGRELFATSARKG
FT                   RSEEEVTRLPWTGFLLRAGRPAPAPGQPVAWYEEAALPVGMD"
FT   gene            complement(265251..265628)
FT                   /locus_tag="Aave_0236"
FT   CDS_pept        complement(265251..265628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30843"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ5"
FT                   /protein_id="ABM30843.1"
FT                   /translation="MTVMAFTPEQMEHAALEEAQRWIVQVARRWFRLEAQEFPDEEALT
FT                   PEQVTACLYMVHRAGRLAGLEDGAALILTGFDALRAMHCGIDGNLGEMIDFCVRMARGG
FT                   NMALAHASVERALALARPAPP"
FT   gene            complement(265625..266227)
FT                   /locus_tag="Aave_0237"
FT   CDS_pept        complement(265625..266227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_4169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30844"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ6"
FT                   /protein_id="ABM30844.1"
FT                   /translation="MASLSLPRFIAHLRSDAANLYALIDSARDHSLVTQMRQANIEHHC
FT                   LFSGVKALTLARVAPYLVPMAALAPHLERLVPYAWGGAWSMVVRGTAGVEATRIQLKKS
FT                   SLVRLPDGRSAYFRFYDARVFDRFMRIGTEGQLRWMLGDRLDGLTWVSGGDATRTRTVR
FT                   HGPARKGLWGLVPATVPLRVTEHHWADMAGTREGARP"
FT   gene            complement(266244..266972)
FT                   /locus_tag="Aave_0238"
FT   CDS_pept        complement(266244..266972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30845"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ7"
FT                   /protein_id="ABM30845.1"
FT                   /translation="MHFISNDNLATSYVKAISLIGFLAMQTAHAEPSQPKTTKEPRQVT
FT                   SCGISFNLPRHLKITPPRRTVNTDGIEECEFQVEYAKCRAFEGTCREGDIRYTDSEKNE
FT                   CERRPMDGPASQILVVKTNFNKDKKTVGAFTYKENKWEIAEGDYYYSDEVQLGNHYGHM
FT                   SLAAAANSRDFWQRWGESVGYQLIEYCCTIGTELVLIQLSSDIAVYMAPPPRDTKDGDE
FT                   CEIFCRSVRPAEPRQRTAAR"
FT   sig_peptide     complement(266880..266972)
FT                   /locus_tag="Aave_0238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(267918..268718)
FT                   /locus_tag="Aave_0239"
FT   CDS_pept        complement(267918..268718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30846"
FT                   /db_xref="InterPro:IPR031922"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ8"
FT                   /protein_id="ABM30846.1"
FT                   /translation="MALKEEDLPDYDKDALSRERALRKTAEECRQEQEKAKAELPGLKK
FT                   ERQKLDRKAEGYAEEARRLDQEIKQKEGKLKRKCLTGNIPCLPADETKRGALNLEIAKM
FT                   INASLGTKIDLAPIAKWEGVYLKSYVPWWPVNEPDGGPSMSKRDGNTRLQGKMKNGDPN
FT                   NSGVTIAKGIDFGGQDYNVYKKELEKFNKRNKIIAEEDFDKLSEKIKPYFGKIGGEACA
FT                   LARKNPLEITQKEADLLNLRAGEEATRRAIELFEKKIQRAPQDL"
FT   gene            complement(268794..269135)
FT                   /locus_tag="Aave_0240"
FT   CDS_pept        complement(268794..269135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0240"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   sde:Sde_0335 phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30847"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIQ9"
FT                   /protein_id="ABM30847.1"
FT                   /translation="MAQPAARMHDDVAHQRGAGPILEGAPTVRIGGQPAARMGDRVRHN
FT                   KGIEPITEGEPSVRLAGRPAARVGDEVACHGLIAQGCPTVRIGRDKDEACMQAAADEGA
FT                   AFVVPAHGS"
FT   gene            complement(269181..271904)
FT                   /locus_tag="Aave_0241"
FT   CDS_pept        complement(269181..271904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0241"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; Gp5 domain protein;
FT                   KEGG: pae:PA0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30848"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR0"
FT                   /protein_id="ABM30848.1"
FT                   /translation="MTRRVTIRTPLGEQLHFRQLRGSEELSQLFSFDIDLLSEGRDIDP
FT                   KALLGKTATVEIETEGGGKRYLDGLVTRFGMQGQDHRLYSYHLRLQPWLWVATRRQDFR
FT                   IFQFKTVPQIVQEVLGRYGYPLQLKLTRAYRAWDYCVQYGESDFDFVSRLLEHEGAYYY
FT                   FQHASGQHTLVIADDIVAGHEPLPGAAVIPFYPPEKSAVADRENIHAWTLGEEIKPGRY
FT                   YNDDYDFKKPRSDLSNMRQQPPGHAHDAYEIYEWPGGYVQHGDGEQYARVRLQEGLTGH
FT                   STVRGESRHRSLAPGYTFTLENYPRGDQNRQYLITGVTYHLHENPRSSSFNSAKPGETL
FT                   KHNEEHGSFQKFSLTAQPTSLPYTPARKTPKPRTTGPQTAVVVGPAGEEIWTDEYGRIK
FT                   VQFHWDRLGAMDENSSCWMRVATSWAGSGFGAISIPRIGQEVIVDFLNGDPDYPIVTGS
FT                   VYNAANMPPWALPGNATQSGIKTKSSKGGAFGDGMKNGAGDANAIRFEDKKGAEQVWLH
FT                   AQKDQLIEVENDEDHWVGQDRRKTIDRDETNTIHRDRTETVDRNEKITVHGWRTEEVDG
FT                   DETITIHSNRTETVDLDESITIHRNRRERVDLDETVSIGVDRSEDVGRNEQVSIGANRA
FT                   KTIGNNEKDRIGRNWSLRVGKTKTETIGRMSLQNVGMARMDNVGLGYSLNVGVAMNTLV
FT                   GLQQSTQVGRTKRLNVGDTYAQDIGKAWNLQVGRTQTVNVGERQETRAGKVLFAQAGEH
FT                   LELACGAAKIVLRSDGGIYLQGTHIEMQASAAINGDAGLIDLNCGSSQPAPETPPPASD
FT                   APGDAAQQAADAAESQAESAASAAMGSGSSGLQSALGALQQAKGLLDTAKALKNGDLGA
FT                   IAGLAGLAGGIAGPGGAGTSAGPAAMGKTPGWNAKP"
FT   gene            272076..273290
FT                   /locus_tag="Aave_0242"
FT   CDS_pept        272076..273290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0242"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rfr:Rfer_0480 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30849"
FT                   /db_xref="GOA:A1TIR1"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR1"
FT                   /protein_id="ABM30849.1"
FT                   /translation="MSFQASRPAFKKFTRAPGVPPRGCRYDAAMDSALRQIIERVRDSA
FT                   REGRPLRIRGGGTKDFHGGMPLAGEVLDTRACAGVVDYEPSELVVTARAGTPLAELEAL
FT                   LAGRGQCLPFEPPHFGEGATVGGMVAAGLSGPARASAGAVRDFVLGAEIVNGRAECLRF
FT                   GGQVMKNVAGYDVSRLMAGAWGTLGVVTEVSLKVLPVPPAEATLCFELSQAEALRRLQE
FT                   WGGQPLPLNASRWEAGPSGAADGVLHLRLRGAVAAVESACRALGGQLQSPQEAAAQWDA
FT                   CREQALPWFAGRPAGAALWRLSVPQSAPALALPAGASGPLVEWHGGLRWVQAAPALGPA
FT                   LREAARAVGGAATLFRAPAESSLVPAAGAAPAQPADAALQRIHERLRAAFDPSGIFNPG
FT                   RRVAG"
FT   gene            273299..274069
FT                   /locus_tag="Aave_0243"
FT   CDS_pept        273299..274069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0243"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bur:Bcep18194_C7065 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30850"
FT                   /db_xref="GOA:A1TIR2"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR2"
FT                   /protein_id="ABM30850.1"
FT                   /translation="MRLLRHLMGRHRTPATNRLLGLLLAFNAGAVNAGGFLVVHSYTSH
FT                   MTGFLSTVADNLVLGNMALVLAAVGTLWAFMSGAGTTAIMVNWARHHRLRSGFALPLLL
FT                   EAVLMLLFGLMGAITLGWPTPFSVPLTVLLLAFLMGLQNAVVTKMSSAQIRTTHMTGVA
FT                   TDLGIEMGKMLYWNRRGTPPEAHVHSNRARLVLFASLLGMFTAGGIVGAAGFKHVGFVW
FT                   VVPLAAVLLGLALPPLASDFGHLAALWRTRRHRH"
FT   sig_peptide     273299..273400
FT                   /locus_tag="Aave_0243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.965 at
FT                   residue 34"
FT   gene            274115..275374
FT                   /locus_tag="Aave_0244"
FT   CDS_pept        274115..275374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0244"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: pol:Bpro_0188 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30851"
FT                   /db_xref="GOA:A1TIR3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR3"
FT                   /protein_id="ABM30851.1"
FT                   /translation="MQTRLAPEFQDTPEGREAEGILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGETPTRKTQLHLDRCLTCRNCETTCPSGVQYGRLVDIGRRIVED
FT                   KVPRPLPERARRWALKEGLPSPLFKPALKAGQAVRGLLPATLRAKVPRPQEAGAWPVRE
FT                   HARKVLMLAGCVQPAMLPNVNRATARVLDAAGIQTVIAAGEGCCGAVKFHLNDQDGGLA
FT                   QMRTNIDAWWPHVEAGGVEAIVLNASGCGATVKEYGHLLRHDPAYAARAERVSALARDL
FT                   SELLPDMLPALAERLEGRIDAPKALLAYHPPCTLQHGQKLRGGVETYLARLGFRLRVAR
FT                   TESHLCCGSAGTYSLLQPEIAGQLRDRKLGALDEACAEEPPAAILSANIGCITHLQSGT
FT                   ATPVRHWIEVLDEALRPGAV"
FT   gene            275537..276496
FT                   /locus_tag="Aave_0245"
FT   CDS_pept        275537..276496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0245"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30852"
FT                   /db_xref="GOA:A1TIR4"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR4"
FT                   /protein_id="ABM30852.1"
FT                   /translation="MNDTVNAPDSEASGASAPDAASAAPAVAANAAAASPEGARADAPA
FT                   GRRPGRRGGRNRRRGAPEGAGGDAAAAPEAASTPAPAQGGRRTPHPALEQLAQLYPHLF
FT                   GAQFLPLKRGIFQDLQDAHPGVFERDALKVALGLHTRSTRYLQVVAEGRPRHDLGGQAV
FT                   EAMVPEHVYHALTEVYRRRKPRDGEDLRAKLRRRIAQAFEASGLDRAGYDALVRGRDEK
FT                   ANAVLDEALAEVAERDARAEALLRAFEASGSADVAQFADMYGMDVRAAERSLQRGRQLR
FT                   SAARARAAAAETAAADATESGDGERGGEDAGTPTDDAK"
FT   gene            276742..277071
FT                   /locus_tag="Aave_0246"
FT   CDS_pept        276742..277071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30853"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR5"
FT                   /protein_id="ABM30853.1"
FT                   /translation="MRMMAVQSPMAAFGGCEFATFRLLPSVDAARITEAAARMRDGFLR
FT                   RQHGFLAHALLQGDGGLWADMVFAATRADAERICAAFMDHAVCRDYLALMEPGSAHLGF
FT                   WSRAA"
FT   gene            277097..277780
FT                   /locus_tag="Aave_0247"
FT   CDS_pept        277097..277780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0247"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   Helix-turn-helix, type 11 domain protein; KEGG: rso:RSc2673
FT                   putative repressor transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30854"
FT                   /db_xref="GOA:A1TIR6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR6"
FT                   /protein_id="ABM30854.1"
FT                   /translation="MRRADRLFQIVQLVRGRRLSTAEFLAARLEVSVRTIYRDVADLQR
FT                   QGVPIEGEAGVGYRLGAGFELPPLMFSQGEADALVAAARLAQAWLDPAMALQMEGALGK
FT                   ILSVLPPAARAAAESQALYAPGPGMDDRTQALLMPLREAVQARRIACIDYADEQGRASA
FT                   RRIRPLGCFFWGKVWTVAAWCELRQDFRGFRIDRIAALRVLDERFPLQPGRTLADLLRQ
FT                   VRGQG"
FT   gene            278036..278770
FT                   /locus_tag="Aave_0248"
FT   CDS_pept        278036..278770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0248"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hhe:HH0294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30855"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR7"
FT                   /protein_id="ABM30855.1"
FT                   /translation="MTTDNDNSAKDRSAFETSIWMLKVEMANAGAHMTIDANARLTYTR
FT                   QIDAMANELRAQALSGNITWAQAAQQAQDTRNVIMEVIRGRSTPFGRAMAQQLKAEGKT
FT                   LNELIARKVQQLHGPGAQFDRLTAAQQNGVYAEIVKSAGKSNPRVTQTMRGLSRAGRGL
FT                   SRAGRGLIVLSLALSVYNVATAQDKVAAAGREVAVTGAGIGGGIAGGALAGLACGPGAP
FT                   VCVAVGAFVGGALSAFGVDMLW"
FT   gene            278783..279256
FT                   /locus_tag="Aave_0249"
FT   CDS_pept        278783..279256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30856"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR8"
FT                   /protein_id="ABM30856.1"
FT                   /translation="MDVLAPEELSLHLLREADERHKPLSDIVLAGQRIGRTVEAAVLEA
FT                   AFRCDSGYLLFTTDDVPGEEFLGIHLFSPAFERLDTATLGGMYSTGSFLLLGVEGTDTV
FT                   RFRFIGGTDWRLRVLPRPRLRMPLMPEARGVSRPLGFSRRFEITGRPQRELSD"
FT   gene            complement(279275..279769)
FT                   /locus_tag="Aave_0250"
FT   CDS_pept        complement(279275..279769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0250"
FT                   /product="glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: rfr:Rfer_0484
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30857"
FT                   /db_xref="GOA:A1TIR9"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIR9"
FT                   /protein_id="ABM30857.1"
FT                   /translation="MTSAYDFDALQMDGQAVPLRQYAGRVLLIVNTASACGFTPQFAGL
FT                   QELHQRYADRGLVVLGFPCNQFGRQDPGSNGEIAAFCQRNYGVDFPMMAKIDVNGSGAP
FT                   PLYRWLTAEAPGLLGTKAIKWNFTKFLIGRDGQVVRRYAPTAKPASLAGDIEAELARPA
FT                   P"
FT   gene            complement(279989..280783)
FT                   /locus_tag="Aave_0251"
FT   CDS_pept        complement(279989..280783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0251"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rfr:Rfer_0486 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30858"
FT                   /db_xref="GOA:A1TIS0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS0"
FT                   /protein_id="ABM30858.1"
FT                   /translation="MRCRRHPAESAAVRILSMTSPLPVLALLLNAFVWGLAWWPFRLMH
FT                   ASGLHPLWATAVMYCGVLIALLALRPGIWAQVRAHPQLWLLAFSSGLNNVAFNWAVTVG
FT                   DVVRVILLFYLMPAWAVLLAWKVLGERPTAGALARLVLAFAGVVLVIWPGDASARELLR
FT                   GLSMADGLALLGGFMFALTNVTLRRLHGVPGQARMFSMFGGCMLMALVVGAIACARAWW
FT                   SPFPLQTSSGWPRRRCSRACCSWATGRCNSALPGWRRARRRS"
FT   gene            complement(280826..282106)
FT                   /locus_tag="Aave_0252"
FT   CDS_pept        complement(280826..282106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0252"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0192 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30859"
FT                   /db_xref="GOA:A1TIS1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS1"
FT                   /protein_id="ABM30859.1"
FT                   /translation="MKRGFYTIMSAQFCSSLADNALFVAAVELLRTNGSPEWQRAALVP
FT                   MFALFYVVLAPFVGAFADAMPKGKVMFVSNAIKVVGCLMMLFGSHPLIAYAVVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASIILGVLLGGQLVGPNISGWLLSVDLPF
FT                   VDTGVDTAAEAAIATLIAVYLAAAWFNTRIPHTGVEMRPMPGNPLALLPDFWACNNRLW
FT                   RDKLGQISLATTTLFWGAGGNLKFIVLAWAAAALAYNTTQASALTGVVAIGTAAGAIVA
FT                   SMRMRLDMATKVIPLGIAMGVLLILMVFIKSIWIAIPFLILLGGLGGYLVVPMNALLQH
FT                   RGHNLMGAGRSIAVQNFNEQAAILGLGAFYSLSLKMGLSVFGAITAFGLVVAGVMWVIR
FT                   RWHIHNCTRHHDEVEHLLHIARHDHHH"
FT   gene            282246..283355
FT                   /locus_tag="Aave_0253"
FT   CDS_pept        282246..283355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0253"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30860"
FT                   /db_xref="GOA:A1TIS2"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TIS2"
FT                   /protein_id="ABM30860.1"
FT                   /translation="MPRPIQATIHTAALQQNLARARAAAPDARVWAVVKANAYGHGIER
FT                   AFEGLRGADGFALLDLGEAERVRQLGWRGPILLLEGVFEPRDLELCSRLSLWHAVHCDE
FT                   QIDWLSAHKTHAPHRVFLKMNSGMNRLGFPPARYRAAWARLNALPQVDEISFMTHFSDA
FT                   DGPRGIAHQIDAFCTATQDLPGERTVSNSAATLRHAGGDARVRGDWVRAGIVLYGSAAD
FT                   HPEHTAAHWGLAPTMTLSARIIGTQQLQAGDTVGYGSSFTADRPMTIGVVACGYADGYP
FT                   RHAPTGTPVLVNGVRTRTVGRVSMDMITVDLTPLHEAGVEAGVGSEATLWGRASCGAVL
FT                   CIDEVAQAAGTVGYELMCALAPRVPVVVD"
FT   gene            283359..284231
FT                   /locus_tag="Aave_0254"
FT   CDS_pept        283359..284231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1522 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30861"
FT                   /db_xref="GOA:A1TIS3"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS3"
FT                   /protein_id="ABM30861.1"
FT                   /translation="MRGKARPGQRSGGSNWRRVRTPGRTLEASLLNRYRLRMHGWCIGA
FT                   FMMAFMWAVSHTQMVLGVESLAVRYLATLGAGYVAYLLVLRLWAARLVGPPAGDRPRNQ
FT                   DGEGVDPSSGVDVADVAEALHDAGDLAARMARGAGGRSPALPRSGGGDFAGAGADGNFG
FT                   DALGDMAGNALGAAADADEGAVVVVPVVAIFLIGAAVLFGAGALALLYFGFDVLLAVAV
FT                   ELAFSYATARAAMGVERAGWLAAAVRLTWKPLLGALLCAVVLGAALDRFLPEARSLPQA
FT                   VRMLQGGHR"
FT   gene            284389..285984
FT                   /locus_tag="Aave_0255"
FT   CDS_pept        284389..285984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0255"
FT                   /product="extracellular solute-binding protein, family 5"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   5; KEGG: bbr:BB4028 putative binding-protein-dependent
FT                   transport protein (periplasmic)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30862"
FT                   /db_xref="GOA:A1TIS4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS4"
FT                   /protein_id="ABM30862.1"
FT                   /translation="MRFSRTLLAASLAAALTAALPLATQAATFRFARSADVTTWDVHAH
FT                   NVGPNNVLHSAVYETLVEYNSKTFKPEPQLATAWKQVSPTQLRLTLRQGVKFSDGSPLT
FT                   AEDVKFSLERAKAKTSNYAVYAQGIDRVQVVDAQTIDIFSDVPNPVLVNQLTELRILSK
FT                   PWAEKNNALTPKDIKTSDEPYTHRNALGTGPFVLKSWSPDQRTVLAANPYWWGKGKFAG
FT                   NVTDVVYTPIKSDATRTAALLSGEVDFVLDPSPQDIARVRQTPGFKVLEGPENRTLFLG
FT                   LDQFREELPGSNVKGKNPLKDVRVRRALCQAIDIQTIQRVTLRGLAQPTGALIARQVNG
FT                   WTQKADARWPYDPAAAQKLLADAGYPQGFEVDFACSAGRYTNDEQLCQAITAQWAKVGV
FT                   RAKLRTQPFATYFPMIQRNEASIYLLGWGVPTFDAFYSLQSLVRSPGAGGDGNFNLGRF
FT                   SDPQQDALIERIKKETDAATRNGLIEQALLKDHELVSHIPLYNQIIPWAATLKVELPHR
FT                   ADNRIDWRVLKVAK"
FT   sig_peptide     284389..284469
FT                   /locus_tag="Aave_0255"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 27"
FT   gene            complement(286027..287292)
FT                   /locus_tag="Aave_0256"
FT   CDS_pept        complement(286027..287292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0256"
FT                   /product="fumarylacetoacetate hydrolase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: pol:Bpro_2996 fumarylacetoacetase; TIGRFAM:
FT                   fumarylacetoacetase; PFAM: fumarylacetoacetate (FAA)
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30863"
FT                   /db_xref="GOA:A1TIS5"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS5"
FT                   /protein_id="ABM30863.1"
FT                   /translation="MPQHTDATHDPSLRSWVESANAAGCDFPIQNLPFGRFRAHDGSAR
FT                   IGVAIGDRILDIQAAGLVAGDDMNALMAAGPQARRALRTRLSQGLAAGSAQQAAWQDAL
FT                   LPQAGTGMLMPCRIGDYTDFYTSVHHATNVGRQFRPDNPLLPNYQWVPIGYHGRASSIG
FT                   VSGAAVRRPRGQLKAPEAAAPVLAPSRRLDYELELGWFVGTGNAQGEPIGIGEAEDHLF
FT                   GVALFNDWSARDIQGWEYQPLGPFLSKNFASTLSPWVVTLEALAPFRAPFTRPDEDPQP
FT                   LPYLDSPDHRAAGAFAITLEVLLQTERMRTEGLPPAVLSRTDTTRAAYWTPAQLVAHHT
FT                   VNGCNLHSGDLLGSGTLSGPGPQEAGSLLELAAAGRQPVRLPSGEERSFLEDGDTVTLR
FT                   GWCEREGAARIGLGEASGTVTG"
FT   gene            complement(287320..288324)
FT                   /locus_tag="Aave_0257"
FT   CDS_pept        complement(287320..288324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0257"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   reu:Reut_A2507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30864"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS6"
FT                   /protein_id="ABM30864.1"
FT                   /translation="MRSIPSASPCMPRRVAMRAAAALLLGAAAGSLAAQEAFPSRPVRF
FT                   IVPYAAGGTTDLVARTVGARMAQTLGQPVVIDNRGGAGGNIGMDAVAKAAPDGYTVGMG
FT                   AISTNALNPHIYKKMPFDPRKDFTPVGLLGQSTIVLEAGPALPVKNVAELIDYAHKHPG
FT                   LPFSTAGAGTSMHLAGVLFGQLSKTEWTHVPYKGSAPLITDLIAGQVPVAFDNLPASLP
FT                   HIQAGKLRALAVAGSQRSPALPDVPTLAEAGLAGYAVEPWFGVYGPAGMPAAVVQRLEK
FT                   ALQEALADPAVKDRLQAAGFTPRGSSAAELGALTLREYDRLGQVARAAGMTAD"
FT   sig_peptide     complement(288220..288324)
FT                   /locus_tag="Aave_0257"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.505 at
FT                   residue 35"
FT   gene            288444..289223
FT                   /locus_tag="Aave_0258"
FT   CDS_pept        288444..289223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0258"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: protein of unknown function UPF0074;
FT                   regulatory protein, IclR; KEGG: eba:p2A140 putative
FT                   IclR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30865"
FT                   /db_xref="GOA:A1TIS7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS7"
FT                   /protein_id="ABM30865.1"
FT                   /translation="MTTVVLDRVLRILDQLSRYDAGGLSLSDIARQSGIPHPTVHRLLR
FT                   DLAQARLVTLLPDGRGYVLGRLAFEVGLAARARHDVAPLFAAHLRRLAEATGYAAYLFV
FT                   RSGLEAVCHDHTHAQRLDPPLSVTVGGRRPLGVGAAGLALLAAQDDARVEASLAAHAGV
FT                   LGRYGGLDVPSLRTLIAQTRALGYARSGGCLNTNTAAVGHAVRDPGGCAFAAVSLSTTV
FT                   ARLTQREAARLASLLRAEIAQIEPRVHFAWSDEAALR"
FT   gene            complement(289443..290060)
FT                   /locus_tag="Aave_0259"
FT   CDS_pept        complement(289443..290060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0259"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /note="PFAM: glutathione S-transferase, N-terminal domain;
FT                   glutathione S-transferase, C-terminal domain; KEGG:
FT                   sme:SMc00036 putative glutathione S-transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30866"
FT                   /db_xref="GOA:A1TIS8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS8"
FT                   /protein_id="ABM30866.1"
FT                   /translation="MTPALTLYYAPGTCAQAVRIALCEAGAEHRLVRLDFPAGEQRSPE
FT                   YLAVNPKGRVPALVTEEGTLTETPALLAYVAQRFPQARLAPTDAHGFARMQEFHSYLAS
FT                   TVHVAHAHRPRAVRWADEPEAIAAMQRKVPQNMTECFELIEQHSLGDGPWVMGDQYTVA
FT                   DGYLFTVAGWLASDGVDIARFPKVHAHSQRVAARPAVQRALT"
FT   gene            complement(290057..291052)
FT                   /locus_tag="Aave_0260"
FT   CDS_pept        complement(290057..291052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0260"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: pol:Bpro_0197 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein; Ketopantoate reductase ApbA/PanE, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30867"
FT                   /db_xref="GOA:A1TIS9"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIS9"
FT                   /protein_id="ABM30867.1"
FT                   /translation="MQVAIYGAGAIGGWLGMGLSRGGADVSFVARGPTLDALRTQGLRC
FT                   IRPDGTCEAVPVAAHDDPAALGAQDVVVLAVKAPALPDVAARIAPLLGPKTTVLTAMNG
FT                   VPWWFLEGCSGPAHGRELASVDPGGSLARAIPAERVVGGVVHASCSVDGPGVVRQHFGN
FT                   RLILGEAVGGITPRLEALSALIARGGIEVEQSPRIQQDIWFKLWGNMTINPISALTGAT
FT                   TDRILDDDLVRGFVSAVMLEAKAIGECLGLRIDQQPEDRHAVTRKLGAFKTSMLQDVEA
FT                   GKPLEIDALVGAVHELGRATGVPTPHTDALLGLVRLFASNRLSLRNETRP"
FT   gene            complement(291182..291571)
FT                   /locus_tag="Aave_0261"
FT   CDS_pept        complement(291182..291571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0261"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dme:Dmel_CG13560 CG13560"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30868"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT0"
FT                   /protein_id="ABM30868.1"
FT                   /translation="MTKNTALSASRRWLVAAPIALASVLALSACDRNKESNVNTTPSST
FT                   PAPTTAPAASDAGSMGSGSTGGTGSMGGTGTSSGGMGAGTGTTTDGSTGTTTTPSTPSS
FT                   GGAVFGGTAPTPLASAASDAASAAR"
FT   sig_peptide     complement(291482..291571)
FT                   /locus_tag="Aave_0261"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.909 at
FT                   residue 30"
FT   gene            291860..293239
FT                   /locus_tag="Aave_0262"
FT   CDS_pept        291860..293239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0262"
FT                   /product="DNA replication and repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0200 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30869"
FT                   /db_xref="GOA:A1TIT1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT1"
FT                   /protein_id="ABM30869.1"
FT                   /translation="MAKDKTVFTCTECGGTSPRWLGKCPACGAWNTLVESVAEAGPGKN
FT                   RYSTPQHAGLAQSQAVTPLSAIEAADVARTASGIEELDRVLGGGVVEGGVVLIGGDPGI
FT                   GKSTLLLQALDALQRLGLPTLYVTGEESGAQVALRSRRLGLDHSQVNVLAEIQLEKILA
FT                   TVEATQPAVAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRAAKATGVSIILVGHVTK
FT                   EGALAGPRVLEHMVDTVLYFEGDTHSQFRLVRAIKNRFGAVNEIGVFAMTEKGLKGVTN
FT                   PSAIFLSQHSEPVPGSCVLVTLEGTRPMLVEIQALVDEGGPSPRRLSVGLERDRLAMLL
FT                   AVLHRHAGVACMDQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKPLPKGFIAFGEVG
FT                   LAGEVRPAPRGQERLKEAAKLGFTMAVVPKANAPRKPIEGLTIHAVERVEEAMEVVRGM
FT                   G"
FT   gene            293470..293943
FT                   /locus_tag="Aave_0263"
FT   CDS_pept        293470..293943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0263"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30870"
FT                   /db_xref="GOA:A1TIT2"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT2"
FT                   /protein_id="ABM30870.1"
FT                   /translation="MNLLRRFFIPVLIALLVIAAYRSYGWQGIFAVGGGLVMWALLHFT
FT                   RLMNVMRKAADRPIGYVGSAVMLNARLREGVNLMHVVAMTRSLGELLSPQGEEPERYRW
FT                   TDGTQSHVTCEFRGGRLAAWELVRPAAEADAGAGGAAAGASDAPAPSVGPSAP"
FT   sig_peptide     293470..293547
FT                   /locus_tag="Aave_0263"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.759) with cleavage site probability 0.390 at
FT                   residue 26"
FT   gene            293988..294926
FT                   /locus_tag="Aave_0264"
FT   CDS_pept        293988..294926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0264"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: pol:Bpro_0203
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30871"
FT                   /db_xref="GOA:A1TIT3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT3"
FT                   /protein_id="ABM30871.1"
FT                   /translation="MSPVVPSMADRDGKIWMDGQMVDWRDAKIHVLTHTLHYGCGAFEG
FT                   VRAYQTPQGTAIFRLQEHTERLFNSAKILRMQIPFTRDEVNEAQRAVVRENRLASCYLR
FT                   PLTWIGSQKLGVSPKGNQIHLMVAAWAWGAYLGEEGMQRGIRVKTSSYTRHHVNITMTQ
FT                   AKAVSNYTNSILANMEATEDGYDEALLLDSAGFVSEGAGENIFVIKDGVVYTPDLSAGA
FT                   LNGITRNTILHICRDLGIELVQKRITRDEVYIADEAFFTGTAAEVTPIRELDRIAIGAG
FT                   ARGPVTEKIQSAFFDIVNGRNPKYAHWLTLV"
FT   gene            294967..295173
FT                   /locus_tag="Aave_0265"
FT   CDS_pept        294967..295173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30872"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT4"
FT                   /protein_id="ABM30872.1"
FT                   /translation="MTQAIIELLAKDLNPQGGVFCPSPKADMKIWNTHPKVYLDVAHTG
FT                   EAKCPYCGTVYRLKAGEVVRAGH"
FT   gene            complement(295225..296172)
FT                   /locus_tag="Aave_0266"
FT   CDS_pept        complement(295225..296172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30873"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT5"
FT                   /protein_id="ABM30873.1"
FT                   /translation="MTHSLPAFAFRAVYALLARLRPRTAAAYAGKAPAAPAAPDEGTGA
FT                   IPRRIWSYWHSVQPDAFVERCVANWRAQCPGFEVHVLNRQTVRDRVPPGDWPAGFEQLD
FT                   PVKQSDWIRLYLVSRFGGYWLDATVLLTRPIDWLEAMRGAQGADFAGFYLQGYTQDAQF
FT                   PVVENWTFGAPSGGAFVTAWQREFHHALFEVGTAAYLAARQAEPGWEALLQGIPDPVYL
FT                   LGHVTAQRVLRQGGAAHRLALARAEDTAFFYQKAVGWKWYLLYPRLCLVPADAEVPPLV
FT                   KLRGGERRHFAQLFARHGEPGSDTLWGRACRPRK"
FT   gene            296346..297638
FT                   /locus_tag="Aave_0267"
FT   CDS_pept        296346..297638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0267"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: xac:XAC3797
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30874"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT6"
FT                   /protein_id="ABM30874.1"
FT                   /translation="MHIPSLLGTAPWQRQWTTLVAFLLPALALTLPSGYSYGAVLLLLG
FT                   ALATLPRWARLRPDRGTLALVAVILAMGLLWCVMSDPREAMGRWDRPIKFMLGAVCGLF
FT                   IASQPPRPRPLFWGLLAGCIGAGLVALWQVHVQGALRASGFPTGRTNAIQWGNLALLLG
FT                   SMLALQLIVLWRQLPRAAAWLAVVAALGALNASVLSQSRGGWLALLLALPMGLWLLHRL
FT                   HPGRITAIAAVLAAALAVLTAMNWDVMEKRWERMQEEVTQYDTHGEADNSVGQRLEHWR
FT                   FAWNVGMERPWTGWGMAGYMHEKAVRVAAKQYEPSIMEYIYVHNEPLDVFVKTGIGGVI
FT                   LLLCFYGVPFALFWPSRRRMAALAAEPEPVRAQVLALRLSGLCIPVLYAGFGLTQVFFA
FT                   HNSGIMFYIFMNMITWAALLGMRMPAAGARV"
FT   sig_peptide     296346..296462
FT                   /locus_tag="Aave_0267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.972 at
FT                   residue 39"
FT   gene            297649..298812
FT                   /locus_tag="Aave_0268"
FT   CDS_pept        297649..298812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0268"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   sth:STH1101 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30875"
FT                   /db_xref="GOA:A1TIT7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT7"
FT                   /protein_id="ABM30875.1"
FT                   /translation="MSARTSHAAAAAGTPPARRPRVLHFVTGGFSGATQVAVDLVRAHA
FT                   GSGRFDALLALRSKRRTTTPERVAALRAENLAVELVPGWAHAATVWALAALCRRWRPDI
FT                   LVAHGFSEHLWGRYAGLLAGVPRLVHVEHNSRERYTAWRLAQARWLARRTAAIVGVSEG
FT                   VRTTLQERGFPPDRIHAIPNGVRLEPFAQAAAHPFAAREPGIVMAARFARQKDHATLLR
FT                   AVALLRDRGLTPPVRLAGGGKPGARQAAERLARELNLLPQVQFIGHCADVPGLLMGQQI
FT                   CVLSTHYEGMPLSLIEGMAAGCAVVGSRVVGVQEVIAPGRTGLLAEPGDFASLADALER
FT                   LLADADAAARMAAAAREDAVARYGLPTMTARYEALLEGLLRESPAAP"
FT   gene            298830..299870
FT                   /locus_tag="Aave_0269"
FT   CDS_pept        298830..299870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0269"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   sma:SAV5093 glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30876"
FT                   /db_xref="GOA:A1TIT8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT8"
FT                   /protein_id="ABM30876.1"
FT                   /translation="MVAGPAAAPWLSVLVPVYNVRDYLAECVGSVLAQAPADAGVEVLL
FT                   LDDCSTDGSAEAMAALDARWPGRLRLMRHERNAGLSAARNTMIAAARGDYLWFLDSDDK
FT                   LLPGAIEGLREVVRLHAPDAVLCDFAVWRERPRLKHRLRGEGHRSTFAGPHAVLRPGGP
FT                   ELLAGLLATGQLHAWSKITRRDLWPETVRFPAGRYFEDMATMPLALLRARSYWHAPRPW
FT                   VAYRQRGGSILATMTLPKAMDQSAALRAFGEALRGRPDAGDAALRFALAHQSARNLMGA
FT                   MRVVARAAGQDGADPAALDAVADRIRADFAAVSPLPAGALARAYLRRGWWLRYLKFLRA
FT                   HALRQR"
FT   gene            299867..300898
FT                   /locus_tag="Aave_0270"
FT   CDS_pept        299867..300898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0270"
FT                   /product="mannosyltransferase OCH1-related enzyme"
FT                   /note="KEGG: mmr:Mmar10_2764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30877"
FT                   /db_xref="GOA:A1TIT9"
FT                   /db_xref="InterPro:IPR008441"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIT9"
FT                   /protein_id="ABM30877.1"
FT                   /translation="MNLPAFPRPTLKTHGELWLARALRWFYGLWPRQLEACPPPPFALH
FT                   AIAPAPGVPEGGEDGTDRSALPPIPRVIWAYWKGAAPPLLIQRCFANWRRNSPGYEIRL
FT                   LDDASARAWLPDIPAVLDDVSPAKRADWIRLELLRLHGGIWVDASTILTAPLDWVLAQQ
FT                   ERTPADFVGFYLGRHTRDAAYPVVENWFMAAPPGSRFIADLQQEFTTQVIHRSGHEYIA
FT                   HLQALGVYEEVRQYIDAPDYLSMHLALQFILRARGGYRLALARAEDGPFYYHMLGRWRR
FT                   TQLKLRLLFSRPTGALPPLIKLRAPDRRRLDDYLARGLYLPDSIAARQLMAETGAVTPA
FT                   SPR"
FT   gene            complement(300876..301973)
FT                   /locus_tag="Aave_0271"
FT   CDS_pept        complement(300876..301973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0271"
FT                   /product="2-nitropropane dioxygenase, NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   cvi:CV4048 probable 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30878"
FT                   /db_xref="GOA:A1TIU0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU0"
FT                   /protein_id="ABM30878.1"
FT                   /translation="MPTPVPPSRRTPLFDRLGLTLPIVQGPMTGSDTPALAAAVSEAGG
FT                   LGMLGCGMRSPAAMAEAAAEVRRRTARPFGMNLFVLEMPAPDAATVREALDRLAPLYAD
FT                   FGLEPAVPAQWCEDFEAQFEALVEARPAVASFTFGILGARQVERLQAAGCVVIGTATTV
FT                   AEARAWADVGADAVCASGLEAGGHRGTFLADFESSQVGTLALVPPCVDALRIPVIAAGG
FT                   IMDGRGIAAAQALGAEGVQMGTAFLACPESAIGPAYRAALARACETDTRITRVFSGRPA
FT                   RGIVNATMEQFAPWEGSVPAYPVQNALMGPVRRAAAAQGRADALALWAGQGVAAVRPMP
FT                   AGELVALLAREWRAAAGGVSAGSPA"
FT   gene            complement(302015..302899)
FT                   /locus_tag="Aave_0272"
FT   CDS_pept        complement(302015..302899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0272"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bur:Bcep18194_A4554
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30879"
FT                   /db_xref="GOA:A1TIU1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU1"
FT                   /protein_id="ABM30879.1"
FT                   /translation="MDLSALEIFRAVAAEGSVTRAAERLGRVQSNVTTRVQQLEEQLGA
FT                   TLFLREGRRMALTPAGTSLVAYADRLLALAEEARQALHPGTPGGRLRLGAMESTAAARL
FT                   PAPLARLHARWPGLQLELRTGASRELVDQVLAHASDCALVAWPPPGVDPEAPVDCTPVF
FT                   TESLLIALPAGHPPVERPGDLQVDTLAAFSPGCTYRRLGEDWMRAQRHGAAPHILELAS
FT                   YHAILACVAAGRCAGVVPQSVIDLMREPPALRWVPLAGRETVLVRRRGWHTPALDALLD
FT                   ALRDVPAGMPPGA"
FT   gene            302970..304253
FT                   /locus_tag="Aave_0273"
FT   CDS_pept        302970..304253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0273"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; KEGG:
FT                   pol:Bpro_1488 protein of unknown function DUF1228"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30880"
FT                   /db_xref="GOA:A1TIU2"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU2"
FT                   /protein_id="ABM30880.1"
FT                   /translation="MAIDTSPPGPGAGTSPALADRPLAVALAGMAALGAAMGIGRFAFT
FT                   PLLPMMLRDGALTLAGGSWLATVNYIGYLAGALVCMALPWLAPGTARSWQGARLTRWGL
FT                   AATVLLTCAMALPLPGAWPLLRAAAGVASAVVFLNVSSWCMARLVALGQPALGGLIFCG
FT                   PGLGIVLTGLSASAMVSAHWRAAAGWAVFGLLCAVLCALVWSVVRGAAQPAAGAAGPAA
FT                   ARTAAPVARGGRSARALLTLAYGLAGLGYIVTATFLPVIARGVLPAGSPWPDLFWPVFG
FT                   AGVALGAALSTRTPAAWDRRWLLAGCYALQAVSIGLGLAWPGVPGFALGSLLLGLPFTA
FT                   ITFYALQEARRIWPAAGDSFAGLLTVAYGLGQIAGPPLVAWALHHAATPQQGFAHGLAM
FT                   AAGALGLGAAVLGAMAWRWPPEPLPAGD"
FT   gene            complement(304282..305523)
FT                   /locus_tag="Aave_0274"
FT   CDS_pept        complement(304282..305523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0274"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: rfr:Rfer_0509 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30881"
FT                   /db_xref="GOA:A1TIU3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU3"
FT                   /protein_id="ABM30881.1"
FT                   /translation="MSNPFSRRLYLRIWLAVVGGMAVLTLAVGWAWRIASEQNALTQPA
FT                   PPPREMVLLDAAGQPVLRGLAIRVPPTAGGPPGGLEFSVEAENGQLPYTLQFSPRIRPP
FT                   GERDRRGGPEAAFWTRPPFGFLWMLGIVGVAVAVGVFPIIRRLLKRLENLQRGVQRFGE
FT                   GDLSVRVAEHGQDEVADLARQFNAAAARIETLVKSHKSLLANASHELRSPLTRIRMGLE
FT                   LMQGSTPSPAFRSEILRNIAELDQLVDEILLASRLDAREADMGTVETVDLMGLAAEECV
FT                   RVDAELQAADGTAADALEVRGIAKLLRRALRNLLENARRYSQGDITVTLRSTGTQVEVS
FT                   VCDQGAGVPPAQRERIFEPFYRLPGASERSGGVGLGLALVRSIAERHDGSVYCTDRPDG
FT                   AEGACFVLRLPRAT"
FT   sig_peptide     complement(305440..305523)
FT                   /locus_tag="Aave_0274"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.509 at
FT                   residue 28"
FT   gene            complement(305767..306486)
FT                   /locus_tag="Aave_0275"
FT   CDS_pept        complement(305767..306486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0275"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rfr:Rfer_0510 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30882"
FT                   /db_xref="GOA:A1TIU4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU4"
FT                   /protein_id="ABM30882.1"
FT                   /translation="MSTAQLLMIEDDFRLAQMVIEYLGQSGLEVAHMADGQSGMARLQG
FT                   SDAGPLPDLVILDLMLPDMDGLDVCRRIRSLPGAAAQVPVLMLTAKGDPMDRIIGLELG
FT                   ADDYLPKPFEPRELLARIRAILRRRETGPAAPSQALRFGSLEIDRDARSVTVGGQPADL
FT                   TSYQFDLLVALAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIESDPKNPR
FT                   RILTVRGVGYVFAKQQD"
FT   gene            complement(306587..307936)
FT                   /locus_tag="Aave_0276"
FT   CDS_pept        complement(306587..307936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0276"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rfr:Rfer_0516 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30883"
FT                   /db_xref="GOA:A1TIU5"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU5"
FT                   /protein_id="ABM30883.1"
FT                   /translation="MTPSPPAPAPSAPPGPARSWRAAWKVYAEPASLRMLALGFSAGLP
FT                   LLLVLGTLSFWLREAGVDRTTIGYLSWVGLAYAFKWVWAPLVDRMPLPLLTRALGRRRS
FT                   WLLFSQALVMAGLAGMAFNDPRAALAPMVWCALAVAFGSATQDIALDAFRIESADADRQ
FT                   AALAATYQTGYRLAMIWAGAGVLWVAARAEVPGLAGYQHGAWRTAYLVMAASMLVGVLT
FT                   VLLSREPAPRPLPPARNAAQWLRGALIDPFADFIARYRWQAALILALIAVYRISDVVMG
FT                   IMANPFYVDMGYTKDEVAAVTKVFGVVMTLAGAFLGGALSMRVGVMRVLMLGALLSAAS
FT                   NLLFAWLGLQEHDVTLLVLVVSADNLAGGIASAAFIAYLSALTNVQYSATQYALFSSMM
FT                   LLLPKWLAGFSGRFVDAFGYPEFFAATAMLGLPVLALVALAARAQQRPPG"
FT   gene            308126..309682
FT                   /locus_tag="Aave_0277"
FT   CDS_pept        308126..309682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30884"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU6"
FT                   /protein_id="ABM30884.1"
FT                   /translation="MRKELASCAVRTAVPSVVLPPKVSPHRAPVAASPDTTQRIAPRGT
FT                   RSMTSAPRRGGIPETAFPTGGGQDGTQNLPARAMKYVLGLAAAGYLCDKAANGFFLSTT
FT                   SLHDGRGGFTSNARLDKAFTEAAAYRQRFHAAEPGERALQPRLPAFLKRCGNRQFVSMT
FT                   DYRAATKVHLIERTDTPEARASLLKSLECLQGTLVKQECVDRYAPSSVPADFDLRNSAL
FT                   YGQKSKYALAGVSNTETGARGYTSRSITRPFVNRGLRHFKEDSERRGLSLRKSSESLQA
FT                   QLAKEGALSGTAQFAAGQTLLNFRQVYASDEHWGHAENVIMKFLVEQGLLSQRQTERID
FT                   ESLMFEDPSKSVFKRNTGVAGPLLHRLETRFKEFLLRDDPEGLEDIRPMALSKNMENLA
FT                   IAHFKLNERGDGFEDCSGLGDSFTAANAVACINHARLMSGEPRLSMQDVEVLIACLNAV
FT                   YDDASGSRHTLQEIARGCFAGAGYTIEDADAFFEGICREAAQEFYTGKQLAKAGLPGRP
FT                   A"
FT   gene            309745..310506
FT                   /locus_tag="Aave_0278"
FT   CDS_pept        309745..310506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0278"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: Cupin 2, conserved barrel domain protein;
FT                   SMART: helix-turn-helix- domain containing protein, AraC
FT                   type; KEGG: pol:Bpro_0312 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30885"
FT                   /db_xref="GOA:A1TIU7"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU7"
FT                   /protein_id="ABM30885.1"
FT                   /translation="MYSGATLSCTLRHYGGEHAAHAHDHAQVLVGLQGRMELEVDGRSA
FT                   FVDASCGILIPAGARHGYLASPGARFCVVDAAAQPGMDRLRRFAVPAQARDGLARAIGG
FT                   GAGGAPCLPSLPGVWSAPVAQGGQVAAHLEALLGRAPRVLARRALPLERLQQAVEAALH
FT                   EPWPTPRMAALCHLSPQRFHARWLELIGATPQAWLRGLRLDAAAQRIARGQRLDDAALA
FT                   CGYATGTALASALRRERGTGARALRGDAGRD"
FT   gene            310569..311534
FT                   /locus_tag="Aave_0279"
FT   CDS_pept        310569..311534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0279"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_3308 possible transporter, DME
FT                   family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30886"
FT                   /db_xref="GOA:A1TIU8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU8"
FT                   /protein_id="ABM30886.1"
FT                   /translation="MSSPSQAASPDTPSSATIRLAAQPASRAPLGIGMVLLAAVLWGTT
FT                   GTAQSLAPSGLAPVWVGALRLLIAGAFFAALLRWQGGARGLGALPWRGVLAGGVCVAAY
FT                   NLSFFAGVKASGVALGTAIAIGSGPIWAGLLQTVVQRRWPAAVWWAGTLLGVAGGAAMA
FT                   LDGRTSVQAPPGGIALCLVAGLSYAAYALVNQRLVARAAPGAVNLAVFGSAALLSLPAA
FT                   FAIAGPLAVSARAWGVVLYLGLVATGVAYLLFTHALRHISGATGVTLALAEPVVAFCLA
FT                   VAVVGESPSAMAVWGLAGVIGGLLIVVWSEIRGRRGAAAG"
FT   gene            311674..312528
FT                   /locus_tag="Aave_0280"
FT   CDS_pept        311674..312528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0280"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p;
FT                   3-oxoacyl-[acyl-carrier-protein (ACP)] synthase III C
FT                   terminal domain protein; KEGG: pol:Bpro_0210 peptidase M48,
FT                   Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30887"
FT                   /db_xref="GOA:A1TIU9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIU9"
FT                   /protein_id="ABM30887.1"
FT                   /translation="MPHYDTGCRFCTALRAGPWNARRGFLLAAGAAAAAPALAQVDVGS
FT                   ASQMRRLVPAEQLEAAADQQYDQMLAKAKAQRALAGDTHPQLVRLRGIGQRLIPFSTQW
FT                   NDRARQWKWEVNLIGSKQINAFCMPGGKIAFYTGILDQLKLSDDEAAMVMGHEMAHALR
FT                   EHARARLAKTQATSMGLSLGAQLLGLGDLGNVAANLGTQLLSLKFSRSDETEADLVGLE
FT                   MAARGGYNPESAVTLWRKMGEATGNQGGLAFLSTHPSGPDRIRELEQNVPRVQGLYQAA
FT                   RRG"
FT   sig_peptide     311674..311793
FT                   /locus_tag="Aave_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.953 at
FT                   residue 40"
FT   gene            complement(312556..314073)
FT                   /locus_tag="Aave_0281"
FT   CDS_pept        complement(312556..314073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0281"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: ser:SERP0348 anion
FT                   transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30888"
FT                   /db_xref="GOA:A1TIV0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV0"
FT                   /protein_id="ABM30888.1"
FT                   /translation="MTTSPVPSPSPAAPITSHPEPDSRRKLGYLLLALGLYALVLALPT
FT                   PAGLSPSGQVALGLLVFVVTLWISECVSPANSAVLLTGMAVVGLMGKPLTPGARPMGSA
FT                   DALTVMLGGFSSTAVLLVAAALFLAVALKHTGLDRRVALLVMSRVGISPARLTLGAMLV
FT                   GFVLALFIPSATARVGAVIPIMVGITAALGLPVGSSLGATLMIVTAQACSIFNIAVKTG
FT                   AAQNLISLNFMQGAFGHGVTWGQWFLAALPFTIGMSVVLFFVSLWLLRPEVPDSEDAAG
FT                   NLREQLRALGPVSAPEKRLIAVALLLLVLWSTEGTLHPFDTTTTTQLGIALLLMPRIGV
FT                   MHWAQAEKLVPWGTVVLFAASISLGTLLQRTGAAGWLAQQTLGQLGLAALPVVSVIGAL
FT                   AVFSIVLHLGFASATGLASTLIPIFIAFAQTLPVSKETAFGIVLVQSFVVSFGFILPTN
FT                   APQNMLCYGTGAFGTLQFAKVGLLVTLAGLALILLLSATLWPWMGVL"
FT   gene            complement(314233..314955)
FT                   /locus_tag="Aave_0282"
FT   CDS_pept        complement(314233..314955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0282"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rfr:Rfer_0167 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30889"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV1"
FT                   /protein_id="ABM30889.1"
FT                   /translation="MARRRPSIGGRHTRPLAHPLCRPSSSVPMLHYHTHPVTAFQQNCS
FT                   LVWCDATQAAAVIDPGGDLDQVLAEVERRGLRLEQIWLTHAHIDHAGGAGELAERLSLP
FT                   ITGPHPGDQFWIDGLPQQSAMFGFPPARPFTPTRWLHDGDTVQIGNETLHVRHCPGHTP
FT                   GHVVFHAPQIQRCFVGDVLFAGSIGRTDFPQGNHQDLIDSIVQRLWPMGDETVFIPGHG
FT                   PESTFGRERRSNPYVGGT"
FT   gene            315057..315968
FT                   /locus_tag="Aave_0283"
FT   CDS_pept        315057..315968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0283"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bbr:BB4124 putative enzyme-regulator fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30890"
FT                   /db_xref="GOA:A1TIV2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV2"
FT                   /protein_id="ABM30890.1"
FT                   /translation="MNKPFISLCPEITRAHALLLMDWLEDEGVTRYLSDARDVSRSIGQ
FT                   VVGRVQLPVLTHLFNQGGRFFMACDRHDMPVGFVRLVKDGPDCEMVLAIGDRANWGRRL
FT                   GASAIREGMKLAFFDMRAERLIAKIHPDNARSLKAFLRSGFALHSEGPSVTSLAMGADR
FT                   YLRLLRERPAAGAPAIHVTEIDEARLRQLVAFHQDPEIFELEHEIERATVVDPRQVAED
FT                   VVTMNSRALLEVDNETVEVALVYPQDADEAAGRHSVCSGLGTAILGYREGDAFRWRIAD
FT                   RTRRIRVRKVLYQPEARGDFHL"
FT   gene            complement(316004..316576)
FT                   /locus_tag="Aave_0284"
FT   CDS_pept        complement(316004..316576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0284"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; KEGG: tbd:Tbd_1061
FT                   putative diguanylate phosphodiesterase (EAL domain) with
FT                   GAF sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30891"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV3"
FT                   /protein_id="ABM30891.1"
FT                   /translation="MQTASYAGTCRCLDWAMFLDYNPDDLDVRISELLVATSDSADPEL
FT                   PSAVPAVLRLLRTRLDMDVAFVSQITNGRRTIEAVDHTPGFDPLPAGSSDPVEETWCQH
FT                   VIEGRLPERVENAAAYVKAGKAPDPGYPVGTLLSTPVRLPGGGVYGTLCCFSRGIHPEA
FT                   DIGRLRYTADLLASRLQPGPGKPASAR"
FT   gene            complement(316949..317845)
FT                   /locus_tag="Aave_0285"
FT   CDS_pept        complement(316949..317845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0285"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rso:RSc1152 probable transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30892"
FT                   /db_xref="GOA:A1TIV4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV4"
FT                   /protein_id="ABM30892.1"
FT                   /translation="MKTTLEELQAFAAVVDAGSVTAAAAQLEQTASGVSRALARLEKKL
FT                   DTTLLRRTTRRIGLTEEGQAFLTRTRAILAALDEAEEHMAARRGQPAGRLRVNAATPFM
FT                   LHVVAPLVPAFRDAYPQIALELDTDERNIDLLERRTDVAIRIGALRDSTLHARPLGSSR
FT                   LRVLASPAYVATHGRPKSAAALAQHTLLGFTQPEALNLWPLRGPHGDAWAATPDIAASS
FT                   GETLRQLALQGTGIACLADFMTARDRERGDLVQLLARDTADVRQPISAVYYRNTQLASR
FT                   IACFLDFLAARLAEPGH"
FT   gene            317959..319161
FT                   /locus_tag="Aave_0286"
FT   CDS_pept        317959..319161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0286"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc1153 putative transmembrane efflux transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30893"
FT                   /db_xref="GOA:A1TIV5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV5"
FT                   /protein_id="ABM30893.1"
FT                   /translation="MPIALFALTLGAFAIGTTEFVIVGLLPTVAADLGIGLPSAGLLVS
FT                   LYALGVAVGAPVLTALTGRLPRKALLLALMALFTAGNLLAWQAPGYGTLVAARVLTGLA
FT                   HGVFFSIGSTIATGLVPREKAASAIATLFAGLTLALVTGVPLGTFIGQHFGWRETFLAV
FT                   AGLGMLAFAGSALFVPRRIAHVPPASLLQQARVLAEPRLLLVYAKTAIGYGGTFIPFTF
FT                   LAPILTGVSGFSESAVGWVMLVYGVSVAAGNLWGGRLADRLGPVAALRIIFALLAAVLL
FT                   LLQFTAPHPWLAVGTVLLWGAVAFGNVPGLQLYVVRQAERVAPQAVDVASGLNIAAFNL
FT                   GIAGAAWAGGLIVTHLGLMHTPWIGAVVVLGALALTQASGVLDARGGAAARGGRPAAAG
FT                   H"
FT   gene            319244..320077
FT                   /locus_tag="Aave_0287"
FT   CDS_pept        319244..320077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0287"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rso:RSc1154
FT                   putative reductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30894"
FT                   /db_xref="GOA:A1TIV6"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV6"
FT                   /protein_id="ABM30894.1"
FT                   /translation="MQASASPSTQPPVPPFGLGTFRLKGQAAIDSVANALDLGYRHVDT
FT                   AQIYGNEAEVGQAVAASGVARGDLYLTTKVWTDHLAASRLVPSLEESLEKLRTDYVDLA
FT                   LIHWPSPGGAVPLAESLEALADARARGLVRRIGVSNFTVALLREAVAAVGAESIATNQI
FT                   ELHPYLQNRAVVDFARSQGIHITSYMTLGYGQMLQDAEIQAIAQACGATPAQVALAWAM
FT                   QSGFAVIPSSTRREHLASNLRATQLRLEDAHMQRIAALDRGGRLVDPEGLAPAWD"
FT   gene            complement(320103..320897)
FT                   /locus_tag="Aave_0288"
FT   CDS_pept        complement(320103..320897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0288"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rfr:Rfer_3929 exodeoxyribonuclease III;
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30895"
FT                   /db_xref="GOA:A1TIV7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV7"
FT                   /protein_id="ABM30895.1"
FT                   /translation="MTSLNLNGIRSAASKGVEAWIAETRPDCICVQEIKAQSADIEGRF
FT                   ETLAGLKGHFHYATKKGYSGVGIYTRHEPSDVRVGYGSTEFDAEGRYVEARFDTPSRKL
FT                   SIISAYFPSGSSGPERQLAKFRFLAEFHVHLMRVKEEREFILCGDVNIAHQQIDLKNWR
FT                   SNQKNSGFLPEEREWMTKLLHKTDPGGGLVDVYRLLQPDTTETAYTWWSNRGQAYANNV
FT                   GWRLDYHLATPAIAALARTESIYKQQKFSDHAPITVGYELAI"
FT   gene            320917..321636
FT                   /locus_tag="Aave_0289"
FT   CDS_pept        320917..321636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0289"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: pol:Bpro_0217 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30896"
FT                   /db_xref="GOA:A1TIV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV8"
FT                   /protein_id="ABM30896.1"
FT                   /translation="MVADGARRRTGEETAGDGASADRLAQEFVHFAVEAGVLRFGEFKT
FT                   KAGRMSPYFFNAGLFDDGAKMGRLAEFYAKALLASGIEFDMVFGPAYKGIPLAATVAVE
FT                   LARHGRNVPFAYNRKEAKDHGEGGTLVGAPLQGRVLIVDDVMSAGTAARESIALIRAAG
FT                   AIPHAMAIALDRQEKATENGQDVDHSAVQYVRSQLGMQVCTIAKLADLLQYLQDRGGSD
FT                   MGAHHERVLAYRQRYGV"
FT   gene            321716..322405
FT                   /locus_tag="Aave_0290"
FT   CDS_pept        321716..322405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30897"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIV9"
FT                   /protein_id="ABM30897.1"
FT                   /translation="MEALPVKQLSLWRAGAGAALAFLCGVAAQAQQQPGPGGIYTCVDA
FT                   KGRRLTADRPIPECSDREQRVLGPSGTERSRVGPTLSDQERTALEAQRRKEADERARAA
FT                   EERRRERVLVARYPDQVAHDAERAAAIAQVNEVTAVAEARVAELRRQRKALDAEMEFYR
FT                   RDPSKAPMALRRQIAEQEESLAQQQRFIASQEDEKRRVHQRFDAELAHLRQLWAAQQGM
FT                   PAVPASR"
FT   sig_peptide     321716..321808
FT                   /locus_tag="Aave_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.955 at
FT                   residue 31"
FT   gene            complement(322440..323894)
FT                   /locus_tag="Aave_0291"
FT   CDS_pept        complement(322440..323894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0291"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: rfr:Rfer_3926
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30898"
FT                   /db_xref="GOA:A1TIW0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW0"
FT                   /protein_id="ABM30898.1"
FT                   /translation="MTTSKLIHGYEVVIGFETHAQLATQSKIFSRAPTAFGAEPNTQAC
FT                   AVDLALPGTLPVMNREAVACAIRLGLALGSRVAPESIFARKNYFYPDLPKGYQISQFEI
FT                   PVVQGGEVSFYLGDEKKTVRLVRAHLEEDAGKSLHEDFIGQSGIDLNRAGTPLLEIVTE
FT                   PDIRSSEEAVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRRPGAPLGTRREIKNL
FT                   NSFRFMQQAIDYEIRWQIEQIEDGHAIQQATVLFDPDTGETRAMRTKEDAADYRYFPDP
FT                   DLPPLRISEQWVQEERARMPELPRTMAARFVADYGLPEYDATTLTQSKAMAAYFEEAAR
FT                   ASGSPKLASNWIMGEVSRRVNAGETDIAAAPVTAALLAKLIQRIADGTISNAAARQVFE
FT                   ALWTGEGTDVDAVIETRGLKQMNDSGALEKIIDEVIAANPDNVAQFKAGKGKAFNALVG
FT                   QAMKASKGKANPQQVNEMLRARLAAA"
FT   gene            complement(323896..325395)
FT                   /locus_tag="Aave_0292"
FT   CDS_pept        complement(323896..325395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0292"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: rfr:Rfer_3925
FT                   glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30899"
FT                   /db_xref="GOA:A1TIW1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW1"
FT                   /protein_id="ABM30899.1"
FT                   /translation="MSEPSSSLHTLGVAELAAALRGKRISAVEAARHFLARIQQHTDLG
FT                   AFVSVNEEATLARARVQDAAIAAGTAGPLAGVPIAHKDIFVTRDFPSTAGSKMLAGYQS
FT                   PFDATVVTRLADAGAVTLGKLNCDEFAMGSANENSAVAPLGADAPAPVRNPWATDRVPG
FT                   GSSGGSAVAVAARLAPAVTGTDTGGSIRQPASFCGITGIKPTYGRASRYGMIAFASSLD
FT                   QAGPMARSAEDCALLLSAICGPDPDRDSTSLDVPAEDFSAKLGDSIDGLRIGIPAEFFG
FT                   EGLAPDVRAAVDGALKEYEKLGAKLVPITLPRTELSIPVYYIIAPAEASSNLSRFDGVK
FT                   FGHRARDYTDLVDMYKKTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKIRRMIAD
FT                   DFQNAFRDCDLIAGPVAPTVAWKLGEHGNDPLADYLADIFTLPASLAGLPGMSVPAGFG
FT                   EGGMPVGLQLIGNYFQESRLLNAAHRLQQATDFHLRTPGGL"
FT   gene            complement(325418..325717)
FT                   /locus_tag="Aave_0293"
FT   CDS_pept        complement(325418..325717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0293"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: rfr:Rfer_3924 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30900"
FT                   /db_xref="GOA:A1TIW2"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TIW2"
FT                   /protein_id="ABM30900.1"
FT                   /translation="MALTPQDIGRIANLARLELSPAESERMLTQLNGFFGIVEKMRAVD
FT                   TAGLEPLSHPVAAIQDIALRLREDTASEPDQREANQRSAPAVERGLFLVPKVIE"
FT   gene            325924..326967
FT                   /locus_tag="Aave_0294"
FT   CDS_pept        325924..326967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0294"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: pol:Bpro_0222 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30901"
FT                   /db_xref="GOA:A1TIW3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW3"
FT                   /protein_id="ABM30901.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARDKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGHEAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTL
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATAVYLIEEPMAAGIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDKFDEAIISYIRRNYGMLIGEPTAEAIKKS
FT                   IGSAFPGSEVREMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNQIVSSVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRQ
FT                   GSIFTSE"
FT   gene            327101..328021
FT                   /locus_tag="Aave_0295"
FT   CDS_pept        327101..328021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0295"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: pol:Bpro_0223 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30902"
FT                   /db_xref="GOA:A1TIW4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW4"
FT                   /protein_id="ABM30902.1"
FT                   /translation="MPIGTLERTAPSFFKQGPSPRARFALCGALALFLMVADARFHVTE
FT                   PLRKAIAVALYPVQWVMLQPVEFVGGGIAYLRTMESAQAEVDTARRNMVAMAQRANQAE
FT                   QLLQENERLRKLLQLRDRLQTPAKAAQVIYDAADPYTRRVMIDQGQMAGIVLGSPVMDE
FT                   SGMLGQVTRVHPLLSEVTLLIDRDQAIPVMNLRTGARGVAYGDPVIAHGGGMELRFMPS
FT                   NADVQEGDLLTTSGVDGLYPPGLPVARIVRVERRADSAFARIYCAPLAQAQGARHVMVL
FT                   QPLDAGLPERPPATEPAPARKGGRR"
FT   gene            328018..328536
FT                   /locus_tag="Aave_0296"
FT   CDS_pept        328018..328536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0296"
FT                   /product="putative rod shape-determining MreD transmembrane
FT                   protein"
FT                   /note="KEGG: pol:Bpro_0224 putative rod shape-determining
FT                   MreD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30903"
FT                   /db_xref="GOA:A1TIW5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW5"
FT                   /protein_id="ABM30903.1"
FT                   /translation="MIMPRGEQLLLPVRPAFIAASLLVALAFNMLPLGRLVWTPDLVMV
FT                   LLVFWGVHQPQRVGMAVAFAMGLCMDVYQTALLGQHALAYCAMMFGAIYLHRRLLWFSP
FT                   FSQALQVLPLFLAAHAIELLVRMVSGGILPGLPGLISPVIEALLWPLASWVLLAPQRLP
FT                   PDRDENRPL"
FT   gene            328568..330514
FT                   /locus_tag="Aave_0297"
FT   CDS_pept        328568..330514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0297"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   pol:Bpro_0225 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30904"
FT                   /db_xref="GOA:A1TIW6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW6"
FT                   /protein_id="ABM30904.1"
FT                   /translation="MTELRNTEADLSRFRLRVLVVGFVVLLAMCLIVARLLVLQVVRHE
FT                   DLADQAESNRTAVVPIVPNRGLILDRNGVVLATNYSAYTLEITPSKVDGLEETIDALSN
FT                   IVEIHARDRRRFKRLMEESRSFESLPIRTRLSDQEVARFTAQRYRFPGVDIKARLFRNY
FT                   PLGETASHAIGYIGRINQREKERIEDSEDAANYRGTDHIGKLGIEQSQETTLHGQTGVE
FT                   RMETSAGGHAVRRLASHPATPGNTVMLSLDIKLQKLVEDMFGDRRGALVAIDPRNGEVL
FT                   ALVSKPTFDPNLFVEGIDSENWQALNESIDKPLLNRALRGTYPPGSTYKPFMALAALQL
FT                   NKRSPTQVYNDPGFYTYGGHTFRSHEGGLGGVDMVRAIQFSSNTYFYSLAVDMGVDTIH
FT                   DFMKPLGFGQLTGIDLNGEVRGVLPSTEWKRNAYKRPEMKRWYSGETVSLGIGQGYNSF
FT                   TMLQLASAEATLANGGIRYRPHLVKAVRDTVTGVVTEVAQPPGENLGYSPRNLEIVRNG
FT                   LVAVIKAGTGTRVFAGAPYTAAGKTGTAQAVSLGQNVKYNAKLLEEHQRDHSLFAAFAP
FT                   AENPRIAVAVIVENAGFGAAAAAPIVRRVFDYWLQGDYPNEQDLAAVAKGQAGAPMGTP
FT                   RRAADVPVMAPAP"
FT   gene            complement(330540..331433)
FT                   /locus_tag="Aave_0298"
FT   CDS_pept        complement(330540..331433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0298"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: ttj:TTHA0012 conserved hypothetical
FT                   protein, integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30905"
FT                   /db_xref="GOA:A1TIW7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW7"
FT                   /protein_id="ABM30905.1"
FT                   /translation="MRSERQGLLALLLVTMVWGTTFPAMKMLSAHLDALQIIWMRFAIA
FT                   LAVLGPMWRGMRRAELGWGLLLGALLFLAFWLQIEGLARTSSNRNAFVTGLNVLVVPLL
FT                   AMAALGRRYGWTLWAACGMALAGMALMFHENEPWNLGDTLTLASTVFYAIYILALEECA
FT                   RLTAAAPLRATRMAAMQALVMFGAATVLVGVRHGGYATSVVQIAQLPGDAWTAVAYLGV
FT                   VASVLVVTLQAWGQQRVDAMRSAIVFGLEPVFAALTAWVLIGERLGWAGVCGAALIVGA
FT                   LIASQLQPPRSPQATG"
FT   sig_peptide     complement(331353..331433)
FT                   /locus_tag="Aave_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.646 at
FT                   residue 27"
FT   gene            complement(331536..332294)
FT                   /locus_tag="Aave_0299"
FT   CDS_pept        complement(331536..332294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0299"
FT                   /product="amino acid ABC transporter ATP-binding protein,
FT                   PAAT family"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: pol:Bpro_0403 ABC transporter-related
FT                   protein; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30906"
FT                   /db_xref="GOA:A1TIW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW8"
FT                   /protein_id="ABM30906.1"
FT                   /translation="MTHPHATPPTPYIVAENVCKAFGTHQVLKDVSTVFNTGEVTVIIG
FT                   ASGSGKSTLLRAINRLEPHDSGRIAIGGVEVTDDQRALQQQRSEVGMVFQQFNLFGHLS
FT                   VLDNVTLAPRRIHRTPRAEANEQALQLLRRVGLRDHAHKYPWQLSGGQQQRVAIARALA
FT                   MRPKVMLFDEPTSALDPEMVQEVLDVMRELARGGMTMIVVTHEMGFAREVADRVMFFDQ
FT                   GRIAHDAPPAEFFANPANDRIRAFLGRMGG"
FT   gene            complement(332291..333073)
FT                   /locus_tag="Aave_0300"
FT   CDS_pept        complement(332291..333073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0300"
FT                   /product="amino acid ABC transporter membrane protein, PAAT
FT                   family"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_0402 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30907"
FT                   /db_xref="GOA:A1TIW9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIW9"
FT                   /protein_id="ABM30907.1"
FT                   /translation="MLTALWPRHWSRQQRSNATLVSALVLMVLALALLGQALSFLPDPI
FT                   GPNAQAFADGARTTLWLTLVSGLCGLVLGTGAALARTARWTPLRWAARFYIWVIRGTPL
FT                   LVQILFVYFALPVLVPGLNLPDFAAAVVALGLNVGAYNSEAIRAGLLAVPRGQTEAARA
FT                   LGLSRTHVFFDVVFPQAFKISLPPLVSNFVALLKDSSLAYAIGVVELTNVGNRIQSATF
FT                   QPIATLSTVAVTYLLLTTLVTQVSNAIEHRFDVEGRAQ"
FT   sig_peptide     complement(332966..333073)
FT                   /locus_tag="Aave_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.346 at
FT                   residue 36"
FT   gene            complement(333112..333879)
FT                   /locus_tag="Aave_0301"
FT   CDS_pept        complement(333112..333879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0301"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: pol:Bpro_0401 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30908"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX0"
FT                   /protein_id="ABM30908.1"
FT                   /translation="MKILKTMATAAVALCAAFSAQARPIDAIQKDGKIIIATEGQFAPF
FT                   NYFNGTQLTGFEVEVANLVAKKMNLKVEWKTLGFDALLTGLGQDRWDVAIASHGVTEER
FT                   SKAVTFAAPHYCSGGMVIAMDPAIRTGKDLAGKVVAVQTGTSYLENVKKVPGVKDVKNF
FT                   PTDVDARSALTSKRVDAWVTDKFVAKEVAAKNPKAGLKLGDMLFIEKMAPAVAKGNTGL
FT                   ADAWNKAFAEILADGSYAAVSKKYFNEDVRCAP"
FT   sig_peptide     complement(333811..333879)
FT                   /locus_tag="Aave_0301"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(334070..335458)
FT                   /locus_tag="Aave_0302"
FT   CDS_pept        complement(334070..335458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0302"
FT                   /product="L-serine ammonia-lyase"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: pol:Bpro_4369 L-serine dehydratase 1; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30909"
FT                   /db_xref="GOA:A1TIX1"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX1"
FT                   /protein_id="ABM30909.1"
FT                   /translation="MAISVFDLFKIGIGPSSSHTVGPMRAARLFTHALEHQGLLAATRR
FT                   VEAELYGSLGATGKGHGSDTAVLLGLAGHEPDTVDVDRTGGYVADIRTGGRLPLAGHHP
FT                   VAFDERRDLRFYALKTLPFHANGLRFAARSDSGDLLHEATYYSVGGGFVVSEAVAADGS
FT                   RHKVVAPDPSVLPLPFGDAADLLRLTAMHGLDIAGVMRVNERHWRTDAEIDAGLLAIWR
FT                   AMQGCVERGCRTEGLLPGGFKVKRRAAALARRLGDFEPRPADPLRVLDWVNLWALAVNE
FT                   ENAAGGRVVTAPTNGAAGIVPAVLHYYVHTAPGASERGVVDFLLTAGAIGILYKQNASI
FT                   SGAEVGCQGEVGVACSMAAGALCAALGGTPAQAENAAEIGMEHHLGLTCDPVGGLVQIP
FT                   CIERNAIASVKAINAARMALHGDGTHFVSLDQVIKTMRETGADMLTKYKETARGGLAVN
FT                   IVEC"
FT   gene            335581..336504
FT                   /locus_tag="Aave_0303"
FT   CDS_pept        335581..336504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0303"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4368 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30910"
FT                   /db_xref="GOA:A1TIX2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX2"
FT                   /protein_id="ABM30910.1"
FT                   /translation="MDMNRLRALRELARCGTMAAAAEALALTPSAVSQQIAQLEAEAGI
FT                   ALTERQGRGVRLTPGGEALVRHAERLMAVLDEAKSELALLRRELAGELRVAAFPSIASA
FT                   LLPETIQALRAAYPRLRLAVEEMEPADGLAALGSWRADIALIDHLALRRDRRQDGYGFV
FT                   ALARDSLHVLLPATHPLAARPWLGVADLRDEPWAMDAASSSFGEFVRNLCLAEGFEPRM
FT                   DVRALGFEVVSAMVGAGCAVTVVPGLRLLRLLPGTRAVPLRPAVAREISVAFRRGERDH
FT                   PAVKVFIGEIVRAAERLSRPAGDVTS"
FT   gene            complement(336494..337252)
FT                   /locus_tag="Aave_0304"
FT   CDS_pept        complement(336494..337252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0304"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rfr:Rfer_3919 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30911"
FT                   /db_xref="GOA:A1TIX3"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX3"
FT                   /protein_id="ABM30911.1"
FT                   /translation="MEWIIVSLASLLAGFVDAIVGGGGLILVPALFATFPNAPPATLLG
FT                   TNKSGSIWGTAIATWQYSRRVQIRWQSLLPAAAAGFAGGFAGAWTVTVVPVDFLRRILP
FT                   FILLAVLLYTLARKDLGKHHAPRFEGAAETRMACLIGLAIGFYDGFFGPGTGSFFVFLF
FT                   VRLLGYDFLNASASAKLLNLATNVAALILFTAKGQVWWHFALPLAVANVVGSVLGTHMA
FT                   MKHGTGFVRGIFILVVGALILKTGYDGFMR"
FT   gene            complement(337555..339249)
FT                   /locus_tag="Aave_0305"
FT   CDS_pept        complement(337555..339249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0305"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: pol:Bpro_0229
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30912"
FT                   /db_xref="GOA:A1TIX4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX4"
FT                   /protein_id="ABM30912.1"
FT                   /translation="MSDTSFDFIVIGGGTAGALLCNRLSADPRHRVLLVEAGRKDDYHW
FT                   IHIPVGYLYCIGNPRTDWLYQTEPDEGLNGRSLRYPRGKTLGGCSSINGMIYMRGQARD
FT                   YEQWAEITGDDTWRWESVLPAFRRHEDHWRLDRPDTASEAFRQLHGSKTTGGSGEWRVE
FT                   RQRLRWDVLDAFARAAQEAGIPATDDFNGGTNEGVGYFEVNQKNGWRWNTAKAFLRPTC
FT                   YGRPNFEMWTGAQAARLLLECLPDGTSRCTGVEVWNGSEMVTAHAARDVILSAGAVNSP
FT                   QLLQLSGIGPGELLQSHGIPVAHDLPGVGGNLQDHLQIRAVFKVNGVPTLNTLAGNLWG
FT                   RARIGLEYALKRTGPMSMAPSQLGAFTRSAPGQPHPNIQYHVQPLSLDAFGEPLHTFPA
FT                   FTASVCNLNPTSRGTVRIRSPRFQDAPAIAPRYLSTPEDRQVAADSLRVTRRIVAQPAL
FT                   APYRPEEWKPGPQYQTDEELARLAGDIATTIFHPVGTTRMGADGDPAAVLDARLRVRDG
FT                   RGGTIAGLRVVDAGAMPTITSGNTNSPTLMIAEKAAEWLRDEARAGG"
FT   gene            339565..340692
FT                   /locus_tag="Aave_0306"
FT   CDS_pept        339565..340692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0306"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pol:Bpro_0230 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30913"
FT                   /db_xref="GOA:A1TIX5"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX5"
FT                   /protein_id="ABM30913.1"
FT                   /translation="MSDSPPRIERNDTPEGPVAALHGRWGAADLGARRTWREVSAQLAQ
FT                   NAPDSGLGWDLRSVDWLDHVGAQLLWNHWGRVWPERIALDDAQRDMLDRVAEFTVIDRP
FT                   PVPPWRLVEEVDRLGVKVLHALGHGRHLLELVGQLVIDLGSALRAPRRAPWRDVSGHLY
FT                   RMGATALPITAIVGFLIGVVLAYLMSLQLRQFGAESFIVNILGISLIRELGPMLAAILV
FT                   AGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRAVALAIAMPLIAVWTTLCAL
FT                   AGGMLAADIAMDVSPAYFVQALPNAVGFSNLVLAMAKSVVFGVGIALIGCHWGLRVKPN
FT                   TQSLGEGTTASVVNAITMVIIVDALFAIAFKNLGI"
FT   gene            340695..341570
FT                   /locus_tag="Aave_0307"
FT   CDS_pept        340695..341570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0307"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: pol:Bpro_0231 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30914"
FT                   /db_xref="GOA:A1TIX6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX6"
FT                   /protein_id="ABM30914.1"
FT                   /translation="MTRDAAEDAIATGPAAAPEPPPKDAPPVVEIRGLSTVFGKGDEAF
FT                   AVHENLDLTVRRGEILALVGGSGTGKTVLLRQMLGLTRPAKGSVTVLGRPASEMGRAGA
FT                   ASRVGMLFQHGALFSAFSVLDNVAFALREQGTLPKDLICDAAMVKLRMVGLKPEHATRM
FT                   PSDLSGGMIKRVALARALVMDPPLLLLDEPTAGLDPNSSDEFCELLRELHAALGLTVVM
FT                   VTHDLDTLFALSTRVAVLAEKRVITSGTPQEVTRFEHPFIQHFFLGERGRRAMAPAPSA
FT                   PPAAAPGQEA"
FT   gene            341570..342550
FT                   /locus_tag="Aave_0308"
FT   CDS_pept        341570..342550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0308"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rfr:Rfer_3915 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30915"
FT                   /db_xref="GOA:A1TIX7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX7"
FT                   /protein_id="ABM30915.1"
FT                   /translation="MENKSHALAAGIFVVVVAALLAALGLWLTRDRASYQLYELSTRES
FT                   VGGLQPQAAVRYKGVAVGKVTRIGFDPDVPGNVLIRIAVNDQAPVTPATFAVLGYQGVT
FT                   GLAHVLLDDGNGPQPALPRGASGLPRLPLKSSPFSQLAEQGPAILAQVQQATDRINDLL
FT                   GDENQKRFSLALENLGQAAGSANALMKRLDATVEQRLDPALASVPAVASDARETLKALR
FT                   QAGTNAGDAANEVKAAVRKLSAENGPLDQIADSSQSLSLAADRFGRVTLPRLNHAADET
FT                   SRAARRLGRAASGFSDNPQSLIYGPGRAAGGPGEPGFEAPAVAAP"
FT   sig_peptide     341570..341638
FT                   /locus_tag="Aave_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.710 at
FT                   residue 23"
FT   gene            342630..343292
FT                   /locus_tag="Aave_0309"
FT   CDS_pept        342630..343292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0309"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pol:Bpro_0233 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30916"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX8"
FT                   /protein_id="ABM30916.1"
FT                   /translation="MAHHAVNTRARGLWTALAAAALMAGCSALPAPPPRADVYDFGPGT
FT                   LAQAPGERGAPLPPIALPEVAVAGPVEGSTAVLYRLAYDDPRHLRPYGQARWSQPPAQL
FT                   VQQALRDQLGLRRAVLMGEEGAAQLVDTGKPPAVLRVEIEEFSQVFQAPKASTGVLRLR
FT                   ASLADSTQAGEKLVAQRVFVIQRPAPTPDARGGTHAMAEAAAQAARDVAAWVEQAGR"
FT   sig_peptide     342630..342740
FT                   /locus_tag="Aave_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.780 at
FT                   residue 37"
FT   gene            complement(343332..344780)
FT                   /locus_tag="Aave_0310"
FT   CDS_pept        complement(343332..344780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_3221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30917"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIX9"
FT                   /protein_id="ABM30917.1"
FT                   /translation="MHPASTDRPTRPVQGHRSHGDMFSIVRHLSFLSTRRDPGNVQAAS
FT                   GASGNGVVFSRSKKALGGSDVGMVGKIDGEEHLVKTGISRSLLGQAVALCAKGQVAEAN
FT                   KRLGYIVSAWDRLVEGGTAKGALERELTGAFHGFLQSEKGRKLAEKAKVDELDIDDVSD
FT                   VHASLVRADPQLRNPLGIPVIFDVINVAAAQDMVNALQGTYLARHHIPDSSLLTVENNA
FT                   LIASRLIPDATPLDVFLTQPFLPDGVSLAEAKRAASLIKTAAAGNRVKPDELARAQALV
FT                   SHINDPANLSSGQQALSEALRQKGLDGLFISLLTRLTLGESSDLGPDNMLVVPGADGRH
FT                   QVVNIDVTGFRYDREEDATASPRDPVRHGWGKVIENPELALNVLLDRSVLNSRYAKGLD
FT                   PVHEAVVDCMREALRPHATPEAATVKRWYASLDIDGSTASLLSLRQGLGRLSGCSWMPD
FT                   ADLVDRVLVRNASFIDNIVQKCRM"
FT   gene            345166..345789
FT                   /locus_tag="Aave_0311"
FT   CDS_pept        345166..345789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0311"
FT                   /product="phosphoadenylylsulfate reductase (thioredoxin)"
FT                   /EC_number="1.8.4.8"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: mfa:Mfla_1679 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30918"
FT                   /db_xref="GOA:A1TIY0"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY0"
FT                   /protein_id="ABM30918.1"
FT                   /translation="MSSIDLDWINAELGHNAQGLVDWAIGLGQPAIVTTNFRPFEAVIL
FT                   HMCTRARPDIPVVWMDNGYNTEATYRFADEVTRQLGLNLRIYLPLRSRAHREAVDGPTP
FT                   ALDDPRHAAFTQEVKLEPFARALRETAPKVWFTALRATDTAVRARMDPVSLNPDGLIKV
FT                   APLLHWSSKDLYEYCQAQGLPNNFDYVDPTKGEDNRECGLHLAH"
FT   gene            346021..346239
FT                   /locus_tag="Aave_0312"
FT   CDS_pept        346021..346239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0312"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: pol:Bpro_1152
FT                   CsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30919"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY1"
FT                   /protein_id="ABM30919.1"
FT                   /translation="MNEDTIKGNWKQFTGKIKEQWGKLTDDDLDVVAGKRDQFLGKLQE
FT                   RQGLARDAAEEELKAWQERHPDFRFDK"
FT   gene            346311..346889
FT                   /locus_tag="Aave_0313"
FT   CDS_pept        346311..346889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30920"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY2"
FT                   /protein_id="ABM30920.1"
FT                   /translation="MKHARNLLALAVAGLLATSGMAMTKEEHKAANDRISADYKAAKVK
FT                   CDGMTGNAKDVCQKEAKGNEKIAKAELEAQYKPSDKNTYKVAEARADAAYDVAKEKCDD
FT                   LQGDAKSVCQKDAKAAHVKAKEDAKVARAQAKPADTMTEKNAKVAETKKDAAEEKREAD
FT                   YKAAKERCDTMNGDAKDKCVADAKRMYNQ"
FT   sig_peptide     346311..346385
FT                   /locus_tag="Aave_0313"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.836 at
FT                   residue 25"
FT   gene            347096..347611
FT                   /locus_tag="Aave_0314"
FT   CDS_pept        347096..347611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0314"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   reu:Reut_A0820 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30921"
FT                   /db_xref="GOA:A1TIY3"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY3"
FT                   /protein_id="ABM30921.1"
FT                   /translation="MAALQWSEGLALDLPLMDETHEEFVALLAAVEQAGDEALLPAWRA
FT                   LVAHTTEHFAREDAWMAATRFASGNCHSLQHKVVLQVMGEGTARAEAGESAVLRHMAGE
FT                   LAVWFPQHTQTMDAALALHLRRVGYDPASGTVHAPGALPAEPIHGCGGACSSDSTGPET
FT                   ESRAATAA"
FT   gene            complement(347711..348034)
FT                   /locus_tag="Aave_0315"
FT   CDS_pept        complement(347711..348034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30922"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY4"
FT                   /protein_id="ABM30922.1"
FT                   /translation="MSGDTAAIADAARRSAAAWSGYLSSWQEPGAATAPALLGPEETAR
FT                   LERYRDRLLAAWEARDRDALRSAKQAVLQTARMRPAPSPVFTQAMRLLAWRMAALRLGR
FT                   SRL"
FT   gene            complement(348031..349440)
FT                   /locus_tag="Aave_0316"
FT   CDS_pept        complement(348031..349440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0316"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   pol:Bpro_0235 inner membrane CreD"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30923"
FT                   /db_xref="GOA:A1TIY5"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY5"
FT                   /protein_id="ABM30923.1"
FT                   /translation="MKHPFLAKAAALVAVTLLLLFGLGMIDNIVRDRQHYRSEATRSVA
FT                   QSLAGPQTLLGPVLHSACVETWDAVTGKGEERRTTEQRREFLLTAMPESLQVRSGAAMQ
FT                   QLSRGLHQVNAYTLQAHVTARWATLADLRPHATVEGSRMQCGAPILMLAVGDARGIRAA
FT                   RVEVDGQPLALKPGTFHPTYTRGLHTPLPESLRGRGEPLSVSVDLELVGTERLSIVPLG
FT                   GNTDVQLQSSWPHPSFGGRFLPSERTIGDDGFTARWHLSALATTAQQDVAASRRLCEIG
FT                   GDTAPYEPPAAAEAGCADAFGVSFIDPVNPYSLSDRATKYGVLFIALTFVAVGLFELLQ
FT                   QLRVHPVQYLLAGSALCSFFLLLVSLSEHLPFGTAYAAAAGACVLLLTYYACHMLRSVR
FT                   RGLPFGAGIALLYGLLYLLLQLEQTALVVGALLLFAVLAFVMVATRKLDWYALSSGGRA
FT                   LPSTARTEAGQ"
FT   sig_peptide     complement(349366..349440)
FT                   /locus_tag="Aave_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.625) with cleavage site probability 0.556 at
FT                   residue 25"
FT   gene            complement(349588..351039)
FT                   /locus_tag="Aave_0317"
FT   CDS_pept        complement(349588..351039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0317"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase, HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: pol:Bpro_0236 periplasmic
FT                   sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30924"
FT                   /db_xref="GOA:A1TIY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY6"
FT                   /protein_id="ABM30924.1"
FT                   /translation="MRLGLRLLFAFFLINGIAAFFVLRVFTAEIKPSVREVMEDMMVDT
FT                   ANLLAELASDDLASGRLAAGAQNSDFARHVQRYASRPVDASIWGLSKQTLDFRIYVTDA
FT                   RGRVVFDTERRAVGDDYSQWRDVARTLRGEYGARATRDVQTDDTSGVMYVAAPIWIDGP
FT                   PGGERRIGGVLTVAKPTRTVQRFIDRAERKVLQGGLLLLALSAAVGVAVTVWTVWHVRR
FT                   LRDYALSVQAPGDGGGPPPAVPRVPGELGDLARAMDHMRERLAGRDYIEGYVRALTHEL
FT                   KSPVAAIRGAGELLQDDLPGDDRRQFAAQVVDQSERLQRLVDRLLELSKLEQRQHAEAG
FT                   AAPVALRACAEAALRQCEARASQRGVRLQLEGDGGSGPWEAELITLALGNLIDNAIDFS
FT                   PEGGTVRVVLDGAAASVQDEGPGVPDYALPRLGERFFTTARPDGTRSGSGLGLAIVKRV
FT                   MALHGGRLDVASTARGLRATLVLAG"
FT   sig_peptide     complement(350956..351039)
FT                   /locus_tag="Aave_0317"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.922 at
FT                   residue 28"
FT   gene            complement(351096..351779)
FT                   /locus_tag="Aave_0318"
FT   CDS_pept        complement(351096..351779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0318"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pol:Bpro_0237 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30925"
FT                   /db_xref="GOA:A1TIY7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY7"
FT                   /protein_id="ABM30925.1"
FT                   /translation="MAARLLLVEDDPAIARTVAYALERDGLAVSHSLLLGDARGLLRAH
FT                   RFDLLVLDVGLPDGSGLDLLRELRQQGSALPVLMLSAHGEEIDRVLGLELGADDYLPKP
FT                   FSPRELAARAKALLRRAAAPAAAPASPVTGPFHDDAAGQRMHLHGRPLALTRREYRLLS
FT                   QLLAGAGRIHTREALLAGAWGGDSESTDRTVDTHIKTLRAKLREADPSREYIHTHRGMG
FT                   YSLEV"
FT   gene            complement(351782..352417)
FT                   /locus_tag="Aave_0319"
FT   CDS_pept        complement(351782..352417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0319"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: pol:Bpro_0238 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30926"
FT                   /db_xref="GOA:A1TIY8"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY8"
FT                   /protein_id="ABM30926.1"
FT                   /translation="MDLKPLITLLAIVNPLAIVPFFIHYTDGFSPRQRRRTIQVAAFSA
FT                   FCVIAACALLGLQILEFFNISLQSFQVGGGMLLLISAMNMLNAQPAEAKPHTHELEEGA
FT                   EKAAQGDSIAVVPLTIPLLTGPASMSTVVIYADRAQTVWQHLALVGYGVVIALATAVCF
FT                   ALADPIARVLGKTGINVMTRLMGLILAALAVEVMADGLGKLFPVLVAR"
FT   gene            complement(352436..353185)
FT                   /locus_tag="Aave_0320"
FT   CDS_pept        complement(352436..353185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0320"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   pol:Bpro_0239 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30927"
FT                   /db_xref="GOA:A1TIY9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIY9"
FT                   /protein_id="ABM30927.1"
FT                   /translation="MDKKVVLVTGGSRGIGAATARLAARHGWAVAVNYARDAAAAGRVV
FT                   DAIREEGGDAVAIQADVADESQVVALFEAVDAQWGRLSGLVNNAGVVDVPARVSEMSGQ
FT                   RLRRMFDINVLGSFYCAREAVRRMGLQRGGQGGSIVNVSSAAARLGAAHQYVDYAAAKG
FT                   AIDVLTVGLAREVAAEGIRVNAVRPGLIDTEIHASGGLPDRVRDLAHQVPMGRGGTPEE
FT                   VAESIVWLLSDAASYTTMSLLDVSGGR"
FT   gene            353322..354011
FT                   /locus_tag="Aave_0321"
FT   CDS_pept        353322..354011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0321"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: pol:Bpro_0241
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30928"
FT                   /db_xref="GOA:A1TIZ0"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ0"
FT                   /protein_id="ABM30928.1"
FT                   /translation="MGSFVDLASADGFKVPAWVARPEGRARGAVVVLQEIFGVNSHIRS
FT                   VADRYAAAGYLAVAPATFARVQPGVGLGYTDDDMKEGFGLKQQVEALPGAGVLPDIQAA
FT                   IDHAAQQSGGKVGIVGYCWGGLLSWRAACELRGLSAAAVYYGGGITGGQEVARTPRCPV
FT                   IAHFGKRDHYIPLEGVEDFRKAHPDVEVHVYEADHGFNCDQRGSYDAPSADLARERTLA
FT                   FFAKYLG"
FT   gene            complement(354091..355659)
FT                   /locus_tag="Aave_0322"
FT   CDS_pept        complement(354091..355659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0322"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_3234 drug resistance transporter EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30929"
FT                   /db_xref="GOA:A1TIZ1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ1"
FT                   /protein_id="ABM30929.1"
FT                   /translation="MSSPTHTPPLAPPPLEGSARMWGTLALSAATFMNVLDTSIANVSL
FT                   PAIAGDLGVSPTQGTWVITSFAVANAIAVPLTGWLSQRFGQVRLFVASVTLFVIASLLC
FT                   GLAPNMATLIAFRALQGFVAGPMIPLSQSLLLSSYPKALAGLAMAMWSMTTLIAPVMGP
FT                   LLGGWITDNMTWPWIFYINVPVGIVAVLVTWGIFHKRESERRALPIDSVGLALLVIWVA
FT                   AMQVMLDIGKEHDWFASPWVVACCVVAVVGFITFMVWERGEEHPVVDLSLFKIRNFWAG
FT                   ALATSVGYGLFFGNVVLLPLWLQQYMGYTATQAGMVMAPVGLLALVLSPVVGKNIAKVD
FT                   PRRFATFAFLVFALVLWMRSRFNTQADLATIMVPTIIQGIAMAFFFIPLVTLTLSEIAP
FT                   ARIPSASGLSNFMRITAGAIGTSVSTTLWERRATLHHAQLTEGLQQGGVAVTQTLQGLQ
FT                   AGGLTAEQALAQVERLVNQQAFMLAANDIFYASAVLFLLLIPLVWLAHPVRASAGSADA
FT                   AAGAH"
FT   gene            complement(355692..357362)
FT                   /locus_tag="Aave_0323"
FT   CDS_pept        complement(355692..357362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0323"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_3236 RND efflux system, outer membrane
FT                   lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30930"
FT                   /db_xref="GOA:A1TIZ2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ2"
FT                   /protein_id="ABM30930.1"
FT                   /translation="MKNLLAPSSSVAAVPHAQPAGDAAGPRWQAVALYAGTLAFALLGL
FT                   TACADMSGIAPRSQMRDAASLGLAAHAEGVADAARAFADPAVASDWWRGFGDAQLDALI
FT                   EQALSQSPDLKLAEARIARAQAFTEGTRAADRPQVNGSLDATRQRYSSNSIYPPPLGGS
FT                   TKNSATGRLTGSWELDFFGKNRAAIDAAVGSANAAIADAQAARVLLASNVVRQYVELAR
FT                   VEAQLGVAQRTLEQRTQTLALVRDRVAAGLDTRLEERQSEGSLPEARQQIEALREQAAM
FT                   ARNALDALVGQPGAAQALVPPPLSSLHAIALPAALPADLLGRRADIAAARWRVEAATQD
FT                   VAMAKAQFYPNVSLTAFVGLASLGLDNFVKGGSREWGVGPAIRLPIFEAGRLRANLRGK
FT                   AADVDAAVESYNATLLDALHEAAGQSATLTADLYGSKVEYTGKVVGLGVGTGAAFALLP
FT                   AQNATGNWIKVVQRVPVRIALDAEQLKGHPLRVGLSMDVTVNTQDRTGALLADAPRAEA
FT                   VAQTAVYAGLDRGADEEVARIVAANAGPAPRAGSRTQAH"
FT   sig_peptide     complement(357309..357362)
FT                   /locus_tag="Aave_0323"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.949 at
FT                   residue 18"
FT   gene            complement(357400..357894)
FT                   /locus_tag="Aave_0324"
FT   CDS_pept        complement(357400..357894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0324"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pol:Bpro_3237
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30931"
FT                   /db_xref="GOA:A1TIZ3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ3"
FT                   /protein_id="ABM30931.1"
FT                   /translation="MHSPHDATPSVHPELIEQSIGYQMRRIVSLMGNEVDRRVEPLGLT
FT                   DAQWRPLLRIFLASGQESTVAALARVCQLDAGGMTRLLDRLEAKGLCRRERSQEDRRVV
FT                   NLALTEEGQAAAAQLPELLQDLQRTALHGFSDAEAAALRRYLARIYDNLTTRLTPPPDA
FT                   Q"
FT   gene            complement(358027..358779)
FT                   /locus_tag="Aave_0325"
FT   CDS_pept        complement(358027..358779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0325"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   aeh:Mlg_1607 glutamine amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30932"
FT                   /db_xref="GOA:A1TIZ4"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ4"
FT                   /protein_id="ABM30932.1"
FT                   /translation="MPSPPAPRPIVIARTGGTFPALRERLGDFEDWVQAGLACTAAPVL
FT                   TIDAAQDEGMPEPASIAGVVVTGSHAMVTDRAPWSEALGGWLARAVAAQTPVLGICYGH
FT                   QLLAHALGGDVADHPGGWEVGTVEVAMAPDATSSDALFAELPAAFHAQVVHRQSVRRLP
FT                   AGAVRLAGNAFEPHQAFRVGHCAWGVQFHPEFGPDAMRSYIDTLAADLRRAGRAPDTLR
FT                   EHVRATPEAAALLRRFAWFCLSNHRRTA"
FT   gene            complement(358794..360023)
FT                   /locus_tag="Aave_0326"
FT   CDS_pept        complement(358794..360023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0326"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: pol:Bpro_0244 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30933"
FT                   /db_xref="GOA:A1TIZ5"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ5"
FT                   /protein_id="ABM30933.1"
FT                   /translation="MSEDSNGTVRVFHIQPQGARELDAIPQRMPAQGFVWIACTRVTFS
FT                   ARLGALQSALQALAGQQLVDLHVSDLLNAQLPSHYDYTSQYDVLVFRRLSATQCDTGEV
FT                   PGLASLTGLGSRRAGPPVLRRIDTSPVGFAVFDQVLLSVHPDDCTVRDAFAARLLTANQ
FT                   PAPPPAPAQEPAAETATPGLPTSETLAREQRTGPAPGSRLPTSPADLMLRVVNLIVDNY
FT                   LDLRRELSRQLDHWQAELLKPRGRFANWSALLDARLTLHQLDEICEDQRAAVQDWVDTL
FT                   ETWALPDNPAALRELELLKVRSRDVLEHIERVVHHVRRLEQSTETAVQMHFSVQSNRTN
FT                   DIMRTLTALTAVFLPLNLIAGIFGMNFEFIPLVHKQDGFWWAMATMTVIAIALVALFWR
FT                   KRYLARTGQH"
FT   gene            complement(360087..361094)
FT                   /locus_tag="Aave_0327"
FT   CDS_pept        complement(360087..361094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0327"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30934"
FT                   /db_xref="GOA:A1TIZ6"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ6"
FT                   /protein_id="ABM30934.1"
FT                   /translation="MHLSSPPPFPQHRPRRLRRDAFTRNLVREHRLSPHDFIYPVFVHE
FT                   GANHRQAVPSMPGVDRLSLDLLLPVAEDCVRLGIPVLALFPSIDPALKTPDGKEALNPD
FT                   GLIPRVVRALKKEFPDLGVLTDVALDPYTSHGQDGMLDETGYILNDETVEILVGQVLTH
FT                   AEAGVDIVAPSDMMDGRIGAIREALEAQGHVHTRIMAYSAKYASAFYGPFRDAVGTRGA
FT                   LGKADKNVYQMDPGNTDEALREVALDIAEGADMVMVKPGMPYLDVVRRVKDEFRVPTFA
FT                   YQVSGEYAMLKAAAANGWLDHDAVMMESLLAFKRAGADGILTYFARDAARLLTK"
FT   gene            361167..361595
FT                   /locus_tag="Aave_0328"
FT   CDS_pept        361167..361595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0328"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   rfr:Rfer_3804 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30935"
FT                   /db_xref="GOA:A1TIZ7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ7"
FT                   /protein_id="ABM30935.1"
FT                   /translation="MLWVKAFHIVFVASWFAGLFYLPRIFVNLAMVPPDSTAERERLLL
FT                   MARKLLRFTTLLAVPALTLGLWLYLGYGIGRGPGNGWMHAKLAVVVLAVGYHHACGVLL
FT                   RKFAAGRNSHGHRWYRWFNEVPVLMLVAAVVLVVVKPF"
FT   gene            361613..362731
FT                   /locus_tag="Aave_0329"
FT   CDS_pept        361613..362731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0329"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: rfr:Rfer_3803 VanZ
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30936"
FT                   /db_xref="GOA:A1TIZ8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ8"
FT                   /protein_id="ABM30936.1"
FT                   /translation="MHKTSAWPLALTYIALIVFASLFPFEGWREQGISPLVFLTARVPP
FT                   PYWTWFDVNINIAGYAPLGFLLALALLRTGWPRAAVAVAVLSGGMLSMLMELLQIYLPR
FT                   RVPSNTDLLLNTAGTLLGALLAALLERLGAIARWSRFRARWFVQDASGALVLIALWPAA
FT                   LLFPAAVPFGLGQMWERLESALAEILADTPFLEWLPVRDAPLEPLMPGAELLAVLLGLL
FT                   VPCLLGYCVIRSVGRRVAYACGMVAAGVAVTALSAALSYGPAHAWEWLGLPARVGIVAG
FT                   LVAALLLVALPRRAAGVLLLLVLVWHLNLLNQAPTSAYFAETLLAWEQGRFIRFYGLGQ
FT                   WLGWLWPYATLVYVVLQVASRPAPEARTAPAS"
FT   sig_peptide     361613..361675
FT                   /locus_tag="Aave_0329"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.939 at
FT                   residue 21"
FT   gene            362741..363091
FT                   /locus_tag="Aave_0330"
FT   CDS_pept        362741..363091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0330"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: rfr:Rfer_3802 ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIZ9"
FT                   /protein_id="ABM30937.1"
FT                   /translation="MTEDTSPSRGYYARHIFFCLNDRINGEDSCAHHGAKEAFDHCKAR
FT                   VKAEKLAGPGQVRVNKAGCLDRCAGGPVAVVYPEGIWYTYVDTSDIDEIVESHLKNGQV
FT                   VERLLTPPELGR"
FT   gene            363181..363822
FT                   /locus_tag="Aave_0331"
FT   CDS_pept        363181..363822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0331"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_0249 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30938"
FT                   /db_xref="GOA:A1TJ00"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ00"
FT                   /protein_id="ABM30938.1"
FT                   /translation="MNAQTERLTFSGAAGAIEALRDPAAAAAGDAPRGVAVIAHPHPLF
FT                   GGTMDNKVVQTLARAFVACGWTAVRFNFRGVGGSAGAHDEGRGELDDLLAVIDQAAPAG
FT                   AIALAGFSFGAFVTSHALERLWGARDIERAVLVGTAASRFTVAPVPAEAHGRTLVVHGE
FT                   QDDTVPLAAVMDWARPQTLPVTVVPGGGHFFHGQLPLLKSLVMRHLTSQA"
FT   gene            363903..365084
FT                   /locus_tag="Aave_0332"
FT   CDS_pept        363903..365084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0332"
FT                   /product="penicillin-binding protein 6"
FT                   /note="PFAM: beta-lactamase; peptidase S11,
FT                   D-alanyl-D-alanine carboxypeptidase 1; Penicillin-binding
FT                   protein 5 domain protein; KEGG: pol:Bpro_0250 serine-type
FT                   D-Ala-D-Ala carboxypeptidase; Serine peptidase; MEROPS
FT                   family S11"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30939"
FT                   /db_xref="GOA:A1TJ01"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ01"
FT                   /protein_id="ABM30939.1"
FT                   /translation="MHASLKSFLPLLRSFAMAAALAPAALWAQVQAPQPPEIAARNYLL
FT                   LDVTAGQVLAAKDIDAPVEQASLTKLMTGYLVFDALRAKKITLEQRLPVSERAWKMPGS
FT                   RMFIDPKMQVPVEDLIKGMIVQSGNDATMALAEGVGGTAENFVKLMNDQARALGMKNTA
FT                   YKNPEGLTEPGHTTTARDLSVLATRLMKDFPEYMHYYSTKHYAYPGTPPSNGTNRNALL
FT                   FRDPTVDGLKTGHTAAAGYCLVATSKRDFPNIGQRRLLSIVLGAASESARANESQKLLN
FT                   WGYTAYDAVKLFDAGQPAATPALWKGVQNTIKIGRPDPIVVTVPSGSAGKITTQVVRQD
FT                   PLVAPLTKGQSIGTLKVSLGEQQIAEVPLVALETVDQAGIFGRAWDAIRLWIK"
FT   sig_peptide     363903..363989
FT                   /locus_tag="Aave_0332"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            365240..365617
FT                   /locus_tag="Aave_0333"
FT   CDS_pept        365240..365617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0333"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: rfr:Rfer_3800 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30940"
FT                   /db_xref="GOA:A1TJ02"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ02"
FT                   /protein_id="ABM30940.1"
FT                   /translation="MPTINQLVRQGREVETTKSKSPAMQNSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQARSKYGAKKPKAK"
FT   gene            365782..366255
FT                   /locus_tag="Aave_0334"
FT   CDS_pept        365782..366255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0334"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: rfr:Rfer_3799
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30941"
FT                   /db_xref="GOA:A1TJ03"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ03"
FT                   /protein_id="ABM30941.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVELSKFMNVIMEGGKKAVAERIIYG
FT                   ALELIQKKHPDKDPLEAFTVAINNVKPMVEVKSRRVGGANYQVPVEVRPVRRLALSMRW
FT                   LKEAARKRGEKSMAQRLANELLEATEGRGGAMKRRDEVHRMAEANKAFSHFRF"
FT   gene            366338..368440
FT                   /locus_tag="Aave_0335"
FT   CDS_pept        366338..368440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0335"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pol:Bpro_0253 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30942"
FT                   /db_xref="GOA:A1TJ04"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ04"
FT                   /protein_id="ABM30942.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDMSYPEHRFNIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVYDQMRLRLK
FT                   ANPVPVVIPIGAEEGFKGVVDLLKMKAIIWDEASQGMKFNYEEIPADLAESAKEWREKM
FT                   VEAAAEASEELMNKYLEEGDLSEEEIKLGLRTRTIATEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDYLPSPVDIPPVAGTDEDEAETTRKADDNEKFSALAFKLMTDPFVGQLTFVRVYSGV
FT                   LSKGDSVYNPVKGKKERIGRIVQMHANERLEVEEIRAGDIAACVGLKDVTTGETLCDPE
FT                   AIVTLERMVFPEPVIAQAVEPKTKTDQEKMGIALQRLAAEDPSFRVKTDEESGQTIISG
FT                   MGELHLEIIVDRMKREFGVEANVGKPQVAYRETIRKTVEEAEGKFVRQSGGKGQYGHVV
FT                   LKIEPNEAGKGIEFVDAIKGGVVPREFIPAVEKGINEAVTQGVLAGYPVVDVKVTLHFG
FT                   SYHDVDSNELAFKMAAIFGFKEGCKKAGPVILEPMMAVEVETPEDYAGTVMGDLSSRRG
FT                   MVQGMDDMVGGGKAIKAEVPLSEMFGYSTALRSATQGRATYTMEFKHYSEAPRNVSEAI
FT                   MAARAK"
FT   gene            368694..369884
FT                   /locus_tag="Aave_0336"
FT   CDS_pept        368694..369884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0336"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu, domain 2 protein; KEGG: pol:Bpro_4449
FT                   translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30943"
FT                   /db_xref="GOA:A1TJ05"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ05"
FT                   /protein_id="ABM30943.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLDKYDF
FT                   PGDDTPIVRGSAKLALEGDKGPLGEQAIDKLAEALDTYIPTPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRVERGIIKVGEEIEIVGIRDTQKTTCTGVEMFRKLLDQGQAGDNVGLLL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGAIELPADKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKIIA"
FT   gene            369908..370219
FT                   /locus_tag="Aave_0337"
FT   CDS_pept        369908..370219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0337"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: rfr:Rfer_3796
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30944"
FT                   /db_xref="GOA:A1TJ06"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ06"
FT                   /protein_id="ABM30944.1"
FT                   /translation="MSKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPTR
FT                   MKRFDILRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ"
FT   gene            370479..371153
FT                   /locus_tag="Aave_0338"
FT   CDS_pept        370479..371153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0338"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pol:Bpro_0256
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30945"
FT                   /db_xref="GOA:A1TJ07"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ07"
FT                   /protein_id="ABM30945.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDAVPVTVVDVSNNRVTQVKTQ
FT                   ENDGYVALQVTFGSRKASRVTKPEAGHLAKAGVEAGEIIREFRVTAETAGKYATGAAVP
FT                   VADVFSVGQKVDVQGTSIGKGYAGTIKRHNMASQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKRMTGHLGDATTTTQNLDVIRVDEARQLLLIKGAIPGSKGGFVTVRPAVKAKASQG
FT                   AN"
FT   gene            371153..371773
FT                   /locus_tag="Aave_0339"
FT   CDS_pept        371153..371773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0339"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pol:Bpro_0257
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30946"
FT                   /db_xref="GOA:A1TJ08"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ08"
FT                   /protein_id="ABM30946.1"
FT                   /translation="MQLELLNDQGQAASKIDVPETVFDRQYNEDLIHQIVVAYRANARQ
FT                   GTRAQKDREQVRHSTKKPFKQKGTGNARAGMTSSPLWRGGGRIFPNLPEENFTQKINKK
FT                   MYRAGMASILSQLAREGRLAVVDSLKVETPKTKVLADKFKAMNLQSVMVISDEVDENLY
FT                   LASRNLKNVFVVEPRYADPVSLVHYKKVLVTKGAIDKLKEMFA"
FT   gene            371770..372084
FT                   /locus_tag="Aave_0340"
FT   CDS_pept        371770..372084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0340"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: rfr:Rfer_3793
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30947"
FT                   /db_xref="GOA:A1TJ09"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ09"
FT                   /protein_id="ABM30947.1"
FT                   /translation="MSTTKFDEGRLMQVLVAPIVSEKATMVAEKSNAVTFKVLQNATKP
FT                   EIKAAVELMFKVEVKGVSVVNTKGKTKRFGKTIGRRDNVRKAYVTLKEGQELNLSGEAA
FT                   "
FT   gene            372085..372909
FT                   /locus_tag="Aave_0341"
FT   CDS_pept        372085..372909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0341"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pol:Bpro_0259
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30948"
FT                   /db_xref="GOA:A1TJ10"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ10"
FT                   /protein_id="ABM30948.1"
FT                   /translation="MAVIKMKPTSPGQRAVVKVTRDHLYKGEAFAALLEPQHQKSGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFKRNKDAIPAKVERIEYDPNRTAHIALVCYADGERRYI
FT                   IAPRNLEVGATIVSGSEAPIRVGNTLPIRNIPVGSTIHCIELKPGAGAQIARSAGTSAT
FT                   LLAREGTYAQVRMRSGEVRRIHIECRATIGEVANEEHSLRQLGKAGVKRWMGIRPTVRG
FT                   VAMNPIDHPHGGGEGRTGEGRHAVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
FT   gene            372920..373198
FT                   /locus_tag="Aave_0342"
FT   CDS_pept        372920..373198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0342"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: rfr:Rfer_3791 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30949"
FT                   /db_xref="GOA:A1TJ11"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ11"
FT                   /protein_id="ABM30949.1"
FT                   /translation="MTRSLKKGPFVDHHLLAKVEKAVATKDKKPVKTWSRRSMVLPEFI
FT                   GLTIAVHNGKQHVPVYITDQMVGHKLGEFALTRTFKGHPADKKVQKK"
FT   gene            373209..373541
FT                   /locus_tag="Aave_0343"
FT   CDS_pept        373209..373541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0343"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: rfr:Rfer_3790 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30950"
FT                   /db_xref="GOA:A1TJ12"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ12"
FT                   /protein_id="ABM30950.1"
FT                   /translation="MSETRAVLRGVRLSVDKGRLVADLIRGKKVDQALNILTFTQKKAA
FT                   VIVKKVLESAIANAEHNDGADIDELKVKTIYVEQGTTLKRFTARAKGRGNRISKPTCHV
FT                   YVTVGN"
FT   gene            373557..374438
FT                   /locus_tag="Aave_0344"
FT   CDS_pept        373557..374438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0344"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: rfr:Rfer_3789 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30951"
FT                   /db_xref="GOA:A1TJ13"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ13"
FT                   /protein_id="ABM30951.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYANNRDFAGMLAEDIKVREYLKA
FT                   KLKNAAVSRILIERPAKNARITIYSARPGVVIGKKGEDIENLKKELASRLGVPVAVNIE
FT                   EVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYGTSEAFTTYGVIGLKVWVYKGDTLGRNDLPAVETPRPE
FT                   EERRPRGPRRDGRPGGDRAGAGRGPRRPMGGNAAPADGSDKPAGAGGTDATAVKRVRKV
FT                   DAPATAADGKGE"
FT   gene            374441..374857
FT                   /locus_tag="Aave_0345"
FT   CDS_pept        374441..374857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0345"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pol:Bpro_0263
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30952"
FT                   /db_xref="GOA:A1TJ14"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ14"
FT                   /protein_id="ABM30952.1"
FT                   /translation="MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTAR
FT                   QIEAARRAISRHVKRGGRIWIRVFPDKPISTKPAEVRMGNGKGNPEYYVAEIQPGKIVF
FT                   EIVGVPEELAREAFRLAAAKLPLRTTFVSRQIGA"
FT   gene            374874..375071
FT                   /locus_tag="Aave_0346"
FT   CDS_pept        374874..375071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0346"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: rfr:Rfer_3787
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30953"
FT                   /db_xref="GOA:A1TJ15"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ15"
FT                   /protein_id="ABM30953.1"
FT                   /translation="MTKAAELRQKDVAGLEAEIKSLQKAHFGLRMQKATQQLGNTGTLR
FT                   TTRRDIARAKTILAEKQAAK"
FT   gene            375081..375350
FT                   /locus_tag="Aave_0347"
FT   CDS_pept        375081..375350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0347"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: rfr:Rfer_3786
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30954"
FT                   /db_xref="GOA:A1TJ16"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ16"
FT                   /protein_id="ABM30954.1"
FT                   /translation="MTEAKKSLKRTLVGKVVSDKREKTVTVLVERRVKHPIYDKIVIKS
FT                   SKYHAHDENSEYKLGDTIEITESRPLSKTKNWVATRLVQKAALV"
FT   gene            375491..375997
FT                   /locus_tag="Aave_0348"
FT   CDS_pept        375491..375997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0348"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: rfr:Rfer_3785
FT                   alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30955"
FT                   /db_xref="GOA:A1TJ17"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ17"
FT                   /protein_id="ABM30955.1"
FT                   /translation="MIKIGEALPAVTLMEYSEVEGGGCSIGPNPVDVAKASAGKTIALF
FT                   AVPGAFTPTCSAKHVPGYVEQAEAFKAAGVDEIWCLSVNDAFVMGAWARDQKTDGKVRM
FT                   LADGDAAFAKATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIEAPGKFEVSDADTLL
FT                   AQARG"
FT   gene            complement(376076..376645)
FT                   /locus_tag="Aave_0349"
FT   CDS_pept        complement(376076..376645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0349"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pol:Bpro_0267 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30956"
FT                   /db_xref="GOA:A1TJ18"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ18"
FT                   /protein_id="ABM30956.1"
FT                   /translation="MDPGPAAWPSGHAVTLFPTATLPTLPVDQPSIALLTPSEPTEMEP
FT                   VRAIFREYGDSLGIDLQFQDFDAELAHLPGDYAPPRGQILLAEVGGAIAGCCALRPLDT
FT                   ADYPNAAEMKRLYVRKAFRGFGLGRQLAEAMLDVARQAGYASVLLDTLDGMESARALYA
FT                   DLGFEEIPPYYHNPIAGSHYLKVDID"
FT   gene            complement(376711..377217)
FT                   /locus_tag="Aave_0350"
FT   CDS_pept        complement(376711..377217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0350"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0270
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30957"
FT                   /db_xref="GOA:A1TJ19"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ19"
FT                   /protein_id="ABM30957.1"
FT                   /translation="MMGLKHWIGAAAVAAFVGVGAFVFLGAGRSQAPDSTFVLLDGSRQ
FT                   TTADLRGKVTLVNFWATSCTTCVAEMPQIVSTYGKYRDRGFETLAVAMSYDPPSYVVNF
FT                   AQTRQLPFKVAIDNTGTVAKAWGDVRLTPSTFIVNKRGEIVKSYVGAPDFAELHQLIER
FT                   LLAET"
FT   sig_peptide     complement(377125..377217)
FT                   /locus_tag="Aave_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.350 at
FT                   residue 31"
FT   gene            377416..377985
FT                   /locus_tag="Aave_0351"
FT   CDS_pept        377416..377985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30958"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ20"
FT                   /protein_id="ABM30958.1"
FT                   /translation="MSRNRMLRILLAGTLSLGGCSPSLDWRSVRMDEAGLTALLPCKPE
FT                   RAVRPVELQGRSVELSMAGCDADGATFAVSHMVLPQGAGAAEAGVVLAQWRAATLARIG
FT                   VAADTAGAGVPFTPRGALQLPQSVRLQAHGAAPGQGADVAMDAAWFARAEAAGDGPRMR
FT                   LYHAVIYSPQPRAAVADTFFPGLALR"
FT   gene            378005..378457
FT                   /locus_tag="Aave_0352"
FT   CDS_pept        378005..378457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0352"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: pol:Bpro_0297 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30959"
FT                   /db_xref="GOA:A1TJ21"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ21"
FT                   /protein_id="ABM30959.1"
FT                   /translation="MSTRILLIAHAPLAHALRACALHVFPDTADDILALDVHPNAPPED
FT                   TLAAARILLDGAGGDAPILVLTDVFGATPCNVAQRLVDGERSRLVTGVNLPMLLRAVSY
FT                   RREPLEALVARAIAGGTQGVMQVAVAAPQNQTRRSHHDQDEYHHQQ"
FT   gene            378426..378695
FT                   /locus_tag="Aave_0353"
FT   CDS_pept        378426..378695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0353"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pol:Bpro_0298 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30960"
FT                   /db_xref="GOA:A1TJ22"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ22"
FT                   /protein_id="ABM30960.1"
FT                   /translation="MIKTNITISNKLGLHARASAKLTKLAGSFPCEVWMARGERRVNAK
FT                   SIMGVMMLAAGIGTEVSIETDGPQEQEAMDALRALIDGKFGEGE"
FT   gene            378751..380529
FT                   /locus_tag="Aave_0354"
FT   CDS_pept        378751..380529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0354"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: pol:Bpro_0299
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30961"
FT                   /db_xref="GOA:A1TJ23"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ23"
FT                   /protein_id="ABM30961.1"
FT                   /translation="MTFAVHGLAVARGIAIGRAVLVASSRVDVAHYFIEPEQVRAEIIR
FT                   VRNGRNAVVEELQRLQAELPADAPPELAALLDVHLMLLQDEALVSGVKHWITDRLYNAE
FT                   WALTTQLEIIARQFDEMEDEYLRERKADLEQVVERILRHMKGVASPVAPPPCSPRRGSA
FT                   ALGLQQDLLPCDMVDVPLVLVAHDLSPADMLQFKQSVFAGFVTDVGGKTSHTAIVARSM
FT                   DIPAVVGARAASQLVRQDDWVIIDGDAGIMIVDPSPIILAEYGFRQRQTELERERLSRL
FT                   RHTPAVTLDGERIELLANIEQPADAAAAVRAGAAGVGLFRSEFMFMGRGGHLPGEEEQY
FT                   QAYRAAVEGMQGLPVTLRTIDVGADKPLDHKAAKEAASHLNPALGLRAIRWSLADPTMF
FT                   RTQLRAVLRAAAHGPVNLLFPMLAHVGEIRQTLAQVDMARAELDARGASYGPVRLGAMI
FT                   EVPAAALIVRRFLQYFDFLSIGTNDLIQYTLAIDRADESVAHLYDPMHPAVLQLVADVI
FT                   AEGHRQGKNVCLCGEAAGDVAMTRLLLGLGLRSFSMHPAQILAVKQEVLRSDTRKLAPW
FT                   ARTVIDADNPADVLGG"
FT   gene            380918..382723
FT                   /locus_tag="Aave_0355"
FT   CDS_pept        380918..382723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0355"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: dar:Daro_1087 K+ transporting ATPase, A
FT                   subunit; TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K+ transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30962"
FT                   /db_xref="GOA:A1TJ24"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ24"
FT                   /protein_id="ABM30962.1"
FT                   /translation="MTASAWGLLALFLSVLGLLAWPLGRGLAAVCDGRLPGWMHRAEAP
FT                   LYRLAGVRPEAGMHWRHYALALLAFNALGVFAVYALQRLQGVLPLNPQGLPAVAGDSAF
FT                   NTAVSFVSNTNWQGYAGESTMGYLVQMLGLSVQNFLSAATGIAVAFALARGFAARGGDG
FT                   AGHVGNFWADIVRITAWVLVPLSFVLAVFLAGQGVIQNFTAYQDVATVEATVYQDPQSD
FT                   AQGQPLKDASGNPLTREVRTRTQTLPMGPVASQEAIKMLGTNGGGFFNANSAHPYENPT
FT                   PLTNLAQMLAIFLVPAALCFAFGRVVGDWRQGVAILAAMTLMFVVAVVAVTAAEQAGNP
FT                   ALSALGADPVASALQAGGNMEGKEVRFGISASALFAAVTTAASCGAVNAMHDSFTPLGG
FT                   MVPMVLMQLGEVVFGGAGSGLYGMLVFAILAVFIAGLMIGRTPEYLGKKIEVREMKLTS
FT                   VAILVTPLLVLVGTAVAVLAPAGQAGIANPGAHGFSEVLYALTSAANNNGSAFAGLSAN
FT                   TPFYNVLLALAMWFGRFGVIVPVLAIAGSLAAKKRLPPGPGTMPTHGPLFVALLVFTVL
FT                   LVGLLNYVPSLALGPVVEHLVLQAR"
FT   sig_peptide     380918..380980
FT                   /locus_tag="Aave_0355"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.822 at
FT                   residue 21"
FT   gene            382745..384877
FT                   /locus_tag="Aave_0356"
FT   CDS_pept        382745..384877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0356"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   dar:Daro_1086 ATPase, E1-E2 type:potassium-translocating
FT                   P-type ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30963"
FT                   /db_xref="GOA:A1TJ25"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ25"
FT                   /protein_id="ABM30963.1"
FT                   /translation="MTTPQSPATAPAAAPVPSRNLTLFDAALVRPAVWQAFAKLDPRVQ
FT                   WRNPVMFIVFIGSIFTTLLWLQALTTAQDMGMRPAFILAVAVWLWFTVLFANFAEALAE
FT                   GRSRAQAASLRGLRKDTWAKKLSEPRHGARFLPEQATNLRRGDVVQVDAGDVIPLDGEV
FT                   IEGMASVDESAITGESAPVVRESGGDFSAVTGGTRVLSDWLVVRITVNPGESFLDRMIG
FT                   MVEAAKRQKTPNEVALTILLVALTIVFLVVTVTLLPFSLFSVQASGAGTVVSLTALIAL
FT                   LVCLIPTTIGGLLSAVGVAGMSRMMQANVIATSGRAVEAAGDVDVLLLDKTGTITHGNR
FT                   QASAFMPAPGVSRAHLARAALMASLADETPEGRSIVELARREGVEAEAGAPAGLVLVPF
FT                   TAQTRMSGVDLPAAGGAAPVALRKGAVQALTRHVQALGGSMPAEVARAADDVARRGSTP
FT                   LAVAEGSRVLGVVELKDIVKAGIQARFAELRRMGIKTVMITGDNRLTAAAIAAEAGVDD
FT                   FLAEATPEDKLALIRRYQSEGRLVAMTGDGTNDAPALAQADVAVAMGSGTQAAKEAGNM
FT                   VDLDSNPTKLLEVVETGKALLMTRGSLTTFSIANDVAKYFAIIPAMFVSTYPQLGALNV
FT                   MRLASPSSAILSAVIFNALIIVFLIPLALKGVRYRPVGAAALLRRNLAVYGLGGLVVPF
FT                   IGIKLIDWALVAVGLV"
FT   gene            384901..385563
FT                   /locus_tag="Aave_0357"
FT   CDS_pept        384901..385563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0357"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number="3.6.3.12"
FT                   /note="KEGG: bbr:BB3919 potassium-transporting ATPase C
FT                   chain; TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K+ transporting ATPase, KdpC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30964"
FT                   /db_xref="GOA:A1TJ26"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ26"
FT                   /protein_id="ABM30964.1"
FT                   /translation="MASSSLASPATPAVPPTAAGTDDGAAPSLRGPLLRPALALFVCLS
FT                   VATGVLYPLAVTGVAQSVFPQQAAGSLVRDSAGHAVGSRLIGQNFTDPAHFWGRPSATA
FT                   PMPYHAGASGGSNQGPANPALADAVKARIEALRAADPGNTAPVPVDLVTASASGLDPHI
FT                   SVAAARYQAARVARARGLPQERVDALVRSHTEAPLLPWLGEAGVNVLTLNLALDAVR"
FT   sig_peptide     384901..384960
FT                   /locus_tag="Aave_0357"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.914) with cleavage site probability 0.431 at
FT                   residue 20"
FT   gene            385601..388399
FT                   /locus_tag="Aave_0358"
FT   CDS_pept        385601..388399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0358"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K+ channel
FT                   His kinase sensor; UspA domain protein; KEGG: dar:Daro_1080
FT                   ATP-binding region, ATPase-like:histidine kinase A,
FT                   N-terminal:osmosensitive K+ channel His kinase sensor"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30965"
FT                   /db_xref="GOA:A1TJ27"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ27"
FT                   /protein_id="ABM30965.1"
FT                   /translation="MPTDLRPDPDALIAQMRAEEQRVQRGKLRIYFGANAGVGKTWSML
FT                   GAAQRERQAGRDVLVGVVETHGRAETAALLEGLPVLPRRTLEHSGRKRTEFDLDAALQR
FT                   RPAVLLVDELAHSNVPGSRHAKRWQDVQELVAAGIEVWTALNVQHLESLNGTVGAITGV
FT                   RVHETVPDTVLDEADEVVLVDATPDELAARLAAGKVYLPQQAERAAQNFFRKGNLIALR
FT                   EIALRRTAEHVEDDVRGWRVEQSGGGHGVPPAWNTSGALLACVGPHEDAAHTVRTAARL
FT                   AGQLNVRWHAAYVETPRLQRLPARERDRILAVLQLAEGLGAETAVLTGDAVAPPLAEHA
FT                   RQLNCATVVVGRARRRTGLGRWWPVPGTAQAIGAAAPTLEIVEAGEPGSSRRLPAAPWR
FT                   PAGDPAGAGAQEDGGRPSVRWPGYGAAVAASVAVTLLALPLSGVLELTNIVMLYLLGVV
FT                   GVAMRFGRVPAALAALLNVAAFDFVFVSPQLSFAVSDVQYLVTFGVMLGVGLLVGQLTA
FT                   GLRFSAGVSAGREQRMRSLFELTRELSAALEASQVVDIGVRAVQQHFGGQAVVLPLDDT
FT                   DRLAVPAVPPAGFDPSVADWTLRHGRSAGLGTATLAAQGWRYVPLTAPMRVRGVLALAP
FT                   ARPRWLLIPEQAQHLETLARQVAIALERVHYVEVAQRAVLDMESERLRNALLGAISHDV
FT                   RTPLTALIALAESLPAQPDEALPAASQAIVQQAHQLHALVSNLLDMARLESGLAGGSVR
FT                   LRRDWQSVEEVVGSAIRAARPALGALEVRTALPADLPLVEFDAVLIERVLVNLLENAAK
FT                   YGALPIDIAAEALPGTLRIRVRDHGPGLPAALRGREHTLFDKFTRGQSESPTPGVGLGL
FT                   AICRAVVLAHGGDIAASGAGAGPGAEFTVTLPRRNPPAVGEAAELPDEDASDSPGADRN
FT                   LS"
FT   gene            388414..389124
FT                   /locus_tag="Aave_0359"
FT   CDS_pept        388414..389124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0359"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: rme:Rmet_0042 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30966"
FT                   /db_xref="GOA:A1TJ28"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ28"
FT                   /protein_id="ABM30966.1"
FT                   /translation="MTQHPRTAIVIEDEPQIRRFVRGALEEEGWQVHEAATLREGLSAA
FT                   GTRQPDLLVLDLGLPDGDGVALIRDVRGWSAVPIIVLSARTDEADKIAALDAGADDYLT
FT                   KPFGTGELLARVRANLRRPRPATGQGLQAEAAEPVFRFGDIEVDRGARLVRRAGTVVHL
FT                   TPTEYRMLTVLVANAGRVITQRQLLREVWGPARSDQSHYLRIYMGHLRQKLEADPAQPR
FT                   HLLTETGVGYRLAA"
FT   gene            389251..389628
FT                   /locus_tag="Aave_0360"
FT   CDS_pept        389251..389628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30967"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ29"
FT                   /protein_id="ABM30967.1"
FT                   /translation="MLLHRIFRDEEGADAGAVCSCARRARPAVPGVVLPVRLAREPALR
FT                   VRQRLHAALGPLLGTYRLSVDAVRPVCTVYLHLREADIGECMDRLMAALPMAEFGRIGR
FT                   VAHDLPRPAEPSPPKVLHVRA"
FT   gene            389615..389905
FT                   /locus_tag="Aave_0361"
FT   CDS_pept        389615..389905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30968"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ30"
FT                   /protein_id="ABM30968.1"
FT                   /translation="MCAHEVQALWQAGMAMLTWFIPLGFGNAAGSDVVAVANPAGGSVF
FT                   LSTCETIITNTSEVAQQIESIMKPDSFTVRTPSGTPQCQVGTVLSAGEPAT"
FT   gene            complement(389995..390993)
FT                   /locus_tag="Aave_0362"
FT   CDS_pept        complement(389995..390993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0362"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: pol:Bpro_0313 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30969"
FT                   /db_xref="GOA:A1TJ31"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ31"
FT                   /protein_id="ABM30969.1"
FT                   /translation="MSTPEVVREAQSTVAYNPLAKQKAAAKLSRIPIKVEQGEVLKKPE
FT                   WIRVKAGSPTTRFYEIKEILREHKLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDKDEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQNIR
FT                   ALSPATQIEILVPDFRGRDDRALEILKAAPPDVMNHNLETAPRLYKEARPGSDYQFSLN
FT                   LLKKFKALHPGVPTKSGIMVGLGETDEEILQVMRDMRAHDIDMLTIGQYLAPSNSHLPV
FT                   RRYVHPDTFKMYEEEAYKMGFTHAAVGAMVRSSYHADQQAHAAGLQAGPQG"
FT   gene            complement(391008..391703)
FT                   /locus_tag="Aave_0363"
FT   CDS_pept        complement(391008..391703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0363"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rfr:Rfer_3935
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30970"
FT                   /db_xref="GOA:A1TJ32"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ32"
FT                   /protein_id="ABM30970.1"
FT                   /translation="MQVRMLGRVDLRETVEAMQAFTAQRTGDTPDVLWVCEHAPHFTQG
FT                   LAGHADHLLAPGDIPVVATNRGGQVTFHGPGQVVAYPLVDLRRAGYYVKEYVHRVEEAA
FT                   IRTLAHFGVTGHRVAGAPGIYVRLDDPRSHALLPQRPRKADPLEPAAAVPDFTGLGKIA
FT                   ALGIKVSRHCTYHGVALNVDMDLEPFSRINPCGYAGLPTVDLSTIGVHTTWDEAASVLA
FT                   SQLAIRLAP"
FT   gene            complement(391718..392029)
FT                   /locus_tag="Aave_0364"
FT   CDS_pept        complement(391718..392029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0364"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   pol:Bpro_0316 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30971"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ33"
FT                   /protein_id="ABM30971.1"
FT                   /translation="MTQPPTPSPVIGSEGDPRKESLIEYPSRFPIKVMGRKADGFVHAL
FT                   TEVARRFDPSFDASTIELRDSREGNYLGVTLTVTATSREQLDDLYRALSSHPMVKVVL"
FT   gene            392250..392720
FT                   /locus_tag="Aave_0365"
FT   CDS_pept        392250..392720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0365"
FT                   /product="putative ATP synthase protein I"
FT                   /note="KEGG: rfr:Rfer_0113 putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30972"
FT                   /db_xref="GOA:A1TJ34"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ34"
FT                   /protein_id="ABM30972.1"
FT                   /translation="MKTDAPDTGTEVEDSGFKPLSAAEAQEWRQRHPPVSIWRIVAGQA
FT                   AVGLVAALVAWVVTGRSHVAWSTGYGALAVVLPAALFARGMARRRSSAGGALAGLFGWE
FT                   LVKIALTVAMLAAAPRLVPGLSWLALLAGMVVTMKTYWIALMARPGVRKPID"
FT   gene            392736..393614
FT                   /locus_tag="Aave_0366"
FT   CDS_pept        392736..393614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0366"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   pol:Bpro_0321 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30973"
FT                   /db_xref="GOA:A1TJ35"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ35"
FT                   /protein_id="ABM30973.1"
FT                   /translation="MAAEAHAPTASEYIVHHLQHLQNIKQKSIVDFSVVNIDSVVVGLV
FT                   LGAIALFAFWLCARKATSGVPGRFQAAVEILVEMVDNQAKANIHNAESRKFIAPLALTV
FT                   FVWIFLMNAMDMLPVDLLPAIWAQIYGAAGHDPHHAYLRVVPTADLSTTLGLSTAVLVL
FT                   CLYYSVKIKGLGGWAHELVTAPFGTSKNPVFALILGVVNLLMQIIEYVAKTVSHGMRLF
FT                   GNMYAGELVFMLIALMGGAAAMSLSGVLLPVGHIIAGSIWAIFHILVITLQAFIFMMLA
FT                   LIYLGQAHEAH"
FT   gene            393669..393917
FT                   /locus_tag="Aave_0367"
FT   CDS_pept        393669..393917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0367"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rfr:Rfer_0111 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30974"
FT                   /db_xref="GOA:A1TJ36"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ36"
FT                   /protein_id="ABM30974.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKYLEASARQPELI
FT                   NELQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLA"
FT   sig_peptide     393669..393737
FT                   /locus_tag="Aave_0367"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.811 at
FT                   residue 23"
FT   gene            393952..394422
FT                   /locus_tag="Aave_0368"
FT   CDS_pept        393952..394422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0368"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   pol:Bpro_0323 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30975"
FT                   /db_xref="GOA:A1TJ37"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ37"
FT                   /protein_id="ABM30975.1"
FT                   /translation="MSINATLFVQAIVFLILVLFTMKFVWPPIAKALDERAQKIAEGLA
FT                   AADRAKSELVAVNQRVETELAQTRNETASRLADAERRAQAIIEEAKARATEEGNKIVAA
FT                   ARAEAEQQTIQAREALREQVAALAVKGAEQILRKEVNAGVHADLLNRLKTEL"
FT   gene            394438..394980
FT                   /locus_tag="Aave_0369"
FT   CDS_pept        394438..394980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0369"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: pol:Bpro_0324 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30976"
FT                   /db_xref="GOA:A1TJ38"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ38"
FT                   /protein_id="ABM30976.1"
FT                   /translation="MAELATIARPYAEALFKACAAQPGADLGSTVAWVDELAAIAADPQ
FT                   VRQLADNPKIESGQLFDLIAGVVRAPLSDAARNFLRVLIDNGRLEALPEVAAQFRALVN
FT                   RQSGSSDAVVHSAFPIDAAALAELGASLEKRFGRKLNLSVQLDESLIGGVRVAVGDEVL
FT                   DTSVKARLEQMKAALVA"
FT   gene            395023..396582
FT                   /locus_tag="Aave_0370"
FT   CDS_pept        395023..396582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0370"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0325 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30977"
FT                   /db_xref="GOA:A1TJ39"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ39"
FT                   /protein_id="ABM30977.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVTDGIVRIHGLS
FT                   EVMQGEMLEFPATKDGQPSYGLALNLERDSVGAVILGEYEHISEGDTVKCTGRILEVPV
FT                   GPELVGRVVNALGQPIDGKGPINAKLTDVIEKVAPGVIARQSVDQPLQTGIKSIDAMVP
FT                   VGRGQRELIIGDRQTGKTAVAIDAIIAQKGQGVTCIYVAIGQKASSIKNVVRALEQAGA
FT                   MEYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAYPGDVFYLHSRLLERAARVNADYVEAFTKGEVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLVKGLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQPQYTPLPISLMGATLFAVNK
FT                   GFMDDVDVKKVLAFESGLHQFLKTSHGALLERLEKNRAFDKEGKDEAELTQAITAFKKS
FT                   FA"
FT   gene            396601..397467
FT                   /locus_tag="Aave_0371"
FT   CDS_pept        396601..397467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0371"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0326 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30978"
FT                   /db_xref="GOA:A1TJ40"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ40"
FT                   /protein_id="ABM30978.1"
FT                   /translation="MAAGKEIRGKIKSVENTKKITKAMEMVAASKMRKAQDRMRAARPY
FT                   SEKIRNIAANLGQANPEYVHPFMKSNDAKTAGFIVVTTDKGLCGGMNTNVLRAVTAKLR
FT                   ELQSQGVSTQAVAIGNKGLGFLNRIGAQVVSHATGLGDTPHLDKLIGPVKVLLDAYAEG
FT                   KINGVYLAYTKFINTMKQESVVEQLLPLSSEKMQAEKTEHGWDYIYEPDAQSVIDDLLV
FT                   RYVESLIYQAVAENMASEQSARMVAMKAATDNAGNVIGELKLVYNKTRQAAITKELSEI
FT                   VAGAAAV"
FT   gene            397486..398916
FT                   /locus_tag="Aave_0372"
FT   CDS_pept        397486..398916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0372"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: rfr:Rfer_0106 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30979"
FT                   /db_xref="GOA:A1TJ41"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ41"
FT                   /protein_id="ABM30979.1"
FT                   /translation="MAQENTQVNAGVQGKIVQCIGAVVDVEFPRDQMPKVYDALKLEGS
FT                   PLTLEVQQQLGDGVVRTIALGSSDGLRRGLMVSNTGNPITVPVGKATLGRIMDVLGSPI
FT                   DERGPVSQELTASIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVG
FT                   KTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLEKLEDSKVAMVY
FT                   GQMNEPPGNRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAV
FT                   GYQPTLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRD
FT                   IASLGIYPAVDPLDSTSRQLDPQVVGEEHYQVARGVQGTLQRYKELRDIIAILGMDELA
FT                   PEDKLAVARARKIQRFLSQPFHVAEVFTGSPGKYVPLAETIRGFKMIVAGECDHLPEQA
FT                   FYMVGTIDEAFEKAKKVA"
FT   gene            399038..399454
FT                   /locus_tag="Aave_0373"
FT   CDS_pept        399038..399454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0373"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: pol:Bpro_0328 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30980"
FT                   /db_xref="GOA:A1TJ42"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ42"
FT                   /protein_id="ABM30980.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   KPGSVRIETADGGEEFVFVAGGILEVQPERVTVLSDTAIRGKDLDDEKAAAAKAAAEEA
FT                   LKNAKSDVDFARAQSELAVMAAQIAALRKFRQKR"
FT   gene            399781..400896
FT                   /locus_tag="Aave_0374"
FT   CDS_pept        399781..400896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0374"
FT                   /product="putative mRNA 3-end processing factor"
FT                   /note="KEGG: ppu:PP_1106 putative mRNA 3-end processing
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30981"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ43"
FT                   /protein_id="ABM30981.1"
FT                   /translation="MAAASDDLVIARPEGLYCPPGDFYIDPWKPVERAVITHGHSDHAR
FT                   WGHSHYLAHIDSEGTLRARLGADITLQTLPYGQAIQHHGVRISLHPAGHVLGSAQVRLE
FT                   HGGRVWVASGDYKTGPDGTCVPFEPVRCDTFITESTFGLPIYRWPSQEVLFAEIDAWWR
FT                   ANAAQGRPSVMLCYAFGKAQRILHGVDASIGPIVVHGAVEPLNAVYRAAGVALPPTLRA
FT                   TDPGVDAKLLQTALVVAPPSAQGTPWMRRFPRHSDAFASGWMQLRGTRRRRGVDRGFVM
FT                   SDHADWPGLQSAIGATGAERVFVTHGSVAVLVRWLREQGLDAQSFRTEYGNEDDDAAPD
FT                   ASTATPPVAAPGGDASPVEDDGPPEGGEAAP"
FT   gene            400893..402593
FT                   /locus_tag="Aave_0375"
FT   CDS_pept        400893..402593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0375"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: reu:Reut_B3895 DNA ligase
FT                   (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30982"
FT                   /db_xref="GOA:A1TJ44"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ44"
FT                   /protein_id="ABM30982.1"
FT                   /translation="MKDFAALYRALDASTSSLAKQAALQAYLRAAAPADAAWAVYFLAG
FT                   GKPRQLVPTKLLRQFAREAAGLPEWLFDESYEAVGDLAETIALLLPAPAEAHALGLAEW
FT                   VEQHLLPLRGMAPEALEPMLRAQWNRLAPEERLVYFKLITGAFRVGVSKLQVTQALAAV
FT                   SGVDPKRVAQRLMGYTHIGARPGPADYERLVAPLAETGQGAADDAAQSGETSGHPYPFF
FT                   LAHPLSLPVDQFAATLGPPGGWIVEWKWDGIRAQLVRRAGATWVWSRGEELVSDRFPEL
FT                   QRLGQEALPDGTVLDGEIVVWQHAEGDAPARVRPFADLQKRIGRKTLGPKLLRELPVVL
FT                   LAYDLLEEDGKDLRALPQHERRARLDALLARVSHPALVASPLLHGHDWDELAARRAHAR
FT                   SLGVEGMMLKARDAQYGVGRTKDVGTWWKWKIDPLSVDAVLIYAQRGHGRRASLYSDYT
FT                   FAVWDGPPGAEGRSLVPFAKAYSGLTDAEMARVDAVIRRTTVETFGPVRSVKPTLVFEL
FT                   GFEGIARSARHKSGIAVRFPRMLRWREDKPVEEADSLETLEALLPRSDP"
FT   gene            402691..405735
FT                   /locus_tag="Aave_0376"
FT   CDS_pept        402691..405735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0376"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: reu:Reut_A1853
FT                   helicase, C-terminal:DEAD/DEAH box helicase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30983"
FT                   /db_xref="GOA:A1TJ45"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ45"
FT                   /protein_id="ABM30983.1"
FT                   /translation="MPSSSSRAPRARPLAEAWIAARGWRPFPFQREVWRALAQGRSGLL
FT                   HATTGAGKTYAVWLGALQAFGTAGKARGKGEGGTSADLADALEAAAGRPADGRRHKAPP
FT                   PEPLTVLWLTPMRALAADTLKALRTPLDELAATQPALARWTSGARTGDTGSAERGAQSR
FT                   RLPTVLVTTPESLSLLLARADARELLSTVRLVVADEWHELLGNKRGVQVQLALARLAGW
FT                   NPRVCVWGMSATLGNLPEARDALLAPLGAEGAGEGVLVQGQVDKRLVVDTLLPDHPERF
FT                   SWAGHLGLRMLPAVVRELESTTTTLVFVNVRSQAELWYKAILDARPDWAGELAIHHGSL
FT                   DRGVREWVEAGLKEGRLRAVVCTSSLDLGVDFLPVERVLQIGSAKGIARLLQRAGRSGH
FT                   APGRPSRITLVPTHSLELVEAAAARAAVQAGEVEMRASPRRPVDVLVQHLVTVALGGGF
FT                   EPEALYAEVRRTVAYRDLPRAVWQWCLDFVHRGGPSLAAYPDYQRVAPDEEGIWRMPSA
FT                   RLARRHRANIGTIVSDASMAVQVLHGARLGTMEESFLSRLSPGDCFVFAGQVLEMVKIE
FT                   DMTAYVRRAARGRPTVPRWAGSRMPLSTVLADFVVQQLAQAAAGRYGSPELRCVRPLLE
FT                   VQQRWSALPTPGTLLAETLRTREGWHLFLYPFAGRHAHIGLASLFAWRAAQGEAGTFSI
FT                   AVNDYGLELLSATERDWAALLPELLRVHAAPVPEGGSDTGPPGLPAGEALAIRNTANAA
FT                   RAAAADSSGASVIGTGSAPQDEARHALLHEVLASLNATEMARRRFREIARVAGLIFQSH
FT                   PGERRSARQLQASSQLFFEVFRKYDAGNMLLRQADEEVLSQELDVAQLLAALRRMQAQA
FT                   LVVQPLARPSPFAFPLMVERFREKLTNEDLADRIARMLAQLDTAADEGGTAAPGPSAQD
FT                   VVPPDPPARPQRRRTAAKKAAGKEEDTAGGVAPAAQTAMQQAADAVRRTLDFSLTSAED
FT                   GGTGAAGDGRSRRRERKPSRPLPRL"
FT   gene            405742..406518
FT                   /locus_tag="Aave_0377"
FT   CDS_pept        405742..406518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0377"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ppu:PP_1102
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30984"
FT                   /db_xref="GOA:A1TJ46"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ46"
FT                   /protein_id="ABM30984.1"
FT                   /translation="MPAPGRPVRDNGASLIVVHGPLQLTGASATVHLAGTEVRLLAGHA
FT                   LWWPDGRTLFVADVHLGKADTFRARGLPVPSGTTRDNLARLSALVAEQGAQRLVVLGDF
FT                   LHAAEARSPTVLASLAAWRAMHAALEVVLVRGNHDSHAGDPPAELGIAIVDEPWPLGPF
FT                   ACCHHPQRHAALHVLAGHVHPAMVLRGPGRDALRLPCFVVDAAEGSDAGATLLPAFGEF
FT                   TGGQVLAPMAGRRLFAVGGGRVWPVPSAATNASLRA"
FT   gene            complement(406519..406941)
FT                   /locus_tag="Aave_0378"
FT   CDS_pept        complement(406519..406941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30985"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ47"
FT                   /protein_id="ABM30985.1"
FT                   /translation="MPRRPREHGLDLPEGAFFDVVGRSTSLLTPRTLSAMEQAVLRQVR
FT                   DPAVHREFLMGHSTWRAGMQALHPREFQEHFRLRDADPFFDADIPEDLEGQADYAARAR
FT                   QVEAHWRRREDQLLLRLAGISPPPSPPPGGPAPRQA"
FT   gene            complement(407008..407580)
FT                   /locus_tag="Aave_0379"
FT   CDS_pept        complement(407008..407580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0379"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0329 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30986"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ48"
FT                   /protein_id="ABM30986.1"
FT                   /translation="MPSTSRPPAPTPPPGLPARIARLLRHRWAEGGLHRALPPDLLERL
FT                   ARRVAASEARHTGQIRICAEGGLPASYLWRGASARERAVTLFGKLRVWDTEHNNGVLIY
FT                   LLLAEHAIEIVADRALARTVPPAAWHEMVARMGEAFRSGHYEDGLTQALEEVSALLAEH
FT                   FPAGRGPRRANELPDMPVLGSGAPDGP"
FT   gene            complement(407637..408578)
FT                   /locus_tag="Aave_0380"
FT   CDS_pept        complement(407637..408578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0380"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0330 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30987"
FT                   /db_xref="GOA:A1TJ49"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ49"
FT                   /protein_id="ABM30987.1"
FT                   /translation="MPAITAPLRTLLALLCIVLGLAFALPARALRAVPPLSAHLIDETG
FT                   TLSAAERERLEARLAGIEQRQGTQIAVFMVASTAPEDIAAFANRVANTWKIGRRDVGDG
FT                   VLVVVAKDDRRMRIEVAKALEGAIPDIAAARIIDGAMKPRFREGDFAGGIDAALGQLSA
FT                   RIAGENLPAPTGTTQAARAERGVDWNDLAIFLFFGVMVGGPVVRRLFGNRAGGLLMGGA
FT                   AGLIAFLFTTSVLLAVGAGAVALLYTWLFGGRGVAAGRGGGLRDGFSTGLGTGIGMGGW
FT                   SGGSGGGSSGDSGGFSSGGGGDFGGGGASGDW"
FT   sig_peptide     complement(408489..408578)
FT                   /locus_tag="Aave_0380"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.746 at
FT                   residue 30"
FT   gene            complement(408591..409325)
FT                   /locus_tag="Aave_0381"
FT   CDS_pept        complement(408591..409325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0381"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: rfr:Rfer_0102 LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30988"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ50"
FT                   /protein_id="ABM30988.1"
FT                   /translation="MRRPLTGQARRLRQNDTSPERPGHVAPTFAIPARRLHTMKRLIAT
FT                   LAAALALSGCGYNDFQRLDEQSKAAWSEVLNQYQRRADLVPNIVATVKGEAAFEQDTLT
FT                   KVVEARAKATSIQVTPETLNNPEAFNKFQQAQGELSSALSRLMVVAERYPQLQANQAFR
FT                   DLRVTLEGTENRITVARNRYIQTVQEYNVLARSFPTNLTAKVFSYEPKPSFTVQNEAQI
FT                   STPPAVDFSRPAPAAPGAPASR"
FT   gene            409436..409885
FT                   /locus_tag="Aave_0382"
FT   CDS_pept        409436..409885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30989"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ51"
FT                   /protein_id="ABM30989.1"
FT                   /translation="MSTRTPYRAALVGGSADETEAAFYEALQAGDIDRLMACWAEEDDI
FT                   VCVNPGGPRLLGAGAIRAAFTAMFEHGGLRARPAQVHRVQALASAVHSVVEHVEVRMEG
FT                   GVREALVQSTNVYHKTPQGWRLVAHHASPGTVHEAVAGPVPPVLH"
FT   gene            409907..410971
FT                   /locus_tag="Aave_0383"
FT   CDS_pept        409907..410971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0383"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="KEGG: rpc:RPC_2939 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30990"
FT                   /db_xref="GOA:A1TJ52"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ52"
FT                   /protein_id="ABM30990.1"
FT                   /translation="MDYVAPRWLPGGHLQTIWPALASRRAEGGAPAYRRERWTAPDGDF
FT                   VDVDFLDAPAAAPEPPRPLLVLFHGLEGSSRSHYAEAFADVARARGWDYAVPHFRGCSG
FT                   EINLAPRAYHSGDHEEIDWILRRMAQRQRPGGAPAGPRAPLLVAGVSLGGNALLRWAGE
FT                   QGLAAARSADAVAAVCSPLDLAAGGRAIGQGFNRLVYTRMFLRTMVPKALAKWRQHPGL
FT                   FDRDALRTVRDLHAFDDLFTAPLHGFRDADDYWRRASAQPLLGAVRIPALAVNALNDPF
FT                   VPADSLPRPGQAGTHVTLWQPPHGGHVGFAFGRLPGHVRAMPEAVAGWLARQAGLPAAH
FT                   PPGHAPTPSEAAAG"
FT   gene            410982..411530
FT                   /locus_tag="Aave_0384"
FT   CDS_pept        410982..411530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0384"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30991"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ53"
FT                   /protein_id="ABM30991.1"
FT                   /translation="MDDIVRQAIAKWPNVPDCYGWLGLDARGRWFMRDDAVQAQGSFPQ
FT                   ARGAVLQHDKLIDFIHRNYEPDARGRWFFQNGPQRVYVELEATPVVWRVEAGAEGSGEA
FT                   GFSIVAHTGLRSAVQECLLDESGRLYLFDGRVLGLVHTLDMELAARAVEQGLWTPADVR
FT                   ADELPRRYGYVQRPSELRD"
FT   gene            complement(411611..412510)
FT                   /locus_tag="Aave_0385"
FT   CDS_pept        complement(411611..412510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0385"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: pol:Bpro_0336
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30992"
FT                   /db_xref="GOA:A1TJ54"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ54"
FT                   /protein_id="ABM30992.1"
FT                   /translation="MSDTPHEEAHTGPIKTPRQLLWTVFVCFVVPVFAIIGLVIYVTSG
FT                   NKPAQGSGNPERALAERIQKVGMVEVRDANRPLRSGEEVFKGQCAACHATGAAGAPKFG
FT                   DAAAWGPRIQTGFEALVHSALAGKGAMAPQGGGDFNDTEIARGVAYMANAAGAKFTEPA
FT                   APAAGGASAPAEVQAGATGASGTPAPAAPAAPAMAAAQQAPAAPTAAAATAPAAAVAAG
FT                   AGEALYKQACQVCHAAGVAGAPKFGDKAAWAERLKDGIDGMTRIAIAGKGAMPPRGGTQ
FT                   ASDAEIRATVEYMANAAK"
FT   gene            complement(412676..413896)
FT                   /locus_tag="Aave_0386"
FT   CDS_pept        complement(412676..413896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0386"
FT                   /product="Kelch repeat protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: dre:562661 similar to activin beta B"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30993"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ55"
FT                   /protein_id="ABM30993.1"
FT                   /translation="MPTPSSPTSGHPASAAQRTNPWQVSRRRSLVGLACALAACTAAAG
FT                   PKPGPQDDGVWTRLSSEGAPSARSAPVAAALRGSIYLFGGVKDDFRAGTNDFLNDLHRY
FT                   DVHANRWTRLVPAGDAPSPRAFTGGVAMPHRGWVVVFGGARYSADLSDFTPLGDVWAYD
FT                   TRAGRWEALSGVAPGGAPAPSPRAWPTVWRAGDQLYVFGGVEAGFRTLNDLWRFDVSTR
FT                   TWTQLSPHGAPGSPPPRYSGAVTGEPWRGQIALYGGEATTGQGGFVFLRDTWTFDLRTL
FT                   AWRQATPAPGEDVDPPQNHGADALLGNGLLIAGGDQPGGATGCGAQFNQNPTNALWRLD
FT                   LNTAAWRHLAPQGDVFPRIKRTSAATVMGEMYVFSGFGFNCEAGSGGQVWNTDVWRYTP
FT                   PYRYWGH"
FT   sig_peptide     complement(413762..413896)
FT                   /locus_tag="Aave_0386"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.934 at
FT                   residue 45"
FT   gene            complement(414089..415567)
FT                   /locus_tag="Aave_0387"
FT   CDS_pept        complement(414089..415567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0387"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: pol:Bpro_2037 RND efflux system, outer
FT                   membrane lipoprotein, NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30994"
FT                   /db_xref="GOA:A1TJ56"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ56"
FT                   /protein_id="ABM30994.1"
FT                   /translation="MQAPSRARLGARPLLCAAAAAALLAGCSFIPTYERPAAPVPQAYP
FT                   AAGAAAAPAGARAAADIDWREYFADPRLQRLIALALENNRDLRVAALNIEQARAQFQIQ
FT                   RAGQFPTVNAAVNASRQPSATTGSYVNNYQVGLAVSAWEIDFFGRIAALKEQALAQYFA
FT                   TEEARRATQISLVAAVASGWFNLLADEELLDISRRTLQTRDESVQLTRLRLENGVSSEL
FT                   DYSQAQGLAQAARATFAQQQRQRLQDENALALLLGQPLPQEIAATLDARTRLADAPAMP
FT                   SLPAGLPSDLLVRRPDIRQAEQQLVAANANIGAARAAFFPRISLTASAGTVSNELSGLF
FT                   KGGSWAFSLAPQLALPIFDGGRNQATLDSARVGRDIAVAQYEKSIQTAFREVSDALAGQ
FT                   ATLGEQFAAQRAQAAADAKRFELSDLRYRNGVASYLDLLDAQRSLFTSEQLVVQTRLLQ
FT                   LQNQVALYKVLGGGWTAAQEPPATGGGATAAPHS"
FT   sig_peptide     complement(415463..415567)
FT                   /locus_tag="Aave_0387"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.875) with cleavage site probability 0.347 at
FT                   residue 35"
FT   gene            complement(415599..418757)
FT                   /locus_tag="Aave_0388"
FT   CDS_pept        complement(415599..418757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0388"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   rfr:Rfer_2065 hydrophobe/amphiphile efflux-1 HAE1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30995"
FT                   /db_xref="GOA:A1TJ57"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ57"
FT                   /protein_id="ABM30995.1"
FT                   /translation="MAKFFIERPIFAWVITIFIMVMGGLSITKLPIAQYPAVAPPTIQV
FT                   SVAYPGANAQTLEDSVLAVIEREMNGATGLAYVETTSQANGTGSITLSFEPGTNADLAQ
FT                   VDVQNRLSRATPRLPAAVTQQGVRVEQSRSNFLMFAMLTTENPDVSIEALNDYAARNVV
FT                   PELQRVSGVGTLTQFGAERAMRVWVDPAKLKGFNLSLDQVNAAIRAQNVQVSAGNLGDL
FT                   PAEQGQPVSATIVVKGQLNNAEQFGNVVLRANTDGSTVRLKDVARIELGSQSYSTSARL
FT                   NGKQAVGLGVQPTPSANALATAKAVRAKLEELKKFFPQGVNYVVPYDTSKFVSVSIEKV
FT                   VHTLIEAVVLVFIVMFLFLQNFRYTIIPTIVVPVALLGTFGALLAMGFSINVLTMFGMV
FT                   LVIGIVVDDAIVVVENVERIMAEEGLPPLQATRKAMGQISGAVIGVTVVLISVFVPLAF
FT                   FAGSTGNIYRQFAATMATSIAFSAFLALSLTPALCATLLKPIDPEHHADKKGFFGWFNR
FT                   SFKSTTHRYESWMGKLLRRGGRMMIIYAVLLGAVALVYTRLPTSFLPNEDQGYIITNIQ
FT                   LPAGAAQSRTSDVLHQVEDYMLKQPEVENIVTVAGFSFSGQGQNAGLAFVVLKDWSERS
FT                   GAEHSAAAISGRAFMALSGIRDAFIFALSPPPIPELGTGTGFSFRLQDRAAQGHDALVG
FT                   ARNQLLGMASQSKVLSGVRPDGMEDAPQMQIDIDRDKANALGVGFDSIGSALSTALGSA
FT                   YINDFPNQGRLQRVVVQADAAARMRPESVLDLPVLNNQGQTVPMSAFASTRWITGAMQT
FT                   VRYNGYPAMKIAGDAAPGFTTGDAMAEMEKLAGQLPPGFGFEWTGQSREEKLAGSQATV
FT                   LYAFSLLAVFLCLAALYESWSIPFSVMLVVPLGVLGVLLATLMRGMSNDVYFQIGLVTI
FT                   IGLSAKNAILIVEFAKDLQAEGRSVLEAALEAAHLRFRPIVMTSLAFTLGVVPLFIASG
FT                   ASSASQRAIGTGVIGGMITGTVLAVIFVPVFFVLVRSFFKGSKRQHDHEARQAHAHRHA
FT                   TDGE"
FT   gene            complement(418782..420086)
FT                   /locus_tag="Aave_0389"
FT   CDS_pept        complement(418782..420086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0389"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rfr:Rfer_2066 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30996"
FT                   /db_xref="GOA:A1TJ58"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ58"
FT                   /protein_id="ABM30996.1"
FT                   /translation="MYRLSVETAVSAAPLRRTARSGLFCLALLAAATLAACGKSGGSDQ
FT                   QGQGGTPPPPQVGVVTVSPGDVGLVTELPGRLEASRVAQVRARAAGILQKRLFTEGSDV
FT                   KAGQRLFAIDDAPYRASLESAQASVAQAEANVAQARALAERYKPLVAVNAVSRQEYDNA
FT                   VASQKTAEANLAAARASVTTARINLGYAAVTAPISGRIGRALVTEGALVGQGEATQLAV
FT                   IQQIDPLYVNFTQSASDALKLKAGLASGKYKQAAKGAASVSVVMEDGSVHPQTGKLLFT
FT                   DLSVDPTSGQVTLRAEVPNPERQLLPGLYVRVRLEQAQVDNGVLLPQQAVTRSARGDTV
FT                   MVVGPDNHLAPRPVKLGPAQGTNWVVLDGLKAGEKVMVDGFQKLPRGKPGDPIVVQPVP
FT                   WQPAGAAPAGGASAPAAGASAAQAPASSASAPAKQ"
FT   sig_peptide     complement(419970..420086)
FT                   /locus_tag="Aave_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.380 at
FT                   residue 39"
FT   gene            420283..420975
FT                   /locus_tag="Aave_0390"
FT   CDS_pept        420283..420975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0390"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; Tetracycline
FT                   transcriptional repressor MAATS-type, C-terminal domain
FT                   protein; KEGG: pol:Bpro_2034 transcriptional regulator,
FT                   TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30997"
FT                   /db_xref="GOA:A1TJ59"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013572"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ59"
FT                   /protein_id="ABM30997.1"
FT                   /translation="MARRTKEDAVATRNSLLDAAEHVFYQKGVSNASLNDIAQAAGATR
FT                   GAIYWHFKDKVDLFNAMMERVTLPLECASDECAGHNRMSPLHRLRAVIDFVLRSLEKDE
FT                   SVRRVFEIAMFRVEYVGELSVVRDRHVEASLEFRRQFAAELALAANDQGVELPSSADVA
FT                   AVGLQALFDGLMQVWMLGGATFGLAETGRATVDAYLRGLGFDVSAGFDPLSAGIPWKIC
FT                   QPRRNAVP"
FT   gene            421004..421079
FT                   /locus_tag="Aave_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            421004..421079
FT                   /locus_tag="Aave_R0001"
FT                   /product="tRNA-Arg"
FT   gene            421403..421732
FT                   /locus_tag="Aave_0391"
FT   CDS_pept        421403..421732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30998"
FT                   /db_xref="GOA:A1TJ60"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ60"
FT                   /protein_id="ABM30998.1"
FT                   /translation="MEHLLSVEQLAAVLHKSPASIRSDASRKPASLPPICRLPGTKRLL
FT                   WRRPDVDAWLALFVAPVTLGVPMALAQLPNRTEATRKRRRGRPTKSEQLARQRLAPTAA
FT                   TQPNA"
FT   gene            421826..422725
FT                   /locus_tag="Aave_0392"
FT   CDS_pept        421826..422725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0392"
FT                   /product="plasmid encoded RepA protein"
FT                   /note="PFAM: plasmid encoded RepA protein; KEGG:
FT                   xac:XAC2441 replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM30999"
FT                   /db_xref="InterPro:IPR006881"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ61"
FT                   /protein_id="ABM30999.1"
FT                   /translation="MAARTEKKATACPPGHEKLLLRAVEIANRPPSGEDMAFTHSVLCQ
FT                   VGLPRAKVEGREFMRQSGAAWVNVQAGWLDEGRGPVQQPIPYGPMPRLALAWVSTYAVR
FT                   HGTREIPIGDSAAGFLRLMDMDKDGRRYLTLRKQMHALAACRLQLGFKGRTFNGQPVEQ
FT                   FDAWVSNCESKQRPLWPGVMTLSEHYFNELRDSAVPLDNRALHALKGSALALDVYCWLA
FT                   HRLHRIEGKAVMLHWHSLRDQFAQEYKGKNADKDFKKKFVPALCKVLAVYPAANVKQVK
FT                   GGLRLLGSPPPIPKKLTS"
FT   gene            complement(423411..423605)
FT                   /locus_tag="Aave_0393"
FT   CDS_pept        complement(423411..423605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31000"
FT                   /db_xref="GOA:A1TJ62"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ62"
FT                   /protein_id="ABM31000.1"
FT                   /translation="MRLLIALILPWLTFFTIGRPIAGIICLILQITLIGWLPATIWAVY
FT                   ALSQYKTDKKIEKALSQRG"
FT   gene            complement(424143..424385)
FT                   /locus_tag="Aave_0394"
FT   CDS_pept        complement(424143..424385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31001"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ63"
FT                   /protein_id="ABM31001.1"
FT                   /translation="MAKTNAPLNGVFQPSTMELLRAYALFTEEVDDLHTTLDYLAESLV
FT                   LAHLEEHERFQDWIASRQKIAVVDRWLKRMGEGFI"
FT   gene            complement(424427..426370)
FT                   /locus_tag="Aave_0395"
FT   CDS_pept        complement(424427..426370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0395"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: bms:BRA0366 trbL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31002"
FT                   /db_xref="GOA:A1TJ64"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ64"
FT                   /protein_id="ABM31002.1"
FT                   /translation="MTSCITQRRAALLLLVIALTLFAADAALADVLNDIGNGYKTESAK
FT                   WFPKLLVIAKSLFWKLAAIEFAWASILWVLKSQEMQSFTAAVVQKLIGIGFFYFLLQNA
FT                   DYWIPAIVNSLVKAGNEATGLPALTPSEVFDLGIDTAVGMLKGIQALSLWEDFATVVVG
FT                   GLAALVIVISFLVIAGQMLIALIESYIAISGGVLFLGFGGSRWTVEFTQKYISYAFATG
FT                   IKLFILYLIIGVGTAQARTWASLLLTTDWNNIFAVMGGSMLLAFLGFQIPNMAASMLSG
FT                   APSLTAGAAAATSGALAAGTVAAGATAISPALQSARGGMQALRAGYDHHRAGGNSALSS
FT                   ALKAVGTSTVDMGREAGRSAGEAIGLAKPTASERSTVGGRAAERRDGMTAQIREERAAM
FT                   ADAGGMSKSSESDAGATCAPAESDGAKNGSADSKSTSAAPVVPPPGTPSGATGRPVDEL
FT                   HGASKPMAGHPQVADDYGNVVAPPSSKIAESNAGGVGTSATNVAAANTSAVNTSATGVN
FT                   AAQAGSSGSVPAQTLAAATPEAQRQVGQDSGSTVYPPSAKIAESDAGGAGTSAAGVSST
FT                   NTSAGNTSTTDKAASSGGGSSAPAPEAGKSGPTLGRDKAPFQDLQRVRPPQIPNDAAPQ
FT                   AGVNIRLTHSED"
FT   sig_peptide     complement(426299..426370)
FT                   /locus_tag="Aave_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.432 at
FT                   residue 24"
FT   gene            complement(426367..426855)
FT                   /locus_tag="Aave_0396"
FT   CDS_pept        complement(426367..426855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31003"
FT                   /db_xref="GOA:A1TJ65"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ65"
FT                   /protein_id="ABM31003.1"
FT                   /translation="MGLARTCAQLRQAVCQRTERIGAMPELQDRQQPEIIDADFREVCT
FT                   TGYQPSPIQRIAGSTVAAACCALMLAAGFELIDGRIAMLLLLVLGAGGYLAYIHLQANR
FT                   PGFVFFAAVALLAIGASVAFAGYYPLASLVALAVGGISGALARAARVDDAPCQRSTLK"
FT   gene            427229..427657
FT                   /locus_tag="Aave_0397"
FT   CDS_pept        427229..427657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31004"
FT                   /db_xref="GOA:A1TJ66"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ66"
FT                   /protein_id="ABM31004.1"
FT                   /translation="MGKLNAVRCDADFQRALEELANARGWSVPALFREAARQYMQGEEL
FT                   HRAMVDLEKRQAGSFKALHKEVRRLRHDMRVLMAVQELFIKSYYMHTPHVPEAARIVSK
FT                   AHAVERWEKLLRAIAGTMQDSGSLSNITVAPESTRSDE"
FT   gene            427955..429046
FT                   /locus_tag="Aave_0398"
FT   CDS_pept        427955..429046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31005"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ67"
FT                   /protein_id="ABM31005.1"
FT                   /translation="MHLVSEGLEMTGQVKAATLDALTPMVQRAEKLSLLLLLIERATSI
FT                   AVVRDFLKSRGLQHSAGSWEDLRTKRILPAYDEGKISLADLQELLRRTEGYGRQHVFLF
FT                   RCPADRAALLLADDRMQRVLNENNISDVGFDPLVVDLPDQPTFVDVRTAVIGGVKSVSI
FT                   KEIEKRTSKKLTSEVNDAAAMTLTKVYSYEHQRVINLVRLWANGLLEVRIASRDNSTKY
FT                   KDDLGQFFYRLRSIFPRTEFKEVSLSSLKKNLWEKRVELQSLVKFSTYTLRDDEGMTLR
FT                   ANTAVNADDLADSERIAKSLAEFDADTTYCADSNVYFKIADGEKVLKEIHVLLNGEDNE
FT                   FAVTAAITEEEYEFVLHQVLENN"
FT   gene            429620..430432
FT                   /locus_tag="Aave_0399"
FT   CDS_pept        429620..430432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0399"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bxe:Bxe_C0489 putative transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31006"
FT                   /db_xref="GOA:A1TIB7"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIB7"
FT                   /protein_id="ABM31006.1"
FT                   /translation="MPRKPYPTDVSDEEWSFAAPYLSLMDQRAPQREHDLREVFNALRW
FT                   LVRAGAPWRMLPNDLPPWEAVYQQTRRWLEAGCFEAMVSDLRSIIRVAQGRQGQPSAMV
FT                   MDGRTLQSSCESGPRAGYDGYKRKRGSKVHMAVDTLGHLLAVHVTPANEQERAQVQRLC
FT                   GDVQQATGHSVKLGWADQGYTGEVAAEAARDNGIDLQIVKLPEAKKGFVLLPRRWVVER
FT                   SFGWLARFRRLTRDYERLPEVLGGLHFLVFAVLMLPAAARVLAAAGSS"
FT   gene            430445..431152
FT                   /locus_tag="Aave_0400"
FT   CDS_pept        430445..431152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0400"
FT                   /product="ymc-like protein"
FT                   /note="KEGG: rba:RB4097 similar to ymc"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31007"
FT                   /db_xref="GOA:A1TJ69"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ69"
FT                   /protein_id="ABM31007.1"
FT                   /translation="MVALLHGIRTAAGWQEKARAALDVPGAIKVVPIGYRYKDVIRFLG
FT                   PCRGHAVDRVTRELRDLQRLNPGCELVVMAHSFGTYVISKILKDAPDIRIQRLLLCGSI
FT                   IPAAFRWDQLPHEFTDKTCVNEVGTRDIWPVFARVATWGYGESGSFGFKTARVTDRFFD
FT                   YGHSDFFTDEHFENFWRPFIAHGLVIPSPWDSKRPTPSWLVSVLGGLPMIKGVLLFLAV
FT                   GVLLFAFWLLGFY"
FT   gene            complement(431227..432225)
FT                   /locus_tag="Aave_0401"
FT   CDS_pept        complement(431227..432225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0401"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bpm:BURPS1710b_1722 probable site-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31008"
FT                   /db_xref="GOA:A1TJ70"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ70"
FT                   /protein_id="ABM31008.1"
FT                   /translation="MPTIRKKGDHQWHAQIRKRGYPSQTRTFTTRADAERWATIVESEM
FT                   ERGMFVSRTEAEATLVSDAVERYRREVLPSKRGKAADESRLKTLLRYFGSYKLAALTST
FT                   LIAQFRDERLTAVGPQSVIHEINLLNRVLKAAVMDWGIALPHGLPTTNVRKPAKPKGRE
FT                   RRVSQEEIAAIVAHSSSSELSVAITVAVETGMRRGELAALTWSNVDLIKRTAHIPLTKT
FT                   DAPRTVPLSSTAVAALQRLLPPHTEVIGKDRRVFAMQAASMQQALERACQAHRADIHNL
FT                   RFHDLRHEATSRFFEKGLSMMEVAAITGHKTLEMLKRYTHLRAEDLAKRLG"
FT   gene            complement(432478..433203)
FT                   /locus_tag="Aave_0402"
FT   CDS_pept        complement(432478..433203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0811 17 kDa surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31009"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ71"
FT                   /protein_id="ABM31009.1"
FT                   /translation="MEPHWRTGAGRPSVGRWRIRRPDGAHGRAIQTPSGPGGIHARRPG
FT                   LPCRAANVRNIAAARRQLMQVKVLFPYRTGTAPSLTRLRSAGRRGGPGTGNTTVPAGGW
FT                   PAAITRSTKPKENIMQPDKTTPPPASVGPSADGIPVEHRPGYGVPSQDPRPAAQVPLTP
FT                   EEAEREAGSVLAGGGVMAGAATGAAVGGAVAGPIGVVVGVAVGGVAGAVGGAAAGKAAA
FT                   TDPRDLPPPAARDTRSGER"
FT   gene            complement(433416..434183)
FT                   /locus_tag="Aave_0403"
FT   CDS_pept        complement(433416..434183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0403"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   pol:Bpro_4539 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31010"
FT                   /db_xref="GOA:A1TJ72"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ72"
FT                   /protein_id="ABM31010.1"
FT                   /translation="MCQLLGMNANTPTDVTFSFTGFAQRGGRTGDHSDGWGIAFFEDKG
FT                   LRHFVDHERAADSPIAELIRRYPIRSRNVIAHIRKATQGSVALQNCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHSHFHPVGATDSEHAFCWIMQELSKSHADVPSVQELTLTLRELAA
FT                   RIAPHGTFNFLLSNGQALWAHASTHLCYIERRHPFSQACLCDEDLSVDFSAHTTPHDRV
FT                   AVVVTAPLTSDEVWTPFRSGELKVFVDGACQAF"
FT   gene            complement(434270..435718)
FT                   /locus_tag="Aave_0404"
FT   CDS_pept        complement(434270..435718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0404"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_4538 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31011"
FT                   /db_xref="GOA:A1TJ73"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ73"
FT                   /protein_id="ABM31011.1"
FT                   /translation="MTGSAALLRERYGERYRWLLLLSVMVGTMASIMSSTIVNVAIPDM
FT                   SHHFTLGQARAQWVTSGFMVATTVAMLTTPWLLARYGYRATYVGAMVLLLVGGIGGGVA
FT                   GQYEWVLLARVLEGLAAGVVQPIPAVIILHAFQPHEQGRASGIFGMGVVLAPAIGPSVG
FT                   GLLVDWFGWRSIFFMVVPFCIASLALAYRYVPVSSPGGVAADRSGASLDSAGLLLGAVG
FT                   TLCLLNGLVSLRDGPAFTSAALLLSALAALAAFIAWERRMLARQGRPLMDLRLFEVRQF
FT                   AMGSIVAFIYGTALFGSTYLLPVFLQLGLQMSASHVGTLMLPAGIVLAITIPLVGRMAD
FT                   RQPTHLLVGTGLALLALSFGLMAFVELHTALWLLVAFAVLGRIGLGFILPSLNLGAMRP
FT                   LPKPLIAQGSSAISFVRMLGGAAGVSLCGIVLEWRIAAHGDSLQNAVSSPERIAAFGDT
FT                   FLLLTGLCLLALVAAWQLRPPREG"
FT   gene            complement(435831..436019)
FT                   /locus_tag="Aave_0405"
FT   CDS_pept        complement(435831..436019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0405"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: pol:Bpro_4532
FT                   4-oxalocrotonate tautomerase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31012"
FT                   /db_xref="GOA:A1TJ74"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ74"
FT                   /protein_id="ABM31012.1"
FT                   /translation="MPTYHIEMMEGRTVEQKKKLVEEITRVSVEILGGSPESVDILITD
FT                   VKRENWATGGKLWSERQ"
FT   gene            complement(436058..436297)
FT                   /locus_tag="Aave_0406"
FT   CDS_pept        complement(436058..436297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31013"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ75"
FT                   /protein_id="ABM31013.1"
FT                   /translation="MPDAAPLPDPARCPLCGQSNQCAIEAGRPAASCWCMDALVSPTAL
FT                   AAVPDPARGMACLCPRCAAGVQPSPDTAGAMPPI"
FT   gene            complement(436361..437938)
FT                   /locus_tag="Aave_0407"
FT   CDS_pept        complement(436361..437938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0407"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: eca:ECA3642
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31014"
FT                   /db_xref="GOA:A1TJ76"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ76"
FT                   /protein_id="ABM31014.1"
FT                   /translation="MKFQDLSIGKRLALAFGLLTFFIVGMLAVGSWRLQSVAQDTAAMM
FT                   NLPLAKERLISDWYRTIYTNVSRHALVARSSDTALAGRFTQENAAASRQSTEQQQQLAQ
FT                   LISGPEEQALFDRAGVLRKQFVTARDAIYRAKVEGRSDDAQRILDTEFTPSGKGYLDAL
FT                   QALLDFQRKQINEAAASVHSNYESGRDALILLGLLATAAAVALAIGITRSVTRPLHRAV
FT                   SVAESVAGGDLTVRSGSAARDEMGQLLRALDAMAARLRDTVGQVRRGADGIALASSEIA
FT                   TGNLDLSSRTEEQASALQQTAASMEQMTATVRQNADNAAQADQLARSASEMAVRGGEVV
FT                   GNVVTTMGGIHSASRKIVDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVVASEV
FT                   RTLAQRSATAAKEIKALIDDSVNQVDAGNRLVEEAGTVIRDVVAGVRRVTDIVAEISAA
FT                   SQEQTSGLEQVNRAIAQMDQVTQQNAALVEEAAAATGSLEAQASQLVQAVAVFRLAEAG
FT                   TALPRLAA"
FT   sig_peptide     complement(437822..437938)
FT                   /locus_tag="Aave_0407"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.883 at
FT                   residue 39"
FT   gene            complement(438082..440382)
FT                   /locus_tag="Aave_0408"
FT   CDS_pept        complement(438082..440382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0408"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: pol:Bpro_4517 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31015"
FT                   /db_xref="GOA:A1TJ77"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ77"
FT                   /protein_id="ABM31015.1"
FT                   /translation="MRIKNSNTVAPAGDFPPRTSLFHPPNPPTMTDRTSVHGLQVATLL
FT                   HRFIEERVLPGTGVDAAAFWSGFDAIVRDLAPRNIALLAERDRLQSELDTWHKAHPGPV
FT                   TDMAGYRAFLEKIGYLVPQPAGVQATTANVDDELAIQAGPQLVVPILNARYALNAANAR
FT                   WGSLYDALYGTDVISEEGGAEKGKGYNPVRGARVIAFARNVLDTSAPLAAGSHKDAKAY
FT                   RVEGGRLAVELQDGSATGLKDAAQFVGYQGDAAAPSSVLLRHNGLHLDIRIDRSTPIGK
FT                   TDPAGVSDLVLEAALSTILDLEDSVAAVDAEDKVAGYANWLGILQGTLTESFAKGGQTV
FT                   TRGLNADRIYTAPGGSGEVRLHGRSLMFLRNVGHLMTNPAVLWTDAQGAQREIPEGILD
FT                   AVVTTAIALHDLQGKGQGGIRNSRKGSVYIVKPKMHGPAEVAFASELFARVERLLGLPE
FT                   NTVKLGIMDEERRTSVNLKACIAAASARVAFINTGFLDRTGDEMHTAMQAGPMVRKGDM
FT                   KASAWIQAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDMMKAMLEQKIAHPRAGANTAWV
FT                   PSPTGATLHALHYHQVNVAEVQKELEKTSADAERDNLLTGLLTIPVAANPQWTDAEKQQ
FT                   ELDNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLLHGVVTE
FT                   DQVRKTFERMAAVVDQQNAGDPAYRKMAGRFAESAAYQAACDLVFKGVEQPSGYTEPLL
FT                   HAWRLKVKAGAAR"
FT   gene            440503..441480
FT                   /locus_tag="Aave_0409"
FT   CDS_pept        440503..441480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0409"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4493 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31016"
FT                   /db_xref="GOA:A1TJ78"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ78"
FT                   /protein_id="ABM31016.1"
FT                   /translation="MDKLKAFESFVSVATRGSLTAAARAEGVAPAIMGRRLDALEEHLG
FT                   VKLMVRTTRRISLTHEGSAFLEDCQRLLADVAEAEASVSVGGARATGHLRITAPAGFGR
FT                   RHVAPLVPLFRDLHPDVRISLNLSDRVVDLAGEGFDCAVRVGDLPDSSLVSVRIADNRR
FT                   LCVATPAYLERHGTPKHPSELARHACLMLSSDASQTRGWAFRMPAADPGGAPGDVVHVK
FT                   PTGPLDCSDGQVLHDWCLGGWGIAWRSTWEVEAEIAAGRLVAVLEDFAAPPNGIYVVFP
FT                   HARHLPLRVRLWIDYLKHHYAQPAFWRRAAHALTAPVLPSPPSP"
FT   gene            441477..442091
FT                   /locus_tag="Aave_0410"
FT   CDS_pept        441477..442091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31017"
FT                   /db_xref="InterPro:IPR021557"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ79"
FT                   /protein_id="ABM31017.1"
FT                   /translation="MTHRLHAPLPDVLRRPAPGRVSAALALAGLMAGCAGAPGTAPAPA
FT                   RDTAAASSRAKGSPPPGIVSVTYADPAGFSDARRGIHDTEQARRAWVDALCLYLSETAA
FT                   AALPEGQRLEVRITDVQRAGGFEPWRGPQAGQVRIVRDVYPPRIVLEFKRLAADGSVLQ
FT                   SGRRELRDPAFMERAARGGTDPLRYEKGLIDDWVRQEFGAR"
FT   sig_peptide     441477..441587
FT                   /locus_tag="Aave_0410"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.699) with cleavage site probability 0.501 at
FT                   residue 37"
FT   gene            442263..444833
FT                   /locus_tag="Aave_0411"
FT   CDS_pept        442263..444833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0411"
FT                   /product="quinoprotein glucose dehydrogenase"
FT                   /EC_number="1.1.5.2"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: mes:Meso_3525
FT                   pyrrolo-quinoline quinone"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31018"
FT                   /db_xref="GOA:A1TJ80"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017511"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ80"
FT                   /protein_id="ABM31018.1"
FT                   /translation="MAGLARITGVLVGITGVLVAGAGGWLVSLGGSPYYLIAGLALLAS
FT                   GVLLARRSAAGLWVYAALLLGSTAWAVWEVGVDWWPLAARLDVLFVLGLWLATPWMRRS
FT                   LLRGPAPLQPGLPGDAPARASSLRMPRMALGLALLLSAVLAVASWFTAPHELAGRLAGE
FT                   SVPAPAQAAPTLPDGEWHAYGRTGHGQRFSPLAQITPDNASQLKMAWEFRTGDVRGKEG
FT                   DPEETTYEVTPLKIGNRLFLCTPHQSVIALDATTGRQLWRYDPQIEGKLALQHLTCRGL
FT                   SYQPPRDPVADASPAALNAVAGAAAGGERTEPAPHASPTTTQPAAPATQAADQRQPPIA
FT                   ARNGPTDAACRAKLFMPTADGRVIALNPESGAVCTNFGGGTGQIDLWQRMPNLRPGAYY
FT                   STSPVVVTQRLVIVGGTVLDNASVKEQSGVIRAFDIDSGALVWNWDSGNPDDTAPLPPG
FT                   RTYTPNSPNSWSISSVDEALGMVYVPMGNQPPDQWGGNRSPAVEKYSSSVVALDLDSGK
FT                   VRWHFQTVHHDLWDYDVPSQPTLIDLQVGGQTVPALVQPTKQGELFVLDRRTGTPILPV
FT                   TEHPAPQGAAKGDRTAATQPKSALSFDPPPLTERDMWGGTMFDQLACRIAFHRLRYEGR
FT                   FTPPSEQGSIIYPGNFGVFNWGGIAVDPQRQVAFTTPTYLAFVSRLVPRKDDTSLLVQE
FT                   GGPPKGSLPALNENFGAPFAASMKPFTSPIGLPCQAPPWGYVAGVDLRTGEVAWKHRNG
FT                   TVRDLSPLPLPFRMGVPGIGGPMLTGGGVAFYSGALDNYVRAYDLNDGRILWQDRLPAG
FT                   GQATPMSYTGEDGRQYVVVVAGGHGSTGTKPGDSVRAYALPAQK"
FT   gene            444871..445359
FT                   /locus_tag="Aave_0412"
FT   CDS_pept        444871..445359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0412"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: reu:Reut_A0848 probable transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31019"
FT                   /db_xref="GOA:A1TJ81"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ81"
FT                   /protein_id="ABM31019.1"
FT                   /translation="MRHPFDAKDRRVTTEALLAYAHFLAILTMAVFLASEAALCRKEWM
FT                   NAAVVERLARVDLIYGLSALAVLATGLARVAWGMKGAGWYWSQPLLHAKVTLFVVIGLL
FT                   SIAPTMRFLRWRKALRATGALPDDAAIRSTRRLVMIEAHLLAVIPLLAVFLARGVGAR"
FT   gene            complement(445679..446044)
FT                   /locus_tag="Aave_0413"
FT   CDS_pept        complement(445679..446044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0413"
FT                   /product="PsiF repeat protein"
FT                   /note="PFAM: PsiF repeat protein; KEGG: rfr:Rfer_0772 PsiF"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31020"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ82"
FT                   /protein_id="ABM31020.1"
FT                   /translation="MKKLLSMMAAAGLALSFATAHAADTPAASAPAAAMASAPASTPGA
FT                   ASAKAHTAQQGKMTTCNAEAKDKKGDERKAFMKECLSAKKPATQQDKMKTCNADAKTKA
FT                   LKGDERKAFMKECLSNK"
FT   sig_peptide     complement(445976..446044)
FT                   /locus_tag="Aave_0413"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            446167..447876
FT                   /locus_tag="Aave_0414"
FT   CDS_pept        446167..447876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0414"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rfr:Rfer_0773 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31021"
FT                   /db_xref="GOA:A1TJ83"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJ83"
FT                   /protein_id="ABM31021.1"
FT                   /translation="MLSVKQELLAALAGELEKLSPGSAGRAAFESPKVAAHGDFACTAA
FT                   MQLAKPLKLNPRALGEQLKAALEATPAFARWVDAIEIAGPGFLNIRLKAAAKQEIVREV
FT                   LSAGDRFGYQKDNGQRVLVEFVSANPTGPLHVGHGRQAALGDAICNLFSTQGWSVHREF
FT                   YYNDAGVQIDTLTKSTQLRARGFKPGDECWPTDPENPASKTFYNGDYIQDIANDFLAKK
FT                   TVKADDREFTANGDVEDYDNIRQFAVAYLRNEQDKDLQAFNLHFDQYYLESSLYTSGRV
FT                   EATVNRLVEKGHTYEQDGALWLKSTDYGDDKDRVMRKKDGTYTYFVPDVAYHIAKWERG
FT                   FAKVVNIQGTDHHGTIARVRAGLQAADVGIPQGYPDYVLHTMVRVVKGGKEVKIGKRAG
FT                   SYVTLRDLIEWTSKDAVRFFLLSRKPDTEYTFDVDLAVAQNNDNPVYYVQYAHARIQSV
FT                   LRAWAEAGGGDVASLKDVDLSALEGPQAQALMLQLAKYPEMLTAAAEGEAPHDVTFYLR
FT                   DLAASYHSYYDAERILVDDEAVKRARLALVAATAQVLHNGLKVLGVDAPARM"
FT   gene            447873..448529
FT                   /locus_tag="Aave_0415"
FT   CDS_pept        447873..448529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0415"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   rfr:Rfer_0774 sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31022"
FT                   /db_xref="GOA:A1TJ84"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ84"
FT                   /protein_id="ABM31022.1"
FT                   /translation="MNHMTKKQQRGGSAVGFILGIVVGLGVALAVAVYVTKVPVPFLNK
FT                   GGARGSDQDALESQRNKNWDPNSPLYGKNPARPATPAASTPAVAGVVPAPASTPASAAV
FT                   AAASTPRAGASKPAAGASSADPLGDLARARAAAGAEPFDYFVQAGAFRTQADADAQRAK
FT                   LAMLGWEARVSEREQNGRTVFRVRVGPFTKRDDAEMLKEKLDGAGVESALVRVQH"
FT   sig_peptide     447873..447965
FT                   /locus_tag="Aave_0415"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.831 at
FT                   residue 31"
FT   gene            448599..449255
FT                   /locus_tag="Aave_0416"
FT   CDS_pept        448599..449255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0416"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pol:Bpro_4488 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31023"
FT                   /db_xref="GOA:A1TJ85"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ85"
FT                   /protein_id="ABM31023.1"
FT                   /translation="MKRREFSLSAATAVAASAVTLPVATPAFAQARQFKEGKDYTRLAK
FT                   PAPTDAPAGKVEVIEFFWYSCPHCNAFEPTLEAWIKSAPKDLVVRRVPVAFNSSFAAQQ
FT                   KLYFALEGMGKLPEVHAKVFRAVHVEKLPLNKDDQIFDWIGKQGLDVAKFKEVYNSFTV
FT                   SNQLRKAAQLQDAYGVEGVPAMGVAGRFYTDGTMAGSMQNVLQVVEYLAGVARKG"
FT   sig_peptide     448599..448688
FT                   /locus_tag="Aave_0416"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 30"
FT   gene            449375..450025
FT                   /locus_tag="Aave_0417"
FT   CDS_pept        449375..450025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0417"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG: rfr:Rfer_0776
FT                   OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31024"
FT                   /db_xref="GOA:A1TJ86"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ86"
FT                   /protein_id="ABM31024.1"
FT                   /translation="MRPRLLPTLLLLASMAFAVGPAQAEKADRNKPMNIEADALRHDEL
FT                   KQTSVFTGRVVVTKGTIVLRGTRLDVRQDPDGFQYGTMTAEPGKRAFFRQKRDTAPGAP
FT                   DEFVEGEGEVIEYDGRADLVRLIRRAELRRYRESTLTDEMAGALIVYNNTTDVFTVDGQ
FT                   KTAPGGAASSGTPGGRVRAVLSPKESASAPAAAPAPGAAPALRRSNELGSGAK"
FT   sig_peptide     449375..449449
FT                   /locus_tag="Aave_0417"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 25"
FT   gene            450028..450819
FT                   /locus_tag="Aave_0418"
FT   CDS_pept        450028..450819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0418"
FT                   /product="ABC transporter-related protein"
FT                   /note="PFAM: ABC transporter-related protein; SMART: AAA
FT                   ATPase; KEGG: pol:Bpro_4486 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31025"
FT                   /db_xref="GOA:A1TJ87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ87"
FT                   /protein_id="ABM31025.1"
FT                   /translation="MAASHPPDAAAAPASDAPSRLEAMHLEKSYGTRKVVKDVSMVVQK
FT                   GEVVGLLGPNGAGKTTSFYMIVGLVRSDGGDIRIDGQSVANMPIHRRSRLGLSYLPQEA
FT                   SIFRKLSVEENVRAVLELQRDDDGRPLSRAEIEERLTALLQELRVDHLRASPALALSGG
FT                   ERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQRIIGFLKARGIGVLITDHNVRET
FT                   LGICDHAFIISDGRVLAQGTPSEIVDNAEVRRVYLGEHFRM"
FT   gene            450819..452408
FT                   /locus_tag="Aave_0419"
FT   CDS_pept        450819..452408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0419"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN/SigL"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor; sigma-54 factor, core-binding region;
FT                   sigma-54, DNA-binding domain protein; KEGG: rfr:Rfer_0778
FT                   sigma-54 (RpoN)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31026"
FT                   /db_xref="GOA:A1TJ88"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ88"
FT                   /protein_id="ABM31026.1"
FT                   /translation="MKPGLSLRISQHLALTPQLQQSIRLLQLSTLELSQEVEQMLDENP
FT                   FLERNPDEAPREEFGLLQADAPVSDADRGAEESLYSPASGAVETAASAPGEGASEGSEA
FT                   PEAPDAPDWEGDGTVEMAPDDGEWGGEAPARTRNQLGDEDDTDATELAREHESLTDYLH
FT                   RQALSLRLSEVDRAALRFLIESLNDDGYLDESLEALAVALAGEEDPEQVEELVHRFTVA
FT                   LRLLQSLEPVGVGARGLSECLALQLRALQEDGDAEPEVLQAALRICNQPLEMLARRDVR
FT                   RLAQGCGAGEECTRAAMALIARLEPRPGRAFAQVERNIIVPDVIVKKSSGRGAAHAFTV
FT                   QLNPDVMPRLRVHDIYAGALRGNRGGEGHQALQQRLQEARWFIKNIQQRFDTILRVSRA
FT                   IVDRQKNFFVHGELAMRPLVLRDIADELGLHESTISRVTTAKYMATPQGTYELKYFFGS
FT                   GLGTETGGNASSTAVRALIKQFVASESPAKPLSDSQIAEMLKEQGIECARRTVAKYREA
FT                   LKIAPANLRKAL"
FT   gene            complement(452433..452975)
FT                   /locus_tag="Aave_0420"
FT   CDS_pept        complement(452433..452975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0420"
FT                   /product="TspO and MBR-like protein"
FT                   /note="PFAM: TspO/MBR family protein; KEGG: csa:Csal_0168
FT                   TspO and MBR like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31027"
FT                   /db_xref="GOA:A1TJ89"
FT                   /db_xref="InterPro:IPR004307"
FT                   /db_xref="InterPro:IPR038330"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ89"
FT                   /protein_id="ABM31027.1"
FT                   /translation="MTSPSTPPSPATASARRAPLSFHTWLALASWLLLCFIAAGTGSVA
FT                   SVQAPQFYAQLVQPPWAPPPGVFGPVWSVLYTLMGIAAWLVWREPAGKARRQALALFCA
FT                   QLALNALWSWLFFQWHRGAWALADIALLGICVAATFVAFLRLRTLAGLLLLPYLAWISF
FT                   AGALNYTLWRMNPGLLG"
FT   sig_peptide     complement(452838..452975)
FT                   /locus_tag="Aave_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.453 at
FT                   residue 46"
FT   gene            complement(453036..454892)
FT                   /locus_tag="Aave_0421"
FT   CDS_pept        complement(453036..454892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0421"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase, HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   rso:RSc0606 putative methyl-accepting chemotaxis
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31028"
FT                   /db_xref="GOA:A1TJ90"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ90"
FT                   /protein_id="ABM31028.1"
FT                   /translation="MFHSLRARLIGICIAITALSLIALALATFFVVRGNTLSGLDERIG
FT                   QLTRLHAGELTEWVKEKQRITSSLKTAVGQAEPVPFLLAAKQAGAFDDTYFVYADKRNI
FT                   FAHPMPEGYDGTARPWYRQAVQAGGPALTPAYVDASTGKLTISFVEPVGPAGQPTAVIG
FT                   TDMHLDTVTRKVNAIHPMEKSFAFLLDGQGNILAHAKAELALKPVTAISPALDGAQIAR
FT                   LASDGGRADISIDDAPTMLYAAKVEGTPWILAIAIDRAEATRPVRELLNVAVAITVLCM
FT                   LAAVGLLTYAVSRQLRRLAVVRDALEDIASGEGDLTRRLDTHGSDELTQISRAFNHFVD
FT                   KIAAVLVRIRASSEAVRLATSEIASGNQDLSGRTEQQASSLEETAAAMEQLTATVQQNA
FT                   ENARQANHLAANASQIAAHGGTVVGQVVQTMGGIDASSRKIVDIIGVIDSIAFQTNILA
FT                   LNAAVEAARAGEQGRGFAVVASEVRTLAQRSATAAKEIKSLIDDSVQQVNAGSRLVQDA
FT                   GSTMQEVVESVQRVTAIVAEISSASQEQSTGIAEIGSAVSQMDQSTQQNAALVEQATAA
FT                   AQSLQQQAHQLADAVAGFRLEAHGSATHAPRHPALGAPAGRA"
FT   sig_peptide     complement(454815..454892)
FT                   /locus_tag="Aave_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.479 at
FT                   residue 26"
FT   gene            455047..456372
FT                   /locus_tag="Aave_0422"
FT   CDS_pept        455047..456372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0422"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: pol:Bpro_4484 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31029"
FT                   /db_xref="GOA:A1TJ91"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ91"
FT                   /protein_id="ABM31029.1"
FT                   /translation="MNSLQIFLPCAAGVEGFLADEVHGITGLTGHDLLTGRGGAMARAS
FT                   WREALRLNLHSRLAQRVLVHLAERMYRSENDLYAIASGIAWEIWFTPRQSFRIDVTAQH
FT                   SPLQSLNFAALRVKDAVADRFRAKAGGVRPDVDTQRPDVRIHLHLTTDQATVYIDTSGE
FT                   PLFKRGWREDKGDAPLKETLAAAMIAASGWDPLGDTPVPLYDPCCGSGTIAIEAAQMAC
FT                   RIPPGLRRRFAFEKLLPFQAHVWNALREEAQDGIVPAAVPVFGSDVSHRMVDFAQRNAE
FT                   RAGVAQAVQLRGGDALQRMPPGDRPGVMLLNPPYGERIAAAGTAGRSARERMGVVERAG
FT                   RETAQTEDGGDFFLQLAAHWKKHYAGWQAWMLTPDMKLPGKMRLKESRRVPMWNGPIEC
FT                   RLFRFDMVQGAVRPRAEGAPPPPADAPAGPGSAADAGRNHAG"
FT   gene            456362..456844
FT                   /locus_tag="Aave_0423"
FT   CDS_pept        456362..456844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0423"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   rfr:Rfer_0780 protein of unknown function DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31030"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ92"
FT                   /protein_id="ABM31030.1"
FT                   /translation="MPVELCLPARAAEGEPARCVVVDTNVALDLLIFSDPRTGPLRQLL
FT                   AQGRLAWIATQVMRDELERVLAYAHIVERMDFYRVDAARVLAAFDAQARLVEIAPRVAY
FT                   VCKDADDQKFIDLAAAHRAILLSKDKAVLCMRKRLLNMDAHVATALVLEAVQPEAA"
FT   gene            complement(456861..458783)
FT                   /locus_tag="Aave_0424"
FT   CDS_pept        complement(456861..458783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0424"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter-related protein; SbmABacA
FT                   family protein; ABC transporter domain protein; SMART: AAA
FT                   ATPase; KEGG: dar:Daro_0045 ABC transporter-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31031"
FT                   /db_xref="GOA:A1TJ93"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ93"
FT                   /protein_id="ABM31031.1"
FT                   /translation="MPSSATAAAPLPTAAEPDPKAAAGARAPTLSLAAWRQFMAVAKPY
FT                   WLGDRKVAAWSLLGLLILLMLLETHLAVRLIDRTGEMTSALAAQDRGRFWDAVRTCLIV
FT                   LAFAVPVYAFYYYMRDAFANHWRRWLTHRFLDGYLGRRRYYELNAEGTVDNPDQRISED
FT                   INSFTGRSTHFLLIFIGAMMQLVAFSAVLWSISQALVAFLAVYALVGTVMALYVFGAPL
FT                   IRLNFWQLRREADFRFGLMRLRENAESIAFYRGEAQERAQLDHSFQAVFNNYARLIKRQ
FT                   RSLNLFQRAFSQLTLVIPSIILADAVLSGDMEVGRAIQAGGAFAAVLASVSLIVDNFEN
FT                   LSRFVAGIGRLDTLRQALEAPADRRTPEPMEPEAAAAARRQLREQRREQRRARRRGGVP
FT                   SATAAAPVAALSPQACGEIEAREGERFAVEGLDLYTPRFARLLVRDLSLDLQPGDALLI
FT                   TGASGCGKSSLLRALAGLWRDGRGVVHHPPMDSVFFLPQRPYMQPGTLRSQMIYPARDT
FT                   DLADEQLLEVLNAVQLPDLAGRVGGLDAVRDWEKELSIGEQQRLAFARVLVRQPRTVIL
FT                   DEATSALDSANEAALYERVRASGASVISIAHRPAVLAHHTHVLVLTGDGGWSLHPAEGF
FT                   QFDEG"
FT   gene            complement(458922..459779)
FT                   /locus_tag="Aave_0425"
FT   CDS_pept        complement(458922..459779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA1441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31032"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ94"
FT                   /protein_id="ABM31032.1"
FT                   /translation="MPAFPPDPAPPTAPACPAHRSARPDWDAFLRERLPSQVHAVESHI
FT                   AADGTRVWLKRAAPVRGPGRHRAMALLAGMLGLPVLRPVPTPGGAEGIATEVRRLRAFS
FT                   ALGLRVPEVLAYSAEGLLTLDLGRPEVDTHSLGNEIEHHLGDGPETVLALWRQGLAAIA
FT                   QVHARGTCLSQAFARNLVRCPDGVVGYLDFEDDPAATLPLPVCQARDLLCYAHSTALYL
FT                   RASDALAPARAEVAAWTAAHGPEFRQTMAQALRRLAWLRRLPQDRRWGRDVQRIRAAYD
FT                   LLAP"
FT   gene            459973..460809
FT                   /locus_tag="Aave_0426"
FT   CDS_pept        459973..460809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0426"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   reu:Reut_B5710 sec-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31033"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ95"
FT                   /protein_id="ABM31033.1"
FT                   /translation="MTDPHAPAADASGAVPALSNDDLDELDALLDDLRSRAEEIPQWEF
FT                   CDGFLTALVCTRRAIAPAEYLPMLLDDGGPMDIVAEGEALPRLPAFQDDAQQARFVELW
FT                   MRRWNEVAGQLEDTVESLEDDRAFQPEVMDMRGAIACLPEEERAEMAGQDVPSFGQVWA
FT                   LGFMFAVENWPEEWAAPRDKEAAQWLDGALDHIVALTEDDTGRPEHNMYAEDGPPSVSE
FT                   DRLEVFGEAIWAVYDLRQLWKSMGPRVESVRRADTPGRNDPCSCGSGKKYKKCCGN"
FT   gene            460957..462438
FT                   /locus_tag="Aave_0427"
FT   CDS_pept        460957..462438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0427"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; Xanthine/uracil/vitamin C permease;
FT                   sulphate transporter; KEGG: xcb:XC_0640 sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31034"
FT                   /db_xref="GOA:A1TJ96"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ96"
FT                   /protein_id="ABM31034.1"
FT                   /translation="MTSSFLTRLRAEWAPSIPRELLAGAVATFALIPEVIAFSFVAGVD
FT                   PSVGLFASFVISIVIAFAGGRPAMVSAAAGSVALVAAPLVQSHGVGYLFAAGLLAGAVQ
FT                   VAFGLLRMGVLVRFVSSSVRTGFVNALAVLIFSAQLPHLQDAGPATWGMLALGLAVIYG
FT                   LPRLGAWLGWRALTAIPSPLVCVVALTALASAAGLPLPTVADLGTLPDALPAFALPGVP
FT                   FTLETLRIIALPALAIAFVGLLESVLTAAVVDEMTDTPSDKNRECAALGLANIAASLTG
FT                   GIAGCGMIGQAVGNVKYGGRGRLSTLFAGVFLLVLMVALKDWVSRVPVIALVAIMVMVS
FT                   ASTFDWASLRTLVRHPRTSSAVMLATVAVTLGTHNLAAGVAVGVVLSGVFFAFKVARLL
FT                   DVRAEDDQATGLRTWRVAGQVFFASADAFIDAFDILAAEGRPVRIDVSRAHFWDVTAVA
FT                   ALDKVVQRLRHHGCSVEVAGLNEASAGLVERVGGP"
FT   gene            complement(462442..464235)
FT                   /locus_tag="Aave_0428"
FT   CDS_pept        complement(462442..464235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0428"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; CHASE3 domain
FT                   protein; KEGG: tbd:Tbd_1619 chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31035"
FT                   /db_xref="GOA:A1TJ97"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ97"
FT                   /protein_id="ABM31035.1"
FT                   /translation="MAARSLTVSQRLLIAFGLVIAIFVAVAATALVSSRSLAEAESWNE
FT                   HTYQVLDRSNALLRSMINMETGARGFLLSGDEKHLEPWNGGAREFNEAFADIKGMTADN
FT                   PVQQQRLEAMKARETEFASVLSGLIQARREVTAGSRTLQDLLPQFGQGKDKAAMDAFRA
FT                   LQKELDQAESGLLAERKAGADRMRGINTAVILAGSALAVALAGALGIWVTRSITRQLGG
FT                   EPDYATGIVRQIAQGNLAVEVDTRAGDRSSLLAGMKDMRDQLARVVGQVRQSSDSIATG
FT                   STQIATGNADLSQRTEEQASNLQQTAASMEQLTATVKHNGDTARQATQLANSASEVAER
FT                   GGTVMGQVVSTMGAITDSSRRISDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAV
FT                   VASEVRGLAQRSADAAKEIKALISTSVEKVEAGSQQVEEAGRTMSDIVTQVKRVNDLIS
FT                   EISAATQEQTQGIGQVSEAVSQLDQVTQQNAALVEESAAAADSLRAQAGRLVDAVSQFR
FT                   LHHDQGLPAPAPVPVAAPRAVAAPATAGTLPAARPAPARVPAPPRAPALAARRPAPVPT
FT                   KAPAPSLALAGSSGEDDWTSF"
FT   sig_peptide     complement(464152..464235)
FT                   /locus_tag="Aave_0428"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.539 at
FT                   residue 28"
FT   gene            complement(464508..464978)
FT                   /locus_tag="Aave_0429"
FT   CDS_pept        complement(464508..464978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0429"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: pol:Bpro_4476
FT                   CinA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31036"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ98"
FT                   /protein_id="ABM31036.1"
FT                   /translation="MSGDIALLAQALPARGWMLATAESCTGGMIAGACTDLAGSSRWFE
FT                   RGFVTYSNAAKTELLGVAAALIDTHGAVSEAVARAMAEGAVRHSRAQAALSVTGVAGPE
FT                   GGSTAKPVGTVWFGWHVGGTTHSEMRRFPGDRAAVRSAARDHAIAGLARLLR"
FT   gene            complement(464975..465517)
FT                   /locus_tag="Aave_0430"
FT   CDS_pept        complement(464975..465517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0430"
FT                   /product="phosphatidylglycerophosphatase"
FT                   /EC_number="3.1.3.27"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pol:Bpro_4475 phosphatidylglycerophosphatase A"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31037"
FT                   /db_xref="GOA:A1TJ99"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJ99"
FT                   /protein_id="ABM31037.1"
FT                   /translation="MNALPPQPAAGAAAAPRRASAAFMRSHPAHWIALGFGAGLSPRAP
FT                   GTVGTAWAWLAYLLLQQWLSPLQIGGLILAGTLVGWWACTTTARHLRVADPGCVVWDEI
FT                   VAFWCVLWLAMPMGFWGQCAAFALFRFFDAAKPGPVAWADQLFKGFGWRGGWGILFDDF
FT                   VAAFCALFVIALWRVLW"
FT   gene            complement(465514..467274)
FT                   /locus_tag="Aave_0431"
FT   CDS_pept        complement(465514..467274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_2312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31038"
FT                   /db_xref="InterPro:IPR011935"
FT                   /db_xref="InterPro:IPR025554"
FT                   /db_xref="InterPro:IPR037291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA0"
FT                   /protein_id="ABM31038.1"
FT                   /translation="MSSACPGTAHSTLSTLSAPPVPPPRRARRAAAACLWLAAAGMASA
FT                   QERPSVVASRITQVTVAPGVATIERSARIAAGARSATFACLPASLDPDSLQISADAGVR
FT                   VGEFKVTTEDRDVAADCASPLDDRVRALEDQIAGVQAEIAALRRADRYLDHLAGGTSAD
FT                   GAPRDGQGGPPAAAATVAPAVLPAQIPATAEALRKTSADTLVRLQPLLRRQEALERDLK
FT                   PLRAERDRTAGGPRAKVVSVAVNLATDRDAGLRLSYQVRGPGWQPAYRARLDTATGAVV
FT                   LERLAVVAQRSGEDWNDVRLVLTTQAPARATAGPRPGTWTVDVAPPPEPQYRLARLPAA
FT                   MAMAAPAPAPMAESADAGEEPLPRFDVVALAGSYATRFEVPRRLSVPASGQRTTLLLGT
FT                   HDAGARLVTRTVPAQRETAYLVAEIAPPAGVWPAGAVGLYRDGAFVGQGRLDFASATDA
FT                   GAPGGRTVPLWFGPDDLVQVHAEPLRETTGTAGFTGAAVERRTQLAYRVENRHTTPITL
FT                   QVIDTAPVSRDAKIEVESRYAPSPLTTAWEGTAGIVAWQQPLAPGAGARFTAEHVVRHG
FT                   KDVELNENRR"
FT   sig_peptide     complement(467137..467274)
FT                   /locus_tag="Aave_0431"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.987 at
FT                   residue 46"
FT   gene            complement(467341..468321)
FT                   /locus_tag="Aave_0432"
FT   CDS_pept        complement(467341..468321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0432"
FT                   /product="thiamine-phosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: pol:Bpro_4471 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31039"
FT                   /db_xref="GOA:A1TJA1"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA1"
FT                   /protein_id="ABM31039.1"
FT                   /translation="MGEFDLIARYFRRPVRRAALGVGDDCALLAPAAGMQLAVSSDMLV
FT                   EGRHFFADVYPAHLGHKALAVNLSDLAACGARPLAFTLALALPRADEVWLQGFSEGLLA
FT                   LAGEHGCELVGGDTTQGPLNICITVFGEVPAGQALLRSGARPGDDLWVSGHLGDARLAL
FT                   DALLGEMPVQLPPQLLAQARERLERPTPRVALGQALRGVASSAIDVSDGLVGDLGHILQ
FT                   ASGVGARINTSLAPQLMAACAGHAPGQLPCGRENLLRCVLAGGDDYELLFTAPPGRRAQ
FT                   VEAAARQGGTRATCIGAIEAEPGLRLLDAQGQQMDAQYLAFDHFR"
FT   gene            468607..470880
FT                   /locus_tag="Aave_0433"
FT   CDS_pept        468607..470880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_1210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31040"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA2"
FT                   /protein_id="ABM31040.1"
FT                   /translation="MPEPQGHPELASFAIVDAEEAGSNLVAAAKYFTDPLHGVSEEASE
FT                   LANGGGKPEGGAEAPGDGASSGGVEGHPPAHGSDQPAAEHGAGTESATHHGEVHGAGEH
FT                   HGPMHAFTEEGTPSGVSDLATTLGLGGAMLPLSAMAIHAGYRELREVAEQREELRHQKE
FT                   ALQQRRDTLAPVLNDDPAHPAGRAQSHAIDQAIDDVSYQQHLNRHDGRVAASTLTSASL
FT                   IFAKTAVETSVHAGLAIGAGSANAGGLVAHSAAAAGAASAATIAGAYVLGPAASVMASV
FT                   VGGVFLHQSRAEKKRFRADFSRVSEFLAGVDAQRLGPDAQRYHDFLKTKFDQRKRFVSG
FT                   FNNWNKGFVAGGVTYTASTAAKVGVGIAAIAGASAAGPVGLALLISAGLVGAVTMGVGS
FT                   HQFFLTHGKLKRYRDYERGDAVGIDRAFLAMADLLQAAPVPGEHPAAAAQGPELQADGG
FT                   SEFHSARSSFASTVSEAASDAEPAEPAGFKLRSALYAATDGREKVLGDFLQKAATDRKK
FT                   HYRDKGRSTDEAPPAAPSRKHSTAREASALVRGGMAYGKSLLTGHKPREARQKARQAYA
FT                   DRTDRLTSTALAQWLDDPASRQAQVDFMRSVAELQVDYLQCKLAAREPLKALEDALAGA
FT                   DGAARDGSSPMTQADLAAELRKARADDEAQWLQWKSLQASLGGNAASAPGASLMMQSLR
FT                   QQFLLCETGTAHAREDTSLQFARYCLKHARARATAVRGTLLATEMQAARVREKAAGMPA
FT                   ASAG"
FT   gene            complement(470913..472037)
FT                   /locus_tag="Aave_0434"
FT   CDS_pept        complement(470913..472037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0434"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: pol:Bpro_4470
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31041"
FT                   /db_xref="GOA:A1TJA3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJA3"
FT                   /protein_id="ABM31041.1"
FT                   /translation="MSLEAFHHSEPLTLGVELELQLVNTHNYDLAPYAEDMLRLMARQP
FT                   LPGSVVPEMTNSMIEVSTGICHSGSEVLGQLTQIRDALVRSADKLNIAVVGGGTHPFQQ
FT                   WHERRIYDKPRFQELSQLYGYLSKQFTIFGQHVHIGCPDADAALLMLHRMSRYIPHFIA
FT                   LSASSPYVQGQDTAFDSARLNSVFAFPLSGRAPMVLTWKDFEAYFDKMTRTGVVKSMKD
FT                   FYWDIRPKPEFGTIEIRVFDTPLTIERAAALSAFVQSLGAWFLAEQPFTPSEDDYLVYT
FT                   YNRFQACRFGMQAVYVDPATGEHMPLRDHILQTIDHIARHATVTGASGALHLLRSEAAA
FT                   GQNDARWLRDRQRDEQLLGEVSRQAALRFRGAPA"
FT   gene            complement(472034..473293)
FT                   /locus_tag="Aave_0435"
FT   CDS_pept        complement(472034..473293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0435"
FT                   /product="transporter, CPA2 family (2.A.37)"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pol:Bpro_4469
FT                   sodium/hydrogen exchanger; TC 2.A.37"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31042"
FT                   /db_xref="GOA:A1TJA4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA4"
FT                   /protein_id="ABM31042.1"
FT                   /translation="MDEIMGFWAQWLRPSAGLPTVQWSLLLAVAAVSGYLFQRHIGLPK
FT                   VVGYTLVGTIAGLLGFSGAVWPLQGISLFLLELGIAIVLFEAGGRIPLRWFRHNPMVLV
FT                   QSIIESALTYFAVYYAMLWLDVPQRAAGPLALVALAASPAVLTRVVADTRAAGPVTDRA
FT                   IVLATLSTLYALTLGSATAELINRPAARLMDTVYPVMVVLGVSIIVGAVLALVLRMALR
FT                   FMSPTSENTAFLLLTLIAAGTAVAAHMGGSAPLAALLAGMLLKQLNPRPWTWPRQLGTA
FT                   ASLLTMLMFVLVSTVAAQADWSGPVAGLVLALIVARLVAKALGVALGNVGSGASWRQAL
FT                   WVGCAMTPMSSIALLIASQFVVASASTGQLIARVALPTILLMEVLGAVIATVAIYRAGE
FT                   SSKPWAPQTRAANAEREQQP"
FT   gene            complement(473437..475428)
FT                   /locus_tag="Aave_0436"
FT   CDS_pept        complement(473437..475428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0436"
FT                   /product="putative site-specific recombinase transmembrane
FT                   protein"
FT                   /note="KEGG: rfr:Rfer_0530 putative site-specific
FT                   recombinase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31043"
FT                   /db_xref="GOA:A1TJA5"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA5"
FT                   /protein_id="ABM31043.1"
FT                   /translation="MTRQTAPQPGTLLADLDPSAPLARRHLWLIECLAWVRGNCRSPEE
FT                   AVARLARLVEAAESDAGARTRLQAWWSALVGTVDITTLLADFGFAPRTALASEVAERLR
FT                   YKLLPGSPETIDASELFMLALPHEFDAQWLALLDEALLARLLALLVPAADGGGATRWQH
FT                   SLLDAITYCAGQILSTGFAPELRLRMSDSARDAQPFHALIRDVESLRVEVLHQLRTTDR
FT                   LDEAVLRLRERLEACRAAAATVYSHFEDNGISVGLVFRLRQLRERILRVRDLLDCLLSP
FT                   EPAASAARLMARLVTVGRERRSLRALIASNSSLLAAKVAERSAETGEHYITRTGAEYRA
FT                   MVAKAAGGGFVMAFTTLMKFGIVALALSSFWSGFWAGMNYAVSFVLVMLLHCTVATKQP
FT                   AMTAPAMAAKLKELQTTEAVESFVDEVTHLVRSQVAAILGNVLVVFPTVAGLTLAIAWA
FT                   TGSPAIDRAEARHVLQSLQLAGPSLLYAAFTGVLLFASSIIAGWAENWFVLHRLDSALR
FT                   YNPRITALLGRERAARWARFWRENLSGFAANVSLGFMLGLVPAFLAFFGLGLDVRHVTL
FT                   STGQLGAALTALGTSALHQPAFWWAAATLPFIGALNVGVSFYLAFRLALRAHNVTRVDR
FT                   ARLTTALRARLRHAPLQFFVPRRMAQRA"
FT   gene            complement(475425..475835)
FT                   /locus_tag="Aave_0437"
FT   CDS_pept        complement(475425..475835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0437"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: pol:Bpro_4467 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31044"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA6"
FT                   /protein_id="ABM31044.1"
FT                   /translation="MPKYQFRAEVQPEYLPDQSAPEDGVYSFAYTVTVTNTGDVPAQLI
FT                   ARHWTISDARGHTEEVKGLGVVGQQPLLRPGEAFQYTSGCRLRTPSGSMHGSYFCVAED
FT                   GERFDCAIPLFVLEALSGGPAGSTPLSGRVLH"
FT   gene            475959..476639
FT                   /locus_tag="Aave_0438"
FT   CDS_pept        475959..476639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0438"
FT                   /product="ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="PFAM: ribulose-phosphate 3-epimerase; KEGG:
FT                   rfr:Rfer_0532 ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31045"
FT                   /db_xref="GOA:A1TJA7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA7"
FT                   /protein_id="ABM31045.1"
FT                   /translation="MTRQFRIAPSILSADFARLGEEVKNVIASGADWVHFDVMDNHYVP
FT                   NLTFGPMVCQALKPHAVTPDGRPAPIDVHLMVQPVDALAAAFAEAGADYISFHPDASAH
FT                   VHRSIQAITSKGIKAGLVFNPAAPLDVLDWVIDDIDLILVMSVNPGFGGQSFIDSALRK
FT                   IEALRRRIDACGKDIRLEVDGGVKVDNIRRVADAGADTFVAGSAIFGKPDYRAVIDAMR
FT                   AQLG"
FT   gene            complement(476686..477270)
FT                   /locus_tag="Aave_0439"
FT   CDS_pept        complement(476686..477270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB3039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31046"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA8"
FT                   /protein_id="ABM31046.1"
FT                   /translation="MPNRFAIAPRILSAACLIAACAAAQAAPGDAASARERYQQDRQAC
FT                   MSGNTGQSRETCLKEAGAALQAARSGQLGAQDATDGYSRNALQRCEVFKNPVDREACAA
FT                   RVRSGTQDGSVAGGGILREATIQVPAAPQSGAAAMPAPQGDATGAMAPQGRPHPHGKPH
FT                   AHPMPGAPKAPPPAPMPQPMTQPAPQPMPQR"
FT   sig_peptide     complement(477190..477270)
FT                   /locus_tag="Aave_0439"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            477527..478234
FT                   /locus_tag="Aave_0440"
FT   CDS_pept        477527..478234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0440"
FT                   /product="phosphoglycolate phosphatase"
FT                   /EC_number="3.1.3.18"
FT                   /note="KEGG: pol:Bpro_4462 phosphoglycolate phosphatase;
FT                   TIGRFAM: phosphoglycolate phosphatase ; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 1; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31047"
FT                   /db_xref="GOA:A1TJA9"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJA9"
FT                   /protein_id="ABM31047.1"
FT                   /translation="MLECSPAALVARADAAIVDLDGTMVDTLGDFAEALRRMLGDLSLP
FT                   GIDAAEIERMVGKGTEHLLRSVLDHVLQPMEPQRRAAAVEAHYPQAWEAYGRHYLAING
FT                   SHSRVYEGVAEGLQALRAAGLRLACVTNKPGAFAVPLLRAKGLDGFFDHVFGGDAFERK
FT                   KPHPLPLLKACEALGTAPARTLAIGDSVNDARAARAAGCPVVLVTYGYNHGQPARQVDA
FT                   DAHVDSLQSLCAG"
FT   gene            complement(478259..478858)
FT                   /locus_tag="Aave_0441"
FT   CDS_pept        complement(478259..478858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0441"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: pol:Bpro_4459 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31048"
FT                   /db_xref="GOA:A1TJB0"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB0"
FT                   /protein_id="ABM31048.1"
FT                   /translation="MTLRQRGLAWALAGLIACGAAPAGAQTAATVAGVAFEPRVTLADV
FT                   PLALNGAGVRYKAVFKVYAAGLYLERHAATLRDVVALPGPKRLSVTMLRDIDSTELGKL
FT                   FARGIEDNLDKAAFSRLAPGVLRMGEIFAAHRRLAAGDRFTVDWLPGTGTVITVKGVPQ
FT                   GEPFHEPEFFGALMAIWLGPQPADWKLKDALLGKAG"
FT   sig_peptide     complement(478781..478858)
FT                   /locus_tag="Aave_0441"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 26"
FT   gene            479180..480679
FT                   /locus_tag="Aave_0442"
FT   CDS_pept        479180..480679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0442"
FT                   /product="anthranilate synthase, component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="KEGG: rfr:Rfer_3607 anthranilate synthase component
FT                   I; TIGRFAM: anthranilate synthase component I; PFAM:
FT                   Anthranilate synthase component I and chorismate binding
FT                   protein; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31049"
FT                   /db_xref="GOA:A1TJB1"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB1"
FT                   /protein_id="ABM31049.1"
FT                   /translation="MITELEFKSLAGEGYNRIPLIAEAFADLETPLSLYLKLAHARDGG
FT                   RYSFLLESVVGGERFGRYSFIGLPARTLLRASGFGAQARTEVVTDGQVVETGHGNPLDF
FT                   IADYQKRFKVALRPGLPRFCGGLAGYFGYDAVRYIEKKLEASCPPDTLGMPDILLLQCE
FT                   EVAVIDNLSGKLYLIVYADPAQPEAYARGKKRLRELKEQLKYSVAAPVVKPTESHPPQR
FT                   DFAKADYLAAVERAKELIAAGDFMQVQVGQRIHKRYTESPLSLYRALRSLNPSPYMYYY
FT                   HFGDCHVVGASPEILVRQERTDEGQKITIRPLAGTRPRGATPEKDKAAENELVNDPKER
FT                   AEHVMLIDLARNDIGRIARTGTVKVTEAFAVERYSHVMHIVSNVEGLLNEGMTSMDVLK
FT                   ATFPAGTLTGAPKVHAMELIDRLEPTKRGLYGGACGYLSYAGDMDVAIAIRTGIVKDGT
FT                   LYVQAAAGVVADSVPELEWKETEHKARALLRAAELVEEGLE"
FT   gene            480676..481029
FT                   /locus_tag="Aave_0443"
FT   CDS_pept        480676..481029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0443"
FT                   /product="Chorismate mutase"
FT                   /note="PFAM: Chorismate mutase; KEGG: pol:Bpro_4456
FT                   chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31050"
FT                   /db_xref="GOA:A1TJB2"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB2"
FT                   /protein_id="ABM31050.1"
FT                   /translation="MTRAIEKTRSCSSMAEVRERIDALDDILVPLLVERGGYMTQAARN
FT                   KRDASQVRDEGRIEFIVRRVRERALAEGGEPDVIEAIYRGMMEAYIAYEHREFDRMVAA
FT                   GEKSGDGADGRPA"
FT   gene            complement(481075..482481)
FT                   /locus_tag="Aave_0444"
FT   CDS_pept        complement(481075..482481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0444"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bma:BMAA1621 regulatory protein HrpB"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31051"
FT                   /db_xref="GOA:A1TJB3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB3"
FT                   /protein_id="ABM31051.1"
FT                   /translation="MLLSLLSLSSQRIGDGAQALTQMLQNLQVKEAATMGRRRLERGQS
FT                   RDASPVEEGALLGRTLLLIGQEELASDVFHQQLKAYDAVSRAMVRWHSALDQAWMFLHL
FT                   RKPARAAACWALVANDHDAPAPLRVEACCGLALSLQAQGQHASALVAAQRAQALCESGE
FT                   SSRLALHAAAIRLEVLYRVELLHSEELSDHAFAEAAQELGRERMSGETLASELRALESG
FT                   PDTPALMRARLAYLAGMHAAHPAARQEAVAAFGRWLRQHGLAGIDAEARVEGCLALLAG
FT                   RAVPAAREAIMPLAGGEREIEHHPLASDIQYCLSKIHMSEGRLGESLRQYKRHVAQAMR
FT                   VVHHAALQRMDAPAANAPQDTVGLRLPPRYRAAYRYIIENLHDPNLSVREIAGRLGVTE
FT                   RALQLAFRNHLGMTPAELIRRERVRRIEGEMEEASATGGRVHMLDVASRWGISNRSTLA
FT                   NAFKLSSMRH"
FT   gene            482980..483780
FT                   /locus_tag="Aave_0445"
FT   CDS_pept        482980..483780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0445"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   KEGG: xcb:XC_3077 HrpG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31052"
FT                   /db_xref="GOA:A1TJB4"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB4"
FT                   /protein_id="ABM31052.1"
FT                   /translation="MRVALLSRRSAVNQFLVDLLNRGGIQAILQVSIAAFRMQARRHPP
FT                   DAVILEDCGGTLAEDLGLIRSCISTHVPVLVAGSELQAGFGTALACGAVDYINLSRVGH
FT                   DELKARLRGHVEAYALETARSITVDGCELDPARQCFVHRGTMVELTHRECELAWLLFSR
FT                   PNQVVSSPTIVARVWGRSVESNKRTLEQHIYKLRVKLRQCGCALHVQAAYGRGYRLISS
FT                   TAEGAGPVAQPSSMQVSRVRPAVTAAMSMPVSLPAMHSMPPLGS"
FT   gene            complement(483843..484298)
FT                   /locus_tag="Aave_0446"
FT   CDS_pept        complement(483843..484298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0446"
FT                   /product="Tir chaperone family protein"
FT                   /note="PFAM: Tir chaperone family protein; KEGG:
FT                   bte:BTH_II0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31053"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB5"
FT                   /protein_id="ABM31053.1"
FT                   /translation="MSFQQYEQLVTDLCGVIDLPDPQAVLDRGWVEVEGFEVQIAHYEN
FT                   DVAAMYLNFHFGIVTAGRTLAVYRLLLEANLTVYAQDQAQAGINPDTGGIILIVRVPMT
FT                   PDITGTWLAETLTHYAEHGRYWGDNILTSTDEAFLGICSGDYLWIKV"
FT   gene            complement(484295..485269)
FT                   /locus_tag="Aave_0447"
FT   CDS_pept        complement(484295..485269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31054"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB6"
FT                   /protein_id="ABM31054.1"
FT                   /translation="MMLNLFSVFRLKQQRNRQQLQQQLIKRENLREQLHEEDVHKRQRA
FT                   VLQGRYGDYVFKTLGRPPPPPPPRQSHLPGQGSEHAPDGERTVLDFQADFEQASETGEA
FT                   VRSERKGQDEEGSREAHEHGMEGVAEHRRDLEELEQYSQDIFLQPGSGTAQQDGRESGS
FT                   GTGGQSGGSHQGGEGRGHGGQSQAGGSAAKLRMQAMLADFEVGMSSEDPVVQADTLVAA
FT                   LGSIVWASHGNGHPAQAMLLARIAEHLRRQNGGKPLATVAEVREALLRAGLDVAGKPSD
FT                   RFALLPLQLLNYSRPRTTSQLRLTTERLAGGPAWLLPRMPERS"
FT   gene            complement(485266..485529)
FT                   /locus_tag="Aave_0448"
FT   CDS_pept        complement(485266..485529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0448"
FT                   /product="type III secretion protein, HrpO family"
FT                   /note="TIGRFAM: type III secretion protein, HrpO family;
FT                   PFAM: export protein FliQ, family 3; KEGG: rso:RSp0859 hrp
FT                   conserved hrcS transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31055"
FT                   /db_xref="GOA:A1TJB7"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006306"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB7"
FT                   /protein_id="ABM31055.1"
FT                   /translation="MNHDNIVQLTSEALMLCLLLSLPAVAVAAIVGLLVALVQAVTSLQ
FT                   DQAISQGIKLICVTVTVAVSAPWVGSTVLQFSQRLLTAVFSP"
FT   sig_peptide     complement(485443..485529)
FT                   /locus_tag="Aave_0448"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.878 at
FT                   residue 29"
FT   gene            complement(485546..486208)
FT                   /locus_tag="Aave_0449"
FT   CDS_pept        complement(485546..486208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0449"
FT                   /product="Yop virulence translocation R"
FT                   /note="TIGRFAM: Yop virulence translocation R; PFAM: type
FT                   III secretion system inner membrane P protein; KEGG:
FT                   rso:RSp0860 hrp conserved hrcR transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31056"
FT                   /db_xref="GOA:A1TJB8"
FT                   /db_xref="InterPro:IPR005773"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB8"
FT                   /protein_id="ABM31056.1"
FT                   /translation="MTPISGLDPVSLALALMLLAVLPFAAMIVTSYTKVVVVLGLLRNA
FT                   LGVQQVPPNMVLNGIAIIISVYVMAPVAMEASDRMQMLPPSAQSSNTQQMLAAASAARE
FT                   PFRKFLDKHADAAEKAFFLKSAQALWPEERARSLQADDLVVLAPAFLLTELTAAFRIGF
FT                   LLYLAFIIVELVIANVLLAMGLSQVSPTNVAIPFKLLLFVVLDGWSQVMHGLVMTYR"
FT   sig_peptide     complement(486131..486208)
FT                   /locus_tag="Aave_0449"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.644 at
FT                   residue 26"
FT   gene            complement(486205..487263)
FT                   /locus_tag="Aave_0450"
FT   CDS_pept        complement(486205..487263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0450"
FT                   /product="type III secretion system apparatus protein
FT                   YscQ/HrcQ"
FT                   /note="TIGRFAM: type III secretion system apparatus protein
FT                   YscQ/HrcQ; PFAM: surface presentation of antigens (SPOA)
FT                   protein; KEGG: bpm:BURPS1710b_A0677 type III secretion
FT                   inner membrane protein SctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31057"
FT                   /db_xref="GOA:A1TJB9"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR013385"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJB9"
FT                   /protein_id="ABM31057.1"
FT                   /translation="MPPGEAHLARIAFDRRFARWAARLCSQPPGRVAAAAPGCHHDAVS
FT                   LDFSCVHGHLQVSVPLSAWPTLGMAARLADAALAREVAETLIAAPLAAVAPVLPGLALT
FT                   GVSVRTALQAPLEWTQGAMRIGLHAIDGGVADRLCAHLAHSAQADGEPLAALRLPGTVR
FT                   LATRRLAPADLASLAAGDVVLCGTLSAGRRRLCHLSFGLGTTMHIPAELDLDDSEIALH
FT                   AAPQADAFAEPADEDGAPDPAGAAEEAAPCSGSDAEPEATPLPLTDIGGIRVPVAIEID
FT                   TARIRLDELAALDAGAIVPLAVAARDATVRLVCHGQVVGTGRLVVIGDHLGVRIAHMAA
FT                   AGAASPTATGAP"
FT   gene            complement(487320..488228)
FT                   /locus_tag="Aave_0451"
FT   CDS_pept        complement(487320..488228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:blr0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31058"
FT                   /db_xref="InterPro:IPR013390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC0"
FT                   /protein_id="ABM31058.1"
FT                   /translation="MQRDLPPLRQGLASGRGTPAGALPPAPGAALRFQRHLLGDAAEDI
FT                   PPATGFLAPGRRALASDPRDPRDPLPAAPPPSRATADPAPGTDGDAPPPATSALPAPPP
FT                   PVDTPDLPAAFGMPRAGEAGLPAVPAARPDDGACQAGPEACPPPAGPATDAAAVPTCPP
FT                   PPDPVPPPPPACGRQDGDASRQRGQDSGAGPSAASAPARPAAADAPAWLQDTVQRIAWL
FT                   CAQADPAFQSWSVTVPMDPAVLPESEVALTLSPYAMSLRFRTRSCESARLISLHRDPLR
FT                   AQLEALGPGQRGIDIDLESPP"
FT   gene            complement(488239..490302)
FT                   /locus_tag="Aave_0452"
FT   CDS_pept        complement(488239..490302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0452"
FT                   /product="type III secretion protein, HrcV family"
FT                   /note="TIGRFAM: type III secretion protein, HrcV family;
FT                   PFAM: type III secretion FHIPEP protein; KEGG: bma:BMAA1630
FT                   type III secretion inner membrane protein SctV"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31059"
FT                   /db_xref="GOA:A1TJC1"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006302"
FT                   /db_xref="InterPro:IPR025505"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC1"
FT                   /protein_id="ABM31059.1"
FT                   /translation="MAKRFDSTLVNDLTMAGFLVGVIALMILPLPTLLIDSLLAINLSI
FT                   SVLLLMTTLFIPDAVSLSTFPSLLLFTTLFRLSLNIASTKAILLHADAGHLIESFGQLV
FT                   VGGNLVVGIVVFLVITIVQFIVIAKGSERVAEVGARFTLDALPGKQMSIDADLRAGLLT
FT                   ADEAKAKRARLSMESMLHGGMDGAMKFVKGDAIAGLIITLVNILAGIVVGILYHSMTAG
FT                   EAANRFAVLSIGDAMVSQIPALFICMAAGILTTRVADEHRKKPTSLGEDMTEQLTRNTR
FT                   SMYLAGALTLGFAAIPGFPAVPFCLLAAGLVGGGQWLSRRRKSAAPGSAKTHSKPIASL
FT                   LREGGKGEGTAIQHRAPEFAKPLSIRLSDPLARLLNAERLDQALNKEREGLQTRLGLPF
FT                   PGAAMWVWDGLEDLRFDILINDVPVAQPRLPGDMLLLLDPQSPLAAQAQRHGPLLGMEE
FT                   SLWVPQTAVPPAQRAGACLEIEQVIAREVVEMLQRHAHLFMGVQEVQWIIERATPEYPG
FT                   LVAEVQKVMPLQRMAEVLRRLLEEQVPIRNIRSIFESLITWAPKEKDLLLLTEYVRSDL
FT                   GRYLAHEAGGGQRHISAILLAPEIEQAIRGCIKPTPAGNYLAMSPDDARDITDRIAAVA
FT                   RSSPATGVALVTSMDIRRYVKKMIEGRIDWLRVYSFQELGSLIELRPIGRVA"
FT   gene            complement(490347..491405)
FT                   /locus_tag="Aave_0453"
FT   CDS_pept        complement(490347..491405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0453"
FT                   /product="type III secretion protein, YscU/HrpY family"
FT                   /note="TIGRFAM: type III secretion protein, YscU/HrpY
FT                   family; PFAM: type III secretion exporter; KEGG:
FT                   xcb:XC_3012 HrcU protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31060"
FT                   /db_xref="GOA:A1TJC2"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006307"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC2"
FT                   /protein_id="ABM31060.1"
FT                   /translation="MSEKTEEPTAKKLKDARKKGQTTKSQDLVAGAVLGAALLVLTGAG
FT                   PMLYDRVRRIVTTALEQGVRVHSTQELLALLSSMALDGMAVAFGMVIVSVLVAVLALLP
FT                   QVGFMITFEPLTPKFDSLNPAEGLKKMFNARSLVEFAKSVLKAVVFGAVLWHIVTGLVP
FT                   LLVGSVYLTPEASGQIAWSALLKLFSFAFLVFLVIGPLDFGLQHWLFMRDQRMSKDDVK
FT                   RENKDSEGDPHLKGHLKSLREEMATSPPQERVPGATVVVTNPTHYAVALRYEAGATPLP
FT                   IVVAKGMDEQAAVIRGLAALHHIPLIANPPLARALHKLPLDQPIPEELFEAVSVVLRWV
FT                   AELDRLGGGSPR"
FT   gene            491645..492187
FT                   /locus_tag="Aave_0454"
FT   CDS_pept        491645..492187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0454"
FT                   /product="type III secretion protein HrpB7"
FT                   /note="KEGG: bpm:BURPS1710b_A0687 type III secretion
FT                   protein HrpB7"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31061"
FT                   /db_xref="InterPro:IPR013392"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC3"
FT                   /protein_id="ABM31061.1"
FT                   /translation="MSTIKGLRTLVRLKARRTEQAEAALQESIQALKGEEEALAQAQAE
FT                   ESHARDAERARRERLASATSAGSCFLANDAITLQMLVSEAQGQSTEAERHTAQARDRVD
FT                   AAREQVRLRDAAVRRAQRQLEATRERLEQALAAAERAQEDAQDEEAEETAVARMLAAAR
FT                   QGRRTGARSGASRAVEA"
FT   gene            492252..493106
FT                   /locus_tag="Aave_0455"
FT   CDS_pept        492252..493106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0455"
FT                   /product="type III secretion protein SpaR/YscT/HrcT"
FT                   /note="TIGRFAM: type III secretion protein SpaR/YscT/HrcT;
FT                   PFAM: type III secretion system inner membrane R protein;
FT                   KEGG: xom:XOO_0083 HrcT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31062"
FT                   /db_xref="GOA:A1TJC4"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006304"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC4"
FT                   /protein_id="ABM31062.1"
FT                   /translation="MLGLLALCCARFYAAMLVLPATNDQLLLGRVRNGTVLLLGAFVAW
FT                   GQPSGLLESTSPLVFIALVVKEALIGMLIGFAVSVVFWAAEGVGMLIDNQAGYNNIQQT
FT                   NPLSGQQSTPVGNLLMQLAIVGFYMLGGMMVFVGLLFDSYDWWPLTGMMPSWPVLAERF
FT                   FPDEVAGYAQTVLKIAGPVLMTLMLIDLGMGLLSKAAEKLEPGSLAQPIKGAATMLLLV
FT                   LLVGVFFHQVREQLTLRPVAQRLERIFAPRDPADSGPAGGASPSVPAPAAAPVPAASAA
FT                   AGR"
FT   gene            493497..495170
FT                   /locus_tag="Aave_0456"
FT   CDS_pept        493497..495170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtc:MT3615.3 PE_PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC5"
FT                   /protein_id="ABM31063.1"
FT                   /translation="MPAIARRRPGKRLLSRDRGNGVRREAAAAFLIHFTGVHPWPFLSR
FT                   RRCKPPRWAFPAILPRHRAAAAGTIPCIMMLIIEQVLKALQDKLGNKDGGKAAGGADSA
FT                   SGPGGAGGSQGGSGPEGALQRFAELFKGLSEALDKSLNDQKANDFAQKLANALGTDAKM
FT                   LDKLDDGKENGSFNDFAKDFMKNLDSLAQGGGAGGGASGAGNAGGADGAGGAGGASGAE
FT                   GAGGAGGADGADGSEGSIGDLVKQLIERLLKGDSKGADNVSGKDGAGDKGGADGKGDAS
FT                   LDKLMEVLKQFIQLLKMALKGNGGQGGGSGGAGAPQGAGGAGGAQGGAGGAQGGAGGAQ
FT                   GAGGGAPAGGSPEAGGAQGAGGPGGGAQGADGAGSPEDQIKQLLDDFAKGNTSGVDNML
FT                   KGEKGQEQLKQILEMLMKLIEALTGKKAGDDGAGQAGGQGGGSGGGTPAAGGAQGGQAP
FT                   QGGQAAPAPAAAPAPAPAPTPAPQPSGTAAPRPTSTESDTRDGTQRDSDPAARTRPPVP
FT                   EPVKAQPPEATQAQAPAPAPAPAPAPAPAAAPQEQHAASR"
FT   gene            495330..496424
FT                   /locus_tag="Aave_0457"
FT   CDS_pept        495330..496424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0457"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mtc:MT1689 PE_PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31064"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC6"
FT                   /protein_id="ABM31064.1"
FT                   /translation="MPAARSCPAGIHSSSIHSQESTSMSVSLQTYSQSTSLQITETPAA
FT                   TPAGGAEPAIDQLVLQVLEQVLKALQGAAQGGNGVGGHCGAGGTGGTRSADGQRNGPEG
FT                   VLQRFAELLKHLGQALEKSLAAVRANAFANKLARALGSDARTLDRLDDGAENGSFQSLA
FT                   KDFLKNLDALSGNGAASGSGRVGSGHGDGDDDLSDLVRQLILAMLLGNPQALAKLLGNR
FT                   GAGSDVLLKVLEQFVQLLGLGLQAAGGGAVGGSHAAGGGGAEAMAELVKQLLGAFMQGD
FT                   TGGVDKLLQGQGGRNSLQQILALLTQLITMLSGGRPAGGGAAGQGGGTCSGHVSFNSGK
FT                   EGAMVPSDAAQDGTRNCGSQSHTG"
FT   gene            complement(496462..498012)
FT                   /locus_tag="Aave_0458"
FT   CDS_pept        complement(496462..498012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0458"
FT                   /product="Leucine-rich repeat, ribonuclease inhibitor
FT                   subtype"
FT                   /note="SMART: Leucine-rich repeat, ribonuclease inhibitor
FT                   subtype; KEGG: rso:RSc1801 GalA protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31065"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC7"
FT                   /protein_id="ABM31065.1"
FT                   /translation="MPAHVARSCMRHREAALFPRTAVSAIAPSAISSCPRGPPRHGPAY
FT                   PGRLRTALARHTMDALFQAPAGPGPEEHTIRDAQGLLALCRQDMRGLRRLTLRGDFRDD
FT                   DLRMLPATLEALELSDCSALTARGLSWLLALPLATLTLRRMPLEPEAAHALARHARLAA
FT                   LELDHVPLDTACAQALAGAGALATLRLDHCGITPEGLAAVSSLPRLSRLQARGNGLGPE
FT                   AMPALLGLRSLAELDLDSNCLGADGAAVIARMPGLRALSVSHNALGDDGARALAALPGL
FT                   HTLSAQANQIGAAGAAALAGGAALRALDLHRNRLGDAGVRALATATRWQQLDLARNGIG
FT                   AEGAATLAGLPALADLVIARNPLGDAGAGALAASDSLRFLDAGDCHIGDTGASALSRCP
FT                   QLASLVLNNSSAEGVRIGERGALALAASPSLEEIDLEGHAVGSAGARAFAANPRLRRLG
FT                   LARNQVGNAGAHALAGSASLASLDLWDNRVTDKALHSPCAPWLRRRGTAPRWAGRSAG"
FT   gene            498139..498627
FT                   /locus_tag="Aave_0459"
FT   CDS_pept        498139..498627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31066"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC8"
FT                   /protein_id="ABM31066.1"
FT                   /translation="MTSKTTESAQAHVPQRIPLSPARRACLGAALRHMGADDHSARSFA
FT                   DEGMVMVNDILLAIASLQERDDGRWLACALVPRPESVSSARWNEALLVANGQAILLAPW
FT                   AFSLEESGDAVLLMPIDPGLTDARALAAHFDGMLSLCEAVATGAQALAQAGQPGKEAA"
FT   gene            498624..499115
FT                   /locus_tag="Aave_0460"
FT   CDS_pept        498624..499115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31067"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJC9"
FT                   /protein_id="ABM31067.1"
FT                   /translation="MNAPLDLSNHSPVPAQEFEASPALQALVCDAALVLGASAGQAQEA
FT                   ARTGRLELERHTVAVTADAGEETLLLSVDLGPSYLAEPGRAQAALVANMHLFVKAGVTF
FT                   ARGLAGPVLVGRWPAADAPALANGVRQMGAIAQGFQVPGSSGASPSPSQPLRGASEPQE
FT                   "
FT   gene            499120..500829
FT                   /locus_tag="Aave_0461"
FT   CDS_pept        499120..500829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0461"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xoo:XOO0097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31068"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD0"
FT                   /protein_id="ABM31068.1"
FT                   /translation="MTLLSSVNRSYSTPVSADQASTSQAGASATLLPASRGSRRLGADG
FT                   GLPVRHAGGHARPDALSAPRVSLELSPQREMVPLRDLSVLLSDHPSFRTEVSHYSDALP
FT                   DELPYVELSPSGSPAIREADAPGGAHESFRTALSETQTSRSGSGDGRADVPARQSWRQM
FT                   AAAALRHRASAVGSAVQSGGAALGRTAMAPVSVARSGVSAAWNLGSQAWRIPKVVVGHL
FT                   THQGISVGVTTAVREVAAEALIAGLRQAPAGALLGIEIGMGIVNMSLQALRQARERRNP
FT                   DEAARGFHALSPEQWASKTPEEQALLRKEQQHHSDRVASLQMASLMVNVGFAAYGAAHG
FT                   DNSFAASSIASEAKVIAYSVLRDGIQSKFGMIKLDKESHGVSGSHIAGASLFYGAANLA
FT                   GGYAWSALPPLGLPPGVTTANVRDVLRGVPVEGVSLQDAVGATAKMVGVKAAINTVLEA
FT                   SDWFSVTEQEARQAGAKQQLAPHIKGNDFGRMKDHVPARIAIIDSSNSIADLVGFLTKD
FT                   MPPSASALLTNSALGLWAGVNYRTIGATWQADSAVRAAEDHRRPAREGAQNV"
FT   gene            500850..501380
FT                   /locus_tag="Aave_0462"
FT   CDS_pept        500850..501380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31069"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD1"
FT                   /protein_id="ABM31069.1"
FT                   /translation="MPDPTDACTVRARSGWGGRLRATAVPAAGARLPLRRALVSVPAAT
FT                   PATAADGPLPGGGDVAPVSPARQLLERFQFCELDAMPQGRMRQVVEFLGGRGRALRTAP
FT                   LRANWKALRLAFEEPALRALLIEHTDEVVEFLMRPDVAGEGRQPVGESLPGGMLLPSSF
FT                   SPAGASSGLLASR"
FT   gene            complement(501480..502808)
FT                   /locus_tag="Aave_0463"
FT   CDS_pept        complement(501480..502808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0463"
FT                   /product="type III secretion apparatus H+-transporting
FT                   two-sector ATPase"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: xom:XOO_0085 HrcN protein; TIGRFAM: ATPase,
FT                   FliI/YscN family; type III secretion apparatus
FT                   H+-transporting two-sector ATPase; PFAM: H+-transporting
FT                   two-sector ATPase, alpha/beta subunit, central region;
FT                   H+-transporting two-sector ATPase, alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31070"
FT                   /db_xref="GOA:A1TJD2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR013380"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD2"
FT                   /protein_id="ABM31070.1"
FT                   /translation="MHDVNGTARIARWMEREIAAAPLVRRSGKVAEVIGTLMRVNGLDA
FT                   KLGELCHVLDERGELLQAAEVVGFANGQSILSPFGSILGVRGGSPVVGLGEVLSVPVGP
FT                   RLLGRVIDSLGQPIDGKGPLDCSETRPVFALPPTPMEREMIEHPLPTGVKAIDGLITLG
FT                   EGQRMGIFAPAGVGKSTLMGMLARGTQCDVSVIALIGERGREVREFVEFILGEEGMARS
FT                   VVVCATSDRSSSERAKAAHVATAVAEYYRDQGLKVLLMMDSLTRFARAQREIGLAAGEP
FT                   PARRGFPPSVFAEIPRLLERAGMGARGSITALYTVLYEDESGNDPISEEVRGILDGHMI
FT                   LSRKIAARNQYPAIDVLGSLSRVMSQIVPREHQQAGGRFRQLMAKYEEIEPLVQMGEYR
FT                   PGNDPLADEAMEKHAAIRDFLNQSTSDLWDFGRSVDTLADISG"
FT   gene            complement(502801..503634)
FT                   /locus_tag="Aave_0464"
FT   CDS_pept        complement(502801..503634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0464"
FT                   /product="type III secretion apparatus protein, HrpE/YscL
FT                   family"
FT                   /note="TIGRFAM: type III secretion apparatus protein,
FT                   HrpE/YscL family; KEGG: bpm:BURPS1710b_A0423 HrpF"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31071"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD3"
FT                   /protein_id="ABM31071.1"
FT                   /translation="MLIWSSPGGAGLHSPAGILRAAEFETATTAVAVLEGARTEGDHLL
FT                   AQARQEAADLLEAAARQAQALRDQAAADAAALVDQARADARLLAEQAVADASEDAARRW
FT                   HAEFAALQASHDAAMAGMEKRLAAVVAMAVERMVLAEPRQALLQRAVLTLRDTLGDART
FT                   ARLRVHPDDADAARAALSAIGSDPDAPRVQVEADADLPPGSSIFDADIGRLDTSLQVQL
FT                   AGLRGALERAVRVAAEEPVTVAYASRLGEDDGHDNDEYQDDGQDDDRLPREDDDA"
FT   gene            complement(503628..504263)
FT                   /locus_tag="Aave_0465"
FT   CDS_pept        complement(503628..504263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0465"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_3008 HrpB4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31072"
FT                   /db_xref="InterPro:IPR013393"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD4"
FT                   /protein_id="ABM31072.1"
FT                   /translation="MSRARDLARLACELQARIDALPDHVDPSWLRPADSVGTAAVRSDA
FT                   LPPQVQGALSKDWFVRRCGPLPSLERLEDGGARLALLDRTSLLARLCALALLGRPGVLR
FT                   CCVQRSARTALQEALGPAFAPLRARDGGAAVSPEVAGWPPLAWSWVGYRELVRAGAWPD
FT                   RALRRMVRLALPASRSGAPRPHLVPRASAAARERLQALETLFPEGRTC"
FT   gene            complement(504260..505123)
FT                   /locus_tag="Aave_0466"
FT   CDS_pept        complement(504260..505123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0466"
FT                   /product="type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family"
FT                   /note="TIGRFAM: type III secretion apparatus lipoprotein,
FT                   YscJ/HrcJ family; PFAM: secretory protein YscJ/FliF family
FT                   protein; KEGG: rso:RSp0867 hrp conserved lipoprotein hrcJ
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31073"
FT                   /db_xref="GOA:A1TJD5"
FT                   /db_xref="InterPro:IPR003282"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD5"
FT                   /protein_id="ABM31073.1"
FT                   /translation="MTHDTPYPARGFSPLRRWLAPLVLLLALVGCKDDLYTKQTEADAN
FT                   DMVAALLESGIDAGKATSDAGKTWNVQVEKSDVVRSLAVLRSYGLPRERHATLGEMFKK
FT                   EGLISTPTEERVRFIYGVAQQLEATLSQIDGVVTARVQIVLPNNDPLASTVKPASASVF
FT                   IKYRESANIAGLTAGIKNMVARSVEGLTYENVTVTLVPGMPIGPAPEKEASRAGLWAAL
FT                   AAAVLLVLGGAAGWIAWKRPAWLPAGLRRKPEAAGGELAADASAASPASAAPLPSAPAM
FT                   AKGLAG"
FT   gene            complement(505136..505516)
FT                   /locus_tag="Aave_0467"
FT   CDS_pept        complement(505136..505516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31074"
FT                   /db_xref="InterPro:IPR013391"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD6"
FT                   /protein_id="ABM31074.1"
FT                   /translation="MNALQLPVSPAPAIESGAAQPSNLSALAEKFARMMEGKPQAPLAE
FT                   MAPDSTLGNALMHQDESMRKALQDMHALAHAQKDNSMNDIDMTSRQIELMYRVSGMQFQ
FT                   FHAMVYLAQSGKSGLQTLMRNQ"
FT   gene            complement(505558..506076)
FT                   /locus_tag="Aave_0468"
FT   CDS_pept        complement(505558..506076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0468"
FT                   /product="HrpB1 protein"
FT                   /note="KEGG: xom:XOO_0090 HrpB1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31075"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD7"
FT                   /protein_id="ABM31075.1"
FT                   /translation="MTPKISRREVVAGLINLATKAVELELTDDAAEILQGARILRPRMV
FT                   ELDLLEGWICIQRGQVEECIRLMRNVEGSPTHWGMAKALMARCQRFMRDPAWRANAEEV
FT                   LAGCTDPTALYLVQQLFAQAGDADGHTAGQDNASQESGETPDPQSTFRPRKFAPVDPLT
FT                   NPFVFQLRA"
FT   gene            complement(506303..506509)
FT                   /locus_tag="Aave_0469"
FT   CDS_pept        complement(506303..506509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31076"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD8"
FT                   /protein_id="ABM31076.1"
FT                   /translation="MSVSGADAATMRSIALQEQNMRNQEALTDASTRNMAKQALLNFQK
FT                   EMAEMNAKTIGAMGKGLSGLAPN"
FT   gene            complement(506611..506817)
FT                   /locus_tag="Aave_0470"
FT   CDS_pept        complement(506611..506817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31077"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJD8"
FT                   /protein_id="ABM31077.1"
FT                   /translation="MSVSGADAATMRSIALQEQNMRNQEALTDASTRNMAKQALLNFQK
FT                   EMAEMNAKTIGAMGKGLSGLAPN"
FT   gene            complement(506937..507386)
FT                   /locus_tag="Aave_0471"
FT   CDS_pept        complement(506937..507386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31078"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE0"
FT                   /protein_id="ABM31078.1"
FT                   /translation="MINAPYPAAAPYAAAEAPAAPYPVIYRNLMSVALLGTVYRVGSDA
FT                   DTISRAVEATLEDSSTYLLYRIIVLAMAGQRGKEHDQLLHHVETHPEDGVSKVALALTL
FT                   LFNGDPAWRHWIDNVLATSVDQPVRQAAQGVLHFLGRATQKPVIH"
FT   gene            complement(507400..507663)
FT                   /locus_tag="Aave_0472"
FT   CDS_pept        complement(507400..507663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31079"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE1"
FT                   /protein_id="ABM31079.1"
FT                   /translation="MTASIESTIFSDLENLEQALSEDLSGDRARAMIRYFDEVARESSA
FT                   MRIQAEIDAERQLIGQLVDAFQVSQRVIRKIWETLHGTTLAV"
FT   gene            complement(507689..508690)
FT                   /locus_tag="Aave_0473"
FT   CDS_pept        complement(507689..508690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0473"
FT                   /product="secretion-associated protein"
FT                   /note="KEGG: bps:BPSS1407 secretion-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31080"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE2"
FT                   /protein_id="ABM31080.1"
FT                   /translation="MKQFRILTGQHAGARIDLTPTRQHISADDTADIQLLDWTAEPVVI
FT                   DAGDDGMVHIATASAGAQSSAVLADFTPRRFGDVVLCAGPADATWPADADIIARLAPAA
FT                   AVVAAPPAAPAKGRSMWPRITSAVVGTALMTAALSAAVAPLSQSQAERKALTSVLSPEP
FT                   LRMRVERALAETSVAGYEVAQQGDGVVVRGLLRQPSDADALRQRLASFQGDRIVQSFAS
FT                   ATEVAQSISDALGQPGLRIAHHGNGLFTVTGEVANLAALQQNAARVATDLAPLVRGIDV
FT                   AATQRPPASPPAMSALMETDGLQYMQTRDGVKHLSLTSGARIASADQPASFR"
FT   gene            complement(508687..510738)
FT                   /locus_tag="Aave_0474"
FT   CDS_pept        complement(508687..510738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0474"
FT                   /product="type III secretion outer membrane pore, YscC/HrcC
FT                   family"
FT                   /note="TIGRFAM: type III secretion outer membrane pore,
FT                   YscC/HrcC family; PFAM: type II and III secretion system
FT                   protein; NolW domain protein; KEGG: bpm:BURPS1710b_A0648
FT                   type III secretion outer membrane pore, YscC/HrcC family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31081"
FT                   /db_xref="GOA:A1TJE3"
FT                   /db_xref="InterPro:IPR003522"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE3"
FT                   /protein_id="ABM31081.1"
FT                   /translation="MPKISAPRPRHAATGMTGSVLAGAVLALGMAGLPAAQAASLRLSA
FT                   SLSSLPSAGAGAALAVPAAELATAGTGAAPSSPAAAPAPAQRSNTLQKAPPRKHSSYHA
FT                   LAAATFSAGAVGAAAASAPVPPSTAPVAIPSIPAARALETLAPASRASDALNRGRFVYR
FT                   AENKRLTDVLQDFAASQGIPAVVADGLDGIVNANFDARPREFLDSVARAYNMLWYHDGS
FT                   ALYFYPGKSIQSRMFRIKGFSRDQLTAMLQSLDVGDKRYPIRFDAASSTIYVSGPPRHV
FT                   ELVSSALEALDAGVTASAERTVRVFSLQFASASDRSMGDSTVPGVATTLRKLYSKDDGE
FT                   GLATSKATSAEVIEKIQQQTRRKMSAYVPVPAANQFLPPLPRANPSEGMRPPEPVSLPT
FT                   ATAADKAEEAPPRFEADEGTNSVVVYGRADRMDEYESLIRRLDQKPQLVELEATIIEVN
FT                   SDSVDALGVNWSLRAGTSSISTNLPGPSTPAALSTIVLDAGRHLLANVNALEAQGKARI
FT                   LSKPSVLGVANRAAVMREKRVATVRVAGNLEANLFQIEAGTLLQMTPQVTPVDGKNNIK
FT                   LSLYIEDGAFETNVVDQIPLVKKTEIRTEAHVREGESLLIGGITVESENTQDNAVPGLS
FT                   KLPVVGGVFRNTERLTRRTERLFLITPRVIAQDAPTTVSSISPEVRKP"
FT   sig_peptide     complement(510622..510738)
FT                   /locus_tag="Aave_0474"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 39"
FT   gene            511047..512546
FT                   /locus_tag="Aave_0475"
FT   CDS_pept        511047..512546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0475"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rru:Rru_B0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31082"
FT                   /db_xref="GOA:A1TJE4"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE4"
FT                   /protein_id="ABM31082.1"
FT                   /translation="MSLPRTAANELVYTHGYYEILSPGVIAAALESRGQRAPDLQDPLC
FT                   YFELGMGFGVSLLAHAASFPHMRFFGNDFNPAHVAYARDLARDAGLSNVEVFEDGFEEL
FT                   PDRDLPMMDCIVMHGVYSWVSPALRQAIVRFIERRLKPGGVVYVSYNTLPGWAPLLPLR
FT                   ELFHLHASRVADPESGAAGQLQGALDFIGRLAACEGGYVQAHPAVAERLRHAQVEGPNY
FT                   ALHEYVGPDSHPLYFHQVAAEFEAAGLSFAAPALLAEQVDAACVPEELAALLESTPDPV
FT                   LRETLRDYGLNRAFRRDLFVRGGQVLAPAEQVARMREREWLLAAPRDALPQCAALRLVG
FT                   QWLGEAACTDLLDALGEGPVRLGDLAARPQLGGLPAQSIHEGLLLLSSSGVVMPALPAA
FT                   LRATARASVQGFNAAVLQRGGEDGTRHLVCGASGIATEWTPAALRQIRAAQSHGGDPDA
FT                   IARAVAESLGRDGVLDAAELAESARRYLAQRAPLLRRLEVV"
FT   gene            512546..513316
FT                   /locus_tag="Aave_0476"
FT   CDS_pept        512546..513316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0476"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   rme:Rmet_2520 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31083"
FT                   /db_xref="GOA:A1TJE5"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE5"
FT                   /protein_id="ABM31083.1"
FT                   /translation="MARPASRMRAARRMLAGVFALSAGAAMAAGAYDCRLPGGAALLVV
FT                   GADIAQRFPSIGSSCNAAAWTPARDVALPGWPDTSAIAAARVIHAPAPRDIYAPTAGAA
FT                   LPGMRWPEGGARRGPGISPRAEALSPIIESAAQRHAIDPHLVRAVIQVESGYAPRARSP
FT                   KGAMGLMQLMPATAARFGAASEDDILSPAVNVDVGVRYLRFLADRFGGRTDLVLAAYNA
FT                   GEGAVIRHGYRVPPYRETQDYVRKVLDLYPLAKR"
FT   sig_peptide     512546..512632
FT                   /locus_tag="Aave_0476"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(513388..514200)
FT                   /locus_tag="Aave_0477"
FT   CDS_pept        complement(513388..514200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31084"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE6"
FT                   /protein_id="ABM31084.1"
FT                   /translation="MHTSQLTPSLQPSTIPAAWRSGANRLVSCGGRPGVQLRLVSLVEP
FT                   PLLLDEGFPQASGLWVSSQLRFSCGMNSLALLHMAMHGLLIRLESMAGASHAMAANHTL
FT                   RMLVEGRLTHVFASTADFQRLTGHADDGTAPLPRLVDIDVEHDWLVVDAQRGFHNARPA
FT                   PALIAGLVRLAEIPRAARRLDMLPDTGPAGEGGDRLALLLEAARALAQQDLGDRGATLS
FT                   QDAGTLASRLGARTLVQWLLSDLPLPDALAPVAGPADRQIAGFQGFLQ"
FT   gene            complement(514182..514670)
FT                   /locus_tag="Aave_0478"
FT   CDS_pept        complement(514182..514670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31085"
FT                   /db_xref="GOA:A1TJE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE7"
FT                   /protein_id="ABM31085.1"
FT                   /translation="MLKLTDRADLGVFYDADAARYGDQGYTETVTRERFAAFYADCPSI
FT                   GFEADGQPIGGILFDGEEAHIAVLPSHHGRWALLLKPALAWLFALQPGITVAVERNNSR
FT                   CLRFLDRHGWQRAGERDGDLLYRLEPQGGTRKTAYPFRRRARGTVSPSTEVAPCTHPS"
FT   gene            complement(514698..515084)
FT                   /locus_tag="Aave_0479"
FT   CDS_pept        complement(514698..515084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0479"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_3011 HrpB1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31086"
FT                   /db_xref="InterPro:IPR013394"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE8"
FT                   /protein_id="ABM31086.1"
FT                   /translation="MDETQLPDDPVAALAVRLVEALRDDRLDEAETLLDEMNALSPETE
FT                   EHLIFPVLIAIQRGYITEALQYLNTLGEDTAPELKALCLNILGDPTWHYHAQQCLESDD
FT                   PHVRKAMRQLLQMEPEDEPAALAA"
FT   gene            complement(515166..516863)
FT                   /locus_tag="Aave_0480"
FT   CDS_pept        complement(515166..516863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mag:amb3422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31087"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJE9"
FT                   /protein_id="ABM31087.1"
FT                   /translation="MSAIKKAFQAIGKGIEKAVHSVGQIAKGIVTLNLKAAAEGLKGLA
FT                   DATMTMARGAMNLMPAAMAANTLLDGALDKMLRKVQNSAQKLADSVVDSVEGGLSNIKD
FT                   GVVNTAKGIARGNFSKAFKGLTQLAMGVVDTASNFGPGGVAKNMARMAVDAAIGLAGQE
FT                   ATKLAAKVLDPHGTSRFGALATDMVGAAVGGGLGGSRAGRFAGCGTGATGMLQGAKHAV
FT                   QDTARTAALGFAQEQVSTLTLKVQMTLDPDGDSRAGEAGANAFDSAANAALFQATAGRR
FT                   RADGTRATAGEHLRGVQGAATDAALNSLNFSAQTAVQGAIYEQLSPLGAGTGTGLGSSL
FT                   GAIGTDAAAGVAGAAVNHAFTGRQRGLDGAVQPMAPSTALAATKGAILLAVDQFVQQVI
FT                   ARTILEAIQSTLGQLDAASLKGFASLSEAPDTTDAPTGQGPAEMARRAAAHIRQQMGLS
FT                   IEMAIDQATRQATEAIGQRLLQGLAGGGNNARALGGDLAAITRNAAMQPIEQASRSVFD
FT                   AVQGAIGVAARQTVEQGLADKLPLGGSSTAATLQVQIEAQISHYQIRA"
FT   gene            517877..520402
FT                   /locus_tag="Aave_0481"
FT   CDS_pept        517877..520402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0481"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG:
FT                   bur:Bcep18194_B1581 rhs element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31088"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF0"
FT                   /protein_id="ABM31088.1"
FT                   /translation="MTRRVTIQTPLGEQLQFRQLQGREELSQVFSLDIDLLSEDKSIDP
FT                   KALLGKSATVVVETEGGGRRYLDGIVTRFGMQGQDHRFYAYRLRLQPWVWLASRKSDFR
FT                   IFQNKSVPQIIEEVLGAYGYPMEKKLSRSYRTWEYCVQYDESDLQFVSRLMEHEGIYYY
FT                   HQHAQGQHTLTLADDIVASHQPLPGAATIPFYPPEKSAVADRENIHAWELHEEIHSGRF
FT                   YNDDYDFKKPKADLANMRQMPPGHSHDAYETYEWPGGYTEFGDGEAYARVRLQENLSGR
FT                   STVRGESRHRSLATGYLFTLENYPRADQNQQYLITGLQYHFKENPRVSAANPGQKGTVQ
FT                   EEGSFQRFTLQAQPTSLPYTPARVTPKPKTTGPQTAVVVGPPGEEIWPDQYGRVKVQFH
FT                   WDRQGRFDEQSSCWIRVSQGWAGQNYGSIYLPRIGQEVIVDFLSGDPDQPIITGRVYNA
FT                   DQMPPWKLPEHKTQSGTLTRWSKGGGGASMLRFEDQKGIEHLELSNTYGNTYLNMGYLM
FT                   HQGTGSQRGYGFELRTDLWGSIRADKGLLITTYPQDFTSMAANFNPDGFDQLGAGLAGT
FT                   ASLMQQASQAAQTLDANLGALNSLKTSHMMELGAGIAAMTGAQATSASLSKAAAALSAF
FT                   QGGGGGAPEAALPSDTDPAMPQSQALRELSRDITQPIVSIVSPQGHTMVSPKPIVISSG
FT                   QSASMHATQHITVSSGAQLTQLAKAGMLTHVSEGGQRTTVGAGDIATDAQTGNLNLTAQ
FT                   QNATLASRTDTATVVGQQNVNLQATEDSVLVKAGQHIRLQAGATITLTAGEGASITLTS
FT                   DGKVEIRGKNGLIELKDVLTVLGKPVNIN"
FT   gene            520433..520912
FT                   /locus_tag="Aave_0482"
FT   CDS_pept        520433..520912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31089"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF1"
FT                   /protein_id="ABM31089.1"
FT                   /translation="MQYHIQEATFDLPEGSFIDRSVNVLVFGDPALPFSVVITRDYFDE
FT                   GGSVEQLLREQVKALSTSGKQFKELEFGTTHLPLNAPAGTQPTSASASAAGGAPNAAGA
FT                   YVTYTKQGHPIHQKIVLAEMPGRRALVVTGTYAGPWKEEHVAHWASVLHTLRLRA"
FT   gene            520962..522755
FT                   /locus_tag="Aave_0483"
FT   CDS_pept        520962..522755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0483"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bur:Bcep18194_B0648 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31090"
FT                   /db_xref="GOA:A1TJF2"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF2"
FT                   /protein_id="ABM31090.1"
FT                   /translation="MPKAARLHDPIAHTYAREGHAAGAAAAVGIEFGAAVAIGAVVGTI
FT                   ACPGLGTAAGIAIGIGVAVASFVVAHAFSLVGDFVQSFGEAFGRSFTSDCGTLTATGST
FT                   TVFINGKPAIRTGLDVATCDKHSMPTSLVIFGSENVFIDSYRAAREGDCVDCEAKISKG
FT                   SEDVFIGGESVPVANFREREVPQSDREFASKARFWAGILGGAAGALKAGVKCFGMAVLS
FT                   GVVGAKVMGEILPSFDGGHSAATGAGDSAGTALGNFLQGKPVHVVTGAKVLLGDDDTDF
FT                   SLPGALPITWRRAYASCDARTGALGTGWSLPFSVELVFEGGKAHFIDEAGRDIPFDDLP
FT                   PGAQMFSVPEGVQLSRGEGGAYFIGMPALGWIYCFGQRAGSSDGERLGLQQWADFNGNT
FT                   IDFHRDADGVVRHVTDSAGHRLALRYAQAGGLRLVRVDLTAGGPAGTLVEYRYDAHGQL
FT                   AQVIDRLGRCVRRFTWEGTTLVSQTFASGLVARYRWDRPAPEGLEREVMPLQVDVACSV
FT                   YPAHELGNVVPAVGDAPFRIGDRDSAAERASHRQCHPWALHSGGSGSRPAQWLLDLQRP
FT                   NRPSIMTCSASFNVAKWWRFS"
FT   gene            523213..524478
FT                   /locus_tag="Aave_0484"
FT   CDS_pept        523213..524478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0484"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   psp:PSPPH_0667 prophage PSPPH01, site-specific recombinase,
FT                   phage integrase family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31091"
FT                   /db_xref="GOA:A1TJF3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF3"
FT                   /protein_id="ABM31091.1"
FT                   /translation="MAVNLLSARRVETAQPREKSYMLKDGGSLFLYITPHGAKLFRYRY
FT                   RIGGKPQIYSIGAYPEVSLEAARKERDQARELVKKGIHPLTNKKIKLVEQIASNDNTYE
FT                   AVARRWMQDNSHWSSGYAGQVKHYLTQDVFPLIGRLPLVSIKPSHLRPVIEAVSARGAK
FT                   SIAVLIRQWSGQIFAYGATRGLCEDDPAALLKGLVKRPPVRHNPPLSWSELPGYLRRVD
FT                   AEGGYRTTVIALRLMALLFVRTAELRKAWWEEFDFEAALWIIPAGRMKMRRPHIVPLSK
FT                   QAIALLLELRQLTGGGKVLFPSYRKPGQVMSASTLNQALKRMGYGGRFSAHGFRSTAMT
FT                   MLSLLSYPEKRVDLQLAHSEEDSSRAPYDHTKFMESRKIIMQDWADILDECAGGASVAD
FT                   ITAKFGPMSERRKALLSVIERE"
FT   gene            complement(524913..525860)
FT                   /locus_tag="Aave_0485"
FT   CDS_pept        complement(524913..525860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0485"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bpa:BPP1897
FT                   IS1002 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31092"
FT                   /db_xref="GOA:A1TIK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK3"
FT                   /protein_id="ABM31092.1"
FT                   /translation="MNSHKHARLTRAGRALLVDRVLQQNWTMRQASEAAGVSLRTGYKW
FT                   MARFRNEGPDGLLDRSSRPHRSPQACPPEQVQLFEQQRRQRLPLWRIARETGRSLATVA
FT                   RHMDRIGLSRLASLEPPQPVRRYERASPGELLHIDTKRLGRIHGVGHRITGDRTQNRNR
FT                   GIGWDAVHLAIDDHSRVSFAQVLADETALSCVQFLRDAVAYYANIGVRIERVMTDNGSG
FT                   YKNAFRAACEELGIRHIRTRPYTPKTNGKAERFVQTSLREWAYARPYESSAQRTAALQP
FT                   FIDGYNWCRPHSALGHQPPITRIPGVNNLVRLNS"
FT   gene            525947..526345
FT                   /pseudo
FT                   /locus_tag="Aave_0486"
FT   gene            complement(526435..526806)
FT                   /locus_tag="Aave_0487"
FT   CDS_pept        complement(526435..526806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0487"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebB79 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31093"
FT                   /db_xref="GOA:A1TJF5"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF5"
FT                   /protein_id="ABM31093.1"
FT                   /translation="MRKEQPVTRPAERRGAMSIVRSLVHAAIWVGLLIAVAFAINVLGI
FT                   RAVGSAEAWEQWIKAHAGHLLVWRISVYGCIAFGWWRIRRVDSKKDRPLADSMRIRRAV
FT                   IAAMAIILIGEISAIGSRW"
FT   gene            complement(526785..527744)
FT                   /locus_tag="Aave_0488"
FT   CDS_pept        complement(526785..527744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0488"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: xac:XAC2285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31094"
FT                   /db_xref="GOA:A1TJF6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF6"
FT                   /protein_id="ABM31094.1"
FT                   /translation="MNANGVRRVQHLVNVSGGKDSTATYLLALESGRDFRAVFADTGNE
FT                   HELTYEFVQRLPERTGGPAIQWVKADFRARMAKHKAYVLEHWPQMGIPDALVREAAELH
FT                   EPTGNPFLDLCITKGRFPSRMAQFCTSELKELPITEQVVLPMLRRGPVIQWLGIRAEES
FT                   RHRALQPRLNRHESGCYLWRPIFEWTLQQVWKKHADHGLTPNPLYSLGMGRVGCMPCIH
FT                   TRKAELRSIAERFPEHVDRIERWERVVAAANKRHAATFFPVRKDPTDADRPGQYSGIRR
FT                   VVQWCRTARGGRQYALFFDDQPGGGCSSDLALCERNSL"
FT   gene            complement(527741..529141)
FT                   /locus_tag="Aave_0489"
FT   CDS_pept        complement(527741..529141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31095"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF7"
FT                   /protein_id="ABM31095.1"
FT                   /translation="MDDMASPRFAPRAGLRSLIAIAALAALCSTSGAQTRIDEDGIRAN
FT                   GNVIGSDVLYSIGGGRAVSMSPAGNMQSIGVGMGWNSNLICGDMSITTTLQNQLNGISN
FT                   GFQSIMTNVIQSATSAVASLPALIIQRADPGLYNLLTNGILQARLDFDRSKMTCRAIAS
FT                   RMADMAGGQTGWDQLAEGMALKQAVSSTDAVSAIERAEANKGNNGVPWVGGSSAGGSGQ
FT                   SSIKIVGDVTRAGYNLLNGRGATDTSSISASDCNGRLSCQTWSSPQAAATWATRVLGER
FT                   EQRTCETCTKTSTTPGVGLTPLIQEEYEAKLKALQELVSGAKPTTAANLDAAGSASLPL
FT                   TRGVIEALRDEPDQDLLGKRLASEVALASVMEKALLLQRTLLTGRKEPNVAANELATKA
FT                   VDQESGALEQEIQNLKTELELRRELAGNSPMTLIQRYSTRAAGSRGIYQGDPTRDRVQE
FT                   IQKPRSTQ"
FT   sig_peptide     complement(529040..529141)
FT                   /locus_tag="Aave_0489"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.880 at
FT                   residue 34"
FT   gene            complement(529162..530091)
FT                   /locus_tag="Aave_0490"
FT   CDS_pept        complement(529162..530091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0490"
FT                   /product="protein of unknown function DUF1527"
FT                   /note="PFAM: protein of unknown function DUF1527; KEGG:
FT                   xac:XAC2283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31096"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF8"
FT                   /protein_id="ABM31096.1"
FT                   /translation="MRSKRLRAATFGVLLAATLPTYALDTATIVASAFSPDCFAYRVSG
FT                   ICYWLYCTWSGCTVRTSVKVRHYVPDAVVSSYSNTGANPWVEVRAMSVPNPTAQAGGDG
FT                   TTNQSHENNLAKFKNADVIGHPAGEAFSAFASASGYTCEGAGTPFMPYLLSTFDTLAWR
FT                   YNVPELAYPESLTPGMREIGSRLSVDLWGNVYPRGGFLHQTDDYFSGAVVAQRAGDVVT
FT                   RTGQPHVYQPLLASPRAGYWPAGPLVESNPDSGKWQELTPTLSSQCAVFPNRGPHVQAQ
FT                   QGDYAWALWRPYSCCQRRGQVFLGSTDF"
FT   sig_peptide     complement(530020..530091)
FT                   /locus_tag="Aave_0490"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(530091..530513)
FT                   /locus_tag="Aave_0491"
FT   CDS_pept        complement(530091..530513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0491"
FT                   /product="protein of unknown function DUF1525"
FT                   /note="PFAM: protein of unknown function DUF1525; KEGG:
FT                   xac:XAC2282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31097"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJF9"
FT                   /protein_id="ABM31097.1"
FT                   /translation="MRTSLALLARATAGLALMASASAFADDVRIFTDTAHPATAVPGAT
FT                   IIELDAPARLVSDLSAGLPRDPQRAEAMMRQRLANPTFAERQKRIGQAYQAVADAYLLG
FT                   VAKLPAVVIDGRYVVYGDADTRRALGRIAAYRRAGQ"
FT   sig_peptide     complement(530436..530513)
FT                   /locus_tag="Aave_0491"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            complement(530671..531174)
FT                   /locus_tag="Aave_0492"
FT   CDS_pept        complement(530671..531174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0492"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: xac:XAC2281
FT                   RadC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31098"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG0"
FT                   /protein_id="ABM31098.1"
FT                   /translation="MPQLATSEVLQPSTTPCPALTVQESRLVHRALHVLEQRMFHREAA
FT                   ISTPRELYDYLRLKLAGELHEVFGVVFLDCQNRAIAFEALFRGTINQAVVYPRVIVKRA
FT                   MDLNASSVILVHNHPSGTSQCSDADRGLTERICASLGLIDVRVVDHVIVGSGTPYSFAE
FT                   AGLL"
FT   gene            complement(531453..532442)
FT                   /locus_tag="Aave_0493"
FT   CDS_pept        complement(531453..532442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31099"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG1"
FT                   /protein_id="ABM31099.1"
FT                   /translation="MPAEAGIGSSLHRERSSTMTPTRINTHVALAHAISPLKVWSSFKD
FT                   ENVRQHVLRVARALLAVRRDLEASAHALATTRLHALGHTVVQLALVADLLPGGPLHGLL
FT                   LPQDRNAAKWSSGMLKHGWHGLATTSQIAWALGFDHASFAEAADNPTLRWIACGEVPLY
FT                   LRGSWQVLGGVIDAPLLRWMSDLGRRQDEQPEASCAALKGSYRDTIQQWDFMASALRDL
FT                   HLRMQECCWMLNQLSERLDPLGQRVLSAIETRFTGAGRGLPTDDVYAEFDSDQQHSMRT
FT                   GCAALLRLAQIRLIDDEGALTDHGRDAVVDARRLIWAAHPPLPRVPRP"
FT   gene            complement(532566..533504)
FT                   /locus_tag="Aave_0494"
FT   CDS_pept        complement(532566..533504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0494"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   xac:XAC2278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31100"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG2"
FT                   /protein_id="ABM31100.1"
FT                   /translation="MKRKIVAALVAALPLLASAFPERPIKLIVPMAAGSITDVAARSVA
FT                   EAMSQRLKQPVVVDNQQNLVGTMAAVRAAPDGYTLLIVGITNAATNVITMKSPPYDPRK
FT                   DFTPIGQMAELPYLLVASTKLPAQTMKDLISYGKSHPDKLSYGYGSGSAQLATVRFTSM
FT                   ANFTATGVGYKGVPQAMTDLMGGTIDFVVADLNNGLQAARAGRVTALGVTSAKRSPLAP
FT                   DVPTLHEQGLEGYDISVRFGLAGPAHLPASITEQLNAALREALNDPAVRQRFDGAGIAI
FT                   VPSSPEVFARNIRDDIAKWSAIARDAGIAPQ"
FT   sig_peptide     complement(533445..533504)
FT                   /locus_tag="Aave_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 20"
FT   gene            complement(533574..534461)
FT                   /locus_tag="Aave_0495"
FT   CDS_pept        complement(533574..534461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0495"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: xac:XAC2277 3-hydroxyisobutirate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31101"
FT                   /db_xref="GOA:A1TJG3"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG3"
FT                   /protein_id="ABM31101.1"
FT                   /translation="MRIGLVGAGNIGKHFAARWAAAGHCVSVYDTCKKARSHAASMGAI
FT                   PAADLGGLIANQDAIALSLPTPEVVVDVAQAIADLARVHTVRLIVDLSTTGADATVRVD
FT                   TMLKQAGVPFFSAPVSGGTVAAAEGQLTVMAAGPLPGWERAMPMFDAIARHTFYLGPNI
FT                   RLGQTLKLINNTLYAACMLASCEALVCGTKAGIEAHTLLNVINRSSGRCFATMERLPNA
FT                   LDRSFPLRFKTSLLRKDVHLALMAADELGVPMQVSKAALRLLDDAMVAGLGEADNITAI
FT                   RVVERHAGVVFGEL"
FT   gene            complement(534594..535541)
FT                   /locus_tag="Aave_0496"
FT   CDS_pept        complement(534594..535541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0496"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: xac:XAC2276 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31102"
FT                   /db_xref="GOA:A1TJG4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG4"
FT                   /protein_id="ABM31102.1"
FT                   /translation="MQFRLKQMDVFRAVMLTGTVKGAAAMLCQSQPAVSRSLAHTEQSL
FT                   GLTLFQRTKGRLVPTPEAEALIEQVNPFFQHAIRINDFATSLRTASVGHLTVISSYCLS
FT                   RGLVSRAVVRFMERHPKVQVQLRTSLLADMPKALLSEEADIAVAAVAMDHLQLQVQPLT
FT                   EGRMVCVMQTGHPLAGADSVCFTDLAKHVVITPHPSIPFGQLLSAALERAGVSLDARVN
FT                   VHNMDLACALVRAGAGLAIVDEFTVDGLDGMQGLATVALKEDVLIAPAVICSAHRAMRP
FT                   CTESFLDALTEQAFMDRQRRSRVEREQKPCLSAT"
FT   gene            535815..538340
FT                   /locus_tag="Aave_0497"
FT   CDS_pept        535815..538340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0497"
FT                   /product="Rhs element Vgr protein"
FT                   /note="PFAM: Rhs element Vgr protein; KEGG: bps:BPSS2093
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31103"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG5"
FT                   /protein_id="ABM31103.1"
FT                   /translation="MTRRVTIQTPLGEQLQFRQLQGREELSQVFSLDIDLLSEDKSIDP
FT                   KALLGKSATVVVETEGGGRRYLDGIVTRFGTQGQDHRFYAYRLRLQPWIWLASRKSDFR
FT                   IFQNKSVPDIIEEVLGVYGYPLEKKLTRSYRTWEYCVQYDESDLQFVSRLMEHEGIYYY
FT                   HQHAQGQHTLTLADDIVASHQPLPGASTIPFYPPEKSATADRENIHAWELHEEIHSGRF
FT                   YNDDYDFKKPKADLANMRQMPPGHSHDAYETYEWPGGYTEFGDGEAYARVRLQENLSGR
FT                   STVRGESRHRSLAMGYLFTLENYPRGDQNQQYLITGLQYHFKENPRVSAANPGQKGTVQ
FT                   EEGSFQRFTLQAQPTSLPYTPARVTPKPRTTGPQTAVVVGPPGEEIWPDQYGRVKVQFH
FT                   WDRQGKFDEQSSCWIRVSHGWAGQNYGSIYLPRIGQEVIIDFLSGDPDQPIITGRVYNA
FT                   DQMPPWKLPEHKTQSGTLTRWSKGGGGASMLRFEDQKGIEHLELSNTYGNTYLNMGYLM
FT                   HQGTGSQRGYGFELRTDLWGSIRADKGLLITTYPQDFTSRVSVNNPDGFDQLGAGLAGT
FT                   ASLMQQASQAAQTLDANLGALNSLKTSHMMELGAGIAAMTGAQAASASISKAAAALSAF
FT                   QGGGGGAPEAALPSDTDPAMPQSQALRELSRDITQPIVSIVSPQGHTMVSPKPIVISSG
FT                   QSASMHATQHITVSSGAQLTQLAKAGMLTHVSEGGQRTTVGAGDIATDAQTGNLNLTAQ
FT                   QNATLASRTDTATVVGQQNVNLQATEDSVLVKAGQHIRLQAGATITLTAGEGASITLTS
FT                   DGKVEIRGKNGLIELKDVLTVLGKPVNIN"
FT   gene            538371..538829
FT                   /locus_tag="Aave_0498"
FT   CDS_pept        538371..538829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: yps:YPTB3622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31104"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG6"
FT                   /protein_id="ABM31104.1"
FT                   /translation="MQYHIQEATFDLPEGSFIDRSVNVLVFGDPALPFSVVITRDYFDE
FT                   GGSVEQLLREQVKALSTSGKQFKELEFGTTHLPLNAPAGAPSSGGAHNAAGAYVTYTKQ
FT                   GHPIHQKVVLAEMPGRRALVVTGTYAGLWKEEHVAHWASILHSLRLRA"
FT   gene            538874..543688
FT                   /locus_tag="Aave_0499"
FT   CDS_pept        538874..543688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0499"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; PAAR repeat-containing protein;
FT                   KEGG: bur:Bcep18194_B0648 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31105"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG7"
FT                   /protein_id="ABM31105.1"
FT                   /translation="MPKAARLHDPIAHTYAREGHAAGAATAVALEFGTAVAIGAAVGSI
FT                   ACPGLGTLAGIAIGIGVALVSFAIAHVASLYGDFAQSFGEAFGRSFTSDCGELKATGSS
FT                   TVFINGKPAIRTGLDVAECDKHKMPPSLVIYGSENVFIDSYRAAREGDRVDCEAKISKG
FT                   SEDVFIGGESVPIAEFRVNEVPESDREFARKARFWAGILGGGVSALKAGVKCFGMAVLT
FT                   GVVGAKVMGEIMPSFDGGHSAATALGDGMGTAVGNLLQGKPVHVVTGAKVLLGDDDTDF
FT                   SLPGALPIVWRRTYASCDARTGALGTGWSLPFSVELVFEGGKAHFIDEAGRDIPFDDLP
FT                   PGGQMFSVPEGVQLSRGEGGAYFIGMPALGWIYCFGQRAGSSDGERLGLQQWADFNGNT
FT                   IDFHRDADGVVRHVTDSAGHRLALRYAQAGGLRLVRVDLTAGGPAGTLVEYRYDTRGQL
FT                   AQVIDRLGRCVRRFTWEGATLVAQTFASGLVARYRWDGPAPQGRVVQHWLEDAAPGMPA
FT                   TAWTFEYDLPGERPGDRRTRVTDHLGRVQLFDHDADQNVTRIEDPLGQVQRMEWNDLWQ
FT                   LLAWTRADGSRFTFTYDRLGNLNGATDPLGQTARLDWHERLQRVRAATAVDGTRWHYTY
FT                   DDRGNRTEVLGPPLKPGTPPHIPSDGDEVRWRESTLHDPRGLPVVTIDANGGRQQWTWD
FT                   ERALLVRHTDCSGKTTRFEYDGNGFLSKHIDALGQITHYVHDALGRLLSVTRADGTAER
FT                   YTYDGADQLVSAGDSSNRLTHYRYDIHGKLLALQRPDGSTVHLGYDAAHRLASLVSENG
FT                   ANYRFAYDTANRLVQEQRPDGSRHTFSHDSLGRVVELREDPGEDDVVGQAIRGHAPAAP
FT                   IRTTCERDGIGRLIAKRVQAMTGAPSSQDTIEQRFAYDKMNRLVRAETLDAAGQSPAQV
FT                   AEFGYTLLGDLAQEAAEDVVSGTRSVMRHTCDPLGNRLATELPDGRLLRELHYGSGHVH
FT                   QISLDGVVVADIERDDLHREVLRTQGRWASRWAYDPLGRQRAQWTQSASLRVGGNWAQQ
FT                   MPDAANASGPGMLTDGLRKQWDYDAAGELVRTRHSRNGETQYRYDPAGHVLSATLQAAG
FT                   AAGGLSPALQQALHEVFHYDPAGNRLDAPVPQGAEGSRGWVRHNRVKVLQDKRFDYDGF
FT                   GRLVRKRIGGHTELHCRYDALHRMIAASVIRAGRDGEPIRQVFRYRYDPLGRRIAKEDD
FT                   FGETRFVWEGMRLLQESRGAHNSTYLYEPSSYRPLARIDGTGPLEPEHPVAVLALAGED
FT                   PRGDPAAGKVRSIPVTNGDASDARHAVAGPVGATARYLAEVEALERGAGPDEPGQSTGR
FT                   GGQARQTQSASTPSARIYYFHLQPSGLPEEMSDRNGHLVWRAQYRLWGNAVAEEWQAFD
FT                   ATGRPVNAPMAETGIRAQVSASPAPQNLRMQGQYLDRETGLHYNTFRYYDPDLGAFTTP
FT                   DPIGLAGGLNLHGYAANPLSWIDPWGWACIPNKVAGTAREARVGAKLDGKFGASNVLRE
FT                   RYLRDANGKIVRDPLTGEARRVDFVVKGSDGKGTAIEVTSKTANKDAQQLKEARIRAQG
FT                   GVYVREPGSKVLVEVRNTSRVVRVE"
FT   gene            544457..545341
FT                   /locus_tag="Aave_0500"
FT   CDS_pept        544457..545341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: atc:AGR_L_2371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31106"
FT                   /db_xref="GOA:A1TJG8"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG8"
FT                   /protein_id="ABM31106.1"
FT                   /translation="MVDPKPPKIYGLIPRYGQGRLLRWSVSITRGGEHFDKEFRVATYD
FT                   DPEKAKAAAIAYRDELLKRVPATSRRDFATIVRSNNTSGVPGVVRREENGFARWCAMVS
FT                   LPNGKTRRRTFAVTKYGEDQARERAIKARLELLTLIDGWFVHHPDAVPEGQTPSEIVAP
FT                   ATPRRDRRPAQASNRKPSPEKRVYRMAIKWTLRDGTQVCRDYWVAECDLPTGGVRRKQF
FT                   AVCEHGDVEARRLAFEQRREWLAHPPAAAPRRARRSSAGSPSGDSSPEVSAPAPAMPAS
FT                   PARTSGHLPAPPR"
FT   gene            complement(545268..545978)
FT                   /locus_tag="Aave_0501"
FT   CDS_pept        complement(545268..545978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31107"
FT                   /db_xref="GOA:A1TJG9"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJG9"
FT                   /protein_id="ABM31107.1"
FT                   /translation="MRPTITRLLRWRTALSYIEWPIAAAAILLAAALAIAIWPEHPQVP
FT                   SSEPQPAQPAPPMPPGPPWTHGRSDARFTITIYADLECPYCRDYVPQLVRWVAATPDVS
FT                   LQWHHLPLQAHEPAASQEARLAECAGNERGHAGFWHTVDWIYAHTSAEGRGVPDGTSYP
FT                   DMTPQMQACVSSEESKTTVSRQAQQAAADGITGTPTLRLRDRTSGKEMHLSGAVPADAL
FT                   MSALDLLASPVPGR"
FT   sig_peptide     complement(545868..545978)
FT                   /locus_tag="Aave_0501"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.743 at
FT                   residue 37"
FT   gene            complement(545993..548929)
FT                   /locus_tag="Aave_0502"
FT   CDS_pept        complement(545993..548929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31108"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH0"
FT                   /protein_id="ABM31108.1"
FT                   /translation="MPRHPHWRWSERAAGALHRLRSGVAAMGSAAPDHPGAEPPDAWDT
FT                   HIARLAENGIPPPGAHVRPSGAPPATEDDERALYGVSPSFVDMLPWAEYLPESRCMLLD
FT                   DGVSVAAFFELVPIGTEGREMAWLWQARDALENALQDAFDELDDHPWVVQLYAQDEASW
FT                   DRYLRGLDAYVQPRARDTAFTTFYQRFFAHHLRAIAKPGGLFEDTAVTRLPWRGQARRV
FT                   RMVVYRRLGDAASQRRGLSPEQALATICDRLQGGLANAGVRAERLGAADIHAWLLRWFN
FT                   PQPRLLGDTALDRERFYDLTRYPDEAEEGDIELASGTDFTQRLFFGPPRSDVDNGLWWF
FT                   DGMPHRAVVMDRLRNAPGTGHLTGETRKGDAINALFDQVPEDTVMCLTLVATPQDVLES
FT                   HLNHLARKAVGETLASEQTRRDVQEARGLIGSAHKLYRGALAFYLRGQDLAQLDERGVQ
FT                   LANVMLGAGLQPVREDDEVAPLNTYLRWLPCVFDAAKDTRQWYTQLMFVQHAANLAPVW
FT                   GRSRGTGHPGITLFNRGGDTITFDPLNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVT
FT                   AMYRPRLFIVEAGNSFGLFGDFAARLGLTVNRVRLAPGAGVSLAPFADARRLVDTPSQV
FT                   RTLDADALDEGPDAGGTASDGDEQRDVLGELEITARLMITGGEDKEEARMTRADRSLIR
FT                   QCILDAARRCTAAGRTVLTRDVRDALRERAGDANLPDMRRARLLEMADAMDMFCQGADG
FT                   EMFDRAGTPWPEADITIVDLATYAREGYNAQLSVAYISLINTVNNIAERDQFLGRPIIN
FT                   VTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLGTQNLDDLPKAAEPMLNMIEWWICL
FT                   SMPPDEVEKIARFRELNAAQKALMLSARKEAGKFTEGVILSKSMELLFRAVPPSLYLAM
FT                   AMTEPEEKAERFALMQQHGINELDAAILVAERIDRARGIEPLPHHALG"
FT   gene            complement(548929..549393)
FT                   /locus_tag="Aave_0503"
FT   CDS_pept        complement(548929..549393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcb:XC_2032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31109"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH1"
FT                   /protein_id="ABM31109.1"
FT                   /translation="MRSTWTERRMPRRHLLATIALLLSGCATHKDDLLSHGDRTMRDIW
FT                   DQETGGAGAPGAQGGGAAARQLLDARQVLRRPLTAADFQAIPGQNAAYTRTAQNEIYRQ
FT                   FRRLPNPDLVMYVFPHLAGTDPVPVPGYSTVFPLYQRVQYAMPGERVEDY"
FT   sig_peptide     complement(549301..549393)
FT                   /locus_tag="Aave_0503"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.795 at
FT                   residue 31"
FT   gene            complement(549374..550849)
FT                   /locus_tag="Aave_0504"
FT   CDS_pept        complement(549374..550849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31110"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH2"
FT                   /protein_id="ABM31110.1"
FT                   /translation="MKSNGLLKWLMIPVIALLVFLGIHLTSGRSDKSAAGGGTAQLTPE
FT                   EMKALGIDGDTPRDTVATLVAQVKQLRGELQTAVGDNKNQRAENERLRQRDSSIDQRIQ
FT                   AAIDGERNRQRQENDQAAGDKQQTQSMLQDLQHKLDQLGAKGGSADLPVGLGLEEGDGK
FT                   GFGTSGASGVRWVEPDDARPDAGKTAPGGPGKADRFPMRFGPADGGTGGGSASATPAGT
FT                   SPATEAKPAKPVYTLPTNATLMGSVAMTALIGRVPIDGTVNDPYPFKVLIGPDNLTANG
FT                   IDLPEVAGAVVSGTASGDWTLSCVRGQIRSITFVFRDGTIRTVPDDKAQGGAGGSRGGS
FT                   GNGNAADGQGPILGGLGWISDPHGIPCVGGERRSNAQQYLGSQALITAAGAGAASLIKS
FT                   DSGSVAVVSNGNGSLGTVGISGNEAMGRILAGGVQEMSQWVNKLYGQAFAAVYVPPGAQ
FT                   VAVHLEQPLQIDYEAQGRKVRHTTGGIHAIDLD"
FT   gene            complement(550839..551834)
FT                   /locus_tag="Aave_0505"
FT   CDS_pept        complement(550839..551834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31111"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH3"
FT                   /protein_id="ABM31111.1"
FT                   /translation="MTRPISFALRALALGATLWLGGAPAAHALQILRWERMPMAVPLRV
FT                   GEERVVFIDRNVRVGVPAAIADRLRVQSAGGAIYLRASEAIEPTRLQLQDADSGALILI
FT                   DIAAEAPKEGQGPLEPVRIIEGDTPGPRYGARDASADTDAGSGEQSAETHASGPTEPGA
FT                   RARHETPVAVVLTRYAAQSLYAPLRTVEPARGVSQANLRRGLNLDALAPSLPVRAQALA
FT                   AWRMEDQWVTAVRLTNTSPRWVDLDPRLLIGDFVAATFQHPGLGPAGDATDTTVLYLVT
FT                   RGRGLGDALLPRISRIDAAQNLPPPAADAAAVTEATPATPRQPSGADHEK"
FT   sig_peptide     complement(551748..551834)
FT                   /locus_tag="Aave_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 29"
FT   gene            complement(551831..552532)
FT                   /locus_tag="Aave_0506"
FT   CDS_pept        complement(551831..552532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0506"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31112"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH4"
FT                   /protein_id="ABM31112.1"
FT                   /translation="MSRFRNEVAHLQAHVSTLRRVGAALFALAVLLGIGWANAPRHLTI
FT                   HVPPDLRSGSTRKWWDVPPENVYAFGYYIFQQLNRWPTNGEEDYPRNLRALSAYLTPSC
FT                   QALLQQDYETRRNNGELRQRVRGLYEIPGRSYGEDPTTRVKVLSERDWIVTLDVAADEY
FT                   YAGEQVKRALVRYPLKVVRLDIDPERNPFGLALDCYSGTPQRITPPAPPPAATTPGSPS
FT                   APAAPLPGSTP"
FT   gene            complement(552529..552987)
FT                   /locus_tag="Aave_0507"
FT   CDS_pept        complement(552529..552987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31113"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH5"
FT                   /protein_id="ABM31113.1"
FT                   /translation="MAPQDTTRDGLVAFLPHRLNRQPVVVRGLTADELWVCAGASAAAG
FT                   LAAGLPLAWITRSIAMVPTMIVAGIAAGVFIGGGILRRAKRGRPDTWLYRQLQWRLALR
FT                   HPLWAARLGGHGLVTRSGCWTTRRTVPVRRLRGRRGFHPHHANPRGRP"
FT   gene            complement(552998..553366)
FT                   /locus_tag="Aave_0508"
FT   CDS_pept        complement(552998..553366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31114"
FT                   /db_xref="GOA:A1TJH6"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH6"
FT                   /protein_id="ABM31114.1"
FT                   /translation="MQASTLPPSRASCAAPILATAALLPIASPAFAVGLPTMEDPSRGA
FT                   GKGILQTLQNYGYDIVLLVALLVVASMFVGVCYHAYTRYSEIHTGRATWGQFGLTVAVG
FT                   AMLLVVGIWLLTKATAIL"
FT   sig_peptide     complement(553268..553366)
FT                   /locus_tag="Aave_0508"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 33"
FT   gene            complement(553399..553641)
FT                   /locus_tag="Aave_0509"
FT   CDS_pept        complement(553399..553641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV2374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31115"
FT                   /db_xref="GOA:A1TJH7"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH7"
FT                   /protein_id="ABM31115.1"
FT                   /translation="MTASADQLAAFQANGGFPASAVADVVLGFVFAVLLLWGVWAMRAA
FT                   YAGWAEQRLSQRQFLAVVVRFLALYLVLTFLLLSR"
FT   gene            complement(553638..554015)
FT                   /locus_tag="Aave_0510"
FT   CDS_pept        complement(553638..554015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31116"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH8"
FT                   /protein_id="ABM31116.1"
FT                   /translation="MTSRATASHAASPRLPLSGVLAVALLCGATSASADTALERERLAG
FT                   AQRLLDQADRLAATAAPAAASEPSRYHFDYARLHDDVRRMQTGFASYLIPVRAQPRDPS
FT                   ALAGQYTRENAPGPAPAEQRR"
FT   sig_peptide     complement(553911..554015)
FT                   /locus_tag="Aave_0510"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            554462..555766
FT                   /locus_tag="Aave_0511"
FT   CDS_pept        554462..555766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO4670 serine protease precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31117"
FT                   /db_xref="GOA:A1TJH9"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJH9"
FT                   /protein_id="ABM31117.1"
FT                   /translation="MRHTWLFVTACAMALSSTAQAQDAKALEQLEVISRSYAKDNHVAE
FT                   AEASRRLELRQVLARPEIEAFKADYADRLDTAYWDDSRDGFKLVLRLKQGPLPAIHELS
FT                   TTHGTIPVKFTLVSGKTLDEISAVLAANQALLQEQVPGLQGTGIDEVDAAIVLYVFVPA
FT                   EEQAAYEAENAALSRQLGVPVRFKFLPGPMESEPQESPEQSSSSTLPTQSAPMATTESP
FT                   YVRGGSQILNLDNGHQCTGGFIVRNKDNTKWGLVTAAHCGKNLMYGNWSDAASGAQVTA
FT                   KLTYEDQLFDATHDLAWHSFPVLGYRPLGEVFARDTCSSCGVVILSTAAAVPGDRVCHR
FT                   GLLTGWTCGVVSSSTASFGSKDCNGQVCDPRAYKVVVGDDLACFSGDSGGPVHYGNIAY
FT                   GLVKSASFAGVEPGRCGALVFSPIGKIVDLGLRLY"
FT   sig_peptide     554462..554527
FT                   /locus_tag="Aave_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            556006..556905
FT                   /locus_tag="Aave_0512"
FT   CDS_pept        556006..556905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0512"
FT                   /product="Resolvase, N-terminal domain protein"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nwi:Nwi_1951 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31118"
FT                   /db_xref="GOA:A1TJI0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI0"
FT                   /protein_id="ABM31118.1"
FT                   /translation="MRCVIYTRKSADETDPQLSSLQVQRDLCAAYIASQAYEGWHLLPE
FT                   QYDDGGYSGATLKRPALQALLTQVRQGAVDMVVLYKIDRLSRSLRDFLNLISLFESYDV
FT                   TFVSVTQSLNTATSIGKLLLNVLLSFAQFERDMTSERLRDWFAGARQRGLWKSGRRPFG
FT                   YTVQKGYLDIMETEAAAVRYAHRRYAAIGSVKLLADEMHRKGFRNQYGGPLKKSALTRV
FT                   LRNRLYCGDLVHLGKPQPGQHVAVISEETWRATQEAMAQSGARRSARNRYPFISVLRGL
FT                   IFNESERALIHVGEVAPV"
FT   gene            556940..557263
FT                   /locus_tag="Aave_0513"
FT   CDS_pept        556940..557263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0513"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mxa:MXAN_1716 transposase orfA, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31119"
FT                   /db_xref="GOA:A1TJI1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI1"
FT                   /protein_id="ABM31119.1"
FT                   /translation="MGKTRPPYPAEFREQIVELVRAGRTPAELAREFDVTAQTIANWVG
FT                   AAGGQASRSQATAGALTGSEREELARLRRQLRQVQMERDILAKATAWFAAKSDKTFTPS
FT                   SNS"
FT   gene            557296..558153
FT                   /locus_tag="Aave_0514"
FT   CDS_pept        557296..558153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0514"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mxa:MXAN_4473 transposase orfB, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31120"
FT                   /db_xref="GOA:A1TJI2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI2"
FT                   /protein_id="ABM31120.1"
FT                   /translation="MCRVLGVSHSGFYDWRHRAPSQRAMEDMVLTERIRQVHAESRETY
FT                   GQPRVRAELAAQGVRVAGKRIARLMRQAGLQGISKRRATTVTTRRDPRERPAADLVMRR
FT                   FRAERANQLWVADMTYVPTWAGFVYLAVVMDVFSRRIVGWSMGERMTAQLVLAALNMAL
FT                   ARRKPQGVIHHSDQGSQYTSLAFGQRCAEMGVRPSMGSVGDAYDNAMAESFFATLECEL
FT                   IERRSFRSKAEAKAAVFSYIEGWYNPRRRHSALSYHSPVEFERRVVAEACQATEINERD
FT                   QIPA"
FT   gene            558175..558627
FT                   /locus_tag="Aave_0515"
FT   CDS_pept        558175..558627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31121"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI3"
FT                   /protein_id="ABM31121.1"
FT                   /translation="MEAGQLQGVPRKGTLYRYYVPRLQRYGAGTTSQDRYRAKPLEQAL
FT                   IALIDRLTGMALDRQTHHQKAEYLRGIIRRIKVYPDELEVTLLTGAVLRTSHAAKLKPQ
FT                   KKPRGAPAWLAQARRLRKKGNSKAETARLLQVPYSQFWRASVKYGL"
FT   gene            558828..559622
FT                   /locus_tag="Aave_0516"
FT   CDS_pept        558828..559622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31122"
FT                   /db_xref="InterPro:IPR017166"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI4"
FT                   /protein_id="ABM31122.1"
FT                   /translation="MSHRITSPRAFDSTVLPPHVAEAVWLGADVGQSLGRTVPSGFDAL
FT                   DAQLPGGGWPTHTLTELLMPQPALCEWRLLGPAVPAMLASDGCIYLVAPPKQPHTVGLA
FT                   QLGLPPDRVVWIHASAPADRLWVTEQLLKSNPAGAVLSWLPQARPEQIRRLQVHAQSCD
FT                   AAMFLLRPTAALSGASPAPLRVAAALGGGWQLEVRIPKRRGAPLDNVLHLEAIPASLAP
FT                   MLPPRLRTTPAPSPQPRRKEPADVPALGRAASPSALGLPASH"
FT   gene            559666..560883
FT                   /locus_tag="Aave_0517"
FT   CDS_pept        559666..560883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31123"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI5"
FT                   /protein_id="ABM31123.1"
FT                   /translation="MALLEDAVVAEVGASERLHGGMEALRALVEAGCSELGTRIAWAPT
FT                   GLAALALVRHATDAAIPDGFSAPIAQLLDQLPLDALAAVGKHRATLARVGCRSLGDVRR
FT                   LPRGGLGRRFDKALLAALDQAYGLRPEAYEWLTLPETFHARLELMARVETAPALLFGAR
FT                   RLLVQMAGWLAARRLGATAFTLRWCHDVMRAKDAGTGGELTVRTARPTQNIEHFARLLA
FT                   EHLSKVQLLAPAGDIELLASEVGQIVEESRSLLPETLRKGVETELALERIQARLGNDCV
FT                   RRPVLQEDHRLEWMQAWTSEPAKRRRAAEQAHVLPLPTWMLDEPLRLMERGNRPYYQGP
FT                   LQLLLGPDRVEGGWWHRTGEGDDARALNVQRDYWLALSAHAGVLWVFQQRLAGDQTAWF
FT                   LHGHFA"
FT   gene            560894..562900
FT                   /locus_tag="Aave_0518"
FT   CDS_pept        560894..562900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0518"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: nmu:Nmul_A2599 DNA polymerase III, alpha
FT                   subunit; PFAM: PHP C-terminal domain protein; DNA
FT                   polymerase III, alpha subunit; SMART: phosphoesterase PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31124"
FT                   /db_xref="GOA:A1TJI6"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR023073"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI6"
FT                   /protein_id="ABM31124.1"
FT                   /translation="MNRRPRTIPDYVELRCVSNFTFLRGASDPEELVRRAQELGYSGLA
FT                   LADECSMAGVVRAHVAAKAAGLRLILGAQFCVQPRTAEEARFTVVVLARNLNGYGNLCE
FT                   FITKLRRSSAKGEYHLTQGQITGAELADCLALLCPDRPSTDAQLEAAGTWALQQFRGRC
FT                   WIGVDQVRQLDDEAWLHRMRTLAELTALPLVAVGDVHMHVRSRKPLQDVLTATRIGKPL
FT                   TECGHALHRSAERHLRTRLRLAQTFPADLLAETLNVAARCSFSIDELKYQYPDEVVPRG
FT                   HTAASFLRQVTYEGAGRRWPEGISPTVQAQIEHELELICELRYEHYFLTVYDIVAFARS
FT                   RHILCQGRGSAANSVVCYCLGVTEVDPARMSVLFERFISRERNEPPDIDVDFEHQRREE
FT                   VIQYLYTKYGRDRAALTATVISYRPKSAIRDVGKALGFDLQTLDALAEGQKWFDGEDIR
FT                   LERFEELGMSVSDLAVRQLITLTTQLIGFPRHLSQHTGGFVLTRDRLSRMVPIENASMA
FT                   DRTVIEWDKDDLDAAGLLKVDVLALGMLSAIRRALDMIGLRRGYAFGMQDIPAEDSDTY
FT                   DMICRADTIGVFQIESRAQMSMLPRLRPRCFYDLVIEVAIVRPGPIQGGMVHPYLNRRQ
FT                   GKEPVTYPSEALKTALGRTLGVKLSRFHGRLSA"
FT   gene            complement(562904..563761)
FT                   /locus_tag="Aave_0519"
FT   CDS_pept        complement(562904..563761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0519"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   mxa:MXAN_4473 transposase orfB, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31125"
FT                   /db_xref="GOA:A1TJI2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI2"
FT                   /protein_id="ABM31125.1"
FT                   /translation="MCRVLGVSHSGFYDWRHRAPSQRAMEDMVLTERIRQVHAESRETY
FT                   GQPRVRAELAAQGVRVAGKRIARLMRQAGLQGISKRRATTVTTRRDPRERPAADLVMRR
FT                   FRAERANQLWVADMTYVPTWAGFVYLAVVMDVFSRRIVGWSMGERMTAQLVLAALNMAL
FT                   ARRKPQGVIHHSDQGSQYTSLAFGQRCAEMGVRPSMGSVGDAYDNAMAESFFATLECEL
FT                   IERRSFRSKAEAKAAVFSYIEGWYNPRRRHSALSYHSPVEFERRVVAEACQATEINERD
FT                   QIPA"
FT   gene            complement(563794..564117)
FT                   /locus_tag="Aave_0520"
FT   CDS_pept        complement(563794..564117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0520"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mxa:MXAN_1716 transposase orfA, IS3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31126"
FT                   /db_xref="GOA:A1TJI1"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI1"
FT                   /protein_id="ABM31126.1"
FT                   /translation="MGKTRPPYPAEFREQIVELVRAGRTPAELAREFDVTAQTIANWVG
FT                   AAGGQASRSQATAGALTGSEREELARLRRQLRQVQMERDILAKATAWFAAKSDKTFTPS
FT                   SNS"
FT   gene            564173..565327
FT                   /pseudo
FT                   /locus_tag="Aave_0521"
FT   gene            complement(565622..566134)
FT                   /locus_tag="Aave_0522"
FT   CDS_pept        complement(565622..566134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0522"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   cvi:CV0957 TIS1421-transposase protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31127"
FT                   /db_xref="GOA:A1TJI9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJI9"
FT                   /protein_id="ABM31127.1"
FT                   /translation="MEPGEHRWLVGAKPPGGQETGPNPTDRGKLGSKRHIVVDARGIPL
FT                   VVLVSGANRHDSMMFEKCIDALPAVRGLRGKPRCRPSKLHADKGYDYARCRAYLKKRGI
FT                   ASRIARRGVESSERLGRYRWVVERTHGWFAGFGKLRIRFERRLDIHEALLKLAAAIICA
FT                   RFVDRWC"
FT   gene            complement(566020..566430)
FT                   /locus_tag="Aave_0523"
FT   CDS_pept        complement(566020..566430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0523"
FT                   /product="putative TIS1421-transposase orfA protein"
FT                   /note="KEGG: rso:RSp0990 probable TIS1421-transposase orfA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31128"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ0"
FT                   /protein_id="ABM31128.1"
FT                   /translation="MARRPVSKELWRQLQPLIPAFVPSAKGGARKRTVSDEAALNGILF
FT                   VLHTGIAWEDLPQSLGYGSGMTCWRRLRDWNAAGVWQKLHHAMLVRLREHDQIDWSRAS
FT                   IDGSSVPSPRGARKRAPTLRTGANSAPSGTSS"
FT   gene            566539..567294
FT                   /locus_tag="Aave_0524"
FT   CDS_pept        566539..567294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0524"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vfi:VFA0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31129"
FT                   /db_xref="GOA:A1TJJ1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ1"
FT                   /protein_id="ABM31129.1"
FT                   /translation="MSPATAEWLLDEFEYDDFIELQNWGARKGVRLATVSLSERGAAVK
FT                   NSEISKEALRLGLLTELIRLREVTVMPTEGDWFMPAEELSSGEYHMLSTMLAVGFALEP
FT                   KAVLLMDEPENNLHPQWQRDLMSAIFDVCDKVRLDGHVIISTHSPLIVGSVPESSSVVD
FT                   MSSEPTRLSLVSYGASSDELLLSQFGVGSSRNAIVVETIQRAISMVENGSYGGEDFLGL
FT                   VPDLKKIRAALTDNDPLISVIDALIDDGE"
FT   gene            complement(568116..569777)
FT                   /locus_tag="Aave_0525"
FT   CDS_pept        complement(568116..569777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0525"
FT                   /product="SEFIR domain protein"
FT                   /note="PFAM: SEFIR domain protein; KEGG: shm:Shewmr7_1857
FT                   SEFIR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31130"
FT                   /db_xref="GOA:A1TJJ2"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR013568"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ2"
FT                   /protein_id="ABM31130.1"
FT                   /translation="MSAAMVYIATRSARNSFIVSTESESGGTCHSEHESATQFLILSRC
FT                   KALGRRSRHYSNDSHISSTTVSGGAVSDQEKPKVFISYSWTNQDHIQWVVDLAHELGDA
FT                   GVHVLLDKFDLREGDDSIQFMERIVNDPTVQKVLLICDRVYAEKTNARTGGAGVEAQII
FT                   SPRIYANTDKGKFVAVLSERDAEGNPYLPTYYASRIYIDLSNQDKYNENFESLIRWINN
FT                   KPLYQRRAIGQRPAYLDEPEELSLGTAPAFRRAIEAMKSGKPSAGGALSDYFQTVSTNL
FT                   ERLRLHDSESEDWADVFFTNLSSTIPLRNELNHTFEAIATYGVTSEFGPKTIRFFESLI
FT                   PYFDRPEGVRSWNDSDFDNFRFLGYEFFIHALAIFISHERFDLCSLLLNSAYYNERNRE
FT                   LGKEPISNFTVFNNSVQTLSRHNEAQPKQYTSPIGKLVSERLVGTQVNLRKIVQADLIA
FT                   YIRSDLDSLNSRNWDMWWPHMYVYGGRHYGALELFARAQSIGYFEKIKGLLGVSNADGL
FT                   APLIEAHSGGQRAPRFNYERVNVGSLIGIEKLASRP"
FT   gene            complement(569843..570592)
FT                   /locus_tag="Aave_0526"
FT   CDS_pept        complement(569843..570592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31131"
FT                   /db_xref="GOA:A1TJJ3"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ3"
FT                   /protein_id="ABM31131.1"
FT                   /translation="MSDVAATAQRQQVRQQGFIVALITLPFRCFGVLCGSLLLCIVVEC
FT                   VGMALFWPDQGWRHAQAMLSHELDQLSDYFVRSALVQEPGRTAHHWVQQGYEWVFVRSG
FT                   LLEWMRDASRQARANAAGHAWSLQKVLGSVATHTQDYLIAAGYTVLVFMVRLLVLCLSL
FT                   PLFILAAFAGFVDGLVRRDIRRFGAGRESGFLYHRARASLVPLAVLPWVIYLALPVSVH
FT                   PVAILLPAAVLLGIATDVAAGSFKKYL"
FT   gene            complement(570589..572781)
FT                   /locus_tag="Aave_0527"
FT   CDS_pept        complement(570589..572781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31132"
FT                   /db_xref="GOA:A1TJJ4"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ4"
FT                   /protein_id="ABM31132.1"
FT                   /translation="MAQAHAVEVLLRPAVELYTVAVCAGAALACVVAPWSLALSPTLGF
FT                   ASALGFAAFGGIRLQQAHAILRYRRNIRRLPRYVMTSRDVPVSQQRLFLGRGFRWDQRH
FT                   THRLMQTYRPEFRRYVEPTALYRLARRCEERLEFAPPPFARLARWTAWDHPMNPVRPLP
FT                   PVGGLPRLHGIEPQEVDVTLPLGERVGHTLVLGTTRVGKTRLAELFITQDIRRRAADGG
FT                   YEVVIVFDPKGDADLLKRMYVEARRAGREGEFYVFHLGWPDLSARYNAVGRFGRISEVA
FT                   TRIAGQLSGEGNSAAFREFAWRFVNIIARALVELGQRPDYLLIQRHVINIDALFMEYAA
FT                   HFFARTQPKAWEIIVQLEARLNDKNIPRNMIGREKRVIAIEQYLAQVRVYDPVLDGLRS
FT                   AVRYDRTYFDKIVASLLPLLEKLTTGKIAQLLAPNYSDLADPRPIFDWMQVIRKRAIVY
FT                   VGLDALSDAEVAAAVGNSMFSDLVSVAGHIYKFGVDDGLPGADASSKVPINVHADEFNE
FT                   LMGDEFIPMVNKGGGAGVQVTAYTQTLSDIEARIGNRAKAGQVVGNFNNLVMLRVRETA
FT                   TAELLTRQLPKVEVFATSVTSGATDSSDPTGNTAFTSNTQDRVASTSVPLIEPAHVVAL
FT                   PKGQAFALLEGGNLWKVRMPLPAPDPDEAMPRDLQELAAGMRLHYVMDAGSWWDGQGAA
FT                   GPRDDGLPDDLLQGAFATTEADDPADQGGMDGAGMP"
FT   gene            complement(572783..573367)
FT                   /locus_tag="Aave_0528"
FT   CDS_pept        complement(572783..573367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31133"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ5"
FT                   /protein_id="ABM31133.1"
FT                   /translation="MKLPALRLRPCAPLWLLALVCLPSLGLGAEPAKSAPSPRPGLIVI
FT                   EDRGGVSAQPYYDELGLPPLRASGAPSTGGAAKSTAPVVPVEAVGLPVRSTLLSPGVVE
FT                   ARPLQAPGLPPFFLVGDDARSRAWLQQRAGALRQLRAAGLVVNVESPQALQELRALAPG
FT                   LVLSPASGDDLARRLGLRHYPALLTATGIEQ"
FT   sig_peptide     complement(573281..573367)
FT                   /locus_tag="Aave_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.573 at
FT                   residue 29"
FT   gene            complement(573364..573972)
FT                   /locus_tag="Aave_0529"
FT   CDS_pept        complement(573364..573972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0529"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   xac:XAC2256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31134"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ6"
FT                   /protein_id="ABM31134.1"
FT                   /translation="MAATVIPQRCTTVLRWAIALGTAACSAVPALAQELPPPAYQIAAA
FT                   QSGVPSSVLYAVALQESGTRLRGRLVPWPWTLNVAGTPQRHATRADACLALRSALRDTP
FT                   AERIDVGLGQVNAGYHAHRVQRPCALLDPYRNLGIAAEILHEQYRPGEDWLAAVGRYHR
FT                   PAGGPPAARYRGAVQRHLVRLLGNPQAMASLHPRRETTP"
FT   sig_peptide     complement(573874..573972)
FT                   /locus_tag="Aave_0529"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(573957..574715)
FT                   /locus_tag="Aave_0530"
FT   CDS_pept        complement(573957..574715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31135"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ7"
FT                   /protein_id="ABM31135.1"
FT                   /translation="MRAESPSAIAVFIAVSLCALGLGAPNVAQAQAQAARVGETRTTAS
FT                   AARPLADAHDDEARAREWGLRAEDWSRYRTLMQGPLGIYSPNLDPLTALGIEARSDEER
FT                   RRYAELQVQAEARRVQKTLDYQRAYDAAWQRLYPDQQRVALQAGPAAGSSGTAEPGRLA
FT                   LFVKEDCAACDQRVQQLQSAGTPVDVYLIGSRGDDERIRRWARRAGVDPAKVRARTITL
FT                   NHDGGRWLSLGASGDLPAVMREVGGQWQRQ"
FT   sig_peptide     complement(574623..574715)
FT                   /locus_tag="Aave_0530"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 31"
FT   gene            complement(574726..575385)
FT                   /locus_tag="Aave_0531"
FT   CDS_pept        complement(574726..575385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2426 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31136"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ8"
FT                   /protein_id="ABM31136.1"
FT                   /translation="MVISRPPAGRPRDRWALWACAIALMVVGGVTAYNTAQLSRMAQEA
FT                   KQANVDAEMQSLASSVAQLRGAFDAARRQPVPVSEAAFSTAQKALGDRLTALEHAREGM
FT                   ARAEDLAALSSRIDALQAVVAARKAAAAPRQARAAESAATRERAPSPLPFTVLGSEMRA
FT                   GVPFLAVVPSGPGSDSQVRLLREGEQERGWRLEVIEPQAAMFSVGDQVRRLPLRAR"
FT   sig_peptide     complement(575287..575385)
FT                   /locus_tag="Aave_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.841) with cleavage site probability 0.775 at
FT                   residue 33"
FT   gene            complement(575379..575948)
FT                   /locus_tag="Aave_0532"
FT   CDS_pept        complement(575379..575948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0532"
FT                   /product="PilL protein"
FT                   /note="KEGG: xac:XAC2253 PilL protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31137"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJJ9"
FT                   /protein_id="ABM31137.1"
FT                   /translation="MQPHPSPAPRRWGFAPVAAAVASVLLGGCASAPPAYEAAAPSPAP
FT                   TASAPAGIDADRPSPVPVTRQGRYTLVELGAEAGQRDLLMQVINVTQPSAEGSTVQDGL
FT                   QYLLRQSGYRLCPPDADSSTLYALPLPAAHVRLGPITLRDALQTMAGDAWALSVDDTTR
FT                   LVCFHRSGASAAAIEPAWLPKEKQPW"
FT   sig_peptide     complement(575835..575948)
FT                   /locus_tag="Aave_0532"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.678 at
FT                   residue 38"
FT   gene            576096..577157
FT                   /locus_tag="Aave_0533"
FT   CDS_pept        576096..577157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31138"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK0"
FT                   /protein_id="ABM31138.1"
FT                   /translation="MESSNQPIPYAARCERLPPSGTTALVWPFVNVAKGEGPYELFLDT
FT                   NALARTEWAEQLPAADRVRYSLNPWPALMEQWMSNQKLRESPDPAAWVNDRLAPLASRG
FT                   FLFRARFAQQQVALLRKNESALRTQFSLIFPYVALMRSLLSQKVPPEEALAKLDALMQA
FT                   DVPRFTGMAMLLALSVLLKGRQSLKLDGDPKPAYSYLESFLSFQPGKKDEADHITLPYL
FT                   RNRAGDLNLWLSVPMLRQAGYEFIGTPALVTEDKALHRVILRTLPPVLTPNRAMGFGVD
FT                   SNGLDPEICHRIVMAVGPMVVRGAVTSQEKEERLGRLFAMAGAACARPEETAALDEAWR
FT                   TWCQPGMHERFVV"
FT   gene            577229..578026
FT                   /locus_tag="Aave_0534"
FT   CDS_pept        577229..578026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31139"
FT                   /db_xref="GOA:A1TJK1"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK1"
FT                   /protein_id="ABM31139.1"
FT                   /translation="MAGEEKSKDSAKEGLPHLSLMEKAWDAQWVMRFVCIVLFIDGALV
FT                   LKGGSGLLQWSTSTDKLWQDLGFLVVAAASFGLLVSFVLPTLGIFLCWIGYHSRRLARH
FT                   VLEVEDRDDFGGAYGHVDAHRFHVYALEKESDFLLRMYENAWRREVQRREELDQIGNLV
FT                   FATAFLAVADGLLAFMQPGGRSLVHDALAPLGDSGLVLGFVLLVLAGYILSEETWGAPD
FT                   RPARVYYPPLYLQLAEERRQRRDEARRQRLNDEEESLRKRRSG"
FT   gene            578158..579669
FT                   /locus_tag="Aave_0535"
FT   CDS_pept        578158..579669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0535"
FT                   /product="MASE1 domain protein"
FT                   /note="PFAM: MASE1 domain protein; KEGG: xcv:XCV1810
FT                   putative sugar transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31140"
FT                   /db_xref="GOA:A1TJK2"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK2"
FT                   /protein_id="ABM31140.1"
FT                   /translation="MAAGKDIARGALLSLGYCASFLLAWRCSMDQWYLPAGLRAATLLF
FT                   LPYRLWPYLLAGDAAALLVIRVPMVERGASPVWAYASPFLLMPCVALAVHAARRQLPRL
FT                   VDQEYLLLPLALMLALWSTLCNMALNALFKGYTALTPLEALTRYWLGDYLGMLMFTLPA
FT                   LLWLRRDEPMTARPRLPRDGLLGSAAVVALFLISGMAQDRLSHQVLMSLMVVPSVVLTL
FT                   LHGWRGAAVGVVLANVAIGIMLPDAMTLASYHAEAFRVQIALAAAATGLFVFGSRLSAA
FT                   FEHASYFRHQRQEAWQIAQASYLQAERTLRRRVVEYSDITVHINKLRTDIVAHLRSRGQ
FT                   HAAAMEMTRTGVIQAQLLDEYVTALYPLGIETHGLYAILRSVAMSNLCDTEFQCRLRGD
FT                   PMQLSLGLQLVAYRCALNVIETLPPAKRHLIKGRVWRAGGRQGIALCVVADASPLERGR
FT                   TVAHDADWELAARLKVHGGTCRRRHAYCLSFLVSESVGEGLSLRR"
FT   gene            complement(579653..580081)
FT                   /locus_tag="Aave_0536"
FT   CDS_pept        complement(579653..580081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0536"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV1811 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31141"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK3"
FT                   /protein_id="ABM31141.1"
FT                   /translation="MMKKSMLTHIALAGALLACAGAAQACCPDGGHGAPAASAGLGESL
FT                   PKARNLALDPTWRIYEFSRDGVTYLQINDVAGTVRAAVGRVNDTLWVLPMGADVARVTL
FT                   PAKGAGTSGSVVYQTSGFVVRVVPGGSGGNSWEISAAD"
FT   sig_peptide     complement(580004..580081)
FT                   /locus_tag="Aave_0536"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 26"
FT   gene            complement(580184..580819)
FT                   /locus_tag="Aave_0537"
FT   CDS_pept        complement(580184..580819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31142"
FT                   /db_xref="GOA:A1TJK4"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK4"
FT                   /protein_id="ABM31142.1"
FT                   /translation="MDTPSTHTRPASDTPNEALQETIQAMAALIATMQKREQSLQDQIT
FT                   RQLQALNGAVDNADRSVNRVVESALPRLTQLSQQALAVALDPAVERFDRTLTAARKTLE
FT                   QATQRYAQAQQSLESKAMRRMWMGAIAMLGAVVMGLCGVGYVLYSAKATLAEAEQRRAE
FT                   IAYLDRVARADLVPCGEDRLCADFEKNGPRYGDRGQYRVVTLRQPPSR"
FT   gene            complement(580865..584872)
FT                   /locus_tag="Aave_0538"
FT   CDS_pept        complement(580865..584872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0538"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31143"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK5"
FT                   /protein_id="ABM31143.1"
FT                   /translation="MADNDPILQSHHVIEQSFFRKHELLLKLASHGLIDEHASANRLYL
FT                   PMDGKLAEELETSPHRGRTRSSYTDGILQELDRIMDSADGVAAMDDDAVALKRVSAKVA
FT                   ELQDTLKVALVNGDVYATTPDRLTNDEANAQNRKTFSDLDRYRAEHPQQLKTLRSMGAV
FT                   ESEWAAITHSEQRIVAVVEAKQRTSTNLVAASSLKDEAVREAAGRAEFRMAIEQAQQSG
FT                   RLRLHEPNVALVAQVVGDELPVMGRAGGVLATYKPLSQRGFATAEFLAGEHSASQLLRG
FT                   AGLLASAADTVITAHRAGELYSQSNPLAAQSELTHFAGRNLGGWAGGTTAAYALGTSGA
FT                   GPMVLIAADAYFMTKAGEKLADLYDNRQIYQQIDRDGTHWSFNGYAWTRQGMVDGSDDG
FT                   AGNPVPTSIVASYDRARELNYLATNAAAALALKDAPKLEDPCVLPANGSDRPSLDAADW
FT                   KRDPADGQWHRLVKTGVFGENNRGIYVDDVALPARVAELEAEAAAVVARNVANSPGAIA
FT                   ARYELAYHRSGWAAEGWPMSEAVKAALPDPDALTASDGKLYRRDAEGRWAHSGVQADSN
FT                   RALELNTARALLQPALVEHAQAIAASPQAPPSPQDLKREETLYRYRIVGTELRPDWREA
FT                   IDLATERTRESQGLSGGGSLKLQRGPGGVFGADSPIEHLQRGADGVERIVAVTSTEEIR
FT                   QALQEVRAHQSAQPSSDMPTPRLAPTALTSDGSADTDGASSNPSSSPQHALDMQAQAQA
FT                   ASAAQQREVREQQERQTGEQQIAQAREHALAQASHKEQVHAAQALEAHATLDHQSQELQ
FT                   QREQQARQAQEQRAQDAQQREAQDAQQREREQRQAETERKREQEQRPMQDALPREQDRR
FT                   QAEDAVPAREPRQSQEAPPLPHGREPALAESVVKPEREQHQAQEAQQRTQALPGGLDRY
FT                   AQDSAEPLEPSRHPQEAEAFQQTTHERQAQEGHTQDAQQPAAPAPNGAHASTTQPTEAQ
FT                   APPAPYLPSTPASVMDEDAPLQRREAPINAPVQARHAHVADATVGRPSTVERMEDQRAA
FT                   TPPALPSVMDDGLALVSSSGVRSADGDRGIQDEAVAGEQRRSARADGQDAQTAPAPERA
FT                   ETWEQTLQTMRALRIQLEKDLAQEERLEQERHERRGRGDDHPQADPDVRHQQGARAPSE
FT                   QAAFEAQPAMARRDTAPAAARRPGEPDDAPLPQRKEISGDSDVDDLLHAIYSKNDAAIE
FT                   RALDRISNSPLTHALLQQGHEHLEAKAMEEAKQQATAMQSLGLDTPAEVQTSRGPVMVM
FT                   TLPQFASGPMGQGGGAPGAAGGGGGDGGGGGGGGGGGGGGGGGGGGGGGGG"
FT   gene            complement(584909..585544)
FT                   /locus_tag="Aave_0539"
FT   CDS_pept        complement(584909..585544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0539"
FT                   /product="protein of unknown function DUF1629"
FT                   /note="PFAM: protein of unknown function DUF1629; KEGG:
FT                   xac:XAC2246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31144"
FT                   /db_xref="InterPro:IPR012433"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK6"
FT                   /protein_id="ABM31144.1"
FT                   /translation="MTTPRAPQKGEFYTLRPDLRGGGPGHGVVFENEKALRPPGRGMIR
FT                   PPHGGFPPLREIPKLRYDSREGLMPSDMESGFSGYWLVSAALKEVFESVDAGGFAFQPC
FT                   EFTLEDGSQGPDYFLCDVVRTLDALDEAASTLKILTEGYPAGKYYSLAGGARLAFIKEV
FT                   VGSAHIFRTPYNSQLVICDRMLRDALIAGGFGKPPNSRGVWLEDAADY"
FT   gene            complement(585884..588157)
FT                   /locus_tag="Aave_0540"
FT   CDS_pept        complement(585884..588157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0540"
FT                   /product="DEAD-like helicase"
FT                   /note="SMART: DEAD-like helicases-like; KEGG: xac:XAC2243
FT                   plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31145"
FT                   /db_xref="GOA:A1TJK7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK7"
FT                   /protein_id="ABM31145.1"
FT                   /translation="MSLDLEPAADAEPVQGELLDADASPLSLSLTEFVAEFGDELLESL
FT                   NRANPPVYAGQPRAHRERVIAGLKRRLFPAQAEVVHAAAELLIDRGERAAFVNGEMGCG
FT                   KTTVGIATAAVLHAEGYRRTLVLSPPHLVYKWRREILETVAGAKVWVLNGPDTLVKLIK
FT                   LREQLGVQPGGQEFFVLGRVRMRMGFHWKPTFVARRTRHGHVAACPDCGTVVTDLDGEP
FT                   VSPVALDAEEYRRKCGHCATPLWTLMRPRTLSGSDQSSAVLKALKRIPTIGEVTAQKLM
FT                   RKFGDGFLASMLGDNIHEFINLMDGDGELVFSDRQAARMERAMANMEFGFGEGGYQPSE
FT                   FVKRYLPNGTFDLLIADEAHEYKNGGSAQGQAMGVLASKCRKSLALTGTLMGGYGDDLF
FT                   YLLFRALPGRMIEDGYRPSKSGSMTSAAMAFMRDHGVLRDIYSESAGTAHKTAKGNKVS
FT                   VRTVKAPGFGPKGVLRCVVPFTIFLKLRDIGSDALPPYDEELREVPMAPAQAAAYAALS
FT                   VRLTTELRQALARRDTTLLGVVLNALLAWPDTCFRAENVVHPRTRATLAFVPSQFHDME
FT                   VMPKERELIEICRQEKALGRKTLVYTTYTGKRDTTSRLKRILELEGFKVAVLRATVDAS
FT                   RREDWIAEQVDRGIDVLITNPELVKTGLDLLDFPTIVFMQSGYNVYSLQQAARRSWRIG
FT                   QKQDIRVIFLGYAASSQMACLKLMAQKIMVAQSTSGDIPESGLDVLNQDGDSVEVALAR
FT                   QLVA"
FT   gene            complement(588295..588603)
FT                   /locus_tag="Aave_0541"
FT   CDS_pept        complement(588295..588603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0541"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31146"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK8"
FT                   /protein_id="ABM31146.1"
FT                   /translation="MFQRRKPLPQPLFALGTIQLSDKVCWLASKGLIDPLPYVQRHIRG
FT                   DWGQVSEAERQANGTALERGTPMTSRFPINPRLSLVVVTSKDQGTTVVQLPEERAVT"
FT   gene            complement(588652..589761)
FT                   /locus_tag="Aave_0542"
FT   CDS_pept        complement(588652..589761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31147"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJK9"
FT                   /protein_id="ABM31147.1"
FT                   /translation="MALMFARLARNFIKNGYYPTDETTLERALQALVPGNGPMCILDPC
FT                   AGEGAALAEVARALGSERAQAYAVEFDAERARHARGLVDHCLHADLMDTMISRQAFGLL
FT                   WLNPPYGDLAKDVNGNIGYQGQGRARLEKLFYQRTLPLLQYGGVLVFIVPGYVLDAELV
FT                   GWLTRHYADLRIYRAVDTQFKQVVIFGRRVRQRDMAADAAAAARTLLLQVGHGEVIPDE
FT                   LPSEWAFMPYIVPASVSPPEHFFRVTMEPEQFAEEVGRLRGLWPMLDTHLGAAQQSLRP
FT                   PARALSPWHLALALAAGAISGVVRSKAGRVLIVKGDTHKDKALQREFTEREDGSIAETR
FT                   ILTDKFVPVIRAWDMTPGSPTLGEVLTIR"
FT   gene            complement(589837..590508)
FT                   /locus_tag="Aave_0543"
FT   CDS_pept        complement(589837..590508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31148"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL0"
FT                   /protein_id="ABM31148.1"
FT                   /translation="MPTTDFRSSPLYLMDECPDVMADACVADDQGGLVFLSIWARDTAV
FT                   QQFLARLTLGRDEQGLQHFHLITPEGGSVPVFVGNVDRLEKRMTRAYRRTLFGALSNVW
FT                   LFDRRCVKPDKANASALALVPKGNGCTLDHLWSLVRDTCPLPLLGHWREPVLDLLQGRD
FT                   MLTRLPFSLGPLEGHRLAIDVPVLTQALGGLIRSGDLRIEPRQPPRSNALTPTQSLEAV
FT                   A"
FT   gene            complement(590586..590846)
FT                   /locus_tag="Aave_0544"
FT   CDS_pept        complement(590586..590846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31149"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL1"
FT                   /protein_id="ABM31149.1"
FT                   /translation="MDPILSTLPRPLLAFVEGQLSNDETSTDEELQEHFVAHGLTEDQA
FT                   RQAVTYRAQYLSNIYLDGFTPITAADDVLRFNPDSRQFEPV"
FT   gene            complement(590863..591270)
FT                   /locus_tag="Aave_0545"
FT   CDS_pept        complement(590863..591270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF1758 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31150"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL2"
FT                   /protein_id="ABM31150.1"
FT                   /translation="MGWYFSPQSRSELIAELIAPQETERTSAKVIAHALRGNVLWSVVE
FT                   MTAKAEGVHRDLAAGQSLRYIRCDLLERSGGQWGHKPLEESMHPYYYSCPLSYLDLAPE
FT                   QSADWRAGVRAYHARRRTPTASASPVAAVLS"
FT   gene            complement(591371..592069)
FT                   /locus_tag="Aave_0546"
FT   CDS_pept        complement(591371..592069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31151"
FT                   /db_xref="InterPro:IPR021693"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL3"
FT                   /protein_id="ABM31151.1"
FT                   /translation="MDTTTPGERPMPSPIIVSGQLTLRTIRGRNGPFTVGRLTTHLGVF
FT                   AIKDAELEQYPEGRYDGEFVIRYIFPKSYPVGDGMRFEIRANLDGMTLYGIDKLSRDEA
FT                   RSFTTQEVDPLDEELGAQPAATPAKPAKASRPAETAPEQASDPLIDTTPFGVDAPLPAA
FT                   VAAAGSTDEDDAGLFGLLWPLGESVKLDSTIDRRTLRAQIARLGELGYALDFKTQQWSR
FT                   QAELQPGCGS"
FT   gene            complement(592133..593056)
FT                   /locus_tag="Aave_0547"
FT   CDS_pept        complement(592133..593056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31152"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL4"
FT                   /protein_id="ABM31152.1"
FT                   /translation="MTTSSSSNAKSYFDLHTSGIGYLKNVREVPVRGGRRAQPFLACKI
FT                   DALVGPAKDPSYRTFDLKVSGAKAKELVESYMGVDDRRKRPLVRFRIGDLWADSFIRDK
FT                   GDRKGEAAAQLKGRLLKAELVDRGEFMRIQTHELITRGIGYLNRPEDVRPKDGDPFLAC
FT                   CIAALAGPTDEPEYRYIEAKVKTESAAHLVRRCVQAVEAERKVLISFLLNDMKIDAYLR
FT                   TKGERAGEAAASLEANLVHIGLIKIDGQKVYPLAAPAPDAPPAEDASTSEADSASDSTS
FT                   VHAPEPAEREPVSEEQEREPEPVESF"
FT   gene            complement(593399..593767)
FT                   /locus_tag="Aave_0548"
FT   CDS_pept        complement(593399..593767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31153"
FT                   /db_xref="InterPro:IPR021436"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL5"
FT                   /protein_id="ABM31153.1"
FT                   /translation="MPLRFRGVELRPVLAEAIRERCPIVLKRGDGVYWHAACSPQYSRG
FT                   YLTPIAYALGCNPRVNAFEHWWDRACQALGADTLCKAFDPRDSAFACILYGNFDLELSA
FT                   VPSPLSVRPVPAGTLFHH"
FT   gene            complement(593945..594892)
FT                   /locus_tag="Aave_0549"
FT   CDS_pept        complement(593945..594892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0549"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: bpa:BPP1897
FT                   IS1002 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31154"
FT                   /db_xref="GOA:A1TIK3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1TIK3"
FT                   /protein_id="ABM31154.1"
FT                   /translation="MNSHKHARLTRAGRALLVDRVLQQNWTMRQASEAAGVSLRTGYKW
FT                   MARFRNEGPDGLLDRSSRPHRSPQACPPEQVQLFEQQRRQRLPLWRIARETGRSLATVA
FT                   RHMDRIGLSRLASLEPPQPVRRYERASPGELLHIDTKRLGRIHGVGHRITGDRTQNRNR
FT                   GIGWDAVHLAIDDHSRVSFAQVLADETALSCVQFLRDAVAYYANIGVRIERVMTDNGSG
FT                   YKNAFRAACEELGIRHIRTRPYTPKTNGKAERFVQTSLREWAYARPYESSAQRTAALQP
FT                   FIDGYNWCRPHSALGHQPPITRIPGVNNLVRLNS"
FT   gene            complement(594962..595627)
FT                   /locus_tag="Aave_0550"
FT   CDS_pept        complement(594962..595627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0550"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xac:XAC2219 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31155"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL7"
FT                   /protein_id="ABM31155.1"
FT                   /translation="MHFSTQPSAGLCTFPRSTGRCAPIPVHLADSHVRRGWLRDLSRSH
FT                   AMADNYYEATGVLVLDHVTPVIRALFSEFRLDADYPGNGEAYIALRSDSTPSWDDLRET
FT                   LTDLATSLALTPSPDTLTPFGEVLKVLSDHFCAGGNAALASMIQRDDFGDAADLNDLFL
FT                   LATCFDDGHHLREIRFEGSWRCDKLLLFEFGGAGHYMSREFALDSASSDAPQLGVMSQ"
FT   gene            complement(595876..596304)
FT                   /locus_tag="Aave_0551"
FT   CDS_pept        complement(595876..596304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31156"
FT                   /db_xref="InterPro:IPR021436"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL8"
FT                   /protein_id="ABM31156.1"
FT                   /translation="MLTGVKHRINVSFFNFAFQEHIMSLRFRGADLRPVLAEAAAQRCR
FT                   IVLVKDRGVYWLAERGARTSNGRQKLIAYAVGCNPDIDPFDDWWHTANAELGGDDFAEH
FT                   IDPSDGVFAKVLAGGHDLELSATPEQLMMLAVPSDRTN"
FT   gene            complement(596289..597086)
FT                   /locus_tag="Aave_0552"
FT   CDS_pept        complement(596289..597086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31157"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJL9"
FT                   /protein_id="ABM31157.1"
FT                   /translation="MDLVLLRAQMPALVQSHIPSNVRRFTYCILDGVPRPSSLGITFDP
FT                   KPFEGKVVAKTEQAIVVKTGRAEFAVLDRSLVTRDPEEGAKVLVEPYARRRFDGLRADT
FT                   PEQRTERRADGTEFVSETMVLGAAPAKLPIAKPRCPELAALIEQLEELPAPDGFRRITH
FT                   MLVDAGAKVFNWVDPKPSDICKTPPAITFTVSAAKFDGAVRILYDRGADAYVIEFLSAG
FT                   QPIDRIEDVYFEDLGNVLASRLDDGSWRRIHVTPLPARTCSPA"
FT   gene            complement(597246..597638)
FT                   /locus_tag="Aave_0553"
FT   CDS_pept        complement(597246..597638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31158"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM0"
FT                   /protein_id="ABM31158.1"
FT                   /translation="MNLNLPPEVADLFVREQIHFAAAPEAFFQAWKRGAEIAGPEWFGD
FT                   GTMEGMRKATSKWDLRPNLLAIGEALHVLSSGQRMFLAAMVSFYNAREGAAMLRQCRFE
FT                   GLADFGGLDLQSRQVIADLLLNYVGW"
FT   gene            complement(597658..597870)
FT                   /locus_tag="Aave_0554"
FT   CDS_pept        complement(597658..597870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31159"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM1"
FT                   /protein_id="ABM31159.1"
FT                   /translation="MPKPSVFGHLALHYAGKLLPLEVLHSAAGHYIGTRDFDGPVSRES
FT                   IEYFRSEKAAQRALERGGWSQLPNP"
FT   gene            complement(598205..599776)
FT                   /locus_tag="Aave_0555"
FT   CDS_pept        complement(598205..599776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2290 ATP-binding region, ATPase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM2"
FT                   /protein_id="ABM31160.1"
FT                   /translation="MTTIRLQTNQHRLIANLRHAFNQRSMLGELLQNARRAQASDIRIY
FT                   VTDDCIAVHDNGSGIEDLQSLIHIAESGWKAVIRERENAFGMGALATLYFAERLMVRSR
FT                   GQTFSARTADILAGNPIEVLPADGTWQGTQIQLDGVRSPDRHVFLPDWVRSEMRRLCEA
FT                   FPVRVYVNDVEVPRPLAKPDIRWRETSMGKVLIDLHGATNQWRCFLQGLPIQVGSSYAP
FT                   KQIVLLPDDMVAKLPDRQHLLNETSDIPRIQAAVNQAYRQALMDAKSELAGHEFAEWYA
FT                   DACVISSNADLLNDVPFVPRAWFRNWKDRPAGVCRYWEHYGDDGVTSADAMSEAGVWRI
FT                   EDDDGDVLLAEVFLQAADAYLLEQINLDAGHWLLRLARPLSAEQIAVRVGASRHRMEHP
FT                   GLADWEVALELVNSLQVGLLEGGELYDVPAIRKDGTLYVTTEACNVTRLVSDYSVDDRY
FT                   DEDLENDDEETIRTFIAVGSSSSPDHVVEALLPRALRYEAQAKLAGASVRLAFDAEGKL
FT                   ASVSTS"
FT   gene            complement(600455..601996)
FT                   /locus_tag="Aave_0556"
FT   CDS_pept        complement(600455..601996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0556"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpc:RPC_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31161"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM3"
FT                   /protein_id="ABM31161.1"
FT                   /translation="MSLSWQPYQGAHAQTHTMPTNTSVIARLGVHSPVPQNILREEHRL
FT                   THTTEDKTILSGPLDECEERLLGVLDFAIGFAKQQGAPLALNASQYHRPHLLALLDPSA
FT                   VEMLVAGETVSISSGPSLRLIDDAGVGNFGGLVLFVGVDSPRLALLKADRRPMVIAVPE
FT                   NDGEHSAILETFPNAGRLETKPEPEIIPLPAMHQSYDSKCQWLDERYDVIAGHNFNRKS
FT                   AEIVLGTGEPQVCRYCGRSTPATTFENVSHAFPEQIGNKWLVDSRECDGCNEHFASAID
FT                   SPFGNWSLLARSTGRIRGKKKVPTFVSTGEDFRIAFKNNVLNVTAHKDDPRLHFDENAK
FT                   RIEMRLERPPYVPMGVFKSFVKMAISVMPEVEANKCQHLKNWILEKKHTFESFPFHPLM
FT                   LYTQFISGPIPNDAISFMLVRRKESVSGCPYMMFMVQYGNHVHQIALPMPTEDGMGREP
FT                   MQTSLVYFPHPWEAADHIAAYGPARCVEEDLSSPEFRRNEPYPMNFSFSEAISTM"
FT   gene            complement(602550..604010)
FT                   /locus_tag="Aave_0557"
FT   CDS_pept        complement(602550..604010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0557"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: xac:XAC2213
FT                   cytosine-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31162"
FT                   /db_xref="GOA:A1TJM4"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM4"
FT                   /protein_id="ABM31162.1"
FT                   /translation="MKPTHTDTEAIDYGSVCSGIEAVSLAWEPLGLRPAWFAETDAFAS
FT                   AVLAHRFPQVPNLGDMTLLARRIRAREVAAPAVLVGGTPCQSFSTAGARQGLADPRGAL
FT                   TLAYVEIADAIDQVRSRAHLPPTTVVWENVPGVLSDRGNAFGCLLGALAGEGGALQPPG
FT                   KRWTHAGCVSGPRRRVAWRVLDAQYFGLAQRRKRVFLVASGRSDLDPAEVLFEREGLPR
FT                   HPAPGSTPRERASSVVGTCAATAGGRSGLKSPYGPVRFSVGFGNGLEPTELAACLMGAP
FT                   PRFDLSTETVLVQSVAGAISHTLDTANGGKGCGEDGTGKGVPIIAFTAQGNGADALTGR
FT                   CPTLRAGAHKSGHGNGGVVPAIAFAQKSHDELRWEGGHGQIAGALSTGGGKPGQGRPMV
FT                   LQPATQEDHFVCEPAGAGSWGVRWRVRRLMPRECERLQGMPDDHTLVPYRGKPAADGPR
FT                   YKAIGNSMAVPCVAWIGARLLRALSGAP"
FT   gene            complement(604492..606534)
FT                   /locus_tag="Aave_0558"
FT   CDS_pept        complement(604492..606534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0558"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: xac:XAC2212 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: TOPRIM domain protein; DNA
FT                   topoisomerase, type IA, central domain protein; DNA
FT                   topoisomerase, type IA, zn finger domain protein; SMART:
FT                   DNA topoisomerase I, ATP-binding; DNA topoisomerase I,
FT                   DNA-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31163"
FT                   /db_xref="GOA:A1TJM5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM5"
FT                   /protein_id="ABM31163.1"
FT                   /translation="MRVVLCEKPSQGKDIARVLGARQREAGCLAGPGIKVTWGIGHLIE
FT                   AAPPEAYGEHFQRWSLETLPIVPQQWRWVVKADTASQFKVVQRLLAQASELIIATDADR
FT                   EGEMIARELIEYCGYRGPIQRLWLSALNDASIRKALGALRASHETLPLYHCALARSHAD
FT                   WLVGINLTRLFTLLGRKAGFDGVLSVGRVQTPTLKLVADRDREIAAFVPVPFWSIEVSL
FT                   SAGAQAFSAHWVPPATVTDAAGRCLQQSAAQHAAAAVRTAGHAQVTGIDTERVQEGPPL
FT                   PFDLSTLQEVCSRRLGLDVQETLDIAQALYETHKATTYPRTDAGYLPENMLTEVPTVIR
FT                   SLLKTDPALQPLMQRLDLGQRSRAWNATKIAAHHAIIPTLEPADLSKMSEKELAVYRLI
FT                   RAHYLAQFLPHYAYDRTMVRLACGGQALQASGKQVVDAGWKAAFAAPSIPGAGAETPEA
FT                   ETDSEAPRDQALPTLHEGMACEVRSLDLKSLYTKSPPPYTQGELVKAMKTVAKLVTDPR
FT                   LKQTLRDTTGIGTEATRANIISGLLARGFLVRKGRVVRASKTAMTLIDAVPAAIADPGT
FT                   TAIWEQALHMIEARTMDLDTFVSKQAAWVSQLVEQHREATLAIRVPAGPPCPLCGAATR
FT                   KRTGKTGAFWSCSRYPDCKGTVAIDSAEAGRRNGPRKPRAARKLH"
FT   gene            complement(606698..607084)
FT                   /locus_tag="Aave_0559"
FT   CDS_pept        complement(606698..607084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0559"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n; KEGG: xac:XAC2211 single-strand
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31164"
FT                   /db_xref="GOA:A1TJM6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM6"
FT                   /protein_id="ABM31164.1"
FT                   /translation="MSTHFHGEGNIGSPPKFDEYPNGNEEPRRVLRLNVYFDNPVPGSD
FT                   GTYDDRGGFWAPVDWWHRDAEHWATLFAKGMRVVVRGRMIRDQWTDDEGQPRTTYKVDA
FT                   RSVAILPYRLDSVELSPKTAAGDE"
FT   gene            complement(607126..608097)
FT                   /locus_tag="Aave_0560"
FT   CDS_pept        complement(607126..608097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0560"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   psb:Psyr_2825 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31165"
FT                   /db_xref="GOA:A1TJM7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM7"
FT                   /protein_id="ABM31165.1"
FT                   /translation="MREQASRWLDTTHAGDCRVLLSRMLADGVQVQTCITSPPYFGLRC
FT                   YLPDHHPDKHREIGCGSTPEQYVAQLVEVFQIVRRLLADDGTLWIVIGDSYAANGASGL
FT                   NTGWAERSRRYAGGGRRAAQARNRTRKSVPAGLKAKDLIGVPWMLAFALRRDGWYLRQE
FT                   VIWHKPNPMPESVTDRCTRAHESVFLLSKRARYYFDVQAIAEPVAPSTVLRLSQPRLAQ
FT                   QSGSTRVQGKTNGNMPTVGCLDMRRRRSVWTIATRANRGPHNATYPAALIGPCILAGSR
FT                   AGDVVLDPFMGSGTTGTTALRLRRHFVGCELVRSYIDPTHLR"
FT   gene            complement(608097..608651)
FT                   /locus_tag="Aave_0561"
FT   CDS_pept        complement(608097..608651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0561"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0118 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31166"
FT                   /db_xref="InterPro:IPR021502"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM8"
FT                   /protein_id="ABM31166.1"
FT                   /translation="MTEPTSCANLGSRRFAPLEQADFRGLRQAASLKGLLQPFKGKGPL
FT                   EAWASECHALRDALTDMAQRRVLAQANQYPYLLLPIHLAQQTTGAGTIFLRWRRHDRSA
FT                   MGVALWQEMMASAATPEGLIDDLHAIEVQRVVLNMQVSLLHTLGRQAMDCASKIASAET
FT                   VYLRRRAPESEGRQRGRGPAP"
FT   gene            complement(608648..609481)
FT                   /locus_tag="Aave_0562"
FT   CDS_pept        complement(608648..609481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31167"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJM9"
FT                   /protein_id="ABM31167.1"
FT                   /translation="MAETPNTPALQLNLGSLRSAMSLTLHTHHASRIWHGRAPAEGRPG
FT                   IVGLNGYIAVMNKMKRGAEQDDPYSDWWMLRIEEKLSQTDIALRQLREQVDRALTGVPA
FT                   ALSLGENLNVQPIRLPLFVNAQLGFMAVYLLADYDELARKLILAHHTALIDRSTLERWL
FT                   NEGAHALRSLFSLAQQYRYSGCTRDDFAAKNAAARAALEKYGELPQDVLEGTRRSRYAP
FT                   PIVRRSGLARTTSAPAEDIEPAESGSAAALGTGDAAGHDSATAAPDGNDDEDTAP"
FT   gene            complement(609805..611040)
FT                   /locus_tag="Aave_0563"
FT   CDS_pept        complement(609805..611040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31168"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN0"
FT                   /protein_id="ABM31168.1"
FT                   /translation="MAAPGKPRPPGPRSLSDVFDAACEQAQPAELPAATPAGKPGGQDG
FT                   FLFSGNRHESVPRALFLDRRLTPLERNAWQVIRMQLNVDGLTALPTYDQLRPMLAVMPC
FT                   GPVASTETVARALTLLRLTRWLSLVRRRRDQRSGRIMGNLYVLHDAPLTPFEAMQLDAD
FT                   YLGLVSQALTHASKAVQSVGHHVLQEVADDPMLRGGVLPTRLQVLTAQLADGVQQPQTQ
FT                   GESYPQDAHTGDSEGGRASLLRIPDQPSSDSESGRKPAPERSLRNPKEARTGSFRIGER
FT                   TVLRERAMDGVRLPAEFLSLKDEQQSGALVALRQVAQEQRQAVMDEWVARCRDSAVRNP
FT                   AGYLFGLIQRALRGEFRAWAGAGNAKAPAPDAPPPAPPRPPPPPSAPAPKPASPEVARA
FT                   HLERLRAILRGG"
FT   gene            complement(611045..611605)
FT                   /locus_tag="Aave_0564"
FT   CDS_pept        complement(611045..611605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0564"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31169"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN1"
FT                   /protein_id="ABM31169.1"
FT                   /translation="MTTPHPLNQAVIAQALHDLRNGQLRRARSMGFGDAELAALKRPDL
FT                   VSVLLNASVSWCSVTVNPEVVRRLLGQTHDVEREISTVDRMLRLGASTEMVSTFFGLSH
FT                   QEVALRREILALPKRKGRHPVLSEAQDAELWGKWKPAIRERGIDLHDDLAMLDVAMDLA
FT                   EEMSIPLSVVWAAIQSWIAQGLV"
FT   gene            complement(611602..613227)
FT                   /locus_tag="Aave_0565"
FT   CDS_pept        complement(611602..613227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31170"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN2"
FT                   /protein_id="ABM31170.1"
FT                   /translation="MTQAGPHDIASQLLSETFERSGRSAQALTDPIADTPMVVTLDQLR
FT                   PYDLNPRVTVNPLYPEIKASIRERGLDAAPAITRRPGAAHYMIRNGGNTRLAILRELWA
FT                   ETKDERFFRIPCLFRPWPERGEIIALTGHLAEGELHGKLTFIERALGVEKARELYESEN
FT                   GGKPISQMELARRLAADGYPVPQPHISRMRDAVQYLLPAIPSVLYAGMGRHQVERLSLL
FT                   RRGAEQAWAQRASADAIAFADLFQDVLSGFDVAPEEFSFDRVRDELIGQMAQVLGADYD
FT                   VLALDIAGLEGRQRVLLSAPSPSAPPVATPPRGATQERAPRPTSPGTAPGGAAARPADP
FT                   ISVPPETTETAAGESTRPTSNPTDERTASPAPTTERLQSIQKLVADHHGEPAHSFADNV
FT                   VHAIPVQAGGLYPITDLWHIDPGLDTPDRLRVHIAQFAREIAAEGGAADSVEGSERGIG
FT                   YTCAAPTTHTPADNPFARAMLSILQALSGVPSAPEPLTDALGPLLRGNEAIARLSDSGL
FT                   VKLFRLIRLARRLSDTQPGAGAMP"
FT   gene            complement(613447..614331)
FT                   /locus_tag="Aave_0566"
FT   CDS_pept        complement(613447..614331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0566"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   xac:XAC2205 chromosome partitioning related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31171"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN3"
FT                   /protein_id="ABM31171.1"
FT                   /translation="MSAPTARGATAAPLVVSIVSTKGGVGKTTTAANLGGFLADAGMRV
FT                   LLLDLDIQPTLSSYFPLDRRAPGGIYELLAFNEQDPGQLISSTAIGGLDLLLSNDGKGQ
FT                   LGTLLLHAADGRLRLRNLLGMFRSRYDVVLIDTQGARCVTLEMAILASDFSLSPVTPEI
FT                   LAARELRRGTLSLMDDIAPYRHLGIEPPPLRLLINRARTVSVNGRQIQHALRGMFQQAS
FT                   GIHVLETTIPAIEAYPAAALRRLPVHRVEPRRPRGRLAPAALESQRALAGELFPMWRDR
FT                   FDHVTGRSHAGAA"
FT   gene            complement(614328..614555)
FT                   /locus_tag="Aave_0567"
FT   CDS_pept        complement(614328..614555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0567"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: xac:XAC2204
FT                   prophage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31172"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN4"
FT                   /protein_id="ABM31172.1"
FT                   /translation="MSSAASQTTSQADDAPTSRRVLRRPLVEQRTGFKRAHIYSLMKEK
FT                   KFPQRVRLGVRAVGWYEDEIDQWLAQRERA"
FT   gene            complement(615455..617326)
FT                   /locus_tag="Aave_0568"
FT   CDS_pept        complement(615455..617326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0568"
FT                   /product="Relaxase"
FT                   /note="PFAM: protein of unknown function DUF1528; Relaxase;
FT                   KEGG: xac:XAC2196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31173"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN5"
FT                   /protein_id="ABM31173.1"
FT                   /translation="MFRLFRRAAGAASTTERTPANAPPVAATTPSLPGWTARQSASELL
FT                   APARRQRLLEHIWQRTSLSRAQFDQLYLGPIRRYAEFVQSFPASESHHHAYPGGMLDHG
FT                   LEIVAYALKLRQSHLLPAGATPEAQAAQAEAWTAGVAYAALLHDIGKIAVDLEVELDDG
FT                   SRWNAWHGVLRRPYRFRYRRGREYRLHGAASGLLYLQILDRAILDWLSGYPDLWRPLLY
FT                   VLAGQHEHAGVLGELVVQADQASVAQAMGGDPARALAAPRHALQRKLLDGLRFLLREQL
FT                   QLNQPQASDGWLTQDALWLVSKTVSDKLRAHLLSQGMEGIPSSNTAVFDVLQEHGIALP
FT                   APDGKAIWRACVTSESGWSNTFTFLRLSPALIWDAGERPAPFSGTVKEVAQDAEAAHAS
FT                   PIAPQSAATMRLDTAGTTPGQGSPAPQQDGIGALLDLLQLDSSAGHQASPDAAIAPQPV
FT                   QPGDGAGGEAEAAALHEADAPANAASGHGFVDWLRLGLQQRRLVLNDAKALVHTVADTA
FT                   YLVSPGVFQRYAQEHPEVRALAKGEQLADWQWVQKQFERLRLHRKQANGLNIWTCEVAG
FT                   PRKTRRLHGYLLRDPLAVLPEALPNNPYLRLLDLNEPEPSPHSTPAE"
FT   gene            617680..618762
FT                   /locus_tag="Aave_0569"
FT   CDS_pept        617680..618762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0569"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="PFAM: NAD/NADP octopine/nopaline dehydrogenase;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: ppr:PBPRB0771 hypothetical NAD/NADP
FT                   octopine/nopalinedehydrogenas"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31174"
FT                   /db_xref="GOA:A1TJN6"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN6"
FT                   /protein_id="ABM31174.1"
FT                   /translation="MCDMANEIAVSIIGAGHCGCAIAADVLGRGGKVLLYAHPDHSATL
FT                   HAILRQGYLDVTGRMRGRFMPVLSNDLSEALRFSDCLVLALPSFAHDDMIAALSAHDLG
FT                   RHVIVCIAGNFFCLATRRSLRARAILETSSAPYASRVVGADVKVMGIKSQLHIASLAPI
FT                   GDQGALQALARLFPMPLRWYRNVLEAGLSCINAVLHPVPALLNTGWIESTAGDFHFYRQ
FT                   GMSASVVRVMQAIDQERMRIASRYGLSVRSAVEMMNAYYGGRFASLRDFARESVEHNQE
FT                   KMAPSSMQHRFIEQDVPLVLVPWHELGLKAGIDALTMRAIIQIASIVRRQPPPDEDSAL
FT                   RRLGLAGLDRRGILAAVAAG"
FT   gene            618778..619722
FT                   /locus_tag="Aave_0570"
FT   CDS_pept        618778..619722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0570"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rsp:RSP_0987 putative transporter,
FT                   RarD family, DMT superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31175"
FT                   /db_xref="GOA:A1TJN7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN7"
FT                   /protein_id="ABM31175.1"
FT                   /translation="MSPGTSAPAVRPDDPRRATLRATAYKLASALVLACMFALIKSLGS
FT                   RYPIGEIVFARSAFALLPIIVALHASSQWSTLRTSRPLAHLRRSVAGVASLFLSFGAVS
FT                   LLPLSTATALTYSAPLFITLLSIVLLGEQVTLGRWAAVLIGFVGMLMVIQPDLEAGLPL
FT                   GKVLGVLAAVATAVALVAIRQMAASESALAIAFYFTLFGTLVGAATLPLQAVVPDGADA
FT                   LRLVSVGVLGGMAQLLLTMAYRLAPASVLAPYEYATLVGAILVGFIVWGEMPGPVEWLG
FT                   IVVIVGANVGMTAHEQARARRARRGPASDGTDE"
FT   gene            complement(619770..620666)
FT                   /locus_tag="Aave_0571"
FT   CDS_pept        complement(619770..620666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0571"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4421 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31176"
FT                   /db_xref="GOA:A1TJN8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN8"
FT                   /protein_id="ABM31176.1"
FT                   /translation="MKTDLNLRHIEAFRAVMLAGSVVGAAELLNITQPAVSRTIAQMEL
FT                   RLGYALYQRKGRRLVPTAAAQALFREVEQVYGGIERIAQVAQDLRHHRAGALRIAVLPA
FT                   LAQWLVPDALAQFMQDRPQVRTFAQSLPSRQIAELVSTRQFDAGVIELPLSHAGIEVRA
FT                   LPSAPLVAVIPRGHRLAASTELSLHGLAAERLILPSPHSYIRYQIDDVFNRGGIAAQVI
FT                   AETPTSSIACALAAAGAGIALVSRWVPSPVHDPRYVAVALRESIRSQYGLITPSGVPEN
FT                   ALVVEFADLLSQRMAQG"
FT   gene            620802..622175
FT                   /locus_tag="Aave_0572"
FT   CDS_pept        620802..622175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0572"
FT                   /product="MmgE/PrpD family protein"
FT                   /note="PFAM: MmgE/PrpD family protein; KEGG: mlo:mll9010
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31177"
FT                   /db_xref="GOA:A1TJN9"
FT                   /db_xref="InterPro:IPR005656"
FT                   /db_xref="InterPro:IPR036148"
FT                   /db_xref="InterPro:IPR042183"
FT                   /db_xref="InterPro:IPR042188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJN9"
FT                   /protein_id="ABM31177.1"
FT                   /translation="MPESYMFRRVQAPDGTAGGVAHALASFIIGARERQLLPATREAAL
FT                   KCVLDALGSAGAAMDVPGVAATREGARRLLGRGAVPIWFSGGSGTLGAALLANSAATAA
FT                   LDLDDGYRRARGHPGAAVVPAALAMLTLRPALSADDILGAIVAGYEVALRVAMARLSYA
FT                   PSGAWSAYGVIAALGYLQGTSLECLAHALAIAAQASPALPALAGLAGSDVKEGIPYGCL
FT                   AGLAALEMAAAGATGPTDIFDIPTLFNGDVALADFGPAPLIEGTYFKPFGCCRHIHGAL
FT                   DAFLLLQREHGFSAEEIDGMEVATYRATFNLANRPAPTSLTDAQYSVPFCLAAAAIGGE
FT                   AALLPLKQPMLSDPRIVRLARTVVVKPDPELETLFPARSPSRLTVTLRTGERIVSPVVD
FT                   PRGDPARPMHRPELVAKFRQVTAHTLGPRQEEVLQELQQFEQGETAPLVRALGLDWTK"
FT   gene            622175..623347
FT                   /locus_tag="Aave_0573"
FT   CDS_pept        622175..623347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0573"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_4423 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31178"
FT                   /db_xref="GOA:A1TJP0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP0"
FT                   /protein_id="ABM31178.1"
FT                   /translation="MSAVQYPITLPAGGEHPRARRPAKHRFDVLVVGAGAVGMSVAYGL
FT                   VRRGLSVCVADEGDIAFKASRGNFGLAWVQGKGAHCDDYAHWSIDAAGMWPGFAAELQQ
FT                   AGGVDVELSQPGGFAICTSAQEYEARVGMLTGMQQRLGGKFTFEALSGPETQDRMPQVS
FT                   AQIAGSTYCPLDGHVSPLKLLRALFTAFSGRDGVLCPHTVVQSLKARPQGGFTARTATG
FT                   TIDADKVVLAAGLGSTALASSLGLEAPLHPIRGQLLITERAEPFLRYPTLHIRQTADGT
FT                   IQIGDSKEDLGLDTGTTWDVLARIAERALRSFPALAGLSMVRGWGALRVMSPDGFPIYD
FT                   ESSQYPGAFLVTCHSGITLAPQHAGPVAEWIATGEKPDGIGGFTARRFHV"
FT   gene            623600..625026
FT                   /pseudo
FT                   /locus_tag="Aave_0574"
FT   gene            625054..625431
FT                   /locus_tag="Aave_0575"
FT   CDS_pept        625054..625431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0575"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: pol:Bpro_4397
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31179"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP1"
FT                   /protein_id="ABM31179.1"
FT                   /translation="MTAFALHRFHTNPRMSKVVAFGPLVFLSGQTASGSPATSFDEQMQ
FT                   EVLDRIDARLADAGSDKQSLLSVTVYLRNMEDFAAMNAAWERWIAPGTAPARCTVEGRI
FT                   ASPHLLIEISAIAATSASIHP"
FT   sig_peptide     625054..625158
FT                   /locus_tag="Aave_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.699 at
FT                   residue 35"
FT   gene            625452..626453
FT                   /locus_tag="Aave_0576"
FT   CDS_pept        625452..626453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0576"
FT                   /product="uncharacterized protein UPF0065"
FT                   /note="PFAM: uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_2068 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31180"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP2"
FT                   /protein_id="ABM31180.1"
FT                   /translation="MTEISHNAPIPRRACLRWTAGAGMAWLAGGSRAADYPSKPIRLVV
FT                   PAPPGGGTDMMSRLLSNALNSTLGWTVVVDNVPGAGGNIGLDKAAKSAPDGYTLAMGES
FT                   SNLTVNQALYKKMPFDVARDLTPVTLMAKVPLVLVVSAKGPYRSVADLAGAARRKAVTF
FT                   ASSGNGTLAHLCGELWKGKAGLDLVHVPYRGAAPAMTDLASGQVDMFAASITAALPMIQ
FT                   AGLLRPLAVASPMRVAALPNIPTMAESGFQGIEAAVIFGVVAPAGTPDTVVSRLNQEIN
FT                   RALKQPQLRQSLIDQGAIPESLGGTVPAFASLLKDERAKWGQVVNDSGASVD"
FT   sig_peptide     625452..625553
FT                   /locus_tag="Aave_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.955 at
FT                   residue 34"
FT   gene            complement(626584..627801)
FT                   /locus_tag="Aave_0577"
FT   CDS_pept        complement(626584..627801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cps:CPS_1614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31181"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP3"
FT                   /protein_id="ABM31181.1"
FT                   /translation="MKVEPVITPGAVRNRLLRLIATCNSFSLASAWVTRSKVFDAAIAA
FT                   HRKLRHFVIGTHGYFTCADCLEACIPLAQVKVVKPVGRMFHPKVYAFEMEKELVLYVGS
FT                   SNFTQAGLDKNVECGVFLRDSNGHENLQSFSEFIAEQWNSAETLDAKFVSLYRANKARV
FT                   KEAQDELEEFIEIPKPRRTSKSANDVDPIEMDWARFMDLVVEEKTHGGPERRLAVLARA
FT                   RQLLSQGKPFARLSELERRCLAGIQKPSQQPDGLDWGYFGQMSAHGNFSPLLSQHAAIF
FT                   SSALEYIPLVGTVREQHYEAYRRKLMSIPGAGDWTGLGTRLLAMKRPDRFVCINNANRT
FT                   GLCGNFGVAKTTTNLSNYWKRIVAPMQLMPWWRAEMPTDRLGRQVWLCRAAMLDAIYYD
FT                   PTTLRR"
FT   gene            complement(628054..632883)
FT                   /locus_tag="Aave_0578"
FT   CDS_pept        complement(628054..632883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0578"
FT                   /product="type III restriction enzyme, res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; SMART: DEAD-like helicases-like; KEGG:
FT                   dvu:DVU2175 adenine specific DNA methyltransferase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31182"
FT                   /db_xref="GOA:A1TJP4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP4"
FT                   /protein_id="ABM31182.1"
FT                   /translation="MTFQELLDELAEAAHSNRGKGTQFEKLIANYLLTDPQYADRLADV
FT                   WLWEEWPDRWSTDVGIDLVARERGTGEYWAIQCKFFDPDHYLQKTDIDSFFTASGKKFA
FT                   TKEGERSFAHRIVVSTTDKWSKHADDALANQVISVSRLWFKELAESPIDWSQFSLSNIK
FT                   DIKLKKKKQPREHQQEAIAAVAAGFTEADRGKLIMACGTGKTFTALRMMENEVAADGRV
FT                   LFLAPSISLVAQSLREWTAESLEPFHAFVVCSDSKVGKDEEDLNTHDLAYPATTDAKRL
FT                   SKAAAMLPKGRRTVVFSTYQSIQVVADAQKGGLGEFDLIVCDEAHRTTGLTLPSEDPSE
FT                   FVKVHNNAIVKAKKRLYMTATPRIFADKSKTKANEADAVLFSMDDVETYGQEFYRLGFG
FT                   KAVTRDLLTEYKVLIVAVKEAEMAKLANNYNNAYKIDDKKAIDINFATKIIGSWKGLSK
FT                   KGLVAVDDDGQEDALNEDAAPMRRAVAFSKSIKDSKQMQDVFGQLVQTYQQVHQQQGEP
FT                   EGQDEALQDMVACQLQHVDGTMNALKRQTSLDWLKAEVGEGQCRILTNARCLSEGIDVP
FT                   ALDAVVFFDTRESIVDIVQSVGRVMRKAEGKQFGYIILPVCIPSERVKDYNNYIDSDPQ
FT                   FKGIWKVIKALRAHDESLVDEAEFRRKIKVIADPDKTKGGDDRKGDQADLPMEFPVLPI
FT                   DAINEAVYAAIPKKLGDREYWAEWAKGIGQVAERLVARINALVDSSSALGQDFARFLKG
FT                   LQDTLNPTVGRDEAVEMLAQHILTLPVFQALFADTDFPTRNVVGRALQDIVDKLDAAAV
FT                   GSETEGLQKFYDNVRERVALAKSDKSKQDIIRNLYDTFFNNAFPRMAERLGIVYTPVQV
FT                   VDFILHSANSALRKHFGQSLGNEGVHILDPFSGTGTFPVRLIQSGLINRSDLPRKFASE
FT                   LHANEIVLLAYYIATINIETAYHGVMGEYLPFDGMVLTDTFQMTEDNDLVDKVVLPENN
FT                   ARVERQLAEPIRVIVGNPPYSAQQESENDNNKNLAYPTLDDRIRQTYAAQSSAKLVKNL
FT                   YDSYIRAIRWASNRIGERGIVAFVTNGSFLDANNMDGLRNCLTQEYSHLYIFNLRGNQR
FT                   TSGEESRREGGKIFGSGSRTPVAISIMVKDPAHAGPCELRYHDIGDYLTQQEKLDILER
FT                   FGSIDGMDWRMLRPNAEGDWVNQRDPAFEGFVPLGDKDDGSGKVVFDVYSQGVLSARDA
FT                   WAYNMDRAALEFNMRRMIAAFNEDRARYSKLCEGKAKDQWPEVEAVIDADPRRISWSRA
FT                   LKADARRGKAYAFEEASLTQSMYRPYTKQWVYFNRRFNEMVYQQPKLFPTPRHSNVVIS
FT                   TTGTGAAKGFSALVGDTVPNYHMHDSGQCFPLYWYEAVEEQTATTQASMFSAQDQADAD
FT                   GYVRRDSITDWALRAFRERYADASITKEDIFWYVYGILHSPEYKARFSTDLKKMVPRIP
FT                   YAKEFRAFSDAGRSLGQWHLNYETIEPYALTEESKRLVMEPGDLRVDKMAFGKKDGKPD
FT                   KSSIVYNRHLTLRDIPMEAYDYVVNGKSAIEWVMERYAVSVDKSSGIKNDPNEWSPDPR
FT                   YIVDLVKRIVRVSVETVRIVKGLPALAESD"
FT   gene            633118..633408
FT                   /locus_tag="Aave_0579"
FT   CDS_pept        633118..633408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0579"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: xac:XAC2188
FT                   cell growth regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31183"
FT                   /db_xref="GOA:A1TJP5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP5"
FT                   /protein_id="ABM31183.1"
FT                   /translation="MRCGRLRIYVVLRISKGVVMLVAKWGNSLAVRLPANVVEALELRE
FT                   GDDIEIFVGDARSFAVSKKPGAEAMLERLRTFRGKLPADFKFNRDEANGRG"
FT   gene            633395..633808
FT                   /locus_tag="Aave_0580"
FT   CDS_pept        633395..633808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0580"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG: xac:XAC2187
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31184"
FT                   /db_xref="GOA:A1TJP6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP6"
FT                   /protein_id="ABM31184.1"
FT                   /translation="MAAGKGKVFLDSNVVLYLLSEDAAKADSAEALLHRRPVISVQVLN
FT                   EVTHVCVRKLKMGWGEVGQFLALVREFCSIVPLTVEVHDRARQLAERHQLSFYDACIVA
FT                   AAAAEGCQTLYSEDMHHGLIIEESLSIRNPFNV"
FT   gene            633829..634191
FT                   /locus_tag="Aave_0581"
FT   CDS_pept        633829..634191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0072 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31185"
FT                   /db_xref="GOA:A1TJP7"
FT                   /db_xref="InterPro:IPR022213"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP7"
FT                   /protein_id="ABM31185.1"
FT                   /translation="MATSQSRTPLSRRAGRAAARAWRWLLVRNAQFTGWLIRAGVPASV
FT                   AKAVGVCALLLVVGVLLYGAFWLGTLVLAVIAALWLIGRIDGFDATPEPEWKDGWEGYG
FT                   LYRGDMRIDPGEQEDS"
FT   gene            complement(634205..635719)
FT                   /locus_tag="Aave_0582"
FT   CDS_pept        complement(634205..635719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31186"
FT                   /db_xref="GOA:A1TJP8"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP8"
FT                   /protein_id="ABM31186.1"
FT                   /translation="MTLYTTDYLEYYLTLVGWIVQNGIWNILVASGAFALPFVAIVVQE
FT                   WLRARGEGADEGNKGVLSAARIENRVWVAVVVILFAGIPFIDVDLSTIQFDTSRSKQCK
FT                   VDVAVPQDTRWANAFTTLNNQSARVPVWWFFMHAISKAVTGAAVVAIPCGTDLRQMRME
FT                   IDSARINDPVLAQEVADFTRDCYGPARAKLFMGRPELSDAQMNDVTWIGSAYFLGTGGY
FT                   YDIYHSQTPRTSWPYDATRDAGLAQVANGGGYPTCRQWWNDGDRGLRSRLLAQVDSGLL
FT                   ARVGRWASFVSRQQADDAVIRAIAAPRQQTMNQGQAYADYGGQVDMTLPNIVTRGAADA
FT                   GLAVGSVGFFPAMDVVRQALPMVLSFLKMALVICVPLVLLFGTYDLKAVVTMSCVQFAL
FT                   FFVDFWFQLARWIDSTILDALYGWSGPHSNLDPLLGLNNAFGDMLLNFVMASMFLILPG
FT                   VWVAALGWVGVQAGTMARMLATGTDGARSAGSKGSDAALNAALRSK"
FT   gene            636404..636976
FT                   /locus_tag="Aave_0583"
FT   CDS_pept        636404..636976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0583"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   pol:Bpro_4455 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31187"
FT                   /db_xref="GOA:A1TJP9"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJP9"
FT                   /protein_id="ABM31187.1"
FT                   /translation="MTVLMVDNYDSFTYNIVQYFGELGAQVEVHRNDEITVEEIAARNP
FT                   RHLVISPGPCSPAEAGVSVEAIRHFAGKLPILGVCLGHQSIGAAFGGRIIRARELMHGK
FT                   TSTITTTGQGVFAGLPEQFTVNRYHSLSIERESCPEVLEVTAWTDDGEIMGVRHKELPI
FT                   EGVQFHPESILTEHGHAMLKNFLSMKA"
FT   gene            637048..637731
FT                   /locus_tag="Aave_0584"
FT   CDS_pept        637048..637731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0584"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_4453 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31188"
FT                   /db_xref="GOA:A1TJQ0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ0"
FT                   /protein_id="ABM31188.1"
FT                   /translation="MPDFHHLLLFIAAGWLLNLTPGPDVFYIATHALRSGARAGIVAGL
FT                   GVTAGCFVHVAAAALGVGALLATSATAFSVLKWAGAAYLVWMGVRMLRARPGGGLAAVA
FT                   RTAGPAGEGAAAVDAAAGAPLRKVFLGGFWTNVLNPKVAIFFLAFVPQFIAPGAEHEAL
FT                   AFVLLGTLFNLNAIPVNVGWALAAAWIARRAALVQRRMHWLDRAAGAMFVGFGIRLALS
FT                   ERPGP"
FT   gene            637764..638801
FT                   /locus_tag="Aave_0585"
FT   CDS_pept        637764..638801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0585"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="TIGRFAM: anthranilate phosphoribosyltransferase;
FT                   PFAM: glycosyl transferase, family 3; KEGG: pol:Bpro_4452
FT                   anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31189"
FT                   /db_xref="GOA:A1TJQ1"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJQ1"
FT                   /protein_id="ABM31189.1"
FT                   /translation="MSITPQEALQRTIEHREIFHDEMLHLMRMIMRGELSPVMTAAIVT
FT                   GLRVKKETIGEITAAAQVMRELSRKVAVADTTHLVDIVGTGGDGANTFNISTCAMFVAA
FT                   AAGAKTAKHGGRGVSSKSGSADVMESLGVHIDLPPEAIARCIADTGIGFMFAPNHHPAM
FT                   KNVAPVRKELGVRTLFNILGPLTNPAGAPNILMGVFHPDLVGIQVRALQRLGAEHALVV
FT                   YGRDGMDEVSLGAATMVGELKNGEITEYEIHPEDFGLAMSSNRALKVETPEQSREMLLS
FT                   VLRGEPGSAREIVCLNAGVALYAANVAATMADGIARARAALDSGAALARLEQLVARTRA
FT                   LAAGG"
FT   gene            638974..639774
FT                   /locus_tag="Aave_0586"
FT   CDS_pept        638974..639774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0586"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="PFAM: Indole-3-glycerol phosphate synthase; KEGG:
FT                   pol:Bpro_4451 indole-3-glycerol-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31190"
FT                   /db_xref="GOA:A1TJQ2"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJQ2"
FT                   /protein_id="ABM31190.1"
FT                   /translation="MSDILNKIVAVKREEIAAAQKKIPLAAMRADAESRVLTRDFEGAL
FT                   RAKIAAGQAAVIAEIKKASPSKGVIRENFIPADIAQSYAEGNGKVSAACLSVLTDRQFF
FT                   QGQPDYLKQARASCALPVLRKDFMVDAYQIYESRAMGADAILLIAACLEDAQMAEFEAI
FT                   AHSLGMAALVEVHDGAELDRALKLRTPLVGINNRNLRTFEVSLDTTVSLRKAVPSDRLL
FT                   VAESGILTPQDVKTLRDADVHAFLVGEAFMRAQEPGAALAKLFA"
FT   gene            639828..640553
FT                   /locus_tag="Aave_0587"
FT   CDS_pept        639828..640553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0587"
FT                   /product="uracil-DNA glycosylase"
FT                   /note="TIGRFAM: uracil-DNA glycosylase; PFAM: Uracil-DNA
FT                   glycosylase superfamily; KEGG: pol:Bpro_4450 uracil-DNA
FT                   glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31191"
FT                   /db_xref="GOA:A1TJQ3"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ3"
FT                   /protein_id="ABM31191.1"
FT                   /translation="MTPSAHAPSAPPSQLQSADPADWPVASGWQPLVDDFFASARGQAL
FT                   LGFLRQRLDAGAVIFPPRPLRALELTPPESVRVVILGQDPYHGRGQAEGLAFSVAPGVA
FT                   LPPSLRNIFKELQRDLGTPFPAWPEPGGSLVKWAKNGVLLLNTCLTVEESQPASHAGKG
FT                   WEQLTDAVIRKVGEGDRPAVFMLWGSHAQSKRPLIDASRHLVLTANHPSPLSALRPPVP
FT                   FIGCGHFGRAREFREQQSG"
FT   gene            641055..642983
FT                   /locus_tag="Aave_0588"
FT   CDS_pept        641055..642983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS05518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31192"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ4"
FT                   /protein_id="ABM31192.1"
FT                   /translation="MSDETAGGVVDEVMTYFQKYQKLRSNPAVSSDVAARMLPGALKMA
FT                   RRGLDAVPFLSFMQVNSVQGQRARQFLPQQLATLAGDLSDELLNAFYGENTGGKLQWRM
FT                   DAAAADRRRMTPDFDRELNDYLRGLDGTLRQLEPCMDAMSVAIKSMGTMEEVKTDADMA
FT                   GILKRAVVDLTEMRLNRIERHLEGIRLCLQRLYMEPELVGTPAGIALGALKTLTADHEE
FT                   MLNALDVLLDARAPISPDKAAQLQRQLDALLGAARAFVEAAGAQFSSEGDDPYIPTVRL
FT                   APHILHSVARIAGEMEDALGAYKLPPSVVRHVQGTTYMGQAIGRHAAIRHPADSVESAG
FT                   KMEVAPDRPAPVAPQRRKAQARSRVHRKAPQSDSGTSTSGTQDTACGALLQMARERLGA
FT                   FNRPPQAGVTSLDDVVAVGASLRKDTSALQVYRNADSDPLEVGRQMRLALDSWFGHAGR
FT                   WKGVQDQLQALQDSDGGALAKDLLRKIREERIEPLRQLHAQIDAVELDRVKTFAYPRLK
FT                   HVEHLMQADPQGRILKVGAPVPLRSQGFDGRNRATLFEVALDVGTLANGQPAPPLYVHL
FT                   HTRQPVTAETCRTIAFDDLDAVHVKNAEQRGKGRTWEVLNNALDSVHRGPLDAKVLEQL
FT                   QQRMARD"
FT   gene            643070..644686
FT                   /locus_tag="Aave_0589"
FT   CDS_pept        643070..644686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0589"
FT                   /product="gamma-glutamyltransferase 2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   pol:Bpro_1819 gamma-glutamyltransferase; Threonine
FT                   peptidase; MEROPS family T03"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31193"
FT                   /db_xref="GOA:A1TJQ5"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ5"
FT                   /protein_id="ABM31193.1"
FT                   /translation="MTAPHGDRAIDWTLPYASHRSAVMGRNVVSTSQPLAAQAGLRMLQ
FT                   AGGNAVDAALAAAMVLTVVEPTGCGIGSDAFAIVWDGQELHGLNASGRAPAAWTPGYFA
FT                   ERGGIPETGWNAVTVPGAVSGWVALSRRFGRLPFAQLAQPAIDYARGGFAVSPTIARQW
FT                   ALGAARLGSQPGFAECFLPGGRAPRAGEIFRSEAHARTLERIAVTGGEDFYRGELARQM
FT                   AAHARANGGAMTEDDLAAHQADWVGTVSRRFGDSVIHEIPPNGQGIAALMALGMLDVAG
FT                   IGAQPVDHVDTVHASIEAMKLALADLYRHNADADAMRVAARDLLSDAYVRERAALIDPA
FT                   RAGDPGHGMPRPGGTVYLAAADESGMMVSFIQSNYMGFGSGVVVPGTGISLQNRGHCFT
FT                   AEAGHANEVAPRKRPSHTIIPAFATDADGAPRMAFGVMGGPMQSQGHVQMALRVLRYGQ
FT                   NPQAAADAPRWRVTGGRGVAVEPAFDPAVVGALRARGHDVAVEAGDGVFAFGGAQLVLR
FT                   LDSGAYAAGSDPRKDGHAVAY"
FT   gene            complement(644741..645850)
FT                   /locus_tag="Aave_0590"
FT   CDS_pept        complement(644741..645850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0590"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   rfr:Rfer_0628 S-adenosylmethionine"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31194"
FT                   /db_xref="GOA:A1TJQ6"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ6"
FT                   /protein_id="ABM31194.1"
FT                   /translation="MSASQPPRAFTLSDFDFSLPPELIAQHPAPERSASRLLDGRADVP
FT                   VDRIFRELPGLLQPGDLLVFNDTRVVKARVFGEKASGGKVELLIERVLVGTGGEAGNEV
FT                   VAHMKVSKKPAVGAMLHMAGGPAGGGFGATLLGRWPDEDGPLFRFALSSPDGAGPHALM
FT                   ERHGHIPLPPYIERHQEGGGDPDAAEDAERYQTVFARAPGAVAAPTAALHFDEGVLASL
FT                   AARGVERASVTLHVGAGTFQPVKTESLADHRMHSEWYEVPLATLAALERCRQRGGRVVA
FT                   VGTTTVRTLESWARSGQGTGDTDIFITPGFAFQVVDLLVTNFHLPKSTLMMLISAFTGY
FT                   EHAMDLYRHAIAQRYRFFSYGDAMLLARR"
FT   gene            complement(646650..647615)
FT                   /locus_tag="Aave_0591"
FT   CDS_pept        complement(646650..647615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0591"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; AraC protein, arabinose-binding/dimerisation;
FT                   KEGG: pol:Bpro_1731 transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31195"
FT                   /db_xref="GOA:A1TJQ7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ7"
FT                   /protein_id="ABM31195.1"
FT                   /translation="MSRARPERACPAVRTYAMAERSRHLDFDIRDQSGRAPLTQPHKHE
FT                   YFQIQVSLEGATQHHVGGTVRPFTPGTLSFVLPHRMHLVPHPPGTRWLVVNFSQRFLWP
FT                   DLRVDPLDLEDVPLALAPELAPFQFQEHLDFTFGGADWQAVLAVLDMLQQENTSRRLAS
FT                   AARIRGGLLELLARACRYREVELRALAANQAQRGSRRAALARVLRYLRGELAGEPTLAS
FT                   AAEAACLSPNYLAHLIKKETGRTFTELLTERRLALAQELLLATGERIGEIARRCGFADE
FT                   AYFARRFRQWHGLSPRDWRTERLRELQGEAASPDRVQVLR"
FT   gene            complement(647612..648907)
FT                   /locus_tag="Aave_0592"
FT   CDS_pept        complement(647612..648907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0592"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: rfr:Rfer_3329 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase, HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31196"
FT                   /db_xref="GOA:A1TJQ8"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ8"
FT                   /protein_id="ABM31196.1"
FT                   /translation="MLKRISVQHLTLGMYLHQFCGSWMDHPFWRTGFVLQDAADLARIH
FT                   ATAIQEVWIDVSKGRDVAAGVEAVTPEQAEARRETDFQKLQDMPELKVAPSPPPPAAPP
FT                   IQARPRGTRPASMSEELAHAAALTSHARQTMTSMFTEARMGRVVDSTEARSLVEEISDS
FT                   VTRNPSALISLARLKTADDYTYMHSVAVCALMVALGRQIGLEGERLRTAGMAGLMHDIG
FT                   KARIPLSVLNKPGKLTDDEFDVIRSHSEHGHRMLLACGGVDEEVLDACLHHHEKMDGSG
FT                   YPHRLAGEGIGLIARMTAICDVYDAITSDRPYKRGWDPAESLRRMAEWTHGHFDARLFQ
FT                   AFVKSIGIYPVGSLVRLASGRIGVVMEQSASLVSPRVKVFFSTKSDLRIPPEVVDLSAA
FT                   GSGDKIVAREDPDTWRFPDLVDLWARPGGTAG"
FT   gene            649080..651206
FT                   /locus_tag="Aave_0593"
FT   CDS_pept        649080..651206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0593"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: pol:Bpro_0468 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31197"
FT                   /db_xref="GOA:A1TJQ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJQ9"
FT                   /protein_id="ABM31197.1"
FT                   /translation="MPAPAPSPAQKALQKLGLSRDIDLALHLPLRYEDETRITPLRNVR
FT                   DGDTAQIEATVTASEVQLRPRRQLVVTVDDGTGTCELRFFSFYPSHQKTLAVGARLRIR
FT                   GEVKGGFWGRQMLHPAFRLAGGELPAALTPVYPTTAGLPQPYLRRAIVSALQRVDLSET
FT                   IPPGLEPPIPRFLGEGGGGRSWWTLRDALVFLHHPTPDVALATLEDHSHPAWQRLKAEE
FT                   LLAQQLSQLEAKRERDRLRAPVLRPAPGGEGGAALHERLLAALPFGLTAAQRRVCAEIA
FT                   ADLARAVPMHRLLQGDVGSGKTVVAALSAAVCMDAGWQCALMAPTEILAEQHFRKLIGW
FT                   LEPLLAASGRRVAWLAGGQKKKERAAMLALVESGEAALVVGTHAVIQEQVRFRNLALAV
FT                   IDEQHRFGVAQRLALRRKLADQGMEPHLLMMSATPIPRTLAMSYYADLDVSTIDELPPG
FT                   RTPIVTKLIADSRKDEVIERIGAQVASGRQVYWVCPLIEESEALDLSNATATHLELSEA
FT                   LQGDPAHGQAPVMVGLLHSRMPPAEKKAVMELFTAGTMGVLVSTTVIEVGVDVPNASLM
FT                   VIEHAERFGLSQLHQLRGRVGRGSAASACVLLYSTGESGRLGETARDRLRAMAETQDGF
FT                   EIARRDLEIRGPGEFLGARQSGAPMLRFADLATDTLLLEWARETAPRMLDGHPGDARRH
FT                   VGRWLGGKADYLKA"
FT   gene            651313..652278
FT                   /locus_tag="Aave_0594"
FT   CDS_pept        651313..652278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0594"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_3681 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31198"
FT                   /db_xref="GOA:A1TJR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR0"
FT                   /protein_id="ABM31198.1"
FT                   /translation="MTLTELKYIVAVAREKHFGRAADACYVSQPTLSVAIKKLEDELEV
FT                   KLFERSAGEVSVTSLGEEIVRQAQSVLEQAAAIKEIAKRGKDPLAGVLTLGVIYTIGPY
FT                   LLPELVRHAIARTPQMPLMLQENFTVKLLEMLRTGEIDCAIMAEPFPDTGLAMAPLYDE
FT                   PFLAAVPSSHPLAERKSISAAELKSETMLLLGAGHCFRDHVLEVCPEFARYASNAEGIR
FT                   RTFEGSSLETIKHMVSAGMGVTLVPRLSVPRDALHTGTKRRKSDDTHIRYLPIEEDDGS
FT                   PPPMRRVVLAWRRSFTRYEAIAALRNAVYACELPGVTRLS"
FT   gene            652387..652911
FT                   /locus_tag="Aave_0595"
FT   CDS_pept        652387..652911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0595"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   rso:RSc2687 putative DNA protection during starvation or
FT                   oxydative stress transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31199"
FT                   /db_xref="GOA:A1TJR1"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR1"
FT                   /protein_id="ABM31199.1"
FT                   /translation="MAKASGKSVASRSPATAPRINIGISDKDRAAIAQGLSRLLADTYT
FT                   LYLTTHNFHWNVTGPMFNSLHTMFMEQYTELWNAVDPVAERIRSLGHPAPGSYAEFGRL
FT                   TSLADVPGTPPAALDMVRILVEGHEAVARTARDLFPVADKASDEPTADLLTQRLTVHEQ
FT                   TAWMLRSLLEG"
FT   gene            653081..653968
FT                   /locus_tag="Aave_0596"
FT   CDS_pept        653081..653968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0596"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: rfr:Rfer_3680
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31200"
FT                   /db_xref="GOA:A1TJR2"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJR2"
FT                   /protein_id="ABM31200.1"
FT                   /translation="MQSTAPHRPPQPSRLALYLDLIRWSRPAGWLLLLWPTLSALWIAA
FT                   GGFPGWHLLAVFTLGTILMRSAGCCVNDVADRDFDRHVKRTAQRPVTSGAVSVREALGV
FT                   GAVLALVSFGLVLTTNAATIAWSLPALAVTIAYPFAKRFVSMPQAVLGVAFSMGIPMAF
FT                   TAVGGAVPMLAAWLVLGNLCWVLAYDTEYAMVDRDDDLKIGMKTSAITLGRHDVPAVMA
FT                   FYLAFVALWAWALAPFGLGWPLHAVLAAMLLQVAWHWRLIRHRTREGCFRAFTGNHWLG
FT                   FTLFAGIVAGFALR"
FT   gene            complement(654015..654851)
FT                   /locus_tag="Aave_0597"
FT   CDS_pept        complement(654015..654851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB4267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31201"
FT                   /db_xref="GOA:A1TJR3"
FT                   /db_xref="InterPro:IPR006879"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR3"
FT                   /protein_id="ABM31201.1"
FT                   /translation="MNPPGSPGASRAVLLCADDYALHPLVDEAVEQLARAGRLSATSCM
FT                   TASPRWQAAAACLAPLRPQLAVGLHFDLTESHGGAHAGARALGPLLLQAYARQIPVAVL
FT                   RAAWRTQLDAFERAMRTPPDFIDGHQHVHQLPRARDALLAELQARYAAHERPWVRSTAP
FT                   APGLWRDPKASIIALLGGWTATRRWRRAGLATNPGFGGVYGFDAPDAQAYGARMATWLP
FT                   RLPEGGLLMCHPATDVVHGDAIGTQRPVEFAYLMSEAFGELLRRSGRHVQQGPFAP"
FT   gene            complement(654848..655252)
FT                   /locus_tag="Aave_0598"
FT   CDS_pept        complement(654848..655252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0598"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: mfa:Mfla_1376
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31202"
FT                   /db_xref="GOA:A1TJR4"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR4"
FT                   /protein_id="ABM31202.1"
FT                   /translation="MLLRRLPQGVQFVLVGGAAAATHLGTMGLLVALAGMPPLAANVLA
FT                   FLVAFAVSYNGHALLTFAASRRRGPTAMARYFAVACLTFAANELMYFTALHILHWHYFW
FT                   SQAGVLVLVALGTFVLSKFWAFKAPSGSGA"
FT   sig_peptide     complement(655148..655252)
FT                   /locus_tag="Aave_0598"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.562 at
FT                   residue 35"
FT   gene            complement(655279..656310)
FT                   /locus_tag="Aave_0599"
FT   CDS_pept        complement(655279..656310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0599"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   lpn:lpg2478 glycosyltransferase, group 2 family protein
FT                   (glycan biosynthesis)"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31203"
FT                   /db_xref="GOA:A1TJR5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR5"
FT                   /protein_id="ABM31203.1"
FT                   /translation="MTALPPPQPPSEYQSEFAPAAPDGLLPRAPLRLSCVVPAHNEESN
FT                   LEEFVHALARAAGALTPDFEIVIVNDGSRDGTHAVAMKLARELPLRYLALSRNFGKEAG
FT                   LSAGIDHARGNAVLLIDADFQHPLDLLPQMHALWLSGYDMVYGVIADRAGDSGAKRMGT
FT                   RAFYRLLNAGNKVKIPPNAGDFRWMDRRVVDALKALPERNRFMKGLYAWVGFKSAALPF
FT                   VPLNRAGGVSSFNLRGLGSLALSGLTAFTTLPLRVWSMAGGCISLAALVYGAWITVSAL
FT                   VFGNPLDGWPTLAASIMLFSGVQLMSIGILGEYVGRIYDEVKRRPLYLVACDEDRSPLR
FT                   EQP"
FT   gene            complement(656328..657851)
FT                   /locus_tag="Aave_0600"
FT   CDS_pept        complement(656328..657851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0600"
FT                   /product="putative 4-amino-4-deoxy-L-arabinose transferase
FT                   and related glycosyltransferase of PMT family"
FT                   /note="KEGG: reu:Reut_B3508 putative
FT                   4-amino-4-deoxy-L-arabinose transferase and related
FT                   glycosyltransferase of PMT family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31204"
FT                   /db_xref="GOA:A1TJR6"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR6"
FT                   /protein_id="ABM31204.1"
FT                   /translation="MPIATTAPSSISYRVLALLAALYVLAWSLLPPLLSSCLPLDVVES
FT                   LSWGREWEWGYYKHPPLAPWLLEVSYRALGRVGPFLLSQLFIAATLWLVWLTGCRLVSR
FT                   ERALLGTLLTMGVAYYTRPALEFNHNIAQMPLWAAAGYCLLAALQEGRLRHWLALGIVA
FT                   GLGLLTKYSVGLLLTALALYLLLTPARRVLAGPGPWLALAAMLLVFAPHLHWLRESGWL
FT                   PMAYARDRAAAEGAGLLASRLDALSFLATQALNHLPLALIVLAALWNTRGQRMADARPI
FT                   AWRLHAGMPGYLLVLALGPCLLACALGVVLGLRLRDMWGVPMWVYSGLLVAAWLPGAWL
FT                   PALRPRLLRGLAVWLVLVSVLSGAFLAYGAQWRKRPARTDWPQAAVAQQVQSLWEAQSR
FT                   CPLDSVSGDYWATGLVAAQLPGRPSVFVTGDDRFSPWITLERLQSKGTLWIGLGDEPAV
FT                   PALLERLDAAPGMRVRQGQVQVHWPYRGAGAPLTMHWRTYVPDACANAT"
FT   sig_peptide     complement(657771..657851)
FT                   /locus_tag="Aave_0600"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.754) with cleavage site probability 0.635 at
FT                   residue 27"
FT   gene            complement(657919..658761)
FT                   /locus_tag="Aave_0601"
FT   CDS_pept        complement(657919..658761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0601"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: pol:Bpro_0475 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31205"
FT                   /db_xref="GOA:A1TJR7"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR7"
FT                   /protein_id="ABM31205.1"
FT                   /translation="MTPDTPSPASEQPAIAFIGGGNMASAIIGGLIRQGMPASGIEVVE
FT                   PWEEARAALRAHHGIEALPEAGTALERAGVVVWAVKPQTFKEAAQQARAHTANAVHLSV
FT                   AAGIRSDSIAAWLGSDCVVRAMPNTPALIGRGMTALYARPQVSPAQRAAVQQVLSSTGE
FT                   LLWVDEEPQLDAVTALSGSGPAYVFLFLEAMARAGVEMGLAPEQAHQLAVGTFTGASEL
FT                   ARRSDESPAVLRQRVTSKGGTTFAAVQAMEQAGVPEHFIRAMKAAQARARELGDEFGR"
FT   gene            complement(658866..660386)
FT                   /locus_tag="Aave_0602"
FT   CDS_pept        complement(658866..660386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0602"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pol:Bpro_0476 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31206"
FT                   /db_xref="GOA:A1TJR8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJR8"
FT                   /protein_id="ABM31206.1"
FT                   /translation="MTYLLALDQGTSSSRSIVFDERGHIVAQAQQELPQIYPQPGWVEH
FT                   DPVDIWRTQIATARQALAQANIGPGDVRALGITNQRETTVLWNRRTGQPVHHAIVWQDR
FT                   RAEPLCAELREQGHEPMIQERTGLRIDAYFSATKLRWLLDQVPGARAAAEAGELAFGTV
FT                   DSWLIWQLTGGKVHVTDVSNASRTMLFNVHSNDWDDDLLALLRIPRKLLPRVQPSASDF
FT                   GATDAALLGGAIPIGGVAGDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSSFQTSRN
FT                   GLLTTSAAQIAPRTGAGHGAPEPAFAMEGSVFVGGAVVQWLRDGLRAISSSSEVQSLAE
FT                   SVPDSGGVMMVPAFTGLGAPYWKPDARGTITGLTRGTTIAHIARAALESIAYQSAALLQ
FT                   AMSRDAVAAGGAPVSELRVDGGACVNDLLMQFQADLLGIPVVRPAVIETTALGAAYLAG
FT                   LSSGVYAGTEALSALWRAERRFLPTLSAARAQECMARWEHAVRQAALD"
FT   gene            complement(660436..661200)
FT                   /locus_tag="Aave_0603"
FT   CDS_pept        complement(660436..661200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0603"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: pol:Bpro_0477 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31207"
FT                   /db_xref="GOA:A1TJR9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJR9"
FT                   /protein_id="ABM31207.1"
FT                   /translation="MNTNPRQLLLLEEVRARQTATVEQLADTLGVTLQTVRRDIQKLAD
FT                   SGLLLRFHGGVRVPSSTTENLGHTQRETLHAEGKARIARAVAQAVPHNCSLILNIGTTT
FT                   EAIARALLHHRGLRVITNNLNVAAILAGNPDCEVIVAGGVVRARDRGIVGEAAVDFIRQ
FT                   FKVDIALIGISGIEPDGSLRDFDLREVKVAQTIIAQAREVWLATDHSKFDRPAMVQVAT
FT                   LAQIDRLFTDARPPDPFPALLRDAGVELDVAE"
FT   gene            661418..662497
FT                   /locus_tag="Aave_0604"
FT   CDS_pept        661418..662497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0604"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter-related protein; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase; KEGG: rfr:Rfer_3676 ABC transporter-related
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31208"
FT                   /db_xref="GOA:A1TJS0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS0"
FT                   /protein_id="ABM31208.1"
FT                   /translation="MQLVLERIGKQVGAQTWLHGMDMALQPGAVTVLLGATQAGKTSLM
FT                   RIMAGLDAPTEGRVRVDGKDVTGMPVRERNVAMVYQQFINYPSMTVADNIASPLRLRGD
FT                   NNVQERVRALAERLHIDMFLNRYPSELSGGQQQRVALARALAKGAPLMLLDEPLVNLDY
FT                   KLREELRDELTQLFAAGDSTVVYATTEPGEALLLGGYTAVLHEGELLQYGPTADVFHAP
FT                   ASLRVARAFSDPPMNLLPAETVVGGVRVAGRDVFALPGPLPAGAASGLTVGVRASALRL
FT                   TARPGDVSVPGTVELAEIAGSDTFVHAQTPWGELVAQFTGVHDFALGSALTLHLQPGDA
FT                   YVFGADGALLRAPARRGGR"
FT   gene            662499..663572
FT                   /locus_tag="Aave_0605"
FT   CDS_pept        662499..663572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0605"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter-related protein; TOBE domain
FT                   protein; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase; KEGG: pol:Bpro_0479 ABC transporter-related
FT                   protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31209"
FT                   /db_xref="GOA:A1TJS1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS1"
FT                   /protein_id="ABM31209.1"
FT                   /translation="MARIQLDLAHSYKPNPQQDSDYALLPLSMEFRDGGAYALLGPSGC
FT                   GKTTMLNIMSGLLAPSQGRVLFDGRDVTRASPQERNIAQVFQFPVIYDTMTVAENLAFP
FT                   LKNRKVPEAQIRQRVGQIAEMLEMSHQLDMRAAGLSADQKQKISLGRGLVRPDVSAVLF
FT                   DEPLTVIDPHLKWQLRRKLKQIHYELKLTLIYVTHDQVEALTFAEEVVVMTRGRAVQVG
FT                   SADALFERPQHVFVGHFIGSPGMNFLPAQLEGGGLRIGGQALPRPARELPDGPLQLGVR
FT                   PEYLAVVPEGTPGALPCTVDKVQDIGTYQLLTARLDGQPLKARVTPAEVLPAPGGTVWL
FT                   QVLGAHTCFYRNEELLA"
FT   gene            663569..664465
FT                   /locus_tag="Aave_0606"
FT   CDS_pept        663569..664465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0606"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_0480
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31210"
FT                   /db_xref="GOA:A1TJS2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS2"
FT                   /protein_id="ABM31210.1"
FT                   /translation="MSQTTKPVNQKAWFLILPVILCVAFSAILPLMTVVNYSVQDIISP
FT                   ERRVFVGTEWFAQVMRDEELHGALLRQLGFSLAVLAVEIPLGICLALSMPTQGWKSSAV
FT                   LVTVALSLLIPWNVVGTIWQIYGRADIGLLGAALQYVGIDYNYTGNATHAWLTVLAMDV
FT                   WHWTPLVALLCFAGLRSIPDAYYQAARIDGASKWAVFRYIQLPKMRGVLMIAVLLRFMD
FT                   SFMIYTEPFVLTGGGPGNATTFLSQYLTQKAVGQFDLGPAAAFSLIYFLIILLLCFILY
FT                   NWMQRVGTDTATEDGHA"
FT   sig_peptide     663569..663649
FT                   /locus_tag="Aave_0606"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.434 at
FT                   residue 27"
FT   gene            664458..665270
FT                   /locus_tag="Aave_0607"
FT   CDS_pept        664458..665270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0607"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_0481
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31211"
FT                   /db_xref="GOA:A1TJS3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS3"
FT                   /protein_id="ABM31211.1"
FT                   /translation="MHENRFRKRTLFLIAYLVFALLPIYWMVNMSFKTNSEILSTFSFW
FT                   PEHFTWDNYRTIFTDESWYSGYINSLIYVAINMVISLTVALPAAYAFSRYQFLGDKHVF
FT                   FWLLTNRMTPPAVFLLPFFQLYTTVGLMDTHLAVALAHLLFNVPLAVWILEGFMSGIPR
FT                   EIDETAYIDGYSFPRFFLTIFLPLIKAGVGVAAFFCFMFSWVELLLARTLTSVNAKPIV
FT                   ATMTRTVSASGMDWATLAAAGVLTIVPGAIVIWFVRHYIAKGFAMGRV"
FT   gene            665562..665870
FT                   /locus_tag="Aave_0608"
FT   CDS_pept        665562..665870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0608"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: rfr:Rfer_3672 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31212"
FT                   /db_xref="GOA:A1TJS4"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS4"
FT                   /protein_id="ABM31212.1"
FT                   /translation="MFDWMAWTTPVAVFFVCIVLMLAGMTVWEIKSPTTLRKGFLPIAT
FT                   TRGDRLFIGLLSAAYVNLAYVGLSGRIAEWMKLEQEPSVWISFVASMLLLALILRKG"
FT   gene            665967..667700
FT                   /locus_tag="Aave_0609"
FT   CDS_pept        665967..667700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0609"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: pol:Bpro_0483 twin-arginine translocation pathway
FT                   signal; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31213"
FT                   /db_xref="GOA:A1TJS5"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS5"
FT                   /protein_id="ABM31213.1"
FT                   /translation="MKMRLTALAFAATALVIGQAAWAGEAEAKKWVDSEFQPSTLSKDQ
FT                   QMAEMKWFIEAAKKLQAKGVKEISVVSETITTHEYESKTLAKAFSEITGITVKHDLIQE
FT                   GDVVEKLQTSMQSGKSIYDGWISDSDLIGTHYRYGKMMSLTDYMAGDGKEWTNPGLDLK
FT                   DFIGIKFTTAPDGKLYQLPDQQFANLYWFRADLFARQDLKDKFKAKYGYELGVPQNWSA
FT                   YEDIAEFFSNDVKQIDGKPIYGHMDYGKKDPSLGWRFTDAWLSMAGAADVGTPNGLPID
FT                   EWGIRVADDKCTPVGASVSRGGATNSPAAVYALTKYVDWMKKYAPKEALGMTFTEAGPV
FT                   PAQGQIAQQIFWYTAFTADMVKPGLPVVNADGTPKWRMAPGPNGPYWKQGMQNGYQDVG
FT                   SWSFFKGHDANRTAAAWLYAQFVTAKTTSLKKTLVGLTPIRESDIQSKAMTDAAPKLGG
FT                   LVEFYRSPARVAWSPTGTNVPDYPKLAQLWWKNVAQAVTGEKTPQGAMDNLAEEMDQVM
FT                   ARLQRAGMAHCAPKLNPKGDPAKWLSDQHAPWKKLANEKPKGETIAYDKLLQAWKDGKT
FT                   R"
FT   sig_peptide     665967..666038
FT                   /locus_tag="Aave_0609"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            667817..669439
FT                   /locus_tag="Aave_0610"
FT   CDS_pept        667817..669439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0610"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0484 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31214"
FT                   /db_xref="GOA:A1TJS6"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A1TJS6"
FT                   /protein_id="ABM31214.1"
FT                   /translation="MARLNGQFIAMTLPNTPLPTDRARLLAQLAEPRQYDLAVIGGGAT
FT                   GLGAALDAAARGFSVVLVESHDFAKGTSSRATKLVHGGVRYLAQGNISLVREALHERTT
FT                   LLGNAPHLAQPLPFVMPSYRFWETPFYGMGLKAYDLLAGRAGLGTTEFLGREGTLRLLP
FT                   TVRRDGLQGGVKYWDGQFDDARLALALARTAALRGALLVNYCPARELIHENGKVAGLRC
FT                   EDAETGTPYTLRARCVVNATGVWVDGLRSQDAEALGRPARPIVAPSQGVHIVVDREFLP
FT                   SDHAMMVPKTADGRVLFAVPWLGKVILGTTDSPRQDLEREPRPFKEEAAFILSESARYL
FT                   TRAPSAADVRSIWVGLRPLVRPPDDEGGNTKSISREHTVLASPSGLVTVTGGKWTTYRA
FT                   MAEDVLQKCFDAGLLPARAGGATQRLPVVGAPDGPVQHGMDEAQGPHSYGSEAVFLDNV
FT                   PGAQHWLAPGLSEAMVRFAARHEYARTVEDMLARRSRMLFLDAAQALRLAPQVAAILAE
FT                   ELGTDPGLAAFEALAAQYHTVPA"
FT   gene            669630..669998
FT                   /locus_tag="Aave_0611"
FT   CDS_pept        669630..669998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0611"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: pol:Bpro_0485 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31215"
FT                   /db_xref="GOA:A1TJS7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJS7"
FT                   /protein_id="ABM31215.1"
FT                   /translation="MIQTKSRLDVADNTGAKSVLCIKVLGGSKRRYASVGDIIKVSIKE
FT                   AAPRGRVKKGEVYSAVVVRTAKGIRRGDGSLVKFDGNAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   gene            670008..670328
FT                   /locus_tag="Aave_0612"
FT   CDS_pept        670008..670328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0612"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; SMART: KOW
FT                   (Kyrpides, Ouzounis, Woese) domain protein; KEGG:
FT                   pol:Bpro_0486 ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31216"
FT                   /db_xref="GOA:A1TJS8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJS8"
FT                   /protein_id="ABM31216.1"
FT                   /translation="MNKIRKGDEVIVLTGRDKGKRGTVSLRKDDSYLVIDGINLVKKHV
FT                   KPNPMKGTTGGIVEKAMPIHQSNVAIFNAATGKADRVGIKVQADGSRVRVFKSSGAEIK
FT                   AA"
FT   gene            670338..670877
FT                   /locus_tag="Aave_0613"
FT   CDS_pept        670338..670877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0613"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: rfr:Rfer_4231
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31217"
FT                   /db_xref="GOA:A1TJS9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJS9"
FT                   /protein_id="ABM31217.1"
FT                   /translation="MARLQQHYREKIVPELTKQFGYTSPMEVPRLTKITLNMGVSEAVS
FT                   DKKVMDNAVADLTKIAGQKPVVTKAKKAIAGFKIREGQAIGCMVTLRGVQMYEFLDRFV
FT                   TVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKSD
FT                   EEAKALLAGFRFPFKN"
FT   gene            670887..671192
FT                   /locus_tag="Aave_0614"
FT   CDS_pept        670887..671192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0614"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pol:Bpro_0488
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31218"
FT                   /db_xref="GOA:A1TJT0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJT0"
FT                   /protein_id="ABM31218.1"
FT                   /translation="MAKVALIQRELKREKLAAKYAAKYAELKAIASDAKRSDEEREAAR
FT                   LGLQKLPRNANPTRQRNRCEITGRPRGTFRQFGLARAKIRELAFAGDIPGVTKASW"
FT   gene            671213..671608
FT                   /locus_tag="Aave_0615"
FT   CDS_pept        671213..671608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0615"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pol:Bpro_0489
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31219"
FT                   /db_xref="GOA:A1TJT1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJT1"
FT                   /protein_id="ABM31219.1"
FT                   /translation="MSMSDPIADLLTRIRNAQMVSKATVSVPSSKVKIAIAQVLKDEGY
FT                   IDGFEVKSEGNKSELEISLKYYAGRPVIERIERVSRPGLRVYKGRDSIPQVMNGLGVAI
FT                   VTTPKGVMTDRKARATGVGGEVLCYVA"
FT   gene            671632..672165
FT                   /locus_tag="Aave_0616"
FT   CDS_pept        671632..672165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aave_0616"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: rfr:Rfer_4228
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Aave_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABM31220"
FT                   /db_xref="GOA:A1TJT2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1TJT2"
FT                   /protein_id="ABM31220.1"
FT                   /translation="MSRVGKMPVAIPNGVDVTITEEQISVKGSGGTLSVAQNRLVKIVN
FT                   KDGKLSFEPADESREANAMSGTIRQLVNNMVVGVSKGFEKKLNLIGVGYKAQASGAKLN
FT                   LAVGYSHPVNFDMPAGITVATPTPTEIVIKGADRQRVGQLAAEIRAVRPPEPYKGKGIR
FT