(data stored in ACNUC8465 zone)

EMBL: CP000518

ID   CP000518; SV 1; circular; genomic DNA; STD; PRO; 5737227 BP.
XX
AC   CP000518; AAQD01000000-AAQD01000039;
XX
PR   Project:PRJNA16081;
XX
DT   22-DEC-2006 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Mycobacterium sp. KMS, complete genome.
XX
KW   .
XX
OS   Mycobacterium sp. KMS
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; unclassified Mycobacterium.
XX
RN   [1]
RP   1-5737227
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Miller C.D.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Mycobacterium sp. KMS";
RL   Unpublished.
XX
RN   [2]
RP   1-5737227
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Kiss H., Brettin T., Bruce D., Han C., Tapia R., Gilna P., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Miller C.D.,
RA   Richardson P.;
RT   ;
RL   Submitted (18-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 7addb2b30eef9eb3235c09c5677e0354.
DR   BioSample; SAMN02598356.
DR   EnsemblGenomes-Gn; EBG00001125130.
DR   EnsemblGenomes-Gn; EBG00001125131.
DR   EnsemblGenomes-Gn; EBG00001125132.
DR   EnsemblGenomes-Gn; EBG00001125133.
DR   EnsemblGenomes-Gn; EBG00001125134.
DR   EnsemblGenomes-Gn; EBG00001125135.
DR   EnsemblGenomes-Gn; EBG00001125136.
DR   EnsemblGenomes-Gn; EBG00001125137.
DR   EnsemblGenomes-Gn; EBG00001125138.
DR   EnsemblGenomes-Gn; EBG00001125139.
DR   EnsemblGenomes-Gn; EBG00001125140.
DR   EnsemblGenomes-Gn; EBG00001125141.
DR   EnsemblGenomes-Gn; EBG00001125142.
DR   EnsemblGenomes-Gn; EBG00001125143.
DR   EnsemblGenomes-Gn; EBG00001125144.
DR   EnsemblGenomes-Gn; EBG00001125145.
DR   EnsemblGenomes-Gn; EBG00001125146.
DR   EnsemblGenomes-Gn; EBG00001125147.
DR   EnsemblGenomes-Gn; EBG00001125148.
DR   EnsemblGenomes-Gn; EBG00001125149.
DR   EnsemblGenomes-Gn; EBG00001125150.
DR   EnsemblGenomes-Gn; EBG00001125151.
DR   EnsemblGenomes-Gn; EBG00001125152.
DR   EnsemblGenomes-Gn; EBG00001125153.
DR   EnsemblGenomes-Gn; EBG00001125154.
DR   EnsemblGenomes-Gn; EBG00001125155.
DR   EnsemblGenomes-Gn; EBG00001125156.
DR   EnsemblGenomes-Gn; EBG00001125157.
DR   EnsemblGenomes-Gn; EBG00001125158.
DR   EnsemblGenomes-Gn; EBG00001125159.
DR   EnsemblGenomes-Gn; EBG00001125160.
DR   EnsemblGenomes-Gn; EBG00001125161.
DR   EnsemblGenomes-Gn; EBG00001125162.
DR   EnsemblGenomes-Gn; EBG00001125163.
DR   EnsemblGenomes-Gn; EBG00001125164.
DR   EnsemblGenomes-Gn; EBG00001125165.
DR   EnsemblGenomes-Gn; EBG00001125166.
DR   EnsemblGenomes-Gn; EBG00001125167.
DR   EnsemblGenomes-Gn; EBG00001125168.
DR   EnsemblGenomes-Gn; EBG00001125169.
DR   EnsemblGenomes-Gn; EBG00001125170.
DR   EnsemblGenomes-Gn; EBG00001125171.
DR   EnsemblGenomes-Gn; EBG00001125172.
DR   EnsemblGenomes-Gn; EBG00001125173.
DR   EnsemblGenomes-Gn; EBG00001125174.
DR   EnsemblGenomes-Gn; EBG00001125175.
DR   EnsemblGenomes-Gn; EBG00001125176.
DR   EnsemblGenomes-Gn; EBG00001125177.
DR   EnsemblGenomes-Gn; EBG00001125178.
DR   EnsemblGenomes-Gn; EBG00001125179.
DR   EnsemblGenomes-Gn; EBG00001125180.
DR   EnsemblGenomes-Gn; EBG00001125181.
DR   EnsemblGenomes-Gn; EBG00001125182.
DR   EnsemblGenomes-Gn; EBG00001125183.
DR   EnsemblGenomes-Gn; EBG00001125184.
DR   EnsemblGenomes-Gn; EBG00001125185.
DR   EnsemblGenomes-Gn; EBG00001125186.
DR   EnsemblGenomes-Gn; EBG00001125187.
DR   EnsemblGenomes-Gn; EBG00001125188.
DR   EnsemblGenomes-Gn; EBG00001125189.
DR   EnsemblGenomes-Gn; EBG00001125190.
DR   EnsemblGenomes-Gn; EBG00001125191.
DR   EnsemblGenomes-Gn; EBG00001125192.
DR   EnsemblGenomes-Gn; EBG00001125193.
DR   EnsemblGenomes-Gn; EBG00001125194.
DR   EnsemblGenomes-Gn; EBG00001125195.
DR   EnsemblGenomes-Gn; EBG00001125196.
DR   EnsemblGenomes-Gn; EBG00001125197.
DR   EnsemblGenomes-Gn; Mkms_R0001.
DR   EnsemblGenomes-Gn; Mkms_R0002.
DR   EnsemblGenomes-Gn; Mkms_R0003.
DR   EnsemblGenomes-Gn; Mkms_R0004.
DR   EnsemblGenomes-Gn; Mkms_R0005.
DR   EnsemblGenomes-Gn; Mkms_R0006.
DR   EnsemblGenomes-Gn; Mkms_R0007.
DR   EnsemblGenomes-Gn; Mkms_R0008.
DR   EnsemblGenomes-Gn; Mkms_R0009.
DR   EnsemblGenomes-Gn; Mkms_R0010.
DR   EnsemblGenomes-Gn; Mkms_R0011.
DR   EnsemblGenomes-Gn; Mkms_R0012.
DR   EnsemblGenomes-Gn; Mkms_R0013.
DR   EnsemblGenomes-Gn; Mkms_R0014.
DR   EnsemblGenomes-Gn; Mkms_R0015.
DR   EnsemblGenomes-Gn; Mkms_R0016.
DR   EnsemblGenomes-Gn; Mkms_R0017.
DR   EnsemblGenomes-Gn; Mkms_R0018.
DR   EnsemblGenomes-Gn; Mkms_R0019.
DR   EnsemblGenomes-Gn; Mkms_R0020.
DR   EnsemblGenomes-Gn; Mkms_R0021.
DR   EnsemblGenomes-Gn; Mkms_R0022.
DR   EnsemblGenomes-Gn; Mkms_R0023.
DR   EnsemblGenomes-Gn; Mkms_R0024.
DR   EnsemblGenomes-Gn; Mkms_R0025.
DR   EnsemblGenomes-Gn; Mkms_R0027.
DR   EnsemblGenomes-Gn; Mkms_R0028.
DR   EnsemblGenomes-Gn; Mkms_R0029.
DR   EnsemblGenomes-Gn; Mkms_R0030.
DR   EnsemblGenomes-Gn; Mkms_R0031.
DR   EnsemblGenomes-Gn; Mkms_R0032.
DR   EnsemblGenomes-Gn; Mkms_R0033.
DR   EnsemblGenomes-Gn; Mkms_R0034.
DR   EnsemblGenomes-Gn; Mkms_R0035.
DR   EnsemblGenomes-Gn; Mkms_R0036.
DR   EnsemblGenomes-Gn; Mkms_R0037.
DR   EnsemblGenomes-Gn; Mkms_R0038.
DR   EnsemblGenomes-Gn; Mkms_R0039.
DR   EnsemblGenomes-Gn; Mkms_R0040.
DR   EnsemblGenomes-Gn; Mkms_R0041.
DR   EnsemblGenomes-Gn; Mkms_R0042.
DR   EnsemblGenomes-Gn; Mkms_R0043.
DR   EnsemblGenomes-Gn; Mkms_R0045.
DR   EnsemblGenomes-Gn; Mkms_R0046.
DR   EnsemblGenomes-Gn; Mkms_R0047.
DR   EnsemblGenomes-Gn; Mkms_R0048.
DR   EnsemblGenomes-Gn; Mkms_R0049.
DR   EnsemblGenomes-Gn; Mkms_R0051.
DR   EnsemblGenomes-Gn; Mkms_R0052.
DR   EnsemblGenomes-Gn; Mkms_R0054.
DR   EnsemblGenomes-Gn; Mkms_R0055.
DR   EnsemblGenomes-Gn; Mkms_R0056.
DR   EnsemblGenomes-Gn; Mkms_R0057.
DR   EnsemblGenomes-Gn; Mkms_R0058.
DR   EnsemblGenomes-Gn; Mkms_R0060.
DR   EnsemblGenomes-Tr; EBT00001716398.
DR   EnsemblGenomes-Tr; EBT00001716399.
DR   EnsemblGenomes-Tr; EBT00001716400.
DR   EnsemblGenomes-Tr; EBT00001716401.
DR   EnsemblGenomes-Tr; EBT00001716402.
DR   EnsemblGenomes-Tr; EBT00001716403.
DR   EnsemblGenomes-Tr; EBT00001716404.
DR   EnsemblGenomes-Tr; EBT00001716405.
DR   EnsemblGenomes-Tr; EBT00001716406.
DR   EnsemblGenomes-Tr; EBT00001716407.
DR   EnsemblGenomes-Tr; EBT00001716408.
DR   EnsemblGenomes-Tr; EBT00001716409.
DR   EnsemblGenomes-Tr; EBT00001716410.
DR   EnsemblGenomes-Tr; EBT00001716411.
DR   EnsemblGenomes-Tr; EBT00001716412.
DR   EnsemblGenomes-Tr; EBT00001716413.
DR   EnsemblGenomes-Tr; EBT00001716414.
DR   EnsemblGenomes-Tr; EBT00001716415.
DR   EnsemblGenomes-Tr; EBT00001716416.
DR   EnsemblGenomes-Tr; EBT00001716417.
DR   EnsemblGenomes-Tr; EBT00001716418.
DR   EnsemblGenomes-Tr; EBT00001716419.
DR   EnsemblGenomes-Tr; EBT00001716420.
DR   EnsemblGenomes-Tr; EBT00001716421.
DR   EnsemblGenomes-Tr; EBT00001716422.
DR   EnsemblGenomes-Tr; EBT00001716423.
DR   EnsemblGenomes-Tr; EBT00001716424.
DR   EnsemblGenomes-Tr; EBT00001716425.
DR   EnsemblGenomes-Tr; EBT00001716426.
DR   EnsemblGenomes-Tr; EBT00001716427.
DR   EnsemblGenomes-Tr; EBT00001716428.
DR   EnsemblGenomes-Tr; EBT00001716429.
DR   EnsemblGenomes-Tr; EBT00001716430.
DR   EnsemblGenomes-Tr; EBT00001716431.
DR   EnsemblGenomes-Tr; EBT00001716432.
DR   EnsemblGenomes-Tr; EBT00001716433.
DR   EnsemblGenomes-Tr; EBT00001716434.
DR   EnsemblGenomes-Tr; EBT00001716435.
DR   EnsemblGenomes-Tr; EBT00001716436.
DR   EnsemblGenomes-Tr; EBT00001716437.
DR   EnsemblGenomes-Tr; EBT00001716438.
DR   EnsemblGenomes-Tr; EBT00001716439.
DR   EnsemblGenomes-Tr; EBT00001716440.
DR   EnsemblGenomes-Tr; EBT00001716441.
DR   EnsemblGenomes-Tr; EBT00001716442.
DR   EnsemblGenomes-Tr; EBT00001716443.
DR   EnsemblGenomes-Tr; EBT00001716444.
DR   EnsemblGenomes-Tr; EBT00001716445.
DR   EnsemblGenomes-Tr; EBT00001716446.
DR   EnsemblGenomes-Tr; EBT00001716447.
DR   EnsemblGenomes-Tr; EBT00001716448.
DR   EnsemblGenomes-Tr; EBT00001716449.
DR   EnsemblGenomes-Tr; EBT00001716450.
DR   EnsemblGenomes-Tr; EBT00001716451.
DR   EnsemblGenomes-Tr; EBT00001716452.
DR   EnsemblGenomes-Tr; EBT00001716453.
DR   EnsemblGenomes-Tr; EBT00001716454.
DR   EnsemblGenomes-Tr; EBT00001716455.
DR   EnsemblGenomes-Tr; EBT00001716456.
DR   EnsemblGenomes-Tr; EBT00001716457.
DR   EnsemblGenomes-Tr; EBT00001716458.
DR   EnsemblGenomes-Tr; EBT00001716459.
DR   EnsemblGenomes-Tr; EBT00001716460.
DR   EnsemblGenomes-Tr; EBT00001716461.
DR   EnsemblGenomes-Tr; EBT00001716462.
DR   EnsemblGenomes-Tr; EBT00001716463.
DR   EnsemblGenomes-Tr; EBT00001716464.
DR   EnsemblGenomes-Tr; EBT00001716465.
DR   EnsemblGenomes-Tr; Mkms_R0001-1.
DR   EnsemblGenomes-Tr; Mkms_R0002-1.
DR   EnsemblGenomes-Tr; Mkms_R0003-1.
DR   EnsemblGenomes-Tr; Mkms_R0004-1.
DR   EnsemblGenomes-Tr; Mkms_R0005-1.
DR   EnsemblGenomes-Tr; Mkms_R0006-1.
DR   EnsemblGenomes-Tr; Mkms_R0007-1.
DR   EnsemblGenomes-Tr; Mkms_R0008-1.
DR   EnsemblGenomes-Tr; Mkms_R0009-1.
DR   EnsemblGenomes-Tr; Mkms_R0010-1.
DR   EnsemblGenomes-Tr; Mkms_R0011-1.
DR   EnsemblGenomes-Tr; Mkms_R0012-1.
DR   EnsemblGenomes-Tr; Mkms_R0013-1.
DR   EnsemblGenomes-Tr; Mkms_R0014-1.
DR   EnsemblGenomes-Tr; Mkms_R0015-1.
DR   EnsemblGenomes-Tr; Mkms_R0016-1.
DR   EnsemblGenomes-Tr; Mkms_R0017-1.
DR   EnsemblGenomes-Tr; Mkms_R0018-1.
DR   EnsemblGenomes-Tr; Mkms_R0019-1.
DR   EnsemblGenomes-Tr; Mkms_R0020-1.
DR   EnsemblGenomes-Tr; Mkms_R0021-1.
DR   EnsemblGenomes-Tr; Mkms_R0022-1.
DR   EnsemblGenomes-Tr; Mkms_R0023-1.
DR   EnsemblGenomes-Tr; Mkms_R0024-1.
DR   EnsemblGenomes-Tr; Mkms_R0025-1.
DR   EnsemblGenomes-Tr; Mkms_R0027-1.
DR   EnsemblGenomes-Tr; Mkms_R0028-1.
DR   EnsemblGenomes-Tr; Mkms_R0029-1.
DR   EnsemblGenomes-Tr; Mkms_R0030-1.
DR   EnsemblGenomes-Tr; Mkms_R0031-1.
DR   EnsemblGenomes-Tr; Mkms_R0032-1.
DR   EnsemblGenomes-Tr; Mkms_R0033-1.
DR   EnsemblGenomes-Tr; Mkms_R0034-1.
DR   EnsemblGenomes-Tr; Mkms_R0035-1.
DR   EnsemblGenomes-Tr; Mkms_R0036-1.
DR   EnsemblGenomes-Tr; Mkms_R0037-1.
DR   EnsemblGenomes-Tr; Mkms_R0038-1.
DR   EnsemblGenomes-Tr; Mkms_R0039-1.
DR   EnsemblGenomes-Tr; Mkms_R0040-1.
DR   EnsemblGenomes-Tr; Mkms_R0041-1.
DR   EnsemblGenomes-Tr; Mkms_R0042-1.
DR   EnsemblGenomes-Tr; Mkms_R0043-1.
DR   EnsemblGenomes-Tr; Mkms_R0045-1.
DR   EnsemblGenomes-Tr; Mkms_R0046-1.
DR   EnsemblGenomes-Tr; Mkms_R0047-1.
DR   EnsemblGenomes-Tr; Mkms_R0048-1.
DR   EnsemblGenomes-Tr; Mkms_R0049-1.
DR   EnsemblGenomes-Tr; Mkms_R0051-1.
DR   EnsemblGenomes-Tr; Mkms_R0052-1.
DR   EnsemblGenomes-Tr; Mkms_R0054-1.
DR   EnsemblGenomes-Tr; Mkms_R0055-1.
DR   EnsemblGenomes-Tr; Mkms_R0056-1.
DR   EnsemblGenomes-Tr; Mkms_R0057-1.
DR   EnsemblGenomes-Tr; Mkms_R0058-1.
DR   EnsemblGenomes-Tr; Mkms_R0060-1.
DR   EuropePMC; PMC1974809; 17504473.
DR   EuropePMC; PMC3271072; 22319448.
DR   EuropePMC; PMC6536560; 31134391.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000518.
DR   SILVA-SSU; CP000518.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000379
CC   Source DNA and bacteria available from Charles Miller
CC   (cdmiller@biology.usu.edu)
CC   Contacts: Charles Miller (cdmiller@biology.usu.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5737227
FT                   /organism="Mycobacterium sp. KMS"
FT                   /strain="KMS"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:189918"
FT   gene            complement(98..1090)
FT                   /locus_tag="Mkms_0001"
FT   CDS_pept        complement(98..1090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0001"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: mmc:Mmcs_5406 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89220"
FT                   /db_xref="GOA:A1U8R2"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8R2"
FT                   /protein_id="ABL89220.1"
FT                   /translation="MTQPTRKRSGLGRGLASLIPTGPTEDGSQAALGGPRMGNAAADVV
FT                   IGGGPVAAPPAPELGAVYREIDPSAIEPNPRQPRQVFDGEALAELVHSIREFGLMQPIV
FT                   VRALEPGDAGPRYQLVMGERRWRAAQEAGLATIPAIVRETADDSMLRDALLENIHRVQL
FT                   NPLEEAAAYQQLLDEFGVTHDELAARIGRSRPVITNMIRLLRLPIAVQRRVAAGVLSAG
FT                   HARALLALEGGPERQEELAARIVAEGLSVRATEEAVTLANHSGPAAPPAPRRKPIQMPG
FT                   LQDVAEQLSTAFDTRVTVSLGKRKGKIVVEFGSVDDLQRIVELMNSTKP"
FT   sig_peptide     complement(998..1090)
FT                   /locus_tag="Mkms_0001"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.757) with cleavage site probability 0.355 at
FT                   residue 31"
FT   gene            complement(1118..2125)
FT                   /locus_tag="Mkms_0002"
FT   CDS_pept        complement(1118..2125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0002"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   mmc:Mmcs_5407 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89221"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8R3"
FT                   /protein_id="ABL89221.1"
FT                   /translation="MSMAEGPEGSRGARGAARVSRETWPVSPKDAPAVAGQDWQNDAVI
FT                   DTPIGAEAERAVRLLHSASRGGLPRPARQRVFTIANQKGGVGKTTTAVNIAAALALQGL
FT                   KVLVIDLDPQGNASTALGIEHRPGTASSYEVLIGDIPVQEALQRSPHSERLYCVPATID
FT                   LAGAEIELVSMVAREGRLRTALAELKQYDFDYVFIDCPPSLGLLTINALVAAPEVLIPI
FT                   QCEYYALEGVGQLLRNIEMVKSHLNPELTVSTVILTMYDGRTRLADQVAQDVRAHFGDK
FT                   VLRTVIPRSVKVSEAPGYGMTILDYDPGSRGAMSYLDASRELAERGAPHDGASR"
FT   gene            complement(2122..2799)
FT                   /locus_tag="Mkms_0003"
FT   CDS_pept        complement(2122..2799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0003"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: mmc:Mmcs_5408
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89222"
FT                   /db_xref="GOA:A1U8R4"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8R4"
FT                   /protein_id="ABL89222.1"
FT                   /translation="MKHVAPPPTAEAVFGDRLPLAQRYAEFLATAGVERGLIGPRETDR
FT                   IWDRHILNSAALGESVESGDRIADIGSGAGLPGIPLALARPDVHVTLIEPMQRRCEFLT
FT                   EVVDALGVAVIVVRGRAENPAVRREVGEMDVVTSRAVGSLDKLATWSMGILREGGRMLA
FT                   LKGARAEAEIEENRRVLARAGAVDVRVLRCGADYLNPPATVVEARRATPSNGRGRPGRS
FT                   SRR"
FT   gene            complement(2860..3405)
FT                   /locus_tag="Mkms_0004"
FT   CDS_pept        complement(2860..3405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0004"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; KEGG: mmc:Mmcs_5409 single-stranded nucleic
FT                   acid binding R3H"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89223"
FT                   /db_xref="GOA:A1U8R5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8R5"
FT                   /protein_id="ABL89223.1"
FT                   /translation="MTDADTTERTEDVETRDAEEITAPEDDLEDRLVAEGEIAGDYLEE
FT                   LLDLLDFDGDIDLDVEGDRAVVSIDGGTDLNKLVGRKGEVLDALQELTRLAVHQKTGER
FT                   SRLMLDIARWRRRRRDELAALGDKVARRVLETGEREELAPMTPFERKIVHDAVAAVAGV
FT                   HSESEGVEPSRRVVVLAD"
FT   gene            complement(3441..4544)
FT                   /locus_tag="Mkms_0005"
FT   CDS_pept        complement(3441..4544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0005"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   mmc:Mmcs_5410 60 kDa inner membrane insertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89224"
FT                   /db_xref="GOA:A1U8R6"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8R6"
FT                   /protein_id="ABL89224.1"
FT                   /translation="MFNWFSLDIIYYPVSAIMWVWYKAFAFLLGPDNFFAWALSVMFLV
FT                   FTLRAILYKPFVRQIRTTRQMQELQPQIKALQKKYGKDRQRMALEMQKLQKEHGFNPIL
FT                   GCLPMLAQIPVFLGLYHVLMSFNRTQTGIGRLGLSVEENRSLPNYLFSATDVGHFLDAN
FT                   LFGAPLGATMIQQHGLEAFTEFNRVAVVVVGVPIMLLAGIATHFNSRASVARQTPEAAA
FT                   NPQTALMNKLALYVFPLGVVVGGPFLPLAVIMYWLANNIWTYGQQHYVFGKIEKEEEAK
FT                   KVEALERRAANAPAPGAKPKRTRKAQEAADAGADAVDGSVTDAAGADEAAGGPAAKASG
FT                   NGAAKPSGGQAVSRTPKPGARPKKRKR"
FT   gene            complement(4537..4863)
FT                   /locus_tag="Mkms_0006"
FT   CDS_pept        complement(4537..4863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0006"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   mmc:Mmcs_5411 protein of unknown function DUF37"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89225"
FT                   /db_xref="GOA:A1U8R7"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8R7"
FT                   /protein_id="ABL89225.1"
FT                   /translation="MNAPRRVSISAAKAVIYVIQLYRHMISPLRYPSCRFTPTCSQYAV
FT                   DALTEYGLVRGGWLSLVRLAKCGPWHRGGWDPIPERPDAASAPPEDRSGADFTADPVRS
FT                   KSRV"
FT   gene            complement(4860..5216)
FT                   /locus_tag="Mkms_0007"
FT   CDS_pept        complement(4860..5216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0007"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: mmc:Mmcs_5412 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89226"
FT                   /db_xref="GOA:A1U8R8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8R8"
FT                   /protein_id="ABL89226.1"
FT                   /translation="MLPARYRMTRSTEFSTTVSKGVRSAQPDLVLHMANVLDDPSGPRV
FT                   GLVVAKSVGNAVVRHRVSRRLRHSVHPMLDELQPGHRLVIRALPGAASATSARLHQELS
FT                   AALRRARPRVEASA"
FT   gene            complement(5238..5381)
FT                   /locus_tag="Mkms_0008"
FT   CDS_pept        complement(5238..5381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0008"
FT                   /product="ribosomal protein L34"
FT                   /note="PFAM: ribosomal protein L34; KEGG: mmc:Mmcs_5413
FT                   ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89227"
FT                   /db_xref="GOA:A1U8R9"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8R9"
FT                   /protein_id="ABL89227.1"
FT                   /translation="MAKGKRTFQPNNRRRARVHGFRLRMRTRAGRAIVTGRRRKGRRSL
FT                   TA"
FT   gene            5935..7422
FT                   /locus_tag="Mkms_0009"
FT   CDS_pept        5935..7422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0009"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: mmc:Mmcs_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator, DnaA C-terminal domain; Chromosomal replication
FT                   initiator, DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89228"
FT                   /db_xref="GOA:A1U8S0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8S0"
FT                   /protein_id="ABL89228.1"
FT                   /translation="MTADPDPPFVAVWNTVVAELNGDPAATGPRNGDGALPTLTPQQRA
FT                   WLKLVKPLVITEGFALLSVPTPFVQNEIERHLREPIITALSRHLGQRVELGVRIATPSP
FT                   EDDDPPPSPVIADIDEVDEDTEARVSAEETWPRYFSRPPETPAAEDPNAVSLNRRYTFD
FT                   TFVIGASNRFAHAATLAIAEAPARAYNPLFIWGESGLGKTHLLHAAGNYAQRLFPGMRV
FT                   KYVSTEEFTNDFINSLRDDRKASFKRSYRDIDVLLVDDIQFIEGKEGIQEEFFHTFNTL
FT                   HNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIAILRKKAQMDRLD
FT                   VPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKSLAEIVLRDLISDASTMQI
FT                   STAAIMAATAEYFETTIEELRGPGKTRALAQSRQIAMYLCRELTDLSLPKIGQAFGRDH
FT                   TTVMYAEKKIRGEMAERREVFDHVKELTTRIRQRAKR"
FT   gene            7984..9180
FT                   /locus_tag="Mkms_0010"
FT   CDS_pept        7984..9180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0010"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: mmc:Mmcs_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III, beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89229"
FT                   /db_xref="GOA:A1U8S1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S1"
FT                   /protein_id="ABL89229.1"
FT                   /translation="MDVVPTTAGHTDLKFRLVREDFADAVAWVARNLPTRPTVPVLAGV
FT                   LLTGDDDGLTISGFDYEVSAEVRVVAEIASPGSVLVSGRLLSDITKALPAKPVDVSVEG
FT                   TRVSLTCGSARFSLPTMAVEDYPALPTLPDETGVIGADLFAEAIGQVAVAAGRDDTLPM
FT                   LTGIRVEITGESVVLAATDRFRLAVRELTWSTSSPDVEAAVLVPAKTLAEAAKAGTDGT
FT                   DVHLALGAGSAVGKEGLLGIRSEGKRSTTRLLDAEFPKFRQLLPSEHTAVATIGVAELT
FT                   EAIKRVALVADRGAQVRMEFADDVLRLSAGADDVGRAEEDLAVAFSGEPLTIAFNPTYL
FT                   TDGLGSLHSERVTFGFTTPSRPAVLRPAGDEDTGGGAGPFPALQTDYVYLLMPVRLPG"
FT   gene            9210..10103
FT                   /locus_tag="Mkms_0011"
FT   CDS_pept        9210..10103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0011"
FT                   /product="6-phosphogluconate dehydrogenase
FT                   (decarboxylating)"
FT                   /EC_number="1.1.1.44"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   domain protein; 6-phosphogluconate dehydrogenase,
FT                   NAD-binding; KEGG: mmc:Mmcs_0003 6-phosphogluconate
FT                   dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89230"
FT                   /db_xref="GOA:A1U8S2"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S2"
FT                   /protein_id="ABL89230.1"
FT                   /translation="MQLGLVGLGKMGFNMRERLREGGHEVVGFDPRPEVTDVPSLAALA
FT                   DALAPPRVVWVMVPSGPVTHDTIVSLAEVLGEGDLVIDGGNSRFTEDAPHAELLKAKGI
FT                   GFIDAGVSGGVWGLAEGYGLMVGGDDADIERVMPIFDTLRPPGDRADGFVHAGPVGAGH
FT                   FAKMVHNGVEYALMTAYGEGYELLAAEELIRDPQAVYQAWTNGTVVRSWLQQLLAKALR
FT                   EDPGLAEISGYTEDSGEGRWTVEEAIRLRVPVPSIAASLFARFESRQEDSPTMKAVSAL
FT                   RNQFGGHAVQRISKSG"
FT   gene            10156..11298
FT                   /locus_tag="Mkms_0012"
FT   CDS_pept        10156..11298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0012"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: mmc:Mmcs_0004 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89231"
FT                   /db_xref="GOA:A1U8S3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8S3"
FT                   /protein_id="ABL89231.1"
FT                   /translation="MFVRHLTLTDFRSWARADLELEPGRTVFVGPNGFGKTNLVEALWY
FT                   SATLGSHRVASDAPLIRVGAPRAVVSTIVVNEGRELAVDLEITTGRANKARLNRSPVRS
FT                   PREVLGVLRAVLFAPEDLALVRGDPGERRRYLDELATTRRPSIAGVRADYDRVIRQRTA
FT                   LLKSAAGARYRGDRSVLETLDVWDGHLAAHGALLMAARADLVHHLAPEVEKAYQLLAPG
FT                   SRPAAIRYRTSIDAEDDVSAEYYEAALLDAMTRRRDAELERGVCLVGPHRDDLELRLGD
FT                   QMAKGYASHGESWSMALSLRLAAYELLRTDGSDPVLLLDDVFAELDAARRRALAEVAAS
FT                   AEQVLVTAAVAEDIPADWDARRIMIRMQDDDDGRVSMVES"
FT   gene            11295..11867
FT                   /locus_tag="Mkms_0013"
FT   CDS_pept        11295..11867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0013"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   mmc:Mmcs_0005 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89232"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR023007"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S4"
FT                   /protein_id="ABL89232.1"
FT                   /translation="MSDDDRDGDGDPIGPPAHLSELKGMDLVRRTLEEARGAARSQGKD
FT                   VGRGRTSPARRVAGTGRRRSWSGPGPDSRDPQTLGAATRDLARTRGWSPKVAEGAVFGQ
FT                   WSTVVGEQIAEHATPSSLREGVLTVAAESTAWATQLRMVQSQLLAKIAAAVGDGVVTSL
FT                   KITGPTAPSWRKGRYHIAGRGPRDTYG"
FT   gene            12088..14115
FT                   /locus_tag="Mkms_0014"
FT   CDS_pept        12088..14115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0014"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mmc:Mmcs_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89233"
FT                   /db_xref="GOA:A1U8S5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S5"
FT                   /protein_id="ABL89233.1"
FT                   /translation="MAAQKKNAPAEYGADSIKVLEGLEAVRKRPGMYIGSTGERGLHHL
FT                   VWEVVDNAVDEAMAGFATKVEVRILENGGVQVTDDGRGIPVAMHSTGIPTVDVVMTVLH
FT                   AGGKFEEGAYQVSGGLHGVGVSVVNALSTRLEADIRTDGYEWFQTYDRSVPGTLKQGEK
FT                   TKKTGTTIRFWADPDIFETTSYDFETIARRLQEMAFLNKGLTIELTDERVTAEEVVDDV
FT                   VSDHAEAPKSAEEKSAEAAKPQKVKHRVFHYPGGLVDFVKHINRTKTPIQPSVIDFDGK
FT                   GEGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRTALTSVVNKYAKDKKLLKD
FT                   KDPNLTGDDIREGLAAVISVKVSQPQFEGQTKTKLGNTEVKSFVQKICNEQLSHWFEAN
FT                   PAEAKTVVNKAVSSAQARLAARKARELVRRKSATDIGGLPGKLADCRSTDPSKSELYVV
FT                   EGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEF
FT                   DISKLRYHKIVLMADADVDGQHISTLLLTLLFRFMKPLIENGHVFLAQPPLYKLKWQRS
FT                   TPEFAYSDRERDGLLEAGRAAGKRINADDGIQRYKGLGEMDAKELWETTMDPSVRVLRQ
FT                   ITLDDAAAADELFSILMGEDVEARRSFITRNAKDVRFLDV"
FT   gene            14149..17922
FT                   /locus_tag="Mkms_0015"
FT   CDS_pept        14149..17922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0015"
FT                   /product="DNA gyrase subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: mmc:Mmcs_0007 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV,
FT                   subunit A; DNA gyrase C-terminal repeat, beta-propeller;
FT                   SMART: Hedgehog/intein hint domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89234"
FT                   /db_xref="GOA:A1U8S6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006142"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S6"
FT                   /protein_id="ABL89234.1"
FT                   /translation="MTDTTLPPGDEAGDRIEPVDIQQEMQRSYIDYAMSVIVGRALPEV
FT                   RDGLKPVHRRVLYAMFDSGFRPDRGHAKSARSVAETMGNYHPHGDSSIYDTLVRMAQPW
FT                   SLRYPLVDGQGNFGSPGNDPPAAMRYCVTGDALVRLPLGQSVRIDGVVPGAKPNSDNPI
FT                   DLKVVDRHGDPVAADRLFHSGEHQTYKVTTTEGYTVTGTENHPLLCLVDVGGVPTLLWK
FT                   LVEEIRPGDTVVLQRSQPMEFGPADWQETLEALLAGAFISEGFISEKRAGFNNLDRDFF
FT                   NMVVAAYDAVVGGRRYVSSRTIASGSLLHELDIHNLESLRRSRLGVAVGQRSADKFVPE
FT                   WIWQSPAAVKRVFLQALFEGDGSCSRLPRNTIQVSYSTRSERLAADVQQMLLEFGIVSR
FT                   RYRHAVGEYKVALTNRAQAELFARQIGFGGAKQVKLLEILSALPEEAAGLDRDFVPGLA
FT                   RFIRQHSGGRWADKEWLRKHNVDRISRWQRNGAEILGRIADPEVRAVATDLTDGRFYYA
FT                   TVASVADAGVQPVYSLRVDTEDHAFITNGFVSHNTEARLTPLAMEMLREIDEETVDFIP
FT                   NYDGRVQEPTVLPSRFPNLLANGSGGIAVGMATNIPPHNLRELADAVYWCLENFEADEE
FT                   TTLAAVMERVKGPDFPTHGLIVGSQGIEDTYKTGRGSVKMRGVVEIEEDSRGRTGIVIT
FT                   ELPYQVNHDNFITSIAEQVRDGKLAGISNIEDQSSDRVGLRIVVELKRDAVAKVVLNNL
FT                   YKHTQLQTSFGANMLSIVDGVPRTLRLDQMIRYYVEHQLDVIVRRTRYRLRKANERAHI
FT                   LRGLVKALDALDEVIALIRASQTVDIARAGLIELLDIDEIQAQAILDMQLRRLAALERQ
FT                   RIVDDLAKIEAEIADLEDILAKPERQRAIVRDELKEIADKYGDDRRTRIVPADGEVSDE
FT                   DLIAREDVVVTITETGYAKRTKTDLYRSQKRGGKGVQGAGLKQDDIVNHFFVCSTHDWI
FT                   LFFTTQGRVYRAKAYELPEASRTARGQHVANLLAFQPNERIAQVIQIKSYEDAPYLVLA
FT                   TRNGLVKKSRLTDFDSNRSGGIVAVNLRDGDELVGAVLCSSEDDLLLVSAKGQSIRFSA
FT                   TDEALRPMGRATSGVQGMRFNADDELLSLNVVRPDTYLLVATSGGYAKRTSIEEYTAQG
FT                   RGGKGILTIQYDRRRGNLVGALIVDDDTELYAITSGGGVIRTAARQVRKAGRQTKGVRL
FT                   MNLGEGDTLIAIARNAEAGDSTDEVNTDPDAV"
FT   gene            17940..18812
FT                   /locus_tag="Mkms_0016"
FT   CDS_pept        17940..18812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89235"
FT                   /db_xref="GOA:A1U8S7"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S7"
FT                   /protein_id="ABL89235.1"
FT                   /translation="MSAPNEPGLPRGGDGPGGGNGSPAPGAGRDNGSPANAAGRVGTEG
FT                   GDVPPWQRGRPNRPPQSRAQDAPTRQEPSRGGSPTHAPGAEARNTSRFPVSGSAPTEET
FT                   KAPAAPVRTPERTEAPRPEAYASELPDLSGPVPRPPQRKPATDRPATEAPARPAARTQV
FT                   GQRPARGPVRASMQIRRVDPWSALKVSLVLSVALFFVWMIAVAFLYLVLGGMGVWSKLN
FT                   SNVGDLLTSASGSSGGELVSSSTIFGGAALVGLVNIVILTAMATAGAFIYNLTTDLVGG
FT                   VEVTLADRD"
FT   gene            18907..18980
FT                   /locus_tag="Mkms_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            18907..18980
FT                   /locus_tag="Mkms_R0001"
FT                   /product="tRNA-Ile"
FT   gene            19142..19214
FT                   /locus_tag="Mkms_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            19142..19214
FT                   /locus_tag="Mkms_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(19239..19652)
FT                   /locus_tag="Mkms_0017"
FT   CDS_pept        complement(19239..19652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89236"
FT                   /db_xref="GOA:A1U8S8"
FT                   /db_xref="InterPro:IPR024245"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S8"
FT                   /protein_id="ABL89236.1"
FT                   /translation="MTLTPLTPRQRLARGLKYTAVGPVDVTRGVLGVGVDSAQATAAEL
FT                   RRRYQSGQLRRELAAARETLVAELVAAQEAVSGLPEALTGARARNRRRKRLLMVGVGAG
FT                   VLAVGAVTFSIVRRSMKPEPSPLPPSVEVTPKP"
FT   gene            19750..20277
FT                   /locus_tag="Mkms_0018"
FT   CDS_pept        19750..20277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0018"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase,
FT                   cyclophilin type; KEGG: mmc:Mmcs_0010 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89237"
FT                   /db_xref="GOA:A1U8S9"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8S9"
FT                   /protein_id="ABL89237.1"
FT                   /translation="MTSPIQTATATLHTNRGDIKIALFGNHAPKTVSNFVGLAQGTKDY
FT                   KGENASGSTSGPFYDGAVFHRVIDGFMIQGGDPTGTGRGGPGYQFADEFHPELQFDKPY
FT                   LLAMANAGPGTNGSQFFITVGKTPHLNRRHTIFGEVVDPESQKVVDAIATTATDRNDRP
FT                   TDPVVIESVTIS"
FT   gene            complement(20291..20710)
FT                   /locus_tag="Mkms_0019"
FT   CDS_pept        complement(20291..20710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89238"
FT                   /db_xref="GOA:A1U8T0"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T0"
FT                   /protein_id="ABL89238.1"
FT                   /translation="MQQTEWSPPAAGIAGCGFAGLLMAIAAVTVVTDPPGRLLAGIAAV
FT                   GLITFAIMSWRARPKLAITPEGVAVRGWWHTRVLRQADIKIVRITEFRRLARKMRLLEI
FT                   DTADDRLHVFTRWDLGTDPVDVLDALTAAGYTGTQ"
FT   sig_peptide     complement(20630..20710)
FT                   /locus_tag="Mkms_0019"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.422 at
FT                   residue 27"
FT   gene            complement(20866..21150)
FT                   /locus_tag="Mkms_0020"
FT   CDS_pept        complement(20866..21150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0020"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   mmc:Mmcs_0012 protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89239"
FT                   /db_xref="GOA:A1U8T1"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U8T1"
FT                   /protein_id="ABL89239.1"
FT                   /translation="MPKSKVRKKNDFTISPVSRTPVKVKAGPSSVWFVALFVGLMLIGL
FT                   IWLLVFQLAATNPVDAPGMLQWMADLGPWNYAIAFAFMITGLLLTMRWR"
FT   sig_peptide     complement(20965..21150)
FT                   /locus_tag="Mkms_0020"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.719 at
FT                   residue 62"
FT   gene            21216..22052
FT                   /locus_tag="Mkms_0021"
FT   CDS_pept        21216..22052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0021"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   mmc:Mmcs_0013 protein of unknown function DUF881"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89240"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T2"
FT                   /protein_id="ABL89240.1"
FT                   /translation="MVQMPPEPNAGPDRETPPTTSAAPAAPARAGAGRRSGWRFGVPLV
FT                   CLAAGLLLAATHGVSGGDEIRRSDAPRLVDLVREAQQSVDRLGAERDTLSAQVDGHHGG
FT                   SPGTDAALSAITNRSAALAAEAGLNPVKGPGLVVTLNDAQRDAEGRFPRDASPDDLVVH
FT                   QQDIQAVLNALWSAGAEGVQMQDQRIIATSAPRCVGNTLLLNGRTYSPPYVITAIGDAG
FT                   AMQAALSASPLVTLYKQYVVRFGLGYTEEPRAEVELVGHTEPVRMKHAQPIGPVGY"
FT   gene            22076..22750
FT                   /locus_tag="Mkms_0022"
FT   CDS_pept        22076..22750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0022"
FT                   /product="anthranilate synthase, component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mmc:Mmcs_0014 glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89241"
FT                   /db_xref="GOA:A1U8T3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T3"
FT                   /protein_id="ABL89241.1"
FT                   /translation="MQFLVVDNYDSFVFNLVQYLGQLGVDVTVWRNDDSRLSTDADIAK
FT                   AAEDFDGVLLSPGPGTPERAGASIPLVHACAAAGTPLLGVCLGHQAIGVAFGGTVDRAP
FT                   ELLHGKTSIVHHTNRGVLKGLPDPFTATRYHSLTILPETMPDELEVTARTPGGVIMGVR
FT                   HVDLPIHGVQFHPESILTEGGHRMLANWLGYCGSAPDEALVRRLEDEVASTVAAATTRS
FT                   SA"
FT   gene            complement(22728..24602)
FT                   /locus_tag="Mkms_0023"
FT   CDS_pept        complement(22728..24602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0023"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; PASTA domain containing
FT                   protein; SMART: tyrosine protein kinase; serine/threonine
FT                   protein kinase; KEGG: mmc:Mmcs_0015 serine/threonine
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89242"
FT                   /db_xref="GOA:A1U8T4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T4"
FT                   /protein_id="ABL89242.1"
FT                   /translation="MTTPQHLSDRYELGEILGFGGMSEVHLARDNRLHRDVAIKVLRAD
FT                   LARDPSFYLRFRREAQNAAALNHPAIVAVYDTGEAETPAGPLPYIVMEYVDGVTLRDIV
FT                   HSEGPMPPKRALEVIADACQALNFSHQHGIIHRDVKPANIMISKTGAVKVMDFGIARAL
FT                   ADSSSVTQTAAVIGTAQYLSPEQARGEKVDARSDVYSLGCVLYEILTGEPPFVGDSPVA
FT                   VAYQHVREDPVPPSQRHEGVSRDLDAVVLKALAKNPDNRYQTAAELRSDLVRVHSGEPP
FT                   EAPKVFTDAERTSMLSAAPHPGRTEPMTHMPRPEPRLVERNRGGSIGRWIAAVAVLAVL
FT                   TVVVAVAINTYGGETRAVQVPDVRGEVSAEAIAQLQNAGFTVRTQNEPNSEVAPDHVIS
FT                   TSPEANTEADAGEEITLNVSTGPEQREVPDVKSLTYAEAVRKLTDAGFGRFRQQASPST
FT                   PELKDRVMATNPPANQTSAITNEVTIIIGSGPQTRAVPEVVGQTVESAQQILTASGFRN
FT                   SVPAEVDSTEPAGQVLGTSPTAGENVPVDTLIQLQVSRGNQFVMPDLTGQFWTDAEPRL
FT                   RALGWTGVLDKGGDVQNSGQRTNAVVRQTPPPGTGVNFDSRITLNFAS"
FT   gene            complement(24599..25930)
FT                   /locus_tag="Mkms_0024"
FT   CDS_pept        complement(24599..25930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0024"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mmc:Mmcs_0016 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89243"
FT                   /db_xref="GOA:A1U8T5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T5"
FT                   /protein_id="ABL89243.1"
FT                   /translation="MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDSRLGRRVAIKVLK
FT                   AEYSTDPEFVERFRAEARTVAMLNHPGIASVYDYGETDMDGEGRTAYLVMELVNGEPLN
FT                   SVLKRTGRLSLRHALDMLEQTGRALQVAHTAGLVHRDVKPGNILITPTGQVKLTDFGIA
FT                   KAVDAAPVTQTGMVMGTAQYIAPEQALGHDATAASDVYALGVVGYESVSGKRPFTGDGA
FT                   LTVAMKHIKETPPPLPADLPPNVRELIEITLVKNPGMRYRSGGPFADAVAAVRSGRRPP
FT                   RPNQAPSIGRATPAAVPSAAQARAAADLTGRAPVTAARARPTGAIHRPPPPRRTFSSGQ
FT                   RALLWAAGVLGALAIVIAILIVLNAQDRKDRQLPPPTVTNTITETTPYQSPAAMPEWMP
FT                   DWTSSAVIGHGGDTSGAVRPDAVAASAHLRALPAPAQTWLRTQT"
FT   gene            complement(25962..27437)
FT                   /locus_tag="Mkms_0025"
FT   CDS_pept        complement(25962..27437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0025"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   KEGG: mmc:Mmcs_0017 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89244"
FT                   /db_xref="GOA:A1U8T6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T6"
FT                   /protein_id="ABL89244.1"
FT                   /translation="MNTSLRRIAVTIMVLIVLLLGNATVTQVFTADGLRTDPRNQRVLL
FT                   DEYSRQRGQITAGGQLLAYSVSTPGRFRFLRVYPNAQAYAPVTGFYSLTYSSTGLERAE
FT                   DTILNGSDERLFGRRLADFFTGRDPRGGNVVTTINPRVQQAAWEAMEQGCNGPCKGSVV
FT                   ALEPSTGKILAMVSAPSYDPNLLATHDVEEQTAAWQQLRDNPDNPLVNRAISETYPPGS
FT                   TFKVITTAAALQNGATPDTQLTAAPRIPLPNSSVTLENFGGSACGGGPTAPLREAFARS
FT                   CNTAFVELGTDTGTEALKNTASAFGLDTPPAPIPLQVAESTVGPIGDAAALGMSSIGQR
FT                   DVALTPLQNAMVAATVANEGVTMRPYLVDSLRGPDLANITTTEPVEERRAVTPEVAATL
FT                   TDLMVGAEQQTQQKGAIAGVQIASKTGTAEHGTDPRNTPPHAWYIAFAPAQAPKVAVAV
FT                   LVENGGNRLSATGGQVAAPIGRATIAAALREGS"
FT   sig_peptide     complement(27345..27437)
FT                   /locus_tag="Mkms_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.797 at
FT                   residue 31"
FT   gene            complement(27434..28846)
FT                   /locus_tag="Mkms_0026"
FT   CDS_pept        complement(27434..28846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0026"
FT                   /product="cell elongation-specific peptidoglycan
FT                   biosynthesis regulator RodA"
FT                   /note="PFAM: cell cycle protein; KEGG: mmc:Mmcs_0018 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89245"
FT                   /db_xref="GOA:A1U8T7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T7"
FT                   /protein_id="ABL89245.1"
FT                   /translation="MTTQPQSPVTVTPPLPNRRNAELLLLAFAAVITTVALLMVEANQE
FT                   QGISWDLAQYAAGYLALFAGAHLAVRRYAPYADPLLLPVVALLNGLGLVMIHRLDLAQG
FT                   ELTGRGLGGTANQQMLWTLVGVIGFACVITFLSDHRMLARYGYVCGLTGLVLLAIPAVL
FT                   PASMSEQNGAKIWIELPGFSIQPAEFSKILLLIFFAAVLVDKRELFTSAGKHFLWMDLP
FT                   RPRDLAPLLAAWIASIAVMIFEKDLGTSLLLYASFLILLYVATDRISWVAIGLSLFAAG
FT                   SVVAYHLFGHVRVRVQTWLDPFADPEGAGYQMVQSMFSFATGGIFGTGLGNGQPGTVPA
FT                   ASTDFIIAAVGEELGLVGFSAVLMLYTILVIRGLRTAIAVRDSFGKLLAAGLASTLAIQ
FT                   LFIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYLLLAILLRISHAARRPISTKPVTQTP
FT                   IAAASTEVIDKV"
FT   sig_peptide     complement(28718..28846)
FT                   /locus_tag="Mkms_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.849) with cleavage site probability 0.761 at
FT                   residue 43"
FT   gene            complement(28843..30318)
FT                   /locus_tag="Mkms_0027"
FT   CDS_pept        complement(28843..30318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0027"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein; KEGG:
FT                   mmc:Mmcs_0019 protein serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89246"
FT                   /db_xref="GOA:A1U8T8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T8"
FT                   /protein_id="ABL89246.1"
FT                   /translation="MTLVLRYAARSDRGLVRANNEDSVYAGARLLALADGMGGHAAGEV
FT                   ASQLVIAALAHLDDDEPGGDLLSKLDNAVREGNSAIAAHVEADPELEGMGTTLTAILFA
FT                   GNRLGLVHIGDSRGYLMRDGELTQITKDDTFVQTLVDEGRITAEEAHSHPQRSLIMRAL
FT                   TGHEVEPTLIMREARAGDRYLLCSDGLSDPVSHDTIAEAMQIPDVAESADRLIELALRG
FT                   GGPDNVTVVVADVVDYDYGQTAPILAGAVSGDDDQPPPNTAAGRASAFNPKRNAPKRVV
FT                   AQPEEPVKKPRSKRRMIIAATLVVLVVLAGLAIAREIVRNNYYVTAHEGTVSIMRGVDG
FT                   SLLGYSLQEPYLLGCLNARNELSLISAGQSGENRGCQLLDVQDMRESERAQVVAGLPGG
FT                   SLDQAIAQIEELARSSVLPICPPPATTSRRPPPPPPPSPTESAATSAVPRPGTSPAPET
FT                   PTTVTPPPPPPSPTVTALPPPPPQPGTTCRAAS"
FT   gene            complement(30315..30779)
FT                   /locus_tag="Mkms_0028"
FT   CDS_pept        complement(30315..30779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0028"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0020 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89247"
FT                   /db_xref="GOA:A1U8T9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8T9"
FT                   /protein_id="ABL89247.1"
FT                   /translation="MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGL
FT                   ALRGSLLPNRQRSVARQLVVTEGALTGTRITLGSQPVLIGRADDSTLVLTDDYASTRHA
FT                   RLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPMGTPVRIGKTVIELRP"
FT   gene            complement(30923..32332)
FT                   /locus_tag="Mkms_0029"
FT   CDS_pept        complement(30923..32332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0029"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0021 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89248"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U0"
FT                   /protein_id="ABL89248.1"
FT                   /translation="MGLVDRFERKLESTVGDAFARVFGGSIVPQEVEALLRREAEAGIR
FT                   ELGRGRILAPNEYVITLSVPDHKKVSADPDLTATTFAKHLEGYIREQGWQTYGDVVVKF
FT                   EQAPNLHTGQFRARGAVNPDSTTGEPAPAHRDHAFPAEPGVPPMSDNPTYRGGGQGQGR
FT                   PGDEYYDDGYGRPQEEPRGQEPRAPYPPEQGGYPPRGGYPEQGGYPDRGGYPDQGGYPD
FT                   QGGYGGGYEQRGPGGYGPPGGGYDQGYRQGPGGYAPPPPPGGQPGYGAPGADYDYGRPP
FT                   GGPGRHEDGGYGRPGYPDQGGYPDQGGYGGGYGAPAGGRQDYGQDYGRGYAEPAGGYGD
FT                   PGYGEPAGRDYDYGQGAGGYGGGYGQADYPAAGVGTTVTLQLDDGSGRTYQLREGANVI
FT                   GRGQDAQFRLPDTGVSRRHLEIRWDGQVALLSDLNSTNGTTVNNAPVQEWQLADGDVIR
FT                   LGHSEIIVRVH"
FT   gene            32570..32652
FT                   /locus_tag="Mkms_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            32570..32652
FT                   /locus_tag="Mkms_R0003"
FT                   /product="tRNA-Leu"
FT   gene            32968..34455
FT                   /locus_tag="Mkms_0030"
FT   CDS_pept        32968..34455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0030"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: mmc:Mmcs_0022 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89249"
FT                   /db_xref="GOA:A1U8U1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U1"
FT                   /protein_id="ABL89249.1"
FT                   /translation="MRRQKIVRGRGASNRQNGTWLKTTDLAKVRNTLWAAADELRANSK
FT                   LTPVQYRNPVLGLVFLAYAENRFEAVRGEVESKASARNPATPADYKAKSVLYVPEESRL
FT                   SYLNDLPEGDDIGKAVDDAIKAIEAANPELKDILPRGYQKLERSTLIELLRLFAPLPTQ
FT                   LEGDAFGFIYEDFLSNFAAQEGKGGGEYFTPYSIVRLIVEILEPFHGRVFDPACGSGGM
FT                   FVQCAKFVERHNESANRKLSIFGAEKTDDTVPLAKMNLALHGLSGDIRQANSYYEDPHK
FT                   AVGAFDYVMANPPFNVDKVKKGQLAGDKRFPFGIPKPDNANYLWIQQFYAALGPKGRAG
FT                   FVMANSAGDAGHSEKEIRKQIIESGVVDVMVAISSNFFYTVTLPVTLWFMDKAKAGTQR
FT                   EDAVLFLDARHTYRQIDRAHRDFTAEQIEFLANVVRLYRGEAVETVAGSDVLLKEHFPD
FT                   GKYIDVPGLCKVATRSEIEDQGWSLNPRPLRRLHGRG"
FT   gene            34576..35811
FT                   /locus_tag="Mkms_0031"
FT   CDS_pept        34576..35811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0031"
FT                   /product="type I restriction-modification system
FT                   specificity subunit"
FT                   /note="KEGG: mmc:Mmcs_0023 type I restriction-modification
FT                   system specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89250"
FT                   /db_xref="GOA:A1U8U2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U2"
FT                   /protein_id="ABL89250.1"
FT                   /translation="MTVWRESVLGDLCTRVTVGHVGKMATEYVPDGVPFLRSQNVRPFV
FT                   IDKRGLLYIGDDFNAKLRKSALTAGDVVIVRTGYPGTAAVVPEDLDGSNCADLVVITPS
FT                   DALNPHVLAALFNSVYGQHAVSSQLVGSAQQHFNVGSAKTMRVRLPDRAEQDHIAAVLC
FT                   SINDLIENNRRRVEVLEGMARTIYREWFVKFRYPGNEGVPLVDSALGPAPKGWEVANLF
FT                   DAADVGFGYSFKSPRFSNSGPFQVIRIRDIPVGISRTYTDEAADPRYAVYDDDVLIGMD
FT                   GDFHMTVWTGEDAWLNQRVTRLRPRLGLSALHLLLAIEEQIKDWNRAIVGTTVAHLGKK
FT                   HLQLVNVLVPNDAVRIDASVVFAPIMEERRALIQSSRRLAALRDLLLPKLVSGQIDVSA
FT                   LDLDAVVGEQVA"
FT   gene            35811..39137
FT                   /locus_tag="Mkms_0032"
FT   CDS_pept        35811..39137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0032"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: mmc:Mmcs_0024 type I site-specific
FT                   deoxyribonuclease, HsdR family; TIGRFAM: type I
FT                   site-specific deoxyribonuclease, HsdR family; PFAM:
FT                   helicase domain protein; type III restriction enzyme, res
FT                   subunit; protein of unknown function DUF450; SMART:
FT                   DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89251"
FT                   /db_xref="GOA:A1U8U3"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U3"
FT                   /protein_id="ABL89251.1"
FT                   /translation="MMARGPEYDYVEKPSMELLAELGWNPVDAFHEILGAEGTLGRDSQ
FT                   HDVILTHRLRLAMRNLNAEDVPDLSINEAIEALTKDRSVMDRVRANREVYDLLRDGYQA
FT                   EWEDDNGDKRIELIRYIDLRDKLNNDLLAVQQMWVKGPLHSRRLDVALFVNGVPLAVLE
FT                   FKEPNAPVKSAYDDNVTDYRDTIPQLFIPNCLVLLSNGSEAKVGSTYAPWDFFSDWKVI
FT                   DAFGARSEIALQTALRGTCDPANLLDLFESFVAYMERPGGLVKIVARSHQYLGVNAAIE
FT                   NLNRARAVHDKRLGVFWHTQGSGKSLSMLWFTQKVLRHVRGKWTFVMVTDRTELDTQLH
FT                   GEFADAGAIPPEARVHADSIAHLRELLEADHRYVFTLIQKFQPAKGERQMPVLSERSDI
FT                   IVITDEAHRSQYDTLALNMRTALPNASMMGFTGTPLIAGEEQATRQQFGDYVSIYNFGD
FT                   AIEDGATVPLYYENRIPELQLTNAEFADELDALLEKAELDEDAEGALARKFGTQYTLLT
FT                   RPERLQTLAQDLVSHFVGRGFSGKAMYVGLDKAAAVTMHDLVQDAWAEHLADLRRQHDA
FT                   LPELERPWLASRIELMETTDMAVVVSQSQNELKMLDDLGLDIRPHRERMNREDLAEKFK
FT                   DPNDPLRLVFVCAMWMTGFDAPSVSTIYLDRPMKNHTLMQTIARANRVFPDKDNGLIVD
FT                   YVGVFRNLEKALAIYGAAKEGESPIEIIDALADELDTAVADLIAFCAGVGVDLIAVRNA
FT                   QGFDHVAKRDAAIEALLVDEQTRNDFTTKARQVRRLYKALLPNPKAAAQQRNVAAIRVL
FT                   AERIHEVTKPPTPDIGVVADAVDALLDRSVGAEEYVIRAAAEGSEPDPLIDLSQIDFDG
FT                   LAARLAGRKRAETDRMAQLLRQQAIGAAMRNPTRYELVERIEQLIADYNAGSVNIDEYL
FT                   RRLVELSRTLTSEEERAVREGMTEEELAIFDLLTQPDPVLTAEERERVQASAKTLLQHL
FT                   HEKLVQDWRRKVDVMNDVNSTIRRVLDDGLPETPYTVDVFREKVQLVYDHVLSAYGDDG
FT                   ESVYTRRVDVGFPPQTAGQVPLGPIDVDRIADDVVARIHADPAFAEHVARQLIDRPNAA
FT                   E"
FT   gene            complement(39713..41524)
FT                   /locus_tag="Mkms_0033"
FT   CDS_pept        complement(39713..41524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89252"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U4"
FT                   /protein_id="ABL89252.1"
FT                   /translation="MASPQRLPTATVVCSGRKQPQSRFTGYALTVIDTQAVFNMALFNL
FT                   RQVERRLMVTAAEMITADALACGHALSFEDQPILGQVFTTLKKRQKHLTLILGAGVSMN
FT                   ASLPSWSTLVRDMSKSVKDAKLSQMLREVTGDSLERKAETTIQIACALNKNIDAAQIIR
FT                   DALYNAEEIPKPGLLASSIGRLIAEYFPAVSVLTTNFDLIMEEAVSAYLPGIAITPYSM
FT                   DTYSDWEASEGTDTELGVLHLHGVVRQGGLSPSGPIVLTDSDFLEHGAQVRSAVGKAIN
FT                   SGVALFVGLSLTDPNIVGPLYEAAGHASSERYGLFVPRLYGDDFTPTEYAKYALSGAEF
FT                   LRRKLHLRPIFMKSYSQLTQLISEFGLAVAEPKLYRRNGPKATSLHYGFRFKEALSAAY
FT                   TAVGANTRTGDLASDSALKLSRKLHSSFHAKNGPMWLLDAFRKRHAADVSLEENFGIFL
FT                   WLRSLDSPPEKKYALKLLGTSVYTHLEAWSAKREEHITAHSNYAAIHAIYEGGVKVENL
FT                   DPSRNGGTWRSALAVPVVVTQSRSLLLRGGDPLDSLTIGAITLDSNKPVEPIDSASSDR
FT                   SVIGALESDEFQQLIDALDRLAGDVLT"
FT   gene            41810..42478
FT                   /locus_tag="Mkms_0034"
FT   CDS_pept        41810..42478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0034"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   mmc:Mmcs_0026 uracil-DNA glycosylase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89253"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U5"
FT                   /protein_id="ABL89253.1"
FT                   /translation="MTIRRDPEGSLQHRKNLLDDEIRSCSRCAGMNEEGVTQAAPGWGN
FT                   LYSPVVIVGQSLCEQCMKPQEPFFEGSGSLLNEGLRLAGRAKGETFISNVVHCHPPKNR
FT                   GSREHEIVNCSSYLHRELELVRPRLVIALGVDAKRVLSFFYPSARVSPWPFRASSGRQP
FT                   RSPYLLFAKHPAWIKRQHDSALEQEYVHSLADAMRWVFHDAAPGLEPTCAGMADVNATD
FT                   "
FT   gene            42952..43236
FT                   /locus_tag="Mkms_0035"
FT   CDS_pept        42952..43236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89254"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U6"
FT                   /protein_id="ABL89254.1"
FT                   /translation="MSDTEPQWRHICEVCGVEEILTPGDAFNLGWDYPPRMGQFGVVGP
FT                   RCCPNCPNVGTVWWALAIDGYTDDMLTEAQRATVRRIAGEPLSIAVLSE"
FT   gene            43570..43812
FT                   /locus_tag="Mkms_0036"
FT   CDS_pept        43570..43812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89255"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U7"
FT                   /protein_id="ABL89255.1"
FT                   /translation="MRDDWSAARRLVSAFHCGAVDNFVAVVDEIDTAGRWKAVALALVG
FT                   EVAAIANHVRGSAAQDFLDQRSATALDRDRQTGEP"
FT   gene            43857..44183
FT                   /locus_tag="Mkms_0037"
FT   CDS_pept        43857..44183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89256"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U8"
FT                   /protein_id="ABL89256.1"
FT                   /translation="MAVDLRELTLFVSDVDAAARFYEAIGLALYCIEEPEHPRRYDGEL
FT                   GLQLRPATARRPVSQLQLGFEVEDISAVVARLAAVGASWTCDLPNFVRTSDPEGNKITW
FT                   TQRR"
FT   gene            44255..44914
FT                   /locus_tag="Mkms_0038"
FT   CDS_pept        44255..44914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89257"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8U9"
FT                   /protein_id="ABL89257.1"
FT                   /translation="MAEFEYIQWRHRWPEVVVQRRTDEAVELLTRYYAVTAAGRPAYSG
FT                   SQFEAMAALNSDPYSIGPADFTAASMLSVNIHAQAAIRLLSRDANEITALLHRIPVDVD
FT                   IITIDPNDLVPGGPASLLWQLLRRGNDGMGRTRTSKLIAAKRPRLIPIWDSFVEQATGL
FT                   DTSDYWRQFQAVLAADDRAVWTWLTQIRSAVPNVPAAVSNLRILDVLLWMTVDQQR"
FT   gene            complement(45760..47007)
FT                   /locus_tag="Mkms_0039"
FT   CDS_pept        complement(45760..47007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0039"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mmc:Mmcs_5364
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89258"
FT                   /db_xref="GOA:A1U8V0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V0"
FT                   /protein_id="ABL89258.1"
FT                   /translation="MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVV
FT                   GAEWGQPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAESALI
FT                   TVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQFRHRPLDSAGPFT
FT                   FVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVA
FT                   RGLAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPAVKAMLHS
FT                   VYDQPDAPAVAAQFDRLIDYVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPA
FT                   ERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTIT
FT                   NDNPEIGADDMPALTA"
FT   gene            47206..48255
FT                   /locus_tag="Mkms_0040"
FT   CDS_pept        47206..48255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89259"
FT                   /db_xref="GOA:A1U8V1"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V1"
FT                   /protein_id="ABL89259.1"
FT                   /translation="MGRHGAMASAADDPEPAKPVARANHDRADSQRHVLAPFHHDVNED
FT                   RYRALAGLTIRGVDPRYLVPALESAKRLWCRLGDFAPSTDRISAAHLARYLAFEAERVG
FT                   TFDYRTALRRANVDRHLMDIATRKTNRSMRTIRWILYDAGRLVHPREYPEARTLPAPRT
FT                   KRIDAAAPQDIRDWYTLAPTLPQWLRRRLALLLDLCYGAGARPPDFKVLRGTSITSETI
FT                   DGLHIAIVRLQNTAGGTRLVPITDPDISRRLLALAQSKGSDYLLPAAKGEVERNATNRI
FT                   GEQLRARGHGNINAAALRNRWILDLADRVPAALLLQLADVVDVQVLADQRTQLPTYGIH
FT                   RAIALMAEG"
FT   gene            48259..50037
FT                   /locus_tag="Mkms_0041"
FT   CDS_pept        48259..50037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0041"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89260"
FT                   /db_xref="GOA:A1U8V2"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V2"
FT                   /protein_id="ABL89260.1"
FT                   /translation="MITDFEKSYRLSDSLFREAKVIIERSHAAEMINDFHDQHRGAGGQ
FT                   DCAGIAYTISAVLVAALGLLMLGRTPTYKAIQQAIGDLTPRQLAEVGMAGQDTSRIFAD
FT                   RAEQRRERTRFVAWLNRRLAPLDPSPDQPARRITNAEHRRIIAHRSTEQRAASGEATER
FT                   LRTVMNRIVFGSIVDPQPPEAVGDIVADETIFDLAGPSAGLGIKPDKQRGAAYFGSYYS
FT                   RDKHSTTVYQDASGGGKRGFGIGLTAVIRVGPPDQLHAVAPVVIGMDVHPPTSGSVDGL
FT                   DVAITHAKRNGLDTRRAGRARLPCLTTDMGYNPKDGFARLMLDHQYAAVVRYPQHWTLT
FT                   DTAANPPGATADVPPGPIQFAGSFYCPAAADLLAQHHMPKTRDLLADNGWEAHDRRLAS
FT                   VLPFLMGLNSRPRLSRPRGRPPLGVEPRLDVKAELVCPAVQLRVQCPLKPASMTRAAFG
FT                   APTAAPTWQASDRQCCAQSIVTVTLTPRQLKKAQWGPVGASWEHILYFEAARARTEQTF
FT                   SILKSAHVTKLVDLKWGPRREPMVKLLMALAVASTNHRIQKTYRSRQAREESIDVRRRQ
FT                   LRDHLGHEPAKTPPLT"
FT   gene            complement(50440..51459)
FT                   /locus_tag="Mkms_0042"
FT   CDS_pept        complement(50440..51459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0042"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mmc:Mmcs_0033
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89261"
FT                   /db_xref="GOA:A1U8V3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V3"
FT                   /protein_id="ABL89261.1"
FT                   /translation="MRYRTLGRTGIQVSAIGLGAMMFATRMGNSKQESVDVIHRALDAG
FT                   INLIDTADAYEDSEDIVGHALKGRRDDVVLATKFGRPVDDNPNHRGASRRWIVAAVENS
FT                   LRRLQTDYIDIYQLHRSDPDTDLEETLSALTDLVRSGKIRAFGTSTLPASNLVQAQWIA
FT                   ERHGYERPHTEQPPYSILNRGIEREVLPIAQQYGLGVLVWGPLGQGMLTGRVRRGHDND
FT                   VIRAQLLSSFHDQRRLDAVERLIPVAAQAGLSMPHLAMAFTIAHPGVTGALLGARTMSH
FT                   LDDLLTGADTVLGDDVLDEIDDIVPPGTDAGPLDQDHTPPAIQKAALRRRPLAERAAA"
FT   gene            51544..52149
FT                   /locus_tag="Mkms_0043"
FT   CDS_pept        51544..52149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0043"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0034
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89262"
FT                   /db_xref="GOA:A1U8V4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V4"
FT                   /protein_id="ABL89262.1"
FT                   /translation="MAGRPERAGVTNASINTGRRQRLDAQRNVLSILEAAKTTFADSGV
FT                   DVPARTITDLAGVGVGTLYRHFPRRSDLILAVIEREIDDCIEAAHELTARMEPRDALVA
FT                   WVSRFAEFVRTKHGLANALHSGDPAYTGLADTLLDRLEPVLDSLLERVPLNVRNRDTVS
FT                   ARDVLTTIALMCQPVPGETSSFNERMTKIFLEGLLASG"
FT   gene            52293..53282
FT                   /locus_tag="Mkms_0044"
FT   CDS_pept        52293..53282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89263"
FT                   /db_xref="GOA:A1U8V5"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V5"
FT                   /protein_id="ABL89263.1"
FT                   /translation="MSENLCVKTPFSDLRYLVDCLGPLTRRDSGPCSLVRRRRHEAISL
FT                   SVPVARMGQRSEWGLGMGSKRSSDGSGAIGGAIFFVIVLIAMVPKPVWIAIGIGVAVIV
FT                   LGWVAYRIFEAVEKSRAEAAERERAEQAARAAAAKREREERARTEKQRRIDTLGKANAA
FT                   LVESALRAVKQIAGSEAARAGWLGDVDFTADIRGITENFQKAHALRGVAGKLSALDKPS
FT                   AEDRVILAEAKTTAANLERTAIERVELVGKCAVEAQLIDKSLRTEREDARVAEQRAELH
FT                   AKLSAMLYGIEAAPNTTPEDSAVDAVMARVQAYREIKYQIEQARDGQS"
FT   gene            complement(53307..54335)
FT                   /locus_tag="Mkms_0045"
FT   CDS_pept        complement(53307..54335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0045"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0036
FT                   homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89264"
FT                   /db_xref="GOA:A1U8V6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V6"
FT                   /protein_id="ABL89264.1"
FT                   /translation="MDEFPQDYEIFDLGDVTLQHGATLRDAKLAYKTYGELNADKTNAI
FT                   VYPTWYSGRHWDNEWLIGEGMALDPTKYFIIVPNMLGNGLSSSPSNTPPPYDAARFPHV
FT                   TFYDQVEQQHKLVTSFGIETLPLVTGWSMGAGQTYQWAVSYPDMVQRALPFCGSSKTSE
FT                   HNIVFLEGVKSALTADAAFKEGWYTEKPTKGLRAAARVYAGWGFSQAFYWQQEYKKMGY
FT                   SSLEDFLVGFWEGFFLDRRDPNNLLAMLWTWQNGNVGATPGRGFDGDQVAALKTIKAKM
FT                   IVAPAEKDLYFPPEDEEFAVSHIPNAELRVIPGIYGHFAGGDANPADNQFIDAALKDLL
FT                   AR"
FT   gene            complement(54440..56311)
FT                   /locus_tag="Mkms_0046"
FT   CDS_pept        complement(54440..56311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89265"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V7"
FT                   /protein_id="ABL89265.1"
FT                   /translation="MAAHAVPSAATHGGGWFTKLPVLPNAAGASAIALAATPANNAGAA
FT                   ALLILFRMTKALPPSLIFKPPRLVTRSTMPRLAGCGLAQARRGYARPEDGCVELTRCWT
FT                   VTTIEHQDPGASAEWPTQPLPAPGRALNPATTQVPGCIVGGRYRLLVCHGTSGVLEFWQ
FT                   AVDLAAGRAVAVTLVDPRSSLPIEWVNEILSLTVRLRGVDAPGIATILDVLHTGQCGVV
FT                   VANWVAGGSLREVADTDPAPEAAAAALESLAMAAEASHRAGMHLSIDHPARVRISSDAR
FT                   AVLAFPATLPDGTPHTDLRGIGGCLYALLAKCWPEDVSEPAQLAELRPGTPYLVSATAS
FT                   GLARPEPGITSAATVLTMLRQAARDGRDDGADIRVLPPLDPPPPGVYAAFRNFGPDEQA
FT                   QEARKSVLRATIGTAAAVVAAGVVMLGSSVNEVLQAPDETPAMDAGQLGLQDGPTSVAP
FT                   KVPEETVKAAAADAPVKPVRAEVFSTDGRPDNPGEAGRVIDGDPATAWSTDRYYDADPF
FT                   PEFKEGLGLMLELPAPTTLGSVEVDLGSTGTVVQVRSAPGQSPAALGDTTEISAPTPMQ
FT                   PGRNTIAVRSREPVKHVLVWVSTLGSTDGRNQAAVSEITLHPPAPPA"
FT   gene            complement(56642..57217)
FT                   /locus_tag="Mkms_0047"
FT   CDS_pept        complement(56642..57217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0047"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0038
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89266"
FT                   /db_xref="GOA:A1U8V8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V8"
FT                   /protein_id="ABL89266.1"
FT                   /translation="MPDGVTAAPRRRSEKSRVAIIAATRELLWQRGFDGLSIEAVAARA
FT                   GVGKQTIYRWWPSRPALVADVLLEDAHEILLPVRDSGNLVADVVSWIGKLAATLTSPRG
FT                   NAMLRILTVASMEHEDTAARLRAGFGDPLHVSVRDRLLAAGVDAPTAESAAEAIVGGVV
FT                   YAIQREGCAYSRSRAQRTARLVVESLTN"
FT   gene            57291..58298
FT                   /locus_tag="Mkms_0048"
FT   CDS_pept        57291..58298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0048"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain; KR; KEGG: mmc:Mmcs_0039 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89267"
FT                   /db_xref="GOA:A1U8V9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V9"
FT                   /protein_id="ABL89267.1"
FT                   /translation="MGKKLVIGASGFLGSHVTRRLVERGDDVRVLIRHTSSTRGIDGLP
FT                   VECHYGDIFDDDAVRAAVAGCDVVYYCVVDARAWLRDPTPLWRTNVEGLQRVLDVVADA
FT                   DLYRFVFTSSIATIGIADSGPATEELSHNWLDRAGEYVRTRVAAEDLVLRYHRERALPA
FT                   VAMCVSNTYGPDDWLPTPHGGLVAAAVRGKLPFYIDGAQAEVVGVRDAADALILAGERG
FT                   RPGERYIVSERFMTAREIYQTACAAVGVTPPQRGVPIRALAAAAVPSAWLARLRRRDTR
FT                   LTPLTIRLMHIMSPMDHSKAERELGWRPAPTTDALAEAAEFFVGNRRRPAEDRR"
FT   gene            58298..60514
FT                   /locus_tag="Mkms_0049"
FT   CDS_pept        58298..60514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0049"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0040 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89268"
FT                   /db_xref="GOA:A1U8W0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W0"
FT                   /protein_id="ABL89268.1"
FT                   /translation="MPIALTPEQRALSDAVREFAARHAPVEKTRQAFDDLAAGNVPTWW
FT                   DDLVSAGFHAVHLPERVGGQGGDLVDTACVVEAAAQAMLPGPLLSTVATGSVALLADTV
FT                   TSESLLRDLAGGTTAAVILPNDAALQAVSTPDGWEVSGVSPVVLGVGAARLLLAAAHTE
FT                   DGGLIWFVADADAAVTECERGTDLTTDVARVRFDGHQVASGARLTGIDTERARCAVAAL
FT                   TASASAGTIRWCVDAVTEHLRTREQFGKPIGTFQALQHRAADLLISSELATAAAWDAVR
FT                   SADEPAEQHVIAAATAVLMAAAPAPDLVLDTLTMFGAIGFTWEHDLHLYWRRATALAAS
FT                   LGPATRWSRRLGELTRTTARDVTVRLGDADPEFRARVSDVLDRASTLPNDGPRPQGDYD
FT                   QFATGPQRTAIAEAGLIAPHYPAPWGLDATPLQQLIIDEEFAARPALTRPSLGIAEWIV
FT                   PSLISAAGQEVRDRLIPPTLRGETAWCQLFSEPSAGSDLASLTTRATRVDGGWKINGHK
FT                   IWTSSAQHAHFGALLARTDPDARKHRGIGYFVVDMSSEGVEVQPIRQVTGDAHFNEVFL
FT                   TDVFVPDEMLLGEPTGGWNLAIATMAQERVAIGNYVHNDRAVALRALARTPGPDQDAAL
FT                   RALGDIDAYAGSIKALGVRETLRLLDGQHAGPASSIAKVATAAMLRRTFEATLQLTGET
FT                   ALLEDTDPPVVQPYLHLPAELVGGGTREIQLNIIAQMVLGLPRG"
FT   gene            60528..61736
FT                   /locus_tag="Mkms_0050"
FT   CDS_pept        60528..61736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89269"
FT                   /db_xref="GOA:A1U8W1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W1"
FT                   /protein_id="ABL89269.1"
FT                   /translation="MGLRGEAAIVGYVELPPERLNKAGPAPFLLEQWAELSAAALEDAG
FT                   LPAESVNGIVTSHIGESEIFVPSTVAEYLGVDANFAEILDLGGASAAGMVWRAAAAIEL
FT                   GLCDVVLCALPARYLTPTSDKKPAPLVDAMFFGSSSNRFGSPQAEFEIPYGNLGQNGPY
FT                   GQVAQRYAAVYGYDERAMAKIVVDQRVNANHTEGAVWKDKPLTIEDVLASPVIADPLHM
FT                   LGIVMPCVGGAAVVVASADIARRAKRRPVWIKGFGEHVPFKTPTYARDLLQTPITKAAD
FT                   TAFAMTGLGRADMDMVSIYDCYTITVLLSLEDAGFCEKGKGMAFVSDHDLTFRGDFPLN
FT                   TAGGQLGFGQAGLAGGMHHVCDATRQIMGRAGAAQVADCNRAFVSGNGGILSEQTTLIL
FT                   EGD"
FT   gene            61741..62157
FT                   /locus_tag="Mkms_0051"
FT   CDS_pept        61741..62157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0051"
FT                   /product="protein of unknown function DUF35"
FT                   /note="PFAM: protein of unknown function DUF35; KEGG:
FT                   mmc:Mmcs_0042 protein of unknown function DUF35"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89270"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W2"
FT                   /protein_id="ABL89270.1"
FT                   /translation="MTTFERPMPVKTPTSAPFWDALAEHKIRIQYSPSSDQYVFYPRVR
FT                   APRTLADDLEWREISGLGTLYSYTVARRPVGPHFADAVPLLTAIVEWGEGPRFSTELVN
FT                   VAPEDIRVGMRVRPVFFDYPDHDVTMLRYEPDVA"
FT   gene            62154..62561
FT                   /locus_tag="Mkms_0052"
FT   CDS_pept        62154..62561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89271"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W3"
FT                   /protein_id="ABL89271.1"
FT                   /translation="MTDRDDIADVLIRYATGIDRRDWPLFRTVFTDDCTLDYGDIGTFD
FT                   GVDAVTEFMDQAHAMAGHTLHRLTNFAIDVGGDSARARAYVDALIFAPDNASGVNAVGF
FT                   YDDELVRTPAGWRIARRRFTTVRVSPVGGQS"
FT   gene            62558..63370
FT                   /locus_tag="Mkms_0053"
FT   CDS_pept        62558..63370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0053"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0044 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89272"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W4"
FT                   /protein_id="ABL89272.1"
FT                   /translation="MTFAQKYGPWAVVAGASDGLGAAFAERIAENGVNVVLLARRQSVL
FT                   DDVAAGIRDRTGVETRTLAIDLTDPAATGAVADATDDLEVGFLVYCAGADPAFEPFLAQ
FT                   PIEAAEAMVQRNCVAPMRLCHHFAPAMAARGRGGLVIFGSGAGLAGGPNMVAYAATKAF
FT                   DMVFAEALWAELHDTGVDVLGLILGKTDTPALRTLEHRRGQIASTEQTPPGAVPVAGVV
FT                   SEAFDNLANGPTWIVGEDLRAATQMMGSISRSDAVRFIVEASRDAMGP"
FT   gene            complement(63394..64098)
FT                   /locus_tag="Mkms_0054"
FT   CDS_pept        complement(63394..64098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0054"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein, family 1; KEGG: mmc:Mmcs_0045
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89273"
FT                   /db_xref="GOA:A1U8W5"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W5"
FT                   /protein_id="ABL89273.1"
FT                   /translation="MLGGCGAQRDPSTLTVFAAASLRTSFAEIAEQFERDHPGMDIEFS
FT                   FAGSSDLVTQLTQGAYADVFASADHRNMDRAAEAGLLDGAPVDFAANTLTIAVTPGNPK
FT                   GIRSLRDLSDPEVRVVLCAPQVPCGHAASAVEEAAGVDLRPVSEESSVTDVLNKVTSGQ
FT                   ADAGLVYVTDARDAGERVTAVPFPESARAVNTYPIAVLKESQNATGARQFLAAVTGTTG
FT                   QTVLRRNGFAAP"
FT   gene            complement(64131..64535)
FT                   /locus_tag="Mkms_0055"
FT   CDS_pept        complement(64131..64535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0055"
FT                   /product="DNA binding domain, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: regulatory protein, MerR; TOBE domain protein; KEGG:
FT                   mmc:Mmcs_0046 molybdenum-pterin binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89274"
FT                   /db_xref="GOA:A1U8W6"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W6"
FT                   /protein_id="ABL89274.1"
FT                   /translation="MPKIRVRQAAELLGVSDDTVRRWLDDGSLAASADASGRKVVDGAE
FT                   LAAFARGNPATAPKDPLGTPSSARNRFAGLVTDVVSDTVMSQVEMQCGPFTVVSLMSTS
FT                   AVRELGLEPGSVAVAVVKATTVIVEAPAQP"
FT   gene            64727..66727
FT                   /locus_tag="Mkms_0056"
FT   CDS_pept        64727..66727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89275"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W7"
FT                   /protein_id="ABL89275.1"
FT                   /translation="MTEHPQADDDPRLGALLEWRQRLIDSGAVSARSFKEAHLRLVLRS
FT                   GRTDVEQIRAMLPGSVAEHADDMARVLAELPARPGGSEEEITPAGRHRGDDPVGEPLYE
FT                   RATQGDHFAPYEGDGPGAAAHSVTLHRRRDTGALELRWPSIDAAGQTVVYRVVSGEDAA
FT                   PRSPDTGDPLTVTTTTSATDDRPPVAAVRHFQVWANLGATRAEALAAQPVLHAAGVLIG
FT                   RITDLALQEDSGRVVGRYTVPPGISAVYVYRMPAGEAHRDGPQYRILAGQDNLAGFVDI
FT                   DVERGYRYVYRVRCAAPVGGVLRLSEAAESGVDVSAVLAPVTDLTITGSTADATVLDLA
FT                   WTTPPGGRVVVYRTPTGPSAGAEADELPEDALDQVGLPPELRLAQPVTEERDEDGRVRT
FT                   AMPGVAWPDQWSRAYFTPVTLIGGRAMLGKTFSTVRTGVIRDIELAEYCNKQVLTFDWP
FT                   DGAASVVVYLAPPGHDPRNGLGGHTYEITLEEYEKYGGLQLSGPLPVHGCSLHLAPIAF
FT                   TGGRRVMGAIASIDYQGLLRLQYAVRVGRDADGRPFTATIAVRSEYDLPGSPAFVLVNN
FT                   PTRIPLSVHDGELVDVAPLNEQGQLAAPPAKELRWSQLTTTGGSELWAANVRNRQGWIR
FT                   LFVSTPSPASLRLIALLDPPVEHLRLTPAVT"
FT   gene            66724..69213
FT                   /locus_tag="Mkms_0057"
FT   CDS_pept        66724..69213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89276"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W8"
FT                   /protein_id="ABL89276.1"
FT                   /translation="MTGRYGQLTYTSFDTAAYMGGWQVKETSADLSPDEVHALTSGVRT
FT                   VFRPAQPLPAYPTPEQLDRGPRRLAYGRLDRRRAGYWHTVPSGSDSTGRPGNVFAHALL
FT                   DRAAGDRADRPIQWWRSDGWLCPYGPLAVGAAALPGTPPAPGTAVTKDSVVRFALDPDA
FT                   WRLATLFGLLDAVAAALDGGPPVVLGVESADSAAQWIGLVSFLMSAGTAARLHFSTFDR
FT                   ADQLTLARQSGQHLTAVPVDDLEHVPDDVVAISEHATLSLGELDHEPHRTADGRAITVT
FT                   PWSAMAQVVLLDAEGARSVLDDIDHYAAQVADAGLHPAWPLAMSVAHRDEFADALTEAY
FT                   AVIAAHSPRAASDSVTARTVAEVMRNALGTSTADAWKAVQDTVDGPAADLADVTYLCRA
FT                   VADEDWLSRPGRIPARERDSERRPPPRELRESLGPALAAAQAGGAHRVARLADLLLRSG
FT                   IDDDRVSAALRTEVAPKLMDSEAAPALLEALRESLGAPTRLALAATLLQDGDATAVNGD
FT                   VFDWLAEGVRAPAPHDLREARPGDPVWTAAALRGARTVQRGAVDQADRWASLWWLRVSG
FT                   SERFEEVAGSSVWHPDELLAAVGDSALPGAAAVRTLAGAPPSAALERLAQTVLRANNDD
FT                   VAVACAAVRIFDPRGWIEQGYAASHQSAYAPLWERALESTGTDAVHRDFAVRLVTFAAI
FT                   ALAAGQPYPPSSALLTAEPRVAADAFGQLAALLDGYVLNAMSVLAVAALRFAHNGDDPA
FT                   AVTDGIEELIWQGARHVMATRRPESIDIGVVAATMARLTGEPNDGAVRRHRKTVLKLLA
FT                   RRPEAPTAPIARTRWSR"
FT   gene            69215..70372
FT                   /locus_tag="Mkms_0058"
FT   CDS_pept        69215..70372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89277"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8W9"
FT                   /protein_id="ABL89277.1"
FT                   /translation="MTKCPRCFSVLDPNQYLWTLPPHAGGTRYRDDLASSYLGAPADSG
FT                   ALYTWARPPGYTGPPPPLSEASQALQGPAVEICPACHFILPDDWRNGHAVCIAMAGARA
FT                   TGKSLYIGVLVKQLELLCEHLGVSMQPATRATAVAYTMNYETPLYVQRGLVPPTPTVQT
FT                   QASHQREPLIYGIGVWHGVRRYLVLRDVAGEDLESGDLYTPPFRFFANADAVFFMFDPL
FT                   RIKGIRDQLHDLLPAQAFSGGDPRAVLNNVLHAVGAAQPKLAVIVSKFDALRVLRDVEG
FT                   SEWSLIMSNAGAAYLRDPSDTPQYDESDGQLLHEEVRSLLTRLHGGAIVAAVENPSTGM
FT                   RLPHRYFAVSALGAPPSGNRLHSRGIAPFRTVDPVRWVTAPYGVL"
FT   gene            70475..71506
FT                   /locus_tag="Mkms_0059"
FT   CDS_pept        70475..71506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0059"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   mmc:Mmcs_0050 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89278"
FT                   /db_xref="GOA:A1U8X0"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X0"
FT                   /protein_id="ABL89278.1"
FT                   /translation="MVQGAGETVPALRIRCGDVLCTVTPGDAPVLIGRDLPAQIRADDP
FT                   RVSPVHARIAVDGDHWVIGDAGGTTGVFVDGERVESVGVRDTVTVRLGHAEGLVVTLAV
FT                   DHATDPEEIEAGVARAGAAVEDRREELGFTRRRLSAEGVIDPQTLADFEAGRVWPPDDA
FT                   RARLEVHLGWEPGTIAAVRAGSPAPEDESTEILSDTVQMAVMVDAASIALGNVKARIDR
FT                   APAPHDAAYDEYVETVLFDLRGLEKMVRNAGKTTRRPDGAVVLRDIRRTYNGVMTRAAQ
FT                   APGAPLSRRLYVARRSAELTVEEAADAAGVSVEAVTDAEDGQFVADADAAALEALVRRL
FT                   AAG"
FT   gene            71567..72076
FT                   /locus_tag="Mkms_0060"
FT   CDS_pept        71567..72076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0060"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0051 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89279"
FT                   /db_xref="GOA:A1U8X1"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X1"
FT                   /protein_id="ABL89279.1"
FT                   /translation="MGKNERAKIVMSDPEIAEFIDHSRTATLATLLPSGRPHLVAMWYA
FT                   VLDGEIWFETKAKSQKAVNLRRDPTVTVMIEDGLTYNTLRGVSIDGRAEIVDSDPDLLL
FT                   RVGISVWERYTGPYSDDMKPFVDQMMHNRIAVRVVPERTRSWDHRKLGMPDMPLSGSTA
FT                   QYLGEQ"
FT   gene            72073..72552
FT                   /locus_tag="Mkms_0061"
FT   CDS_pept        72073..72552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0061"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: mmc:Mmcs_0052 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89280"
FT                   /db_xref="GOA:A1U8X2"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X2"
FT                   /protein_id="ABL89280.1"
FT                   /translation="MTAPDRPKQLDSPLLPKIFKYVGKAHVWVYRRTGGRIGGKWRVGA
FT                   GFRKPVPTMLLEHRGRKTGKVFVTPLLYLRDGADVVIVASQGGRKEHPQWYRNLIAGPD
FT                   VFAEIGSERRPVKAVVADAEQRARLWPALVELYADFDTYQSWTEREIPVVILQPR"
FT   gene            complement(72533..73363)
FT                   /locus_tag="Mkms_0062"
FT   CDS_pept        complement(72533..73363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89281"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X3"
FT                   /protein_id="ABL89281.1"
FT                   /translation="MSTTRPSAPAFFVPEGDTFIPTGIARGPWGETVSGTYVGGLLGHV
FT                   VERDTDADPEVAPARLTVDLLRPVAMAPVHTRSTVVRRGRRLWLADAELVQAGTVVARA
FT                   SALLLRRGPEPPDDAWTSPVNMPPLPPDPTEIGTRTTVLWVFGGADPSTPTADLSGWQQ
FT                   SGPKSVWVREITPLIDGVTLTPFVRAAIAGDYASSLTNFGSTGLPFINADYTVSLSRLP
FT                   DGPHLGLAALTHHACDGVSTGVATLFDHRGPIGNATVTALANPGFTPGLSAAAG"
FT   gene            complement(73415..73720)
FT                   /locus_tag="Mkms_0063"
FT   CDS_pept        complement(73415..73720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0054 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89282"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X4"
FT                   /protein_id="ABL89282.1"
FT                   /translation="MTTDKTGASTTVKAEADRFTIGVEGQTVGFAEFTDRDGQRVFTHT
FT                   EVDGEFEGRGLATILVGEALDQTRSAGKRIVPECKLVASYIDKHDEYADIVDPVGH"
FT   gene            complement(73733..74227)
FT                   /locus_tag="Mkms_0064"
FT   CDS_pept        complement(73733..74227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0064"
FT                   /product="protein of unknown function DUF55"
FT                   /note="PFAM: protein of unknown function DUF55; KEGG:
FT                   mmc:Mmcs_0055 protein of unknown function DUF55"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89283"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X5"
FT                   /protein_id="ABL89283.1"
FT                   /translation="MTNWINTVSRDHVERAVRGRFTQANHGKPQALRRMARGDWIIFYS
FT                   PRVTYPDGAQLQAFTAIGQVVDDEPYQASTEDEVWRRNVDFLDCAETPIRPLIDALDFI
FT                   ENKQRWGYKFRFGVFRIDDHDFETIRSAMTRSPELIGASTVSDAAGGVPGQTAAPPNDT
FT                   D"
FT   gene            74282..74632
FT                   /locus_tag="Mkms_0065"
FT   CDS_pept        74282..74632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0065"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0056 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89284"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X6"
FT                   /protein_id="ABL89284.1"
FT                   /translation="MDRRRIGDGRSAARTRSVRLRSQSMSEPSGGLTADAVRSATFSKP
FT                   PLGKRGYDPKSVRDFLALTARRLEGRGHLCAADVRSIRFPKPPLGRRGYHDGEVDEYMV
FT                   TVAAAIAALDGQ"
FT   gene            complement(74766..75059)
FT                   /locus_tag="Mkms_0066"
FT   CDS_pept        complement(74766..75059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0066"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: mmc:Mmcs_0057
FT                   transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89285"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X7"
FT                   /protein_id="ABL89285.1"
FT                   /translation="MSNVTFLEVPVGACTRDPERWTTTADEEAKAICRGCPRRWMCARD
FT                   AVELPRAEGLWAGIVIPEAGRGRTFALKQLRSLAERNGYPVRAIRRVFPESA"
FT   gene            75418..76149
FT                   /locus_tag="Mkms_0067"
FT   CDS_pept        75418..76149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0067"
FT                   /product="conserved hypothetical alanine rich protein"
FT                   /note="KEGG: mmc:Mmcs_0058 conserved hypothetical alanine
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89286"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X8"
FT                   /protein_id="ABL89286.1"
FT                   /translation="MTNAESIDEATGVLDPGVARAGAAAAARRRELDISQRSLAADGII
FT                   NAGALIAFEKGRSWPRERTRAKLEEVLRWPTGTIAKLRRGEPTAAVPAVPAAADGAEAP
FT                   LIAQAVEAAVHTLGATADVLPALDDREFTPRVTTILSDLRQLEAVAARAARIGKVTPAL
FT                   IKALSAVRGRIDELTMLAATAPNATLGQRLYAVRRRANLTISETAQAAGVPDDDIAGAE
FT                   AERPISAESAAAIEALIGVLE"
FT   gene            76270..77232
FT                   /locus_tag="Mkms_0068"
FT   CDS_pept        76270..77232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0068"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89287"
FT                   /db_xref="GOA:A1U8X9"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8X9"
FT                   /protein_id="ABL89287.1"
FT                   /translation="MTWPPPPPSSDPWATGPAPDSDADRDDGAPAADPVAEPLWEPLAD
FT                   PVADSGPDELSEPVEQPVEQPVEPPTARPVDQPIVHPEAATPVPQGEFVPPPAPVSEPP
FT                   PPDGGWSAAGYGGPPPVVPRAQVAPPQQKKPVWLIAAAVLGVVVIGVVVWLLVPSGDGG
FT                   STAASPTTPSPTRTADPRAEADLRGLLPRGYAADACEMRTPPAGALAEAACGANLDPGG
FT                   PPSATYTITADDTALDAAFNDVVEASSIVTCPGNIQSPGPWRRNATPQKVSGVLFCGLQ
FT                   ADRPVVAWTNTDEALVAVVKSGPRGPGLDQLYTWWSSHS"
FT   gene            complement(77302..78297)
FT                   /locus_tag="Mkms_0069"
FT   CDS_pept        complement(77302..78297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0069"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: mmc:Mmcs_0060 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89288"
FT                   /db_xref="GOA:A1U8Y0"
FT                   /db_xref="InterPro:IPR015250"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y0"
FT                   /protein_id="ABL89288.1"
FT                   /translation="MKITTVFAATAAAAAVAAAGAVIAAPIAGAESGAPAGPAVHEIGQ
FT                   QADLVNGSVVQGWTVTDLKASTDTIPYAVRGTLWEATATDEAIQGAATPIVSNFNARAR
FT                   NGETYRALWQVATAQGVNPSTLGQGQETTGKLYFDVTGAQPDSVVYNDGGQDLLLWVQP
FT                   PPSSTSSSTPRSSSSPSGSATSATPQATPQGSEASPPAAEAVEPGTPGAAPASTELVPA
FT                   PAGSSGTPLPAGSSGTPLPATSSGTPLPAGSSGTPLPATSSGTPLPAGSQGTPALAPGA
FT                   PAPAPAVPAQPAPQPASSGPAPVPVSTGDQAPVPHGQGVPTPTPTPVPVP"
FT   sig_peptide     complement(78205..78297)
FT                   /locus_tag="Mkms_0069"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.840 at
FT                   residue 31"
FT   gene            complement(78415..79374)
FT                   /locus_tag="Mkms_0070"
FT   CDS_pept        complement(78415..79374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89289"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y1"
FT                   /protein_id="ABL89289.1"
FT                   /translation="MAQPGSYADWIRVDELVPPRRTPPAHGWRRWVYRLSFGRINPGQS
FT                   PEELRQLELENKVRGVLRGHYKVGVMGKGGVGKTTVSASIGSVFAELRQDDRVVAIDAD
FT                   TAFGKLGSRVDPNAQGSYWELASDQHLESFADVRSRVGNNAAGLFVLAGEGSPARRRVL
FT                   DPAIYREAASRLDRYFSISIVDCSSTMDSPVTQEVLRDLDALIVVSSPWVDGAAAAGQT
FT                   LDWLAARGMTGLLQRTVVVLNDSDGHADKRTRSILAQQFAGHGQRVIEIPFDGHLRPGG
FT                   VISGTREMSPAARRKFLELAAALADHFPSTDDRSRERG"
FT   gene            80246..81094
FT                   /locus_tag="Mkms_0071"
FT   CDS_pept        80246..81094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89290"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y2"
FT                   /protein_id="ABL89290.1"
FT                   /translation="MMAGAPAASSGTHYDDVVAVEVTIDGMLVIADRMSASDFPPSLGI
FT                   RLNIPQPDLRKIVWDQVARDLTEQGVLNFYGDPHPEVAAMVDTLSRSDRVLEGRWWRRD
FT                   LGGKMVRFVVCRKGDRHVVAARDDEMLVLQRIAPQIGLANMVTTVLGTAPPADVEPLTG
FT                   VAAKLAQCRTANELQAYGIALTSARAYADIISEPASWVELTATERHPGGTQTTTDVAAG
FT                   VLDSPHGRIVSIPRRVSGELYGSFLPGTQENLQRALDGLVDFLPSKTWFDHSDADASHG
FT                   E"
FT   gene            81107..81613
FT                   /locus_tag="Mkms_0072"
FT   CDS_pept        81107..81613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0072"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0063 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y3"
FT                   /protein_id="ABL89291.1"
FT                   /translation="MAGDFSTRDPDDDADDLSALDFYRPVPVEDDGEVDGGDLAALDAF
FT                   AGYGLSDEPEPEPEPLFTVTNPPGTVTVTSYLDGRVQHIDLSPRAVHMSETELAEEIVV
FT                   IAGLAAQDAKSAQYEFMLDGMREQGHDDPATRDFLQRDLELPTPEEARAHRAEVFTTRY
FT                   AGSHE"
FT   gene            81606..83327
FT                   /locus_tag="Mkms_0073"
FT   CDS_pept        81606..83327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0073"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mmc:Mmcs_0064 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89292"
FT                   /db_xref="GOA:A1U8Y4"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y4"
FT                   /protein_id="ABL89292.1"
FT                   /translation="MSDHLASLFGSAVGMLPNAPARSYELFTDITNYDETACDAWVGRI
FT                   RCGDMDRVTLFRAWYSRGNFGQLAGAAEISMNTLAARIPIGGLFGEITYPITSPLAITM
FT                   GFAVNEAKEGNFTDAMEALENVPPGGADHLIAWVKTVVYGAAERWTDVIDKVRGANSWP
FT                   DKFLAAAAGVAHGVAAANLGLFTEAERRLTEMNSSPAGQACAQTIAWYLAMTYRSQGNE
FT                   EGARALLEWLQATHPEPKVTAALRDPSYRLVTTTAEKIAARTDPWDPASAVADTSGRER
FT                   LLEEAQAELDRQIGLSRVKEQIEAYRAATQMAKIRAARGMKVAQTSKHMIFAGPPGTGK
FT                   TTIARVVANILAGLGVISEPKLVETSRKDFVAEYEGQSAVKTARTIDRAVGGVLFIDEA
FT                   YTLVQERDGRADPFGTEALDTLLARMENDRDRLVVIIAGYSADIDRLLETNDGLRSRFA
FT                   TRIEFDSYSPDEIVEIAKVIAAANDSTVNEDAAKLVLEAATLLGQRTLGGKPALDIAGN
FT                   GRYARQLVEAGEQSRDMRLARSLDFDSLGVEQLSEINGEDMASAIAAVHSRLNISG"
FT   gene            83331..84806
FT                   /locus_tag="Mkms_0074"
FT   CDS_pept        83331..84806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0074"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0065 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89293"
FT                   /db_xref="GOA:A1U8Y5"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y5"
FT                   /protein_id="ABL89293.1"
FT                   /translation="MASFRLTTKVQVSGWRFLLRRVEHAIVRRDTRMFDDPLQFYSRAV
FT                   GAGIIIAVLICLGAALMAYFKPLGKRGGDQLLVDRSTNQLYVVMPGGGELRPVYNLTSA
FT                   RLVLGNPGTPVAVKSEELNRMSKGQPIGIPGAPYATPVSGAAESMWTLCDTVTKPESVV
FT                   PRVETSVLVRPLVVDSTVGPLRPDQGMLVSFKGANWLVTEGGRHSIDLADRAVTSAVGI
FT                   PVTARATPISEGLFNALPNAGPWQLPQVARAGEPNTVGLPANLVIGSVFETVTESDDQQ
FT                   HYVVLADGVARVNDPTAAALRATNSYGLIEPPMVEASVVARIPEQVYVSPLPDKALDIL
FT                   LRQDDPTLCWSWQRVAGDQAPRTTVIAGRRLPIAASALNTGIRQITGDSTVYIDGGQFI
FT                   RLQSPDPRYGESLYYIDPQGVRYGVSDEETAKNLGLVGPLTAPWQVVSLLVDGPVLSKQ
FT                   AALLEHDTLPANPNPRKVGEDGPVAGARPGGSR"
FT   gene            84820..87057
FT                   /locus_tag="Mkms_0075"
FT   CDS_pept        84820..87057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0075"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: mmc:Mmcs_0066
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89294"
FT                   /db_xref="GOA:A1U8Y6"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y6"
FT                   /protein_id="ABL89294.1"
FT                   /translation="MTTKKFTPIIKRGPRLTPGEITVTPPDDLGVEIPPSGIQRALPWV
FT                   MGGCMLGMISIMIFTGVRQLSPYMLMMPLMMVMATVGFMAGGGSGAKRVPEINADRKEY
FT                   LRYLSGLRTRVTSSAAAQVTFFNYHAPHPEDLLSIIGTNRQWSRQANSEFFAATRIGLG
FT                   SEPAVDRLLKPSIGDVNGLAGPQAAPQPHLEPVSHMWVTKFLRTHGLIHDCPKLLQLRS
FT                   FPTIAIGGDPDGSAALLAAMICHLAVFHPPDLLQLRVLTDNPEDPNWSWLKWLPHVQHQ
FT                   SDVDAAGPTRMVFTRPDGLSDLTARGPHTADSAPSGPYVVVVDLTGGRAGFPADGRAGV
FT                   TVLTLGNHNGSAYRIRVAADGTADDRMPNSSFRLVTNSSDRLTPGQAGRIARKLAGWSI
FT                   TGAIIDKNVRVQKKVATEWHQLVGAQTVEEVTPARWRMFADTDRDRLKIPFGHELRTGD
FT                   IMYLDIKEGAEFGAGPHGMLIGTTGSGKSEFLRTLILSLAATHHPDQVNLLLTDFKGGS
FT                   TFLGMEKLPHTAAVVTNMEEEAELVSRMGEVLTGELDRRQSILRQAGMQVGAAGALSGV
FT                   AEYEKHRERGADLPPLPTLFVVVDEFAELLQNHPDFIALFDRICRVGRSLRVHLLLATQ
FT                   SLNTGGVRIDKLEPNLTYRIALRTTSSAESKAVIGTPEAQYITNKESGVGFLRVGMEDP
FT                   VKFQSVYTGNPYVPATTVQEDGEVKPRQSTRNRVRIHKFTATPIFDTAVTS"
FT   gene            87054..88856
FT                   /locus_tag="Mkms_0076"
FT   CDS_pept        87054..88856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0076"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0067 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89295"
FT                   /db_xref="GOA:A1U8Y7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y7"
FT                   /protein_id="ABL89295.1"
FT                   /translation="MTASRQAAEQKVLREVVLDQLTTGEIRAYRMWLPPLTDPTPVDEL
FT                   VERDHQRRPLRFGLGIMDEPRRHRQDIWGVDVSAAGGNIAIGGAPQTGKSTFLQTLILS
FT                   AAATHSPRDVQFYCVDLGGGGLMYLEDLPHVGGVATRAEPDRVNRVVAEVKAVQRQRER
FT                   TFKELRVGSIAGYRQMREDPNNPAAADPFGDVFLVIDGWPAFVAEFPDLEPVVQDLAGQ
FT                   GLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAIS
FT                   MEKHHLMMGVPRLDGQHSAGNLVPAITSAVAQIAARHTVRAPQVRVLPERVHLDELDPN
FT                   PPGPDADYRTRWRIPLGVRESDLSVAYNEMQMTPHLLIFGAPKSGKTTIAHAVAQAICR
FT                   RNSPQQVRFMLADYRSALLDAVPQSHLLDAGAVNRNHASLEAAIKALATNLQKRLPPPD
FT                   LTTAQLRSRSWWSGPDVVLLVDDWHMIVAASGMVPPMAPLAPLLPAAADIGLHIIVTCQ
FT                   MSQAHRATMDKFVGAAYGAGTPTLFLSGEKTEFPSSEIKLRKRPPGQALLVSPDGKEVV
FT                   QAAYVDPPADPLEEEVLAPPPQGG"
FT   gene            89004..89297
FT                   /locus_tag="Mkms_0077"
FT   CDS_pept        89004..89297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0077"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mmc:Mmcs_0068 PE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89296"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y8"
FT                   /protein_id="ABL89296.1"
FT                   /translation="MQPLEHNPGAAGIGGQVVANGARGLAGGTAATAAVTALVPAGADE
FT                   VSAMAAATFAAEGAETLALNTFAQEELSRAGAAFTEISGIYAAVDAANASTF"
FT   gene            89348..90679
FT                   /locus_tag="Mkms_0078"
FT   CDS_pept        89348..90679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0078"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0069 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89297"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Y9"
FT                   /protein_id="ABL89297.1"
FT                   /translation="MALTGIPLPPTWTALPPEVNTGRLMAGAGPAPMLQAAAGWEALAV
FT                   LLETQADELAASLANLSSMWTGTASERAVAATMPMVLWLRTTSAQAMKRALQAANQANS
FT                   YTLAMATTPPLPEIEQNHITHAVLEATNFLGVNTVPIGVNEFDYFVRMWNQAAGAMDVY
FT                   QAETQMNLLFEPIPPMTPIVIPGVGESTGAAAVAQAGARAPMGVARNGLIAKASATAKM
FT                   ESVGLNAGRAMAQGNMAAQRAQGAVQKGEQAAHQQPQDQVMQQGVQMGVQMAGQVGSMV
FT                   AQVPQQFGQMVQTPMQMLTQPLQQVSSIFGQMGGGLGGEKAQIGVIGAAPFSNHPLAGG
FT                   SGVSSGAGLVRAASLPGAGGTAARTPLMANLVGDKMAAAPVPVGAGAAAGATVGGLAPV
FT                   GGAGGGMGPMGMAGQGAKGGGSKPGLTAPAPLVHDLDEDDGDDW"
FT   gene            90773..91072
FT                   /locus_tag="Mkms_0079"
FT   CDS_pept        90773..91072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0079"
FT                   /product="10 kDa culture filtrate antigen LHP (CFP10)"
FT                   /note="KEGG: mmc:Mmcs_0070 10 kDa culture filtrate antigen
FT                   LHP (CFP10)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89298"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z0"
FT                   /protein_id="ABL89298.1"
FT                   /translation="MAMNTDIAVLAKEAGNFERISGELQGVMRSVDATANSLLPQWRGQ
FT                   AGEAAQAALLRYQEAAQAQIQTLTEISSNIHTSGTQYGSTDEDQAGTLASSMNL"
FT   gene            91103..91390
FT                   /locus_tag="Mkms_0080"
FT   CDS_pept        91103..91390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0080"
FT                   /product="6 kDa early secretory antigenic target EsaT6
FT                   (EsaT-6)"
FT                   /note="KEGG: mmc:Mmcs_0071 6 kDa early secretory antigenic
FT                   target EsaT6 (EsaT-6)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89299"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z1"
FT                   /protein_id="ABL89299.1"
FT                   /translation="MSEQVWNFAGIEGGAGEINGAVSTTQGLLDEGKASLGALAAVWGG
FT                   SGSEAYQAVQARWDNTSAELNAALQNLAQTISEAGSTMAQTEAGVTGMFA"
FT   gene            91496..92923
FT                   /locus_tag="Mkms_0081"
FT   CDS_pept        91496..92923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0081"
FT                   /product="conserved hypothetical proline and alanine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0072 conserved hypothetical proline
FT                   and alanine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89300"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z2"
FT                   /protein_id="ABL89300.1"
FT                   /translation="MSADYDRLFHSPDAAQTPDEATVHVDRDALMQGTAPAPAPAGGSN
FT                   NADGSAPPPLPITPPRTQAAPAPPPRHAEITTQMPPTTQAPTSQGPVPQRPPNGMMRTP
FT                   QTNLPGGARFEAPRQASAPAPRPAPAPPPSAHFAEAPPAEVAWPQSQPPAQPAPTSAAA
FT                   MGNHRAIDALSHVGVKSAVKMPSQRGWRHVLYLLTRINLGLSPDEMYEMDLHARIRRNA
FT                   RDSYQIGVLGLKGGVGKTAVTVALGSTLAKVRGDRILAIDADPDAGNLADRAGRQSAAT
FT                   IADLLSDKELDRYNDIRAYTSMNGANLEVLSSEEYSQARREFNDDDWKGATDVVSRYYN
FT                   LVLADCGAGLFQPASRAVLSTVSGLVIVASASIDGARQAAVTMDWMRQNGYQDLLGRSC
FT                   VVINHVVPGKPNIDVDDLVQQFERHVAPGRVIVLPWDKHIAAGTEIQLDLLDKVFQRRI
FT                   TELAAALSDDFDRLERR"
FT   gene            92986..94449
FT                   /locus_tag="Mkms_0082"
FT   CDS_pept        92986..94449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0082"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0073 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89301"
FT                   /db_xref="GOA:A1U8Z3"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z3"
FT                   /protein_id="ABL89301.1"
FT                   /translation="MTILTGRRMTDLVLPAAAPVETYIDETVAVLAEILEDTPKDVLAG
FT                   FDFTAQGVWAFARPGAPPLKADESLDDAGVVDGSLLTLVSVSRTERYRPLVEDVIDAIA
FT                   VLDESPEFDRAALNRFVGVSIPLVSVAITLMSLVSWDRTGQSLWWALALAVLGLGLLGG
FT                   SLLAQNRYANLNMAESLLIASIPALAGGAALAVPLPNGVGSLGAPQLAGAGAVVLLLTL
FT                   ATRGGPRKRAEVAAFLAIATAALTAAAVGYGYGWQYWVPAGAVAFGLIVLTNAAKLTVA
FT                   VARIALPPIPAPGETVTNDELLDPVTSREGVDEESPTWQAIIASVPESAARLQERSVLA
FT                   KKLLIGFLTAGALILAVGAVAVVVQGHFFVHSLIVAGLVAAICGFRSRLYAERWCAWAL
FT                   LAVTVIVPTGVMVRLCQWYPDDAWLVLAIYTALGAVALVVIGATDGVRRVSPVTKRILE
FT                   LVDGAAIAAVIPLLLWIASVYDVLRNLRF"
FT   gene            94459..94770
FT                   /locus_tag="Mkms_0083"
FT   CDS_pept        94459..94770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89302"
FT                   /db_xref="GOA:A1U8Z4"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z4"
FT                   /protein_id="ABL89302.1"
FT                   /translation="MSGEVLQVNPPALAGAGTAFGQAASGVAGLHADAPLGEAARAVAA
FT                   LQTAAACRQAQADIGALTAAAAAAADEYGENLRSAAARYESVDQAGRDAIEQVALAGG"
FT   gene            complement(94776..95096)
FT                   /locus_tag="Mkms_0084"
FT   CDS_pept        complement(94776..95096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89303"
FT                   /db_xref="GOA:A1U8Z5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z5"
FT                   /protein_id="ABL89303.1"
FT                   /translation="MHPQVAAVLAQAQQLQSIMDEQLHKMKHQTFTASDETETVEVTLD
FT                   GHQQLTSVHIEDGLLRQGAHVVEQRLNEALQNATEAASAAIEADRERIDARVAELTESW
FT                   RP"
FT   gene            complement(95105..96706)
FT                   /locus_tag="Mkms_0085"
FT   CDS_pept        complement(95105..96706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89304"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="InterPro:IPR041275"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z6"
FT                   /protein_id="ABL89304.1"
FT                   /translation="MAGDEVRVEPADLRARATTLDEEITDESQRPTPPCGLPFVTASAA
FT                   GIAAGSDTLRSHLISGNREAERLAAVLSEAADVYQQIDNRAAQALEYPDGPRSVEPVPV
FT                   NPTLPPSVPPIEFPATVPAVPGGQTDAGFMDVKAAAQIIHSGDSGPMRTYGEQAKKFAG
FT                   TLRDRAASFNLDGINWDGTAAEKAGDAVRQHKEWLEKLAESYEFLGTEAIDMADAHDKW
FT                   SGQHPTVAEVEAVEARVAQAGQAGDKDALARAMMDYLALQRKSEDVRTSYSADVAGKSL
FT                   PKVLDPPPGAAPVPPISSNGDPRKGKIQPAGEGAPGEPGSGGGAQPGGRPGAQPGGQAA
FT                   AAPMGGGSPAGQGGAQPAGASSGGGGSPSGGGGSPAGGGGAPAAPAAGGGLPGGLPGGG
FT                   PDGLPPLDDPALKPAAASGGGAGGGSGGGAGGGGGGVPPSPLQPAVGAETVAPGAAGTG
FT                   RAGAAAAGPAGAMGAMGGMGGMPMGGHGAGRGQGGGEKKRTPGLAPDEDLYVEDRPFTE
FT                   SVIGYTPKPRDRKDSK"
FT   gene            complement(96757..98154)
FT                   /locus_tag="Mkms_0086"
FT   CDS_pept        complement(96757..98154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0086"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0077 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89305"
FT                   /db_xref="GOA:A1U8Z7"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z7"
FT                   /protein_id="ABL89305.1"
FT                   /translation="MRSFVAQFGLRLTTGHLMWAAVLIPACIAIFVPLDLLWVGVTVSV
FT                   LIALIAVVTVRGRRLTGWVAALFSWRRRHLSTPPAPSEPAVGSTVMPGDHVAVRWQGDH
FT                   LMSAIELVPRPFTPTVVVNGQSFTDDVLDTALVENLIAAHCPELEADVVAAGYRVGKTA
FT                   PASLVALYEQVVGPYPAPANRRTWIVLRADPELTRKPAQRRDSGVAGLARYLVASTTRL
FT                   ADQLAGNGIDARPSRSFDDFDRATEVSFERETWSAIKGRSTFTAAYSAPGGPDVWWSAR
FT                   ADHTITRMRIRPGIAPTTTVLLTTLANPATPRGFSCLFGGQRAALQGISPVSDKHYELP
FT                   IGSAGILIGETADRYPVYMPFDDVDVSINLGDARLFTQFVVRSAAAGAVVTLGPQFREF
FT                   AGFVNGRIGQEAKLSWPNATTYLSPHPGVGRVILRHNFIDTPRHRQLPIRLINPREESR
FT                   YQMALEQ"
FT   gene            complement(98151..99497)
FT                   /locus_tag="Mkms_0087"
FT   CDS_pept        complement(98151..99497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0087"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0078 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89306"
FT                   /db_xref="GOA:A1U8Z8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z8"
FT                   /protein_id="ABL89306.1"
FT                   /translation="MQRVGLILLALLLALLSAPPVGAIEPPSIDPAALPPDQTGPDSPT
FT                   EQRRVCSAPTVLPNSNFADKPWPNDYLQLAEAQKFATGAGVTVAVIDTGVNGSPRVPAE
FT                   PGGDFVDQAGNGMSDCDSHGTLTASIIAGRGSPTDGFIGVAPDARILSLRQTSEAFQPV
FT                   GARQDPNDPNTTQTAGSLRSLARAVVHAANLGAQVINISEAACYKITRPIDETGLGAAV
FT                   NYAVNVKNAVVVVAAGNTGQDCSQNPPPDPAVPTDPRGWQQVQTVVSPAWYSPLVLTVG
FT                   SINDNGQPSNFSMSGPWVGAAAPGANITALGYDGQPVNALQGQDGPIPIGGTSFSAAYV
FT                   SGLAALLKQRFPELTPAQIMNRITATARHPGGGVDNYVGAGVIDPVAALTWEVPEGPTA
FT                   IPYRVKQLPPPVYVPPPDRGPITWVVVIGAGLTLVLGIAALTRRALRRR"
FT   sig_peptide     complement(99426..99497)
FT                   /locus_tag="Mkms_0087"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 24"
FT   gene            complement(99688..99945)
FT                   /locus_tag="Mkms_0088"
FT   CDS_pept        complement(99688..99945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0088"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: mmc:Mmcs_0079
FT                   phosphotransferase system, HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89307"
FT                   /db_xref="GOA:A1U8Z9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8Z9"
FT                   /protein_id="ABL89307.1"
FT                   /translation="MPARTVTVGSAIGLHARPAAIIAEAVVNAGVPVTLAVAGGEPVDA
FT                   GSALMIMTLGAGNGAEVTVESDDAAALDTVAGLVEQDLDA"
FT   gene            complement(99974..101989)
FT                   /locus_tag="Mkms_0089"
FT   CDS_pept        complement(99974..101989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0089"
FT                   /product="PTS system D-fructose-specific IIB component
FT                   (F1P-forming), Frc family / PTS system D-fructose-specific
FT                   IIA component (F1P-forming), Frc family / PTS system
FT                   D-fructose-specific IIC component (F1P-forming), Frc
FT                   family"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; phosphotransferase system, EIIC;
FT                   phosphotransferase system PTS, fructose-specific IIB
FT                   subunit; KEGG: mmc:Mmcs_0080 phosphotransferase system,
FT                   fructose IIC component; TC 4.A.2.1.4; TC 4.A.2.1.4; TC
FT                   4.A.2.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89308"
FT                   /db_xref="GOA:A1U900"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A1U900"
FT                   /protein_id="ABL89308.1"
FT                   /translation="MSSPTASPIITTDLVLLDVDAGGDKEAVIGRLVNRLADAGRSTDA
FT                   DGLTRAALAREEQSATGLPGGIAIPHCRSPYVDTATIGFARLTPGVDFGAPDGPADLVF
FT                   LIAAPDSGGAEHMKLLSSLARALVRKEFVASLRAAETSEDVVSLVEDVVNPQAAAPPPP
FT                   AAEPEPARQRSLVAVTACPTGIAHTYMAADSLAAAAKNAGVTLHVETQGSSGSTPLSDA
FT                   TIAEADAVIFATDVGVKDRQRFAGKPVVASGVKRAINEPDKMVADALAAADNPDAARVE
FT                   GSAGAPSAAAPAGDVGWGTRTRQILLTGVSYMIPFVAAGGLLIALGFLFAGYDIANTPD
FT                   GQTDSLGKIIATTNSLTNLPSGGLIQYLGAVLFTIGNLAFFFLVPALAGYIAFAIADRP
FT                   GIAPGFVAGYIATTVGAGFIGGIVGGLIAGFAALWISRIGVPHWARGLMPVVIIPLFAS
FT                   LVVGLLMFLLLGRPLAWLTTSLTDWLNGLSGSSVIVLGVILGLMMCFDLGGPVNKAAYA
FT                   FATTGLNVADPASLRIMAAVMAAGMVPPLAMALASTVRPGLFTEPERENGRAAWLLGAS
FT                   FISEGAIPFAAADPLRVIPSMMFGGAITGALVMAFDVTSKAPHGGIFVFFAIGNLAWFL
FT                   VALAVGTAAGAGAVVAAKQFAKPETPADASPALANA"
FT   gene            complement(102010..102987)
FT                   /locus_tag="Mkms_0090"
FT   CDS_pept        complement(102010..102987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0090"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: mmc:Mmcs_0081 PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89309"
FT                   /db_xref="GOA:A1U901"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1U901"
FT                   /protein_id="ABL89309.1"
FT                   /translation="MIVTVTPNPSIDRTVALPAPLTRGAVQRVTSVTSEPGGKGVNVAR
FT                   ALTLARLDAVALLPAADGDPMVTALRAIGVPFRCVPIAEPVRTNLAITESDGTTTKLNE
FT                   RGAALDAAARDALTRGIIDAAEQASWVVLSGSLPPGLPDDWYAEVVARLVPLRCRVAVD
FT                   TSERPLAALAAAFDHAAPDVIKPNAEELAGLVGASAEELESAAAQGDPEPVAAAARQLV
FT                   DRGVGAVLATLGAAGAVLVDRTGAWMATPPPIVPRSTVGAGDASLAGYVRAAVAGAEPP
FT                   RRLRMAVAYGSAAAALPGSALPSPAQLDLDGVAVSTIAPTPASS"
FT   gene            complement(102984..103751)
FT                   /locus_tag="Mkms_0091"
FT   CDS_pept        complement(102984..103751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0091"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein, DeoR; Helix-turn-helix,
FT                   type 11 domain protein; KEGG: mmc:Mmcs_0082 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89310"
FT                   /db_xref="GOA:A1U902"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1U902"
FT                   /protein_id="ABL89310.1"
FT                   /translation="MYAEERQQAIASLVMQKGRASVAELAEAYDVTTETVRRDLAALDR
FT                   AGLLRRVHGGAVPARTLHLVEAGVGEREATRAEYKDAIAAAALEYLPGSGASVLLDAGT
FT                   TTARIAGQLPSDRELVVVTNSVPIAARLAGMPSVNLQLLGGRVRGLTQAAVGEQALRVL
FT                   DSLRVDVAFIGTNGISVRHGLSTPDSEEAAVKRAMVRAAGYVVVAADSSKVGREEFVSF
FT                   APISSVDTLITDGEISDNYRGQFAERGVEVVVA"
FT   gene            103794..105548
FT                   /locus_tag="Mkms_0092"
FT   CDS_pept        103794..105548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0092"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: mmc:Mmcs_0083
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89311"
FT                   /db_xref="GOA:A1U903"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1U903"
FT                   /protein_id="ABL89311.1"
FT                   /translation="MFGFTPVRVDLSTLFSNLVHMTASSAPTSHATAGTVLRGVPVVPG
FT                   VQYAPVVRPGRLPVVEDTAAEIADADRPAEAARFSAAATAVATRLRDRAAHSTGAASEV
FT                   LAATATLAQDRAWLGAAEKRIAGGTPAVRAVREAVAQFVDLFTKMGGLMAERVTDLQDI
FT                   RDRVLAELSGLPEPGVPLPMVPSVLCAEDLAPADTAGLDPTLIVALATTLGGPTSHTAI
FT                   IARQLGIPCVVAVDGLDAVPAGAFVLVDGTAGTVTVGPDEVAAAEAVAAARHEAERAAH
FT                   WAGPGATADGHAVAILANVQDGAAARAARETPAEGVGLFRTELCFLNRDTEPTVDEQAE
FT                   IYGEVLDAFAGHKVVVRTLDAGSDKPLKFAGHRDEANPALGVRGIRIAHGNPGILERQL
FT                   AGIAAAAARTGTRPWVMAPMIATAGEAKDFAAAARRHGLTPGVMIEVPAAALLADRILE
FT                   HVDFLSIGTNDLAQYTMAADRMSADLALLTDPWQPAVLALVAMTVRAGAAAGKPVGVCG
FT                   EAAADPTLACVLAGLGVTSLSAASAAVPGVGARLAQVTLQQCRDAAEAVLATATAAEAR
FT                   AAALAALG"
FT   gene            105585..106571
FT                   /locus_tag="Mkms_0093"
FT   CDS_pept        105585..106571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0093"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; Pirin
FT                   domain protein; KEGG: mmc:Mmcs_0084 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89312"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A1U904"
FT                   /protein_id="ABL89312.1"
FT                   /translation="MPAITADTLTLPRVTAPAPSDTERPVRSITTGPRGYEGEGFPVVR
FT                   AFAGVSAADLDPFIHMDQMGEVEYEPGEPRGTDWHPHRGFETVTYMIDGRFAHQDSHGG
FT                   GGLITDGATQWMTAGSGILHIETPPAELVESGGLFHGIQLWVNLPRKDKFATPRYQAIE
FT                   GGQVKMLASEDGGALIRIIAGDVDSQDGPARGPGATHTPITMAHATVEPGARLNIPWNR
FT                   DFNALVYVLSGRGAVGPVGHPIRQGQLAVFGPGDRLSVAAEPTQDSHRPALEVLILGGR
FT                   PIREPVFHYGPFVMNSKSELIRAVEDYQAGKFGTIPPNALMPHTSGR"
FT   gene            complement(106574..108730)
FT                   /locus_tag="Mkms_0094"
FT   CDS_pept        complement(106574..108730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0094"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: mmc:Mmcs_0085 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89313"
FT                   /db_xref="GOA:A1U905"
FT                   /db_xref="UniProtKB/TrEMBL:A1U905"
FT                   /protein_id="ABL89313.1"
FT                   /translation="MLTPAVLWRRAADRIQRRDPERDALRRAGRAAIVLPVAAAASFTL
FT                   AGGTQAPMFTIFGSVALLILADFPGNRAARALAYAGLGFNGAILITLGTLTAPHPWLGV
FT                   ALMFVLGVVVTFSGVLSEVIAAGQRATLMTFVLPACTAPGPIDERLTGWLIALALCVPA
FT                   ALFLFPPRHHDDLRRHAATVCRSLADCLDGDASTRDVHRAMNALWENFVNADFRPVALT
FT                   AGSRALVRVVDDLGWLSDRVTDDTAALLGDMKPPIVRVLRDAAAVVRIHDRQVRAARNA
FT                   DLDAALDELRSIAHGRYREDIEQILAVPDDATAVAVSRTLLGRRTFSATVGVTGRIIRN
FT                   AALADARPVWARVLGRRLPRTGAADWVMPETTAVAAITKGFVATRAVVLRNSLRTGLGL
FT                   ALAVTVTQVFPVEHGFWVVLGAMSVLRSSALTTGTRVLRAVAGTAIGFLLGVALIEVVG
FT                   VEPAVMWLLLPVVAFGSAYVPEIASFIAGQAAFTMMVLIIFNVIAPTGWSVGLIRVEDV
FT                   VLGALVGATVSLLMWPRGASATVTAAVRDACEAGAALLRAAVLRVTRGSSEQAADRVTA
FT                   LSHAALEASRTLDDAVRQYLSENGGKTDVRAPVVRAANRAVRLRAAAELIADVVPPPLG
FT                   VYPQTRRVLEAHAELVCRRLVGPAPEAVHTPPISDDVALALRPEAEENDLAISAALPLV
FT                   TVAAHLGELELLYPRAEQPLTTGR"
FT   gene            complement(108762..109379)
FT                   /locus_tag="Mkms_0095"
FT   CDS_pept        complement(108762..109379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0095"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0086
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89314"
FT                   /db_xref="GOA:A1U906"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1U906"
FT                   /protein_id="ABL89314.1"
FT                   /translation="MWRRRPQNQSQQLLFRLMGAVVTREGYFETGLAVLADQGYGGLKL
FT                   AEVCHRLGVTTGSFYHYFANWSAYTRELVEYWRQQATVRIVEAVRAEKDPHRRIETLIE
FT                   EALALPHGAEAAIRVWSSIDPDVHAVQAAVDRQRYDIMRESSLEVVGDERQAEVFAACC
FT                   VYILVGYEQATIPPDNVALRWLAAEMLHTLDSGRLNSLPDAR"
FT   gene            109494..110129
FT                   /locus_tag="Mkms_0096"
FT   CDS_pept        109494..110129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0096"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0087
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89315"
FT                   /db_xref="GOA:A1U907"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1U907"
FT                   /protein_id="ABL89315.1"
FT                   /translation="MPHTASRGPGRPPAAKAAETRERILRAAREVFSELGYDAATFQAI
FT                   AIRADLTRPAINHYFASKRVLYREVVEQTNAWVISAGMERAHGEGTLLGRLSAFFSAAM
FT                   HAESEDRSAAAFLVTSVLESQRHPDLRSDEHDALRMSRSFVSWAVNDAIERGELSTDTD
FT                   IPSIVEMLVAVMWGMGFYAGYVGGQQELEVIVEKFELLMANKLWQLNA"
FT   gene            110238..111176
FT                   /locus_tag="Mkms_0097"
FT   CDS_pept        110238..111176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0097"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0088
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89316"
FT                   /db_xref="GOA:A1U908"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U908"
FT                   /protein_id="ABL89316.1"
FT                   /translation="MSSLRTADDTWDIATSVGSTAVMVAASRAAETERDEALIRDPYAR
FT                   LLVTGAGTGIWESVLDAKFVETVAAADAEAAAIFEHMISYQAVRTHFFDAFFTAAAEAG
FT                   IRQIVILASGLDSRAYRLDWPSGTTVYEIDQPKVLEYKSATLAEHGVEPAATRREVGID
FT                   LRHDWPAALRGAGFDPSRPTAWLAEGLLMYLPADAQDRLFEQITELSAPGSRVAAETAG
FT                   VQAEDRRQQMRERFERIAEKFDMTASLDIQQLIYEDPDRADVADWLDAHGWTATAVSSQ
FT                   QEMRRLDRWALPADLTDDDAFSNFVTAEKQS"
FT   gene            111173..111964
FT                   /locus_tag="Mkms_0098"
FT   CDS_pept        111173..111964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0098"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0089
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89317"
FT                   /db_xref="GOA:A1U909"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U909"
FT                   /protein_id="ABL89317.1"
FT                   /translation="MRRQEAGTSSLATRVGPEVLTTAAVASVTGCDDPLAAVLLGRPKV
FT                   IEVLQRSAELIDRVPALAAAHHQIADYHAMRSRFFDAYLADAAAEGIRQCVVLAAGLDT
FT                   RAFRLPWPDGMTVFEIDQPTVLRYKENALTAHGARPAADWHPVGVESDMPWPRRLWESG
FT                   FNHNEPTIWLAEGLLPLPDATQDALISEIDGLSAAGSRIAFDDVLGMCSGRSDAPGWLT
FT                   SRGWWTDVVEARHLPELSGRRDDDAQSYTAHAALVTAEKIA"
FT   gene            112036..113448
FT                   /locus_tag="Mkms_0099"
FT   CDS_pept        112036..113448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0099"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0090
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89318"
FT                   /db_xref="GOA:A1U910"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1U910"
FT                   /protein_id="ABL89318.1"
FT                   /translation="MTTDSAAQATQAAQADTDIPATVARLRRTFATGRTRDIEWRKRQL
FT                   RALERLMVENETAIAAALEQDLGRKPFEAWLADIASVAGEAKDAAKNVRKWTRRRYRML
FT                   ELSQLPGLGWVEYEPFGTVLIIGAWNFPFALTLGPAVGAIAAGNTVVLKPSEVAPACSA
FT                   LMAELVPRYLDNEAIVVVEGDGSVSQELIAQGFDYLLYTGGTEIGRKVYEGAAPHLTPV
FT                   TLELGGKSPVIVTADADIDVAAKRIAWTKLINSGQICIAPDYVLADAKIRDQLVDKIKA
FT                   AVQTFESENPDGKRIVNERHFDRLTAALAATKGDVVIGGGSDASKISIQPTVVVDPDPA
FT                   EPLMTDEIFGPILPIVTVQSLDQAIDFVNARPKPLAAYLFTKTKAIRERVVKDVSSGGM
FT                   VVNHLLFHFATSKLPFGGVGPSGMGAYHGRFGFETFSHHKTVMTKPTRPDVGAFIYPPY
FT                   TEKAWKLARRLF"
FT   gene            113523..114386
FT                   /locus_tag="Mkms_0100"
FT   CDS_pept        113523..114386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0100"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0091 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89319"
FT                   /db_xref="GOA:A1U911"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U911"
FT                   /protein_id="ABL89319.1"
FT                   /translation="MPGVQDRVIVVTGAGGGLGREYALTLAREGAAVVVNDLGGARDGT
FT                   GAGSAMADQVVDEIKAAGGRAAANYDSVAEPEGAENIIKTAIDEFGKVDGVVSNAGILR
FT                   DGTFHKMTFENWDAVLKVHLYGGYNVIRAAWPHFREQSFGRVVVATSTSGLFGNFGQAN
FT                   YGAAKLGLVGLINTLAQEGAKYNIKTNAVAPIAATRMTQDILPPEVFEKLTPEYVAPVV
FT                   AHLMTEELTDTDSIFIVGGGKIQRAALFQNEGTTFTKVPTLDDVASRWGEITDLSAAQQ
FT                   ASFKLG"
FT   gene            114389..115354
FT                   /locus_tag="Mkms_0101"
FT   CDS_pept        114389..115354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0101"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0092 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89320"
FT                   /db_xref="GOA:A1U912"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U912"
FT                   /protein_id="ABL89320.1"
FT                   /translation="MKALLAQELSGPSGLVYTDVDDPASDGAVIIDVGAAGVCFPDLLL
FT                   LRGEYQLKLEPPFIPGMEVAGTVRSAPDSSGFMPGQRVSAFTLMGGFAERVAALPDSVI
FT                   PTPDGVDDASAAALLGNYYTMQFALARRGGLTPGETVLVLGSAGGVGTAAIQLAKAQGA
FT                   TVIAMVHRSGAEEFIRGLGADVVLPLTDGWRQAVLDATDGRGVDIVVDPIGGPAFDDAV
FT                   RVLAPEGRLLVIGFAAGGGIPTVKVNRLLLRNVSVVGVGWGEFVRRNPSAQAAVGAELA
FT                   ALVEAGLRPPPPVCYPLAEGPAALQALADGEIKGKLVLQP"
FT   gene            115366..115977
FT                   /locus_tag="Mkms_0102"
FT   CDS_pept        115366..115977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0102"
FT                   /product="haloacid dehalogenase, type II"
FT                   /note="TIGRFAM: haloacid dehalogenase, type II;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 2
FT                   (HAD-like); PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: mmc:Mmcs_0093 haloacid dehalogenase, type
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89321"
FT                   /db_xref="GOA:A1U913"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1U913"
FT                   /protein_id="ABL89321.1"
FT                   /translation="MLAFDVFGTVVDWRSSVIAQLEEFGRAHGVDADWAAFADAWRAGY
FT                   VPSMDRVRRGELPWTRLDDLHRMTLVDLLAAEHISVGDEAVDELTRAWHRLDPWPDSVA
FT                   GLTRLKRRYVITPLSNGNVSLLTNMAKRAGLPWDCVLSAELFRHYKPDPEAYLGCADLL
FT                   DVTPDELMLVAAHRSDLRAAREAGLRTAYVSRPLEYGPGR"
FT   gene            116078..116785
FT                   /locus_tag="Mkms_0103"
FT   CDS_pept        116078..116785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0103"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mmc:Mmcs_0094
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89322"
FT                   /db_xref="GOA:A1U914"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1U914"
FT                   /protein_id="ABL89322.1"
FT                   /translation="MDTALTMAQRLLADPPEHPDVSKGYLDLLTDGGDRNTGTIQAVWS
FT                   SRLGSLLYDNSQTVIRRVSAAWQLPLEWLNVPVGGVALDVGSGPGNVTAALGRVVGPGG
FT                   LALGVDISEPMLARAVRAEAGPNVGFIRADAQRLPLRDESVDAVVSVAMLQLIPDPSAA
FT                   MAEMVRVLRPGRRMAVMVPTAGQMARLINVLPNAGARVFDEDELGDALEGLGLVGVRTK
FT                   TMGTVQWARGRRP"
FT   gene            116782..117264
FT                   /locus_tag="Mkms_0104"
FT   CDS_pept        116782..117264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89323"
FT                   /db_xref="GOA:A1U915"
FT                   /db_xref="InterPro:IPR007403"
FT                   /db_xref="UniProtKB/TrEMBL:A1U915"
FT                   /protein_id="ABL89323.1"
FT                   /translation="MSAGGLLLVALAVAVGMVGIVVPLLPGTLLVFGAIAVWAVVEQNV
FT                   TAWVTLGVVTVILGAALLIKYLWPMRRMRAADVRTMSLVAGGVLGVIGFFVIPVLGLVI
FT                   GFVSGVYMAELGVRRDQRVAWASTVHAVKGVALSVGVELAGALLATVAWAVGVYLT"
FT   sig_peptide     116782..116883
FT                   /locus_tag="Mkms_0104"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.602 at
FT                   residue 34"
FT   gene            complement(117318..118178)
FT                   /locus_tag="Mkms_0105"
FT   CDS_pept        complement(117318..118178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89324"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1U916"
FT                   /protein_id="ABL89324.1"
FT                   /translation="MSSDTLHRMKGPFLGSGALAAGMTRHALRTRYVAVHKDVYVAENT
FT                   EMTAIVRARACWLRSRGHGVLAGFSASALHGSRWIDGRRPATVIGNNRRREPGVTVWAD
FT                   AIGDDEICLINGMRVTTPLRTAIDLARRYPVDKSVPAIDALARATRLSVTDLRQALDRY
FT                   AGWKGIKQARTAIGLVDPGAESPKETWLRLLIVRAGFPRPETQLPVYDEYGMLIGEVDL
FT                   GWRDHKIAAEYEGDHHRTNRVVFRKDIRRIEALTEQGWLVIRVTALDTEGGIIRRLESA
FT                   FASHS"
FT   gene            complement(118254..119054)
FT                   /locus_tag="Mkms_0106"
FT   CDS_pept        complement(118254..119054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0106"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: mmc:Mmcs_0097 protein tyrosine/serine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89325"
FT                   /db_xref="GOA:A1U917"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A1U917"
FT                   /protein_id="ABL89325.1"
FT                   /translation="MASAGDELSGAWNFRDVSSHTGVAPGVFFRASELSRLDDEGRAAL
FT                   SGYGVTDVADLRTLRELERHGPGRVPAGVDIHHLPFIETVASDAEAPHEHAFQRMMTDK
FT                   PEGESIAAAAARYMTEEYARIASAPLAQRAVRQVVTLLGSGRRVLAHCFAGKDRTGFTV
FT                   AVVLEAAGVDREAVMADYLHSNTAVPQLRESILVTVRERAAETPEVLEMAEARLTESVL
FT                   GVREEYLDAAFRTIAGEYGSLEGYLSAAGVSADELARLRSTLRG"
FT   gene            complement(119054..120355)
FT                   /locus_tag="Mkms_0107"
FT   CDS_pept        complement(119054..120355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0107"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0098 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89326"
FT                   /db_xref="GOA:A1U918"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U918"
FT                   /protein_id="ABL89326.1"
FT                   /translation="MERRALGHRQWPGGPSAWASSYRDGMDFAMSAKALDYHQRLTDFM
FT                   VEHVFPAEADYHRYREEAGPKDHTVPPVVEDLKKLAKERGLWNLFLPSESGLSNLEYAE
FT                   LAELSGWSMEIAPEVINCAAPDTGNMETLHLFANDEQRKQWLDPLLNGEIRSAFAMTEP
FT                   AVASSDARNIETTMLRDGSDYVINGRKWWITGAADPRCKLLIVMGRTNPDAASHQQQSM
FT                   ILVPADTPGVDIQRSLPVFGWQDQHGHCEIVFDNVRVPVENLLHEEGSGFAIAQARLGP
FT                   GRIHHCMRALGAAERALALMIDRVQKRVAFGKPLAEQGVVREAIAKSRNEIDMARLLCH
FT                   KAAWTIDQEGNKAAHVLVSQIKSVAPQVACDVIDRAIQVHGGAGVSDDFPLARLYAWHR
FT                   AMRLFDGPDEVHMRTIARAELGREKSPFAAAVCR"
FT   gene            complement(120413..121555)
FT                   /locus_tag="Mkms_0108"
FT   CDS_pept        complement(120413..121555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0108"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0099 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89327"
FT                   /db_xref="GOA:A1U919"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U919"
FT                   /protein_id="ABL89327.1"
FT                   /translation="MPVDRLLPSDEARELIALTRDIADKVLDPIVDEHEKTETYPEGVF
FT                   AQLGAAGLLSLPQPEEWGGGGQPYEVYLQVLEEIAARWAAVAVAVSVHSLSSHPLLAFG
FT                   TDEQKQRWLPGMLSGSQIGAYSLSEPQAGSDAAALRCAAVPSDGKYVITGEKSWITHGG
FT                   RADFYTLFARTGEGSRGISCFLIPGGQPGLSFGKPEEKMGLHAVPTTTAHYDEARVDAD
FT                   RRIGAEGQGLQIAFSALDSGRLGIAAVAVGLAQAALDEATRYANERTTFGRKIIDHQGL
FT                   GFLLADMAAAVVSARATYLDAARRRDLGLPYSTQASVAKLIATDAAMKVTTDAVQVLGG
FT                   VGYTRDFRVERYMREAKITQIFEGTNQIQRLVISRSLTAR"
FT   gene            complement(121561..123000)
FT                   /locus_tag="Mkms_0109"
FT   CDS_pept        complement(121561..123000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0109"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="PFAM: NAD(P) transhydrogenase, beta subunit; KEGG:
FT                   mmc:Mmcs_0100 NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89328"
FT                   /db_xref="GOA:A1U920"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:A1U920"
FT                   /protein_id="ABL89328.1"
FT                   /translation="MLSLETTATAAYVVAAILFILALAGLSKHETSRAGNTFGIAGMAV
FT                   ALIATIALALDHDIEPLGLGLLIGAMVIGAVIGLWRAKVVEMTGMPELIALLHSFVGLA
FT                   AVLVGWNGYLHVEGQPDGAEAAAIAAEGMLGIHSAEVVIGVFIGAVTFTGSIVANLKLS
FT                   ARIKSAPMMLPGKNALNVGALVAFAALTVWFVIDPQLWLLVVVTVLALLLGWHLVASIG
FT                   GGDMPVVVSMLNSYSGWAAAASGFLLANDLLIVTGALVGSSGAYLSYIMCKAMNRSFIS
FT                   VIAGGFGIEAGPAEDKDYGEHREINAEGAAELLSSASSVIITPGYGMAVAQAQYGVADL
FT                   TRKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFADTDVVLVI
FT                   GANDTVNPAASEDPGSPIAGMPVLTVWNANHVIVFKRSMASGYAGVQNPLFFRDNTQML
FT                   FGDAKDRVDAINAALTVPEKV"
FT   gene            complement(123004..124527)
FT                   /locus_tag="Mkms_0110"
FT   CDS_pept        complement(123004..124527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0110"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /note="TIGRFAM: NAD(P) transhydrogenase, alpha subunit;
FT                   PFAM: alanine dehydrogenase/PNT domain protein; KEGG:
FT                   mmc:Mmcs_0101 NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89329"
FT                   /db_xref="GOA:A1U921"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U921"
FT                   /protein_id="ABL89329.1"
FT                   /translation="MLIAIPRESQPGETRVAATPQTVGQITKLGYSVVVESGAGVASSF
FT                   PDAAYVEAGAEIGDPWSADVVLKVNAPTDAEIAALRDGATLVGLISPALNPELVEKMST
FT                   RRITVLAMDAVPRISRAQSLDVLSSMANIAGYRAVVEAAHTFGRFFTGQVTAAGKVPPA
FT                   KVLVVGAGVAGLAAIGAAGSLGAIVRATDPRPEVADQVASLGGEYLAVDPAAAEVSATG
FT                   YAKEMGEDYKVREAALYAEQCKDVDIIITTALIPGRPAPRIITADMVASMKSGSVIVDM
FT                   AAANGGNVEGTVKDQAIVTDNGVTIIGYTDLAGRLPATASQLYATNLVNLLKLLTPNKD
FT                   GQLTLDFDDVVQRSVTVIRDGEVTWPPPPVQVSAAPAAKAAAPVEHKPAKQPMSMGRRL
FT                   GITFAAAAALFVLIALSPAALQVHLTVFALAIVIGYYVIGNVHHALHTPLMSVTNAISG
FT                   IIVVGALLQIGHGDPVVTAIATVAILLASINVFGGFSVTRRMLAMFSRS"
FT   gene            complement(124581..125267)
FT                   /locus_tag="Mkms_0111"
FT   CDS_pept        complement(124581..125267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0111"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0102 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89330"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U922"
FT                   /protein_id="ABL89330.1"
FT                   /translation="MHHGPERIVLITGASGGIGAEVARHLAGPDTHVVVHYREHSGAAD
FT                   AVAGAIRDAGGRASTLGADISDEAEAATLMDSVAASFGRLDALVLNTASRAELGADPRY
FT                   AMRLNRDAQRRLAQLAVPLMPAGARIVFVTSHQAHFFPNKAVPKGYVAVAASKRAGETA
FT                   LYGMRSVLAHAGIHLTVVSGDRIDGPTLRPLPTADEFAEAIVGATRTPFPPSIVYVGKT
FT                   DYLMTA"
FT   gene            125405..127012
FT                   /locus_tag="Mkms_0112"
FT   CDS_pept        125405..127012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0112"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: mmc:Mmcs_0103 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89331"
FT                   /db_xref="GOA:A1U923"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A1U923"
FT                   /protein_id="ABL89331.1"
FT                   /translation="MDTSDPTSDRWKDHPALAALTLCLALLAATVVLAPAAQRLSVPYP
FT                   AVMLAFGLALAFIPGVPVLSPNPELILPLVLPPLLFAAARRTSWREFLDNRRPIALLAV
FT                   ALVGVTAVAVGATLHALVPTVPLIAAIALGAAVAPPDAVAATAVAQKLGIPRRLRTILE
FT                   GEGLSNDATSLVLYEVAVAGTMTGAFSAWGAGEALGLAVVLGVLVGLAIAVATRWLINK
FT                   LPAHPAGSGLVLVVPFAAYAAADAVHGSGVLAVVTVALAMSRYGDTQSSQTRLATGTTW
FT                   EIVELLLTGSAFAFVGLQMRAVADSIDMTFWELLQQGLIITLVVIVVRFLWIFPVATID
FT                   ERMHRRKAHVAEPIGWREMTVSSWAGMRGVVTLAAVLALPPQFPERERLVFYAFVVIVV
FT                   TLLLQGLSLPTVVRRLGVRASPHEEDDAVQALIRRARDAGFERLDEIRAREEADPEVIE
FT                   HARDNAERMWQSVGFAPPDAESHHAHTDHAMTLNALKDEILAAAREAVVKARSESGTDP
FT                   TVVDRVLRRLDTRGSQPE"
FT   sig_peptide     125405..125515
FT                   /locus_tag="Mkms_0112"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.444 at
FT                   residue 37"
FT   gene            127147..128007
FT                   /locus_tag="Mkms_0113"
FT   CDS_pept        127147..128007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0113"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmc:Mmcs_0104
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89332"
FT                   /db_xref="GOA:A1U924"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1U924"
FT                   /protein_id="ABL89332.1"
FT                   /translation="MSVFVDLTPDESQLDSPVAPPRGKWAGRLTRAALPLISVAVFFGL
FT                   WQLAAASGIWNQTFVPYPGTVFRAFIEVSTTHDGARGYAGYLLVEHLYMTLRRVLAGVV
FT                   IGVALGVLLGLVMGSVSWVRSVLEPWLTFLRALPPLAYFFLLVIWLGIDEAPKITLLAL
FT                   AALPPAAVATTAAVLAAPVGLTEAARALGASRGEVIRDVVVPSALPETFTGIRLAVGMA
FT                   YSSVVAAELFNGLPGVGGLVKDASNYNNTPVVLVGIFAIGISGLIIDGLLRTIERRSTP
FT                   WIGKV"
FT   gene            128014..129039
FT                   /locus_tag="Mkms_0114"
FT   CDS_pept        128014..129039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0114"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; SMART: extracellular
FT                   solute-binding protein, family 3; KEGG: mmc:Mmcs_0105
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89333"
FT                   /db_xref="GOA:A1U925"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1U925"
FT                   /protein_id="ABL89333.1"
FT                   /translation="MRLKALAAVAVAMLAVAGCSVDTSGQDAGKQTIRIAYQSFPSGDL
FT                   IVKNNRWLEDALPDYNIKWTKFDSGADVNTAFIAKEVDFGALGSSPVARGLSAPLNIPY
FT                   KVAFVLDVAGDNEALVARNGSGVNTIADLRGKRVGTPFASTAHYSLLAALDQNGLSPND
FT                   VQLVDLQPQAILAAFDRGDIDAGYSWLPTLDQLRRNGKDLITSRQLARDGKPTLDLAVV
FT                   ADEFAEAHPDVVDIWRQQEARALTVIKDDPDAAAKAIAAEIGLTPEEVAGQLTQGVYLT
FT                   PAEVASPEWLGSEGAPGNIAVNLESASQFLAEQKQIPAAAPLKTFQDAIYTKGLPGAIT
FT                   Q"
FT   sig_peptide     128014..128091
FT                   /locus_tag="Mkms_0114"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.883 at
FT                   residue 26"
FT   gene            129023..129802
FT                   /locus_tag="Mkms_0115"
FT   CDS_pept        129023..129802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0115"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0106 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89334"
FT                   /db_xref="GOA:A1U926"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U926"
FT                   /protein_id="ABL89334.1"
FT                   /translation="MPSPSDGAIRLRGVSHRYGRGGQEVTAVGPVDLTVEPGAFLVLVG
FT                   ASGCGKSTLLRLLAGFEAPTEGTIAVAGAPPTPGVTAGVVFQQPRLFPWRTVGGNVDLA
FT                   LKYARVPRERRAERREQLLARVGLEGTADRRIWEISGGQQQRVAIARALAAETPLFLLD
FT                   EPFAALDALTRERLQEDVRQVSAESGRTTVFVTHSADEAAFLGSRIVVLTRRPGQVALD
FT                   LPVDLPRTNVDPDELRRSPEYTELRAEVGRAVKAAAA"
FT   gene            complement(129884..130012)
FT                   /locus_tag="Mkms_0116"
FT   CDS_pept        complement(129884..130012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0116"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89335"
FT                   /db_xref="UniProtKB/TrEMBL:A1U927"
FT                   /protein_id="ABL89335.1"
FT                   /translation="MDPNPDYDASDEIEYFFNYFFWGLRGVSGPGGGYPPPAYPPV"
FT   gene            130161..130820
FT                   /locus_tag="Mkms_0117"
FT   CDS_pept        130161..130820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0117"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0108
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89336"
FT                   /db_xref="GOA:A1U928"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:A1U928"
FT                   /protein_id="ABL89336.1"
FT                   /translation="MSAEASPNGSTRRDELLRVATKLFAARGYHGTRMDDVADAVGLNK
FT                   ATVYHYYASKSLILYDIYKGAADFTVDALHDDPTASARETIYHFTRRLLVGIANDIERA
FT                   AVYFQEGPYIGEWFTEEQVEYIREKETQVYEHVRDVIDRGIASGEFYDCDSHVLALGYI
FT                   GMTLGAYRWLRPQGRRTAQEIAEEFSTALLRGLIRDEAVRTESPLGVDVRTGVGSD"
FT   gene            130813..131584
FT                   /pseudo
FT                   /locus_tag="Mkms_0118"
FT   gene            131581..133347
FT                   /locus_tag="Mkms_0119"
FT   CDS_pept        131581..133347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0119"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0110 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89337"
FT                   /db_xref="GOA:A1U929"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U929"
FT                   /protein_id="ABL89337.1"
FT                   /translation="MKSTLLSRRDLDFLLFEWLRVDELTQRPRFADHSHDTFTGVLDLC
FT                   EQLAERYFAPHNKKSDAHEPTFDGEKVTVIPEVKEAWEAFAAADLLAMGMDAELGGAQL
FT                   PATVAQAAFAWISAANLATSGYLMLTIANANLLAEFGTAEQIDRFVRPMLAGRFSGTMA
FT                   LSETQAGSSLADITTRAEPRDDGTYRLFGSKMWISGAEHEITENIVNLVLAKIPGGPPG
FT                   TKGISLFVVPKYLVAEDGSVGERNDVVLAGLNHKMGQRGITNTVLNFGEGVFNPGGEPG
FT                   AVGYLVGEPHRGITYMFRMMNEARLGVGMGAVALGYTGYLKSVKYARERPQGRPVTAKD
FT                   PATPQVPIIEHADVKRMLLAQKSYVEGALALALYCARLVDLGDNQDLLDILTPVAKSWP
FT                   SQWCLEANSLAIQVHGGYGYTREYDVEQHYRDNRLNPIHEGTHGIQSLDLLGRKVTQRG
FT                   GASLRAVGGALAATVAAAGECGGEAASLAEELDARWQRLVAVTTAMFGSGDIEAAMANS
FT                   VVYLEAFGHVVIAWMWLEQFLAAEGRTGDFYDGKRQAARFFYRYELPKVGPQLDLLDSL
FT                   DRTTLEMRDSWF"
FT   gene            complement(133344..134456)
FT                   /locus_tag="Mkms_0120"
FT   CDS_pept        complement(133344..134456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0120"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0111 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89338"
FT                   /db_xref="GOA:A1U930"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U930"
FT                   /protein_id="ABL89338.1"
FT                   /translation="MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIE
FT                   AAGLCHSDLSVVDGNRVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHC
FT                   TACATGGLTPCEPGTAANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVA
FT                   VDADVPPVVASLLGCAVLTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVD
FT                   VVGIDQLEDKLDRARAMGINAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGG
FT                   RTITVGLPRPDARISVSPLGFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETL
FT                   VSSTISLDEINAGMDRLAEGKAVRQVIEFD"
FT   gene            134491..134934
FT                   /locus_tag="Mkms_0121"
FT   CDS_pept        134491..134934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0121"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0112 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89339"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U931"
FT                   /protein_id="ABL89339.1"
FT                   /translation="MPPESADRPTSRDFPVHWPVSTRWTDNDMFGHLNNAVYYALFDTA
FT                   INGWINTTVDVDPVSAPWLGVVAESGCQYFAELRFPDPLTVGLSVARLGNSSVTYRLAL
FT                   FERDAVQVAAIGHWVHVYVDRSTRRPVPIPEAIRSLLETARVE"
FT   gene            134951..135397
FT                   /locus_tag="Mkms_0122"
FT   CDS_pept        134951..135397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0122"
FT                   /product="cyclase/dehydrase"
FT                   /note="PFAM: cyclase/dehydrase; KEGG: mmc:Mmcs_0113
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89340"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1U932"
FT                   /protein_id="ABL89340.1"
FT                   /translation="MPLVSKTVEVEAPAEAIMAIVADFERFPEWNPEIKGCWILARYDD
FT                   GRPSQLRLDVEVQGQAGTFINAVYYPGENQIFTLLQQGDHFDKHEQRFSVVSIGASSLL
FT                   TVDMDVETKLPIPKPMVKKAIGETLDYLADNLKARAEHLGAGSA"
FT   gene            complement(135419..136174)
FT                   /locus_tag="Mkms_0123"
FT   CDS_pept        complement(135419..136174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0123"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; KEGG:
FT                   mmc:Mmcs_0114 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89341"
FT                   /db_xref="GOA:A1U933"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U933"
FT                   /protein_id="ABL89341.1"
FT                   /translation="MAKALRGQPRPITPKNRRAPVNAAPVARRPARRRATRREQLSDEV
FT                   AGHLRAAIMTGALRPGTFIRLDETAAELGVSITPVREALRTLRGEGMVRLEPHRGHVVV
FT                   PMTRGDIEDIFWLQATIAEKLAEAATERISETQIEELEQLNSALAEAVEHQDPEEVAFA
FT                   EFAFHRAFNHASGRIKLAWFLLHVARYLPPLLYATDPSWGTDAVASHRELIAALRRRDA
FT                   ETVVRLTTGQFTDGAQRLIVRLEKIGLWD"
FT   gene            136250..137920
FT                   /locus_tag="Mkms_0124"
FT   CDS_pept        136250..137920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0124"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0115 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89342"
FT                   /db_xref="GOA:A1U934"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U934"
FT                   /protein_id="ABL89342.1"
FT                   /translation="MTSEPDASEPSHTEQPYLARRQNWTNQLARHALMQPGDTALRFMG
FT                   RTTTWGELDDRVTKLAGALSRRGVGFGDRVLILMLNRTEFIESFLAVNKLGAIAVPVNF
FT                   RMTPPEIAFLVSDCAARVVVTEAVLAPVATAVRDLDPTLETVIVAGGATDDGILGYDDL
FT                   IAEPGEAPAPVDIPNDAPALIMYTSGTTGRPKGAVLTHVNIAGQAMTFLFTNGVDLNHD
FT                   VGFIGVPLFHIAGIGNTIVGLLLGRPTVLYPLGAFDPGALLDVLAEEKVTGIFLVPAQW
FT                   QAVCAAQRAKPRDLKLRVLSWGAAPASDTLLRDMAETFPGAQILAAFGQTEMSPVTCML
FT                   LGEDALRKLGSVGKVIPTVAARIVDEDMNDVPIGQVGEIVYRAPTLMAGYWNNPKATAE
FT                   AFEGGWFHSGDLVRQDEEGYIWVVDRKKDMIISGGENIYCAEVENVLAAHPAIAEVAVI
FT                   GRAHEKWGEVPVAVAAVRGAEDAAKPPALSLADLDEFLTERLARYKHPKALEIVDALPR
FT                   NPAGKVLKTELRQRYAGPKPIDVGESSTAPTGSAAGPGS"
FT   gene            138133..138930
FT                   /locus_tag="Mkms_0125"
FT   CDS_pept        138133..138930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0125"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0116 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89343"
FT                   /db_xref="GOA:A1U935"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1U935"
FT                   /protein_id="ABL89343.1"
FT                   /translation="MTASSGGLTGYVRDQVRPGLEAVGGFVRMCVLTGKALFRPFQWRE
FT                   FILQAWFLFRVSFLPTVAVSVPLTVLIIFTLNILLAEFGAADVSGAGAALGAVTQLGPL
FT                   VTVLVVAGAGSTAICADLGARTIREEIDALEVLGIDPIHRLVVPRVVASTFVALLLNGA
FT                   VITIGLVGGFIFGVYIQNVSAGAYVSTLTLVTGLPEVLISVVKATTFGLIAGLVGCYRG
FT                   LTVGGGAKGVGTGVNETLVLCVVALFAVNVVLTTIGVRFGTGR"
FT   gene            138932..139822
FT                   /locus_tag="Mkms_0126"
FT   CDS_pept        138932..139822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0126"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0117 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89344"
FT                   /db_xref="GOA:A1U936"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1U936"
FT                   /protein_id="ABL89344.1"
FT                   /translation="MTTTQSHTSTGTVLRQRFPRGYARAEKLVAAPSRGLDSVGHVAWF
FT                   VVTAVGSIGHALRYYRKEVLRLIAEIGMGTGAMAVIGGTVAIVGFVTLSGGSLIAIQGF
FT                   ASLGNIGVEAFTGFFAALVNVRIAAPVVSGQALAATVGAGATAELGAMRISEEIDALEV
FT                   MGIKSISYLVSTRIMAGFIVIIPLYAMAIIMSFLSAQVTTTLFYGQSTGTYEHYFRTFL
FT                   RPDDVAWSFVQAIIISIIVMINHCYYGYYASGGPVGVGEAVGRSMRASLIAIVLVVLLA
FT                   SLALYGTDPNFNLTV"
FT   gene            139825..141045
FT                   /locus_tag="Mkms_0127"
FT   CDS_pept        139825..141045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0127"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0118 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89345"
FT                   /db_xref="GOA:A1U937"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U937"
FT                   /protein_id="ABL89345.1"
FT                   /translation="MAEPRSPVNKPRTPPYKLAGLILLVVFAVIATLVAFQFRGDFTPR
FT                   EKLTMMAARAGLNLDPGTKVTFNGVEIGRVAEVNAVSVGNDPRARITLEVDTKYMQLIP
FT                   ANVLADISATTVFGNKYVSFTTPPDPVPQRIKSTDVIDVTSVTTEFNTLFETVVSVAEK
FT                   VDPVKLNQTLTATAQALDGLGDRFGESIVNGNAILADLNPQMPQIRRDVRGLADLGEVY
FT                   ANAAPDLFDGLENAVTTARTLNEQRGNLDQALIAAVGFGNTGGEVFERGGPYLVRGAED
FT                   LIPTSALLDEYSPALFCTIRNFHDVEPKISSSLGGNGYSLNTHSEALGAGNPYVYPDNL
FT                   PRVNAKGGPEGRPGCWQPITRDLWPAPYLVLDTGASLAPYNHLELGQPIAIEYVWGRQI
FT                   GENTINP"
FT   gene            141042..142073
FT                   /locus_tag="Mkms_0128"
FT   CDS_pept        141042..142073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0128"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0119 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89346"
FT                   /db_xref="GOA:A1U938"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U938"
FT                   /protein_id="ABL89346.1"
FT                   /translation="MKITGTALKLGAFSLVLLLFTAIIIVVFGQMRFDRTTGYSAIFTN
FT                   VSGLRPGQFVRASGVEVGKVSKIELIEGGSRVKVDFKVDRSLPLFDESTASVRYLNLIG
FT                   DRYLELKRGDSDRKMPSGGTIPVERTEPALDLDALIGGFRPLFRALDPEKVNNIARSII
FT                   TVFQGQGGTINDILDQTASLTSALADRDQAIGEVIRNLNTVLDTTVRHQEQFDETLVNF
FT                   ERLITGLKNRADPIASSVADISDAAGTVADLLAENRSLLQDTVGYLEATQQPLVEQKGQ
FT                   LNDILVRLPNALKIIGRAGGVYGDFFNFYACDVTLKLNGLQPGGPVRTVKVWGQPTGRC
FT                   TPQ"
FT   sig_peptide     141042..141131
FT                   /locus_tag="Mkms_0128"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.927 at
FT                   residue 30"
FT   gene            142070..143656
FT                   /locus_tag="Mkms_0129"
FT   CDS_pept        142070..143656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0129"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0120 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89347"
FT                   /db_xref="GOA:A1U939"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U939"
FT                   /protein_id="ABL89347.1"
FT                   /translation="MRTLEGSNRLRGGLMGIIILVLVVGVGQSFASVPMLFAKPRYFAQ
FT                   FGDTGGINPGDKVRIAGVDVGEVLKTEIEGDKVVVGFTLGGTQIGSDSRAAIRTDTILG
FT                   RKNIEIEPRGSEALQSNGVLPLGQTTTPYQIYDAFFDLTKSASGWDTKSVRESLNVLSE
FT                   TIDQTYPHLSAALDGVARFSDTIGKRDEQLKQLLANANKIAGVLGERSGQVNALLVNAQ
FT                   TLLAAINERSYAVGQLLERVSAFSEQVEGFIDDNPNLNRVLEQLRVISDILVERKFDLV
FT                   DVLTTLSKFTASLAEAFASGPYFKVMLVNLAPYWILQPYVDAAFKKRGIDPQKFWRDAG
FT                   LPAYQFPDPNGVRQPNGAPPPAPATLQGTPEYPNPAVPRGDPCSYTPPADGLPTPGNPL
FT                   PCADLSVGPFGDNPYGPNYHGRPNVATSEPNPNGMLPTPGVASSGVPGQQAPVVPGTPV
FT                   PLPPAPPGARNEPPGPFPGPTAVGGQVNNVPPPPALPGPPPPPGPGQQLSPAQTGPLPG
FT                   NPPFLPPGSQQ"
FT   sig_peptide     142070..142165
FT                   /locus_tag="Mkms_0129"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.672 at
FT                   residue 32"
FT   gene            143671..145317
FT                   /locus_tag="Mkms_0130"
FT   CDS_pept        143671..145317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0130"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0121 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89348"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U940"
FT                   /protein_id="ABL89348.1"
FT                   /translation="MSTIFNVRNMKMPTLSRASVIIGTLVVVLALVAAFAGWQLYKRLS
FT                   TNTVVAYFSDTLALYPGDKVQIMGVRVGTIDKIEPAGDKMKVTFSYESKYKVPANATAS
FT                   ILNPSLVASRTIQLAPPYTGGPVMEDDAVIPIDRTQVPVEYDELRDSLDRILTDLGPTP
FT                   DQPKGPFGDVIESFADGLSGKGKQINTTLNSLSEALTTLNEGRGDFFSVVKSLALFVNA
FT                   LYRSDQQFVALNDDLAQFTNSFTNTDRELATALQDLNELLTTTRGFLDENSEVLTKDIN
FT                   NLADVTNAILQPEPLDGLETGLHVLPNLGGNILNISSPVNGGIVGVPVINGMANPMQFI
FT                   CSSIQAGSRLGYQESAELCAQYLAPILDALKFNFPPFGLNQISTAMTLPKMIAYSEDRL
FT                   RPPPGYKDTTVPGIFSRDTLFSHGNHEPGWVVAPGMQGVDVQPFTANMLTPQSLAALLG
FT                   GPDAPIPGAPPAFGTTRDGNLPGPPNAFDERNPLPPPWYPQPGPPPAPAPGVIPGDPGG
FT                   SPLSGPAPGPAPAAQAPAPAGPPLPAEAGAP"
FT   sig_peptide     143671..143775
FT                   /locus_tag="Mkms_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.744 at
FT                   residue 35"
FT   gene            145317..146465
FT                   /locus_tag="Mkms_0131"
FT   CDS_pept        145317..146465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0131"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0122 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89349"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U941"
FT                   /protein_id="ABL89349.1"
FT                   /translation="MKHRIRRLATRTVALAVAAVVLTSCGSWKGIANVPLPGGPGTGGD
FT                   AMTVYVQMPDTLALNVNSRVRVADVFVGTVRAIELKNWVATLKLGIQPGVELPSNALAK
FT                   IGQTSLLGSQHVELEAPPDPSSEPLRDGDTIPLKNASAFPTTERVLASIATILRGGGIP
FT                   NLEVIQTEVNNLLTGRAEQIREFLGRLDVFTDELNQQREDLTRAIDSTNRLLNIVASRN
FT                   DTLDRVLTEFPPLIEHFAETRDLFADAVIAVGRISRAADTYLGQAQDPLNTNLQNLQRP
FT                   LKQLARSSPYLIGALKLMLTAPFSIENVPKVVRGDYINVSLNVDLTLSAIDNGILTGTG
FT                   VSGMLRALEQAWGRDPATMIPDVRFTPNAHSAPNGPLVERGE"
FT   sig_peptide     145317..145457
FT                   /locus_tag="Mkms_0131"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.337 at
FT                   residue 47"
FT   gene            146469..148028
FT                   /locus_tag="Mkms_0132"
FT   CDS_pept        146469..148028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0132"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0123 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89350"
FT                   /db_xref="GOA:A1U942"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U942"
FT                   /protein_id="ABL89350.1"
FT                   /translation="MLTRFIKIQLIIFTVLTVIALVALGWYYLRVPSLMGIGQYKLYAE
FT                   LPRSGGLYETANVTYRGTTIGKVTAVEPTERGAKATMSIDNRYRIPVDASANVHSVSAI
FT                   GEQYLDLVSTGNPGQYFSDGQTITKSTVPSEVGPALDAANEGLAVLPREKIDALLTETA
FT                   DAVGGLGPSLQRLVDSTTLIAQDFKDNLGPVNDIIANSAPILESQVNSGDNIAQWSRNL
FT                   NILAAQSAEQDAALRSGLQQAAPTADQLNAVFSGVRDSLPQTLANLAVVIDMLKRYNKG
FT                   LEQALVVLPQGASVAQAGTIFEGEGLLHFGLSINQPPPCLTGFLPASEWRAPADTSMKE
FT                   LPSGTYCKIPKDFQANVVRGARNYPCADVPGKRAATPKECRSDDPYVPLGTNPWYGDPN
FT                   QIRDCPAAGARCNQPVHPGRNGVIPAPSINNGMNPLPADQLPQPPSPVSDPLSPPGQGR
FT                   VECSGQQPNPCIYTPAPGPPGTAVYNPASGEVVGPDGVKYNVSNSSNPGDDGWKEMLAP
FT                   AS"
FT   gene            147998..148654
FT                   /locus_tag="Mkms_0133"
FT   CDS_pept        147998..148654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0133"
FT                   /product="putative conserved MCE associated membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0124 putative conserved MCE
FT                   associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89351"
FT                   /db_xref="GOA:A1U943"
FT                   /db_xref="UniProtKB/TrEMBL:A1U943"
FT                   /protein_id="ABL89351.1"
FT                   /translation="MEGDAGTRQLNPTDAEETPDKSVAVSGDNPDDTESPAEDGVTTVP
FT                   SEDDGRRPPRLGRGWLTAICAVLLLLGAGAGVGGYLALRSHEESAQLAENEAAAVAAAR
FT                   DCVAATHAPDAAAMTASQAKILECSTGDFGVQAGLYGGLLVDAYRAAQVQVQVSDMRAA
FT                   VEKHNADGSIDVLVAVRVKVTNSESADQEQGYRLRVQMAPDDGTYKVARLDQVTS"
FT   gene            148651..149622
FT                   /locus_tag="Mkms_0134"
FT   CDS_pept        148651..149622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0134"
FT                   /product="RDD domain containing protein"
FT                   /note="PFAM: RDD domain containing protein; KEGG:
FT                   mmc:Mmcs_0125 RDD domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89352"
FT                   /db_xref="GOA:A1U944"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A1U944"
FT                   /protein_id="ABL89352.1"
FT                   /translation="MTAVVDAPPDAPAAETTPAEPLARWHVRAAALAVDVLPGLAVVAT
FT                   TAPWVLAGPGIGWSWWVLTAVAAVALLAVIVNRVLLPSLIGWTLGRALCGIRVLRRDGG
FT                   EAALGRLLLRELAHVLDTVALFVGWLWPLWDRRNRTFADLLLRTEARVVARPDRDMRRF
FT                   TAKVLIGAVVVAVAAVGVTYLAVYRKEQGLDRARAQIAEQGPRIVEQMLSYGAETMDED
FT                   LNRAQTLTTEAYRPQLVAQQEAARKGGATTNEYWAVSSAVLSSSMDEAAMLLAMQGQRG
FT                   TKAEDLKFITATVRVDFDKIGDNWRVDNLTVLKAPLMQGAGQ"
FT   gene            149619..150170
FT                   /locus_tag="Mkms_0135"
FT   CDS_pept        149619..150170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89353"
FT                   /db_xref="GOA:A1U945"
FT                   /db_xref="UniProtKB/TrEMBL:A1U945"
FT                   /protein_id="ABL89353.1"
FT                   /translation="MSPRRRVDGDEPDFFAVSPRRPRRWGLPLIATVAALLLAAALTVS
FT                   TLMLVSHETDRRAEVRDAAALDYVRSFMTSYTTLDPFNANAYADRILAQGTGEFAKMFK
FT                   EKMNEIVIQVARAEPTEGNVVEAGVQRWNDNGSVDVLVATTTTSKTPDGKKTIESGNRW
FT                   VATTTQEGQQWKISQLIQVI"
FT   gene            150137..151090
FT                   /locus_tag="Mkms_0136"
FT   CDS_pept        150137..151090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89354"
FT                   /db_xref="GOA:A1U946"
FT                   /db_xref="UniProtKB/TrEMBL:A1U946"
FT                   /protein_id="ABL89354.1"
FT                   /translation="MEDQPADSGDLTTDPAGTGSAEPKRGRRLPWRRAKKAAAESDSPG
FT                   VAAEEPATPEEPSTPDEQAPRMPTGKARRSPKPVSATDTEPEPEPEPEVAVEKEPDAEP
FT                   EGEAQAAEPEVEAETADGAGESDAAGESEGEPEPEPVLVPHRPAGRRLLIAAAAASVVF
FT                   VGAGAFAGAMLQPYLADRAEVDTKLNIARTATEAITTLWSYTPEDMATLPDRSSRFLTG
FT                   DFATEYRRYIDAIVSTNEQAKVTNTTQVMGTAVESLTPTEATALVYTNSVSTSPVSKNV
FT                   PSLRYLSYRLTMERDGADWLITGMNAVTKLDLTPQL"
FT   gene            151107..151781
FT                   /locus_tag="Mkms_0137"
FT   CDS_pept        151107..151781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0137"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   mmc:Mmcs_0128 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89355"
FT                   /db_xref="GOA:A1U947"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1U947"
FT                   /protein_id="ABL89355.1"
FT                   /translation="MAVRSPVSNRLTVTALLLLTFATGLIDAVSVLVLGHVFVANMTGN
FT                   VIFLGFWFVPHSGVDLTAALVAFVSFLIGAVIGGRLARHLGSRPRPWLSVALGVEVVAL
FT                   MVLAVLAGTGVLDYRDNTKLVLIACLAMVFAIQNATARQFGVQELSTTVLTQTIVGIGF
FT                   DSRLAGGSGEREKLRYGVVLTMCAGAVVGATLTLVTVAPVIALAGAVVATAAALFRFGP
FT                   PA"
FT   sig_peptide     151107..151193
FT                   /locus_tag="Mkms_0137"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.906 at
FT                   residue 29"
FT   gene            151778..152548
FT                   /locus_tag="Mkms_0138"
FT   CDS_pept        151778..152548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0138"
FT                   /product="fructosamine kinase"
FT                   /note="PFAM: fructosamine kinase; KEGG: mmc:Mmcs_0129
FT                   fructosamine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89356"
FT                   /db_xref="GOA:A1U948"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:A1U948"
FT                   /protein_id="ABL89356.1"
FT                   /translation="MTEFVKRNPDAPPGFFACEAAGLRWLAAAAGAPCVPVIDCDATSL
FT                   TLEHLDSAAPSRSAAAAFGARLAVTHDAGASGFGAGPDGWGGPGFFGPLQKPLPMSLTA
FT                   HPTWGEFYADERLGPMGEHAAPRLTAAGREALAAVRDLCRAGRFDDGDPPARLHGDLWS
FT                   GNLMWTPDGVVLIDPAAHGGHRETDLAMLALFGCPHFDEVIAGYQSVRPLRGGWRERIA
FT                   LHQLYPLLAHVVLFGGGYIRQTESALRSVLSDFA"
FT   gene            152921..155212
FT                   /locus_tag="Mkms_0139"
FT   CDS_pept        152921..155212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0139"
FT                   /product="AAA ATPase containing von Willebrand factor type
FT                   A (vWA) domain-like protein"
FT                   /note="KEGG: mmc:Mmcs_0130 AAA ATPase containing von
FT                   Willebrand factor type A (vWA) domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89357"
FT                   /db_xref="UniProtKB/TrEMBL:A1U949"
FT                   /protein_id="ABL89357.1"
FT                   /translation="MAKHRGAKRRSKKIAALGAVTVTATALTVGAAPAPQASAAAARST
FT                   DAVDLTADFRLFPPPQAIPDLTGGAGEAAYDLKNEFADFVFRSIFENLNLAAFAQAAGV
FT                   DPQSILERVLDNLPLALLTDPIFVDLLGGITLPLAAALGALPVLNQIPLLRDLLTQGLN
FT                   VAGLNTISGLLDILGLDLSNLADLTGLGERVGVNLVTSGDVFTLLKVLGTDLGWVPTLP
FT                   NSVADDVNETEYLGIGVDGVLDLVDTGIINVPGLLNQLLDLLNLNTDQIPDVLKVRAPV
FT                   VIGEGVGAFAAGMAYQDILAQLPNQPGGANYNGVEADPLLGSVTVLPMLLLRNPGRANG
FT                   GLFARLYPLAGLFGIDTVTPDTEVSNSGGVRLPGGLYVGGATLIPVKIDVTLQHDWLSD
FT                   VPAWPNPFSLLNTLTAVVAPTYILRGLDTGLVAGAVAGQLGPQIGEVVGGIAEDDPLAL
FT                   DFYVTVPIDALPLLEPTYLFFDAINLLTGANLNNPIGTALGPALSSLVNLGYTDVVRQW
FT                   NDDGDYWEYVRTFDDTDVPTAFGSFPDINWMNVPGDIAGAFAAGVRQAFEDGLVNRDGP
FT                   VKNALATLLNLIGLDNGLPGGIGGAGLNGVLDQIRDTIDDVLGGLDLPRPSTAAVNSVP
FT                   DDASPRIALRTVGGEDTPAEEADDDTKDHVEDVPVADTDTDGDADTDTDIDTGTDTENE
FT                   PVDEPEDQLEEDETTVEDDTTVEDEDASETEPADDTADTEDTADTKDTGDTGDTKDGDT
FT                   GESGAGDKAA"
FT   sig_peptide     152921..153040
FT                   /locus_tag="Mkms_0139"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.544 at
FT                   residue 40"
FT   gene            complement(155216..157396)
FT                   /locus_tag="Mkms_0140"
FT   CDS_pept        complement(155216..157396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0140"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmc:Mmcs_0131
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89358"
FT                   /db_xref="GOA:A1U950"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1U950"
FT                   /protein_id="ABL89358.1"
FT                   /translation="MTDVTNPPISRVTSRRGVSAGGRSGAPSRTFRTDIEGLRAVAVLA
FT                   VVLYHAGMPGLGGGFIGVDVFFVVSGFLITGLLWRQVAAGGGVRLGAFYAARARRLLPA
FT                   AALVLVATAVGAVLLLPPLQARAVLGDAIAGALYVGNYRFAIQGTDYLAATEPSPLQHY
FT                   WSLGVEEQFYLVWPLLIVGTAWLIARRFGPGAARSVLPFAAVLSAAAAASYAVSLAWTG
FT                   DWPAWAFFSLPTRAWELAAGGLVALSVGWWRRLPPVAAAAVGWSGLVLIVAACTRVTAT
FT                   TPFPGTAALLPVAGTALVIVAGCATPNLGVGRLLSKPLPRAIGRVSYSWYLWHWPVLIL
FT                   APAMFGTDLGLASRLAMIVISLGLAILTLHLVENPARFAAALRGSAVRSLAVGGVATAA
FT                   AVCAAIVLLVIRPVPTGDGPAATPVALTAPAPRATAGPAPEVAPSAPTPRQQVQAAVAA
FT                   SAEMRSVPADLSPSLGNVTKPEVFVNGCVLSWRDVDQPECVSGDAESAVSVALVGDSHA
FT                   AMWQPALETVAEQNHWRLETMSKVTCPLMDLPITSPYLGRTFSECEQWRRDVLARLESE
FT                   RPQLIVVDMSRRYGADFGFVSYDPAWVEGLGRLVSRLRATGAAVLVLGPAPDPLSTVPS
FT                   CVSDHMDDVVACSPGRAAALNAGGIAAEANAAQAAGGSYADLGDLFCTSQRCPVIVGNT
FT                   LVYRDDNHITGEYAQWLAPVIGEITHGAFAPN"
FT   gene            complement(157447..158478)
FT                   /locus_tag="Mkms_0141"
FT   CDS_pept        complement(157447..158478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89359"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:A1U951"
FT                   /protein_id="ABL89359.1"
FT                   /translation="MFALCAALGTMGEPHARASDPKSLLLGAIANTKGSYLVYNFGGEF
FT                   AAPFRAADGREYTLNNGGHLMTIKNASSRLNPRLLVDTHQGYQARCERDPRARTGEGLW
FT                   QASETFTPHQAWQALGQPTIAVNANFFDVRGQQGGSWRETGCSSPLGAYVDNTRGLGRA
FT                   NAPITGTIAYAGKQGLSGGDETWSALATMILPVGGAPYVVMPKGKQDFDAASPEIQKLM
FT                   DRNARFVAVAGLGLLAPGETGQLNDPGPSAARTAVAYSSASDQLYVFQGGNYTPDNMQD
FT                   LFRGLGAEHALLLDGGGSSAIVLRRDTGGMWSGAGSPRGSCDTRQVLCDSRERALPSWL
FT                   AFN"
FT   gene            158767..159057
FT                   /locus_tag="Mkms_0142"
FT   CDS_pept        158767..159057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89360"
FT                   /db_xref="GOA:A1U952"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:A1U952"
FT                   /protein_id="ABL89360.1"
FT                   /translation="MIGTILGALVVGLIVGALARLIMPGKQNIGVIMTIVLGALGSFLG
FT                   SWLTYQLGYSNSNGGFEIIPFLVGIIVAIVLIAIYVGVTGKRGSRPGSTVR"
FT   gene            complement(159113..160396)
FT                   /locus_tag="Mkms_0143"
FT   CDS_pept        complement(159113..160396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0143"
FT                   /product="SMP-30/gluconolaconase/LRE-like region"
FT                   /note="KEGG: mmc:Mmcs_0134 SMP-30/gluconolaconase/LRE-like
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89361"
FT                   /db_xref="GOA:A1U953"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A1U953"
FT                   /protein_id="ABL89361.1"
FT                   /translation="MRICLPYKAFGVLAVAALAGCSTSAPDETAPSPSTSTSAPAPASA
FT                   DRTVTVEVPAGMDAAPFDEARRVSIPAGWTMAVWARVPKARFARWAPDGALLVSVPSTG
FT                   EILKLDGSGSTPLLEGLTQPHGMAFAGSTLYVAESDEISAYDYVDGRAGNRRTVAAGLP
FT                   DAESPDLRGAYAHALKSVAVGPDGAVYFSIGSTGNISAEDRDATPPRATIMRVPPGGGP
FT                   AEPFATGVRNGTGLAVAPDGSVWTAVNGRDNVADPATGEVDPAYVNDHPPEQLAKLTPG
FT                   RELGWPYCNIDGGPADVPFIRDVQTNADGDKLDCAALPPVEQSFGAHSAPLGLSFVDGE
FT                   LPEPYARGALVGIHGSWNRRPPRAPEVSFYPWRDGGLGDQQTLVGGFQDEDGSRWGRPV
FT                   DAVAGPDGAVYITDDDAGAVYRLAPPGR"
FT   sig_peptide     complement(160259..160396)
FT                   /locus_tag="Mkms_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.606 at
FT                   residue 46"
FT   gene            complement(160374..161138)
FT                   /locus_tag="Mkms_0144"
FT   CDS_pept        complement(160374..161138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0144"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein domain protein; KEGG:
FT                   mmc:Mmcs_0135 pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89362"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:A1U954"
FT                   /protein_id="ABL89362.1"
FT                   /translation="MTTAERIDVRRAGERPRTRISWLDSKHSFSFADHYDPANTHHGLL
FT                   LVNNDDTVTPGSGFETHPHRDMEIVTWVLRGSLVHQDSTGNSGVIYPGLAQRMSAGRGI
FT                   LHSEKNDSWTLTGEASHREPVHFVQMWVVPDESGIAPGYQQLEIDDEQLRGKFVTIASG
FT                   MPEHRDDTAITIRNRYAALHGARLEPGDNVELPQAPYLHLFVPRGEVTLEGAGALTEGD
FT                   AVRFTASGGQRVTAVEPAEILVWEMHANLSAV"
FT   gene            161211..161666
FT                   /locus_tag="Mkms_0145"
FT   CDS_pept        161211..161666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0145"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_0136
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89363"
FT                   /db_xref="GOA:A1U955"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U955"
FT                   /protein_id="ABL89363.1"
FT                   /translation="MYSVWLSDEEQQVWRGYLAMVAELQAAMNRQLQHDCGLSLADYEV
FT                   LVALSERGGRRMYELGETLAWEQSRLSHQLRRMRERGLVSRRGATDDRRGATVALTDAG
FT                   RAALRTAAPGHAALVRRVLFDGMPTARRKAFSDVIDTVRERLRDSPV"
FT   gene            complement(161655..162779)
FT                   /locus_tag="Mkms_0146"
FT   CDS_pept        complement(161655..162779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0146"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0137 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89364"
FT                   /db_xref="GOA:A1U956"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U956"
FT                   /protein_id="ABL89364.1"
FT                   /translation="MRTKGALLWELNAPFRVDEIEVGDPVDDEVQIRVHAAGMCHSDYH
FT                   LTTGATPIGLPALGGHEGAGVVTKVGRNVTGIEEGDHVILAFIPACGQCQPCLKGYRSL
FT                   CDRGALLLGGKAIADGTSRVHAGSTEVSPMNLLGTFAPYMTVHKDSVVKIDHDVPFETA
FT                   AIMGCAVPTGFGSATNVAEVQPGETVVIVGVGGIGLSALQGAVIAGARNVVAVDPVEFK
FT                   RDQATKFGATHVFSSMAEAIGPVLELTHGFMAEKTIIAVGEMRGEYIEEAMTLTAKTGT
FT                   CVVTGMGSMFDADVKLNLFLFTMLQKTLKGNIFGGGSSHVETPRLVGLYKSGLLKVDEM
FT                   VTNTYRLEDINQGYQDMLDGKNIRGVITFDESDW"
FT   gene            162974..163876
FT                   /locus_tag="Mkms_0147"
FT   CDS_pept        162974..163876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0147"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89365"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1U957"
FT                   /protein_id="ABL89365.1"
FT                   /translation="MMGPFLGTEALAAGMVTRRQLGRRYRALYRNVYLPAEQELTAVTR
FT                   AKGAWLWSGRDAVAVGLSASALHGSKWIEANEPAELIRIGDAVSGILIRRDRLPEDEVC
FT                   VRLGIPTTTAARTAFDLGRRGNLTAAVQRIDALANATLLTRADVDPLLERHRGARGIVQ
FT                   ARRAIDLMDGGAESPPETTVRLMLIAARFPRPETQIVVRDQFGRFVGRIDMGYREYQIG
FT                   VEYDGPQHWTDPIQHARDIDRQAELAAQGWVIIRVSRDILRHRRDVAIRRTRDAMRAAG
FT                   WPNWAQVRVDPRISVERWA"
FT   gene            complement(163904..164917)
FT                   /locus_tag="Mkms_0148"
FT   CDS_pept        complement(163904..164917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0148"
FT                   /product="RNA polymerase, sigma subunit, ECF family"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   mmc:Mmcs_0139 RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89366"
FT                   /db_xref="GOA:A1U958"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014305"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A1U958"
FT                   /protein_id="ABL89366.1"
FT                   /translation="MSAIVRKLASVTVLARTVDDGPDEDAFLADAQKYRRELLAHCYRM
FT                   TGSLHDAEDLVQETYLRAWKSYKGFQGKSSVRTWLYRIATNTSLTALDGRARRPLPTGL
FT                   GAPSSDPVDDIHERAEVPWLQPLPDDAGDPSSIVGSRESVRLAFIAALQHLSPRQRAVL
FT                   VLREVLQWKAAEVADALGTSTAAVNSLLQRARAQLDAIGPSEDDDLRPPESPEARDLLT
FT                   RYIAAFETYDVDRLADLFTAEAVWEMPPFDGWYQGPHDIVLLSKTHCPAERAGDMQLIP
FT                   TTANGQTAAALYMRNPATGRHEAFQLHVLDVTADGISHVVAFHATTFAPFGLADTL"
FT   gene            164962..165801
FT                   /locus_tag="Mkms_0149"
FT   CDS_pept        164962..165801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0149"
FT                   /product="Acylglycerol lipase"
FT                   /EC_number="3.1.1.23"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0140
FT                   acylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89367"
FT                   /db_xref="GOA:A1U959"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U959"
FT                   /protein_id="ABL89367.1"
FT                   /translation="MASTRSERHFDGVGGVRIVYDTWTPDAPARGVVVLSHGYAEHARR
FT                   YDHVAQRFGEAGLIVYALDHRGHGRSDGKRVYLRDIAEYTGDFHTLVGIAAREHPDLPR
FT                   IVLGHSMGGGVVFAYGAEHPGDYAAMVLSGPAVYAQSAVKPWLVTVAKLLGRIAPGVPV
FT                   EQLDADAVSRDPEVVAAYKADPLVHHGKLPAGVARGLFTVGETMPQRAGALTAPLLVVH
FT                   GEKDRLIPVEGSHRLVDRVASQDVHLKVYPELFHEVFNEPERATVLDDVISWIEVRL"
FT   gene            165798..166811
FT                   /locus_tag="Mkms_0150"
FT   CDS_pept        165798..166811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0150"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0141 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89368"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U960"
FT                   /protein_id="ABL89368.1"
FT                   /translation="MKAVVRLAASCIAAALLVAGCGSDDKAADETAPAQTGWVDDEVTF
FT                   TADGLTIHGTYRHRDGSGPAALLISESGQTDRNGDNAVAGPVGNMRQLAELLSERDVAS
FT                   LRYDKVGTGRTGLGPYATRPADVGTAVYTAGAAAALRFLADQPDTASDRISVYALGEGT
FT                   VHAMSLAAANDPAVHSLALLQPLAARYLDIITGRVRAEADPTVLANWLAAVEEIRTKGT
FT                   VPAQLPEGLGAIVNPGNIKAVIEADRVDPLALAAKVPAGTPVLLTCSNSDGQAKCDALR
FT                   PLMDALRHTELTVVELDGVNHVLRDDPSDNVANYAQQAPLSPQVVKALDEFVGEQP"
FT   sig_peptide     165798..165902
FT                   /locus_tag="Mkms_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.585 at
FT                   residue 35"
FT   gene            166822..167571
FT                   /locus_tag="Mkms_0151"
FT   CDS_pept        166822..167571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0151"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89369"
FT                   /db_xref="InterPro:IPR024498"
FT                   /db_xref="UniProtKB/TrEMBL:A1U961"
FT                   /protein_id="ABL89369.1"
FT                   /translation="MSDDKMLARIAALLRQAEGTDNVHEAEAFMAAAQRLATATSIDLA
FT                   VARSHSDQRTKAQTPVQRTITIGEAGTRGLRTYVQLFVVIAAANDVKCDVASNSTFVHA
FT                   YGFAEDIDASHALYASLVTQMVKASQAYIESGAHRPTPTITARLNFQLAFGARIGVRLT
FT                   EAREEALAAATEAEDSRPGTAIALRDKDLELKDFYRQASQARGTWRATSATAGYSSAAR
FT                   RAGDRAGRRARLGPSQELAGARTALET"
FT   gene            167568..168083
FT                   /locus_tag="Mkms_0152"
FT   CDS_pept        167568..168083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89370"
FT                   /db_xref="InterPro:IPR027595"
FT                   /db_xref="UniProtKB/TrEMBL:A1U962"
FT                   /protein_id="ABL89370.1"
FT                   /translation="MSGRDTQRAKVYAAEQFVRTLFDRAAERGNRIVEFFGTQLTLPPE
FT                   ARFASVASVQAYVDDVLAHPRMRTGWPGAGALTVRPRRGATAAHYEVGDGRALIAVPER
FT                   HSTWALRELVVLHEIAHHLSRAEPAHGPAFVSTFCEVAEAVMGPEVAHVLRVVYAKEGV
FT                   RMGGGSKG"
FT   gene            168087..168752
FT                   /locus_tag="Mkms_0153"
FT   CDS_pept        168087..168752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0153"
FT                   /product="O-methyltransferase, family 3"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; O-methyltransferase, family 3;
FT                   conserved hypothetical protein 95; KEGG: mmc:Mmcs_0144
FT                   O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89371"
FT                   /db_xref="GOA:A1U963"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1U963"
FT                   /protein_id="ABL89371.1"
FT                   /translation="MRVSEPNPQAVDQLFDRLLHTEDDALIAARESAAAAGMPQIEVSA
FT                   QHGRLLLLLASVTHARRVLEIGTLAGYSTINLARGVGPDGRVVTLEFDPRHAEVARTNL
FT                   ARAGVADQVEVLVGAALDTLPTLQHGAPFDLVFIDADKENNVAYVEWAIKLGRPGTVIV
FT                   VDNVTRMGRIYDPAPDDLQAQAVREMLEMMGSHPRLSTAAIQTVGAKNWDGFAVAVVT"
FT   gene            168779..169177
FT                   /locus_tag="Mkms_0154"
FT   CDS_pept        168779..169177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89372"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1U964"
FT                   /protein_id="ABL89372.1"
FT                   /translation="MGICYRNGMLTVDRVVNASPAEVWSVLIDLDAWPKWGPTVAGAEL
FT                   LDGTELGLGERGKVYTPVGIPLPFTITEFEPGRRWSWQVAGIPATAHGVEPTEAGTRLY
FT                   MGAPVWAGAYLPVLAVALQRIDRMVSGG"
FT   gene            complement(169271..171013)
FT                   /locus_tag="Mkms_0155"
FT   CDS_pept        complement(169271..171013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0155"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: mmc:Mmcs_0146 dihydroxy-acid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89373"
FT                   /db_xref="GOA:A1U965"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:A1U965"
FT                   /protein_id="ABL89373.1"
FT                   /translation="MPSGSSGTPADALRASDSSPDIKPRSRDVTDGLEKTAARGMLRAV
FT                   GMGDDDWVKPQIGVGSSWNEITPCNMSLQRLAQSVKGGVHSAGGFPLEFGTISVSDGIS
FT                   MGHEGMHFSLVSREVIADSVETVVQAERLDGTVLLAGCDKSIPGMLMAAARLDLASVFL
FT                   YNGSIMPGVAKLTDGSEREVTIIDAFEAVGACARGLMSREDVDIIERAICPGEGACGGM
FT                   YTANTMASAAEALGMSLPGSASPVAIDKRRDEYARKSGEAVVEMLRRGITARDILTKEA
FT                   FENAIAVVMAFGGSTNAVLHLLAIAWEANVKLTLEDFTRVGQKVPHLADVKPFGRHVMK
FT                   HVDEIGGVPVVMKALLDAGLLHGDCLTITGETMAENLAHIEPPDPDGKVLRAMNNPIHP
FT                   TGGITILHGSLAPEGAVVKSAGFDSDVFEGTARVFERERAALDALEDGTITHGDVVVIR
FT                   YEGPKGGPGMREMLAITGAIKGAGLGKDVLLMTDGRFSGGTTGLCVGHIAPEAVDGGPI
FT                   AFVRDGDRIRLDVAKGTLDLLVDEAEFESRKAGFEPLPPVYTTGVLAKYTKLVGSAAVG
FT                   AVCG"
FT   gene            171093..171701
FT                   /locus_tag="Mkms_0156"
FT   CDS_pept        171093..171701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0156"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   mmc:Mmcs_0147 protein of unknown function DUF305"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89374"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:A1U966"
FT                   /protein_id="ABL89374.1"
FT                   /translation="MTSRALRPLALSAALLTALFLSACTSTEQPQSEGSTSHAHSETAG
FT                   DAHAPHNADDVAFARDMMPHHQQALQLVDLARDRSSDPALQGIASAIAAAQGPEMDQLA
FT                   GMLRGWGQDPEAGMHHGGHGMAMPGMVDDATMKRLESLRGAEFDRLWLESMISHHQGAV
FT                   EMAKAEIANGDNADAKAMAEHIIEAQEAEIAQMKQMLEG"
FT   sig_peptide     171093..171212
FT                   /locus_tag="Mkms_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.644 at
FT                   residue 40"
FT   gene            171704..172015
FT                   /locus_tag="Mkms_0157"
FT   CDS_pept        171704..172015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0157"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   mmc:Mmcs_0148 protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89375"
FT                   /db_xref="GOA:A1U967"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U967"
FT                   /protein_id="ABL89375.1"
FT                   /translation="MSTGAPEDVAVHGYSAQKENYAKRLRRIEGQVRGIAKMIEDDKYC
FT                   IDVLTQISAVNSALQSVALGLLDEHLGHCVTQAVAEGGEQADAKLAEASAAIARLVRS"
FT   gene            172043..172540
FT                   /locus_tag="Mkms_0158"
FT   CDS_pept        172043..172540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0158"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0149 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89376"
FT                   /db_xref="GOA:A1U968"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1U968"
FT                   /protein_id="ABL89376.1"
FT                   /translation="MLPASVEHLTALRDDRTAFGELLGCAVPDGWPEFPESIEFTIGQL
FT                   TEHPHQAGWWMHFFLADGGAVLVGSGGFVGPPQDGVVEIGYEIAPEFRGRGYATAAARA
FT                   MIDKAKTATARLTTVVAHTLAHENPSTAVLRRLGFIRVAEIEDSDDGPLWRWEVAVPAG
FT                   AR"
FT   gene            172548..173750
FT                   /locus_tag="Mkms_0159"
FT   CDS_pept        172548..173750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0159"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0150 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89377"
FT                   /db_xref="GOA:A1U969"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U969"
FT                   /protein_id="ABL89377.1"
FT                   /translation="MTRAWTPRVAGQLTVLAAAAFVYVTAEVLPIGALPAIAADLRVSE
FT                   ALVGTLLAGYALVAAVTTMPLVRLTASWPRRRTLLLTLVCLTASQAVCALAPNFAVLAG
FT                   GRVMCALTHGLMWSVIAPIGVRLVPADHAARATTAVYAGTGLALVVGNPLTAAMSQLWG
FT                   WRTAVVVVTAAAATVTVAAWRALPPMRSPANVATRVAPRPRNPRLVTLAALTLLGVTGH
FT                   FMAYTFVVVVIRDVVGVPGAQSAWLLAAFGVAGLVGMAALARPGDRRPHLAVVGCLAVM
FT                   VLSFGVLTGLAAGHRTGLLVLGVGALAVVAWGAASTAVPPMLQAAVMRTAPEDPDGASG
FT                   VYVAAFQIGIVAGALGGGLLYERAGAGLVLAGSTAVTAVVLACVLRRSDLLRAPATVSE
FT                   R"
FT   sig_peptide     172548..172664
FT                   /locus_tag="Mkms_0159"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.738 at
FT                   residue 39"
FT   gene            173827..174813
FT                   /locus_tag="Mkms_0160"
FT   CDS_pept        173827..174813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0160"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   mmc:Mmcs_0151 ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89378"
FT                   /db_xref="GOA:A1U970"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:A1U970"
FT                   /protein_id="ABL89378.1"
FT                   /translation="MPQQTMRKLTTAIFAAGLFGGLVLSAAPALAQPAPPPPPPAPVDP
FT                   FAPPPPPANPFAFPAPAAADPFAPTAQPLPIPEGTPAGQNPTPYVGKPVFAPPTFNPVN
FT                   GSIAGAAKPIYIDFQRPIANRALAEQAIHISSNPPVPGRFYWTSDTQVRWRPQDFWPAG
FT                   TVVNIDASGTKSSFTVPEQLVATIDNKSLQMEIHRNGELVKTFPVSMGKKGYDTKNGTY
FT                   YVLEKFADIVMDSSTYGVPVDDPSGEGYKLKVQDAVRIDNSGVFVHSAPWSVGSQGESN
FT                   VSHGCINLSPANAQWFFDNFGSGDAVVIKNSTGIYNQPDGASDWQMF"
FT   sig_peptide     173827..174021
FT                   /locus_tag="Mkms_0160"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.882 at
FT                   residue 65"
FT   gene            174912..175874
FT                   /locus_tag="Mkms_0161"
FT   CDS_pept        174912..175874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89379"
FT                   /db_xref="GOA:A1U971"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:A1U971"
FT                   /protein_id="ABL89379.1"
FT                   /translation="MPGADKATARTVTVIVLILLAGVALRGRIPGAEPAADEPTDSGPG
FT                   SLIAVLVMLGLSMAVIAVSVVSQARHPVTRPGTAADPPRFRGGDGARFTWRMVLVMVGA
FT                   LLVWLLVVLTLMRISGWLDVSVDPPAAPSPDPDPGSSSAADSEPPPPPPDSEPPVSNAV
FT                   LGYFAAAAALFVLLSVIGVMAGRNARRRPATVVATDDEGDGDAPSTSRTQSLARAAERG
FT                   LIEIGDLSREPREAIIACYAAMERELGKSPGAMPQDSDTPTEVLARAVDRRLLHGESAT
FT                   ELVDLFEEARFSAHVMGEDHRDAAVRVLRLVLRELQDAA"
FT   sig_peptide     174912..175019
FT                   /locus_tag="Mkms_0161"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.793) with cleavage site probability 0.293 at
FT                   residue 36"
FT   gene            175871..176356
FT                   /locus_tag="Mkms_0162"
FT   CDS_pept        175871..176356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89380"
FT                   /db_xref="GOA:A1U972"
FT                   /db_xref="UniProtKB/TrEMBL:A1U972"
FT                   /protein_id="ABL89380.1"
FT                   /translation="MTRAVAAAMLMLVAVEIYAVVRLDRDDVLTVSAVMLAGALIAARF
FT                   ALRGEVAPASTATDADERGAALRRWVDRTETMIGWSEASRADWDGRLRPLLARQFELAT
FT                   GQRKARDARAFHATGQMLFGPELWQWVDPENVSRTGADEPGPGREALGEILRRLERV"
FT   gene            176367..177329
FT                   /locus_tag="Mkms_0163"
FT   CDS_pept        176367..177329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0163"
FT                   /product="ATPase associated with various cellular
FT                   activities, AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities, AAA_3; ATPase associated with various cellular
FT                   activities, AAA_5; KEGG: mmc:Mmcs_0154 ATPase associated
FT                   with various cellular activities, AAA_3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89381"
FT                   /db_xref="GOA:A1U973"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:A1U973"
FT                   /protein_id="ABL89381.1"
FT                   /translation="MNMPATTTTAHCEAVLDEIGEVVVGKRRALALILTAVLARGHILI
FT                   EDLPGLGKTLIARSFAAALGLQFTRVQFTPDLLPADLLGSTIYDMHSGRFEFRHGPIFT
FT                   NLLLADEINRTPPKTQAALLEAMAERQVSIDGVTHPLPTPFLVLATDNPIEYEGTYPLP
FT                   EAQLDRFAIRLELRYLSGPDEVTMLRRRLDRGSAAPTVQQVVDGDGLLAMQESVEQVTV
FT                   HEDVLQYVVSLAAASRQHPQVAVGVSPRAELDLVQLSRARALLAGRDFVIPEDVKSLAV
FT                   PALAHRISLRPEMWVRRVQGADVVEELLRRLPVPRTGNP"
FT   gene            177329..178555
FT                   /locus_tag="Mkms_0164"
FT   CDS_pept        177329..178555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0164"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   mmc:Mmcs_0155 protein of unknown function DUF58"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89382"
FT                   /db_xref="GOA:A1U974"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:A1U974"
FT                   /protein_id="ABL89382.1"
FT                   /translation="MYDVELHWRASPLARALATCAAVGLAAALFTLRWELVAFVAPMLG
FT                   VLCSVGWQPRPPGVSVSTSTPLQRCFETEPSTVDIRAVADDGSDVTMTPSTLDGADLAT
FT                   AADGTGATVTLTAARWGRYPVRANVRVAGRGGLLEGTGSVDAAHVCVFPLAAPQSVSVP
FT                   RTDLLDRLGTHLTRHIGPGVEYADIRGYVPGDHLRTVNWSVSARRRSLHVTQRLTDRSA
FT                   DVVVLVDTYAQPPGPATAATERIARGAVQVVQSALRYGDRAGLVTLGSRRTRWLGADIG
FT                   QRQFYRILDVLLAAGDFDATTGSLAPQAAVPPGAIVVAFSTMLETEFALALIDLRKRGH
FT                   TVIAVDVLEGSPLDGDRDPLIDRMWALQRSFMYRDMGTIGVDVVSWPADATLDQAMALT
FT                   RHRRTGARR"
FT   gene            178552..179022
FT                   /locus_tag="Mkms_0165"
FT   CDS_pept        178552..179022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89383"
FT                   /db_xref="GOA:A1U975"
FT                   /db_xref="UniProtKB/TrEMBL:A1U975"
FT                   /protein_id="ABL89383.1"
FT                   /translation="MKALLPSVFGVLMVAAVGYRADGPALVTAVAALVAVTVSVWWRPA
FT                   AVVAVVLTVSAVVLAPSAPMSTALAGLAAAAYLVLRHNSGHGEARATPPTMVAAVAFAL
FT                   TATAVVALPVDIPWLPLAAPVALLVGYVLTLRPFSDFGVLGRAQHDPARRNP"
FT   sig_peptide     178552..178647
FT                   /locus_tag="Mkms_0165"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.696) with cleavage site probability 0.380 at
FT                   residue 32"
FT   gene            complement(179019..181013)
FT                   /locus_tag="Mkms_0166"
FT   CDS_pept        complement(179019..181013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0166"
FT                   /product="endothelin-converting enzyme, Metallo peptidase,
FT                   MEROPS family M13"
FT                   /EC_number="3.4.24.71"
FT                   /note="PFAM: peptidase M13, neprilysin; peptidase M13;
FT                   KEGG: mmc:Mmcs_0157 neprilysin"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89384"
FT                   /db_xref="GOA:A1U976"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:A1U976"
FT                   /protein_id="ABL89384.1"
FT                   /translation="MTVEATIKSGIDLSYLDTAARPQDDLFGHVNGRWLADYEIPADRA
FT                   ADGAFRTLYDRAEEQIRDIITEAADANAADGTDEQRIGDLYASFLDEATVARIGVQPLL
FT                   DELALVDAADSPDALAAVLGGLQRTGVGGGAGVYVDTDSKNSTRYLLHFSQSGIGLPDE
FT                   SYFRDEQHAEILAAYPGHIAAMFALVYGGDHTQTAERIVALERKLAAAHWDVVKRRDAD
FT                   LTYNLRTFADLSAEAPGFDWAGWVTALGTTPESVAEVVVRQPDYLTEFAAAWSSEPLED
FT                   WKHWVRWRLIHARAFLLTDELVAEDFAFYGRLLSGTEQIRDRWKRGVSVVENLMGEALG
FT                   KLYVQRHFPPNAKARMDELVANLREAYRVSINRLEWMTPETREKALAKLDKFTPKIGYP
FT                   VRWKDYSQLVIRRDDLYGNYRRGYQLASDREVQKLGGPVDRDEWFMTPQTVNAYYNPGM
FT                   NEIVFPAAILQPPFFDADADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNLVDWWTD
FT                   ADRTEFGARTKALIEQYEQYTPRELEGQNGHHDAHVNGAFTVGENIGDLGGLSIALLAY
FT                   ELSLKGEPAPVIDGLTGVQRVFFGWAQVWRTKYRSAEAIRRLATDPHSPPEFRCNGVIR
FT                   NLDAFYEAFEVGADDALYLEPERRVRIWN"
FT   gene            181054..181668
FT                   /locus_tag="Mkms_0167"
FT   CDS_pept        181054..181668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89385"
FT                   /db_xref="GOA:A1U977"
FT                   /db_xref="UniProtKB/TrEMBL:A1U977"
FT                   /protein_id="ABL89385.1"
FT                   /translation="MPDELTDERADAAESADGRVLTGFGVASAVLAALSVAAVVLAVMI
FT                   WSGHREASAERAYQTRVLQAAADWTSVLVNMNKDSVDASMQRLHENTIGDLNADFDSAV
FT                   EPYRQLVQRLQTRTRGQVDSVSIESLHHPVPGPDGGPALAPPPDPQLSAFASRTDTVLV
FT                   VATSISDNVGNKEPQTVRWTLRLDVSDVDGKLMISRLEPIR"
FT   gene            181665..182354
FT                   /locus_tag="Mkms_0168"
FT   CDS_pept        181665..182354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0168"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0159 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89386"
FT                   /db_xref="GOA:A1U978"
FT                   /db_xref="UniProtKB/TrEMBL:A1U978"
FT                   /protein_id="ABL89386.1"
FT                   /translation="MRNRLRVLVFDILAPVAAIAGLLYIGLALGWPLWWVSVCSVLCLL
FT                   IVQGVIVNVALMRRDGVTVGTDDDGPGLRLAVMGLATVAVVAAVALGYQRWTVPDRAFT
FT                   ADSAEVVRIASSVSEATATFSPQSPTASIDRAAAQMVPERAQAFKDEFAGVAKQLTSKN
FT                   VSAQASTVSAGVEAIGPEAASVAVVLRGTQSVPGQPVDNAVLALRVTLSKTDGRWMVDD
FT                   VTPIHAR"
FT   sig_peptide     181665..181757
FT                   /locus_tag="Mkms_0168"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.727 at
FT                   residue 31"
FT   gene            complement(182403..182822)
FT                   /locus_tag="Mkms_0169"
FT   CDS_pept        complement(182403..182822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0169"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   mmc:Mmcs_0160 CoA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89387"
FT                   /db_xref="GOA:A1U979"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U979"
FT                   /protein_id="ABL89387.1"
FT                   /translation="MTEWIEPEHDDLRRIMRETRTVAVVGASPNPMRPSYGVWDYLRSA
FT                   SHYELYLVNPTVSEIDGTPVYPSLADLPVVPDMVDVFRRSSELPGVLRDTISVGAKTLW
FT                   LQQGLWDEQIARDGVAAGLEVVMDRCLKVDYARLL"
FT   gene            complement(182851..183381)
FT                   /locus_tag="Mkms_0170"
FT   CDS_pept        complement(182851..183381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89388"
FT                   /db_xref="UniProtKB/TrEMBL:A1U980"
FT                   /protein_id="ABL89388.1"
FT                   /translation="MTLTSDARGTRRDAATAATRPLTAASRRASIDDRPVEFWSTAAIR
FT                   DALETDDLTVWQRIVTAIKRDPYGRTARQVEEVLEKAKPYGVSKALAEVLVRTREQMAA
FT                   AERAEVGHHVQLLLNRSGLGAPEFASRIGVGVDEFQSYIDGEVSPSASLMIRMGRLSER
FT                   FAKIRAQRANNPR"
FT   gene            complement(183378..186329)
FT                   /locus_tag="Mkms_0171"
FT   CDS_pept        complement(183378..186329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0171"
FT                   /product="MmpL11"
FT                   /note="KEGG: mmc:Mmcs_0162 MmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89389"
FT                   /db_xref="GOA:A1U981"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1U981"
FT                   /protein_id="ABL89389.1"
FT                   /translation="MMRLSGTLRRFRWAVFGAWVLLLVPAIYLALNHSSNLTGGGFEVE
FT                   ASQSLHVQYELEDHFPDQGASPLALVAAPRADASYDDMNAAVAHLEQIATQVPSVKISP
FT                   NPQQPPPQPDRPYVITLSLDFNNTGATDVAKDLRTRVGIDGEEPGEFRDGKVKMYVIGQ
FT                   GALGAAASQAIKTDVAQAEQWNLPIVLIVLLAVFGSFAAAAMPLLLGVCTVAVTMGLVY
FT                   LLSTITTMSVFVASTVSMFGIALAVDYSLFILMRFREELRAGRDAQQAADAAMATSGLA
FT                   VLLSGMTVIASVTGIYLINTPVLTSMATGAILAVAVAVLTSTTLTPAVLATFGRAAAKR
FT                   SSYLHFSRRPDTTQSRFWTRWTGWVMRRPWVAATSAALVLLTMAAPAFMMELGNSMQRQ
FT                   FEPTHEVRGGVNAAAEALGPGALGPVRVLVTFPDGNPASAAAKEPTLEAVRAEMSKAPN
FT                   VATVTPAEFGDDYRSALLSAVLTVDPEDKGARETVDWMRANLPSTAGPNVSVDVGGPTA
FT                   LIKDFDDRVSATQPLVFGFVALIAFLMLLISIRSVVLALKGVLMTVLSVAAAYGSLVAV
FT                   FQWGWLEPLGFEPIPSLDSTIPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGNTRDAVA
FT                   YGVSTSARTITSAALIMIAVFIGFAFAGMPLVAQLGVACAVAIAVDATIVRLVLVPALM
FT                   AMFDRWNWWLPKWLDRVLPSVDFEKPLPKVQIDDLVIIPDDISALGPSGADLRGMVKSA
FT                   ARMKTLAPQTVTVADPLAFSGCQPIKQRMVARNGGDQTVKLRTGAGLWRGGRNGHGDGN
FT                   GSTVRTTLPVHPVTLWRGRLSVALDALETAQQTEAETDRAPVERRTPVETTNVQLPTGD
FT                   RLQIPTGAETLRLKSYLIMCRNSSRDYAEFAELVESMETQTAAIVLSGMDRYYCGQQPK
FT                   KQWVATQLVRRLADPQPSDEHDAAISDPDAESDWALVRQRCLSVAVAMLEEAR"
FT   sig_peptide     complement(186189..186329)
FT                   /locus_tag="Mkms_0171"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.604) with cleavage site probability 0.306 at
FT                   residue 47"
FT   gene            186655..187143
FT                   /locus_tag="Mkms_0172"
FT   CDS_pept        186655..187143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89390"
FT                   /db_xref="GOA:A1U982"
FT                   /db_xref="InterPro:IPR030937"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A1U982"
FT                   /protein_id="ABL89390.1"
FT                   /translation="MRSITLGRHRLGRSVCAAFAVTAAGGVAAAALTMPATPATAAPDP
FT                   CAASQVAKTVAAVATNTSNYLAANPETDQALTTIAQQQAGPASLASLKAYLDANPQVGS
FT                   DMQKLQQPLTNLSGRCKLPVTIPQVLGLMQAAQQSGAAQPAAPAAASPVSPAAATGHR"
FT   sig_peptide     186655..186780
FT                   /locus_tag="Mkms_0172"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 42"
FT   gene            187282..187680
FT                   /locus_tag="Mkms_0173"
FT   CDS_pept        187282..187680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89391"
FT                   /db_xref="GOA:A1U983"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR032407"
FT                   /db_xref="InterPro:IPR038378"
FT                   /db_xref="UniProtKB/TrEMBL:A1U983"
FT                   /protein_id="ABL89391.1"
FT                   /translation="MLLPARTARRVVVGAAGAGAIAGAMLFGAVPAMAQPAPPPPLPPN
FT                   CTAADLAGVASGVSASTSAYLFTHPPVNDFFTSLEGQSRDQIRPQVEEYLNANPQVKAD
FT                   LTGIRQPLVDLKTRCGTATPPEDDVDTP"
FT   sig_peptide     187282..187464
FT                   /locus_tag="Mkms_0173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.596 at
FT                   residue 61"
FT   gene            187686..188417
FT                   /locus_tag="Mkms_0174"
FT   CDS_pept        187686..188417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0174"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: mmc:Mmcs_0165 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89392"
FT                   /db_xref="GOA:A1U984"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1U984"
FT                   /protein_id="ABL89392.1"
FT                   /translation="MRAETGEPEPAAQDTPGRTVLMVDDDPDVRTSVARGLRHSGFDVR
FT                   VAANGKEALRLLSAESHDALVLDVQMPELDGVAVVTALRALGNDIPICVLSARDTVNDR
FT                   IAGLEAGADDYLTKPFDLGELVARLHALLRRAHHSDRPSDTMTVGPLTIDTARRLVFVD
FT                   GERVDLTKREFDLLAVLAENNGVVLSRQRLLELVWGYDFDVDTNVADVFISYLRRKLER
FT                   DGLPRVIHTVRGIGYVLRDEP"
FT   gene            188473..189759
FT                   /locus_tag="Mkms_0175"
FT   CDS_pept        188473..189759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0175"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: mmc:Mmcs_0166 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89393"
FT                   /db_xref="GOA:A1U985"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1U985"
FT                   /protein_id="ABL89393.1"
FT                   /translation="MASAAAASAVVAAFTILTSVVLASNDDAQLDRRLDSIVDASMYPE
FT                   QLQDPRRGVLTTGRDRSTGQVVFQRGFQLPKLPPGTETVEVNGVDYRVRTLVVDQEGGV
FT                   LVSIGIRADSILLSRGRIPEYVLVGLVTVLIAGGLGWVLAGPAIRPLRKLTEQTSKLST
FT                   GTDEMPEVRGAREAEELSAAMSAMLRRLAAAQQATTNSLQAAQDFAANAAHELRTPLTA
FT                   MRADLDTLRIHDLPEDERAEVVADLSRAQRRVEAIITALGQLASGQLAQAADREPIDIT
FT                   DTLDRVARENMRSAPQVDIQVDAEDLGTVWGLPDGLRLAVDNLVRNAITHGGAGRVVLT
FT                   ARRTDGWLTIVVDDDGRGLPAEEHEMVLGRFRRGSTAAPGGSGLGLALVAQQAELHGGT
FT                   IELADSPLGGLRATLTVSTSTTGGDPQLR"
FT   sig_peptide     188473..188544
FT                   /locus_tag="Mkms_0175"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            complement(189747..190130)
FT                   /locus_tag="Mkms_0176"
FT   CDS_pept        complement(189747..190130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0176"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0167 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89394"
FT                   /db_xref="GOA:A1U986"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:A1U986"
FT                   /protein_id="ABL89394.1"
FT                   /translation="MPTVDRRTAALALLADLVCVVVFCTIGRRSHAEGLTVAGIAETAW
FT                   PFLAGTAVGWLAARAWRRPLSLTPTGVLVWVCTVTVGMVLRKLSGQGVAVSFVIVASLV
FT                   TALLLLGWRGVATALRHKQIQRS"
FT   sig_peptide     complement(190032..190130)
FT                   /locus_tag="Mkms_0176"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.995 at
FT                   residue 33"
FT   gene            complement(190190..191326)
FT                   /locus_tag="Mkms_0177"
FT   CDS_pept        complement(190190..191326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0177"
FT                   /product="conserved hypothetical protein 374"
FT                   /note="PFAM: conserved hypothetical protein 374; KEGG:
FT                   mmc:Mmcs_0168 conserved hypothetical protein 374"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89395"
FT                   /db_xref="GOA:A1U987"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1U987"
FT                   /protein_id="ABL89395.1"
FT                   /translation="MSHDATANDAKRGRADPDGSTRGKYWWVRWAIITVAVVVLTVEVV
FT                   LVWDQLAKAWKSLVSANWWWVVAAVVASLASMHSFAQIQRTLLRSAGVHLKQWRSEAAY
FT                   YAGNALSTTMPGGPVLSATFLYRQQRLWGASPVVASWQLVMSGVLQGVGLALLGLGGAF
FT                   MLGASKNPLSLIFTLGGFAALLVLAQAVASRPELIDGIGARLLARFNSLRNKPLDTGLA
FT                   KWRELLRQLESVQLGRRDLSMAFGWSLFNWIADVACLAFACYAAGGHPSLAGLTVAYAA
FT                   ARAVGTIPLMPGGLLVVEAVLVPGLVSSGMTLAGAISAMLIYRLVSWIFLAAIGWVVFF
FT                   FVFRTEKDIDPDAPVKGAHKAGEPIRNQPPRSAREDLG"
FT   gene            191446..192591
FT                   /locus_tag="Mkms_0178"
FT   CDS_pept        191446..192591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0178"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mmc:Mmcs_0169 protein of unknown function UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89396"
FT                   /db_xref="GOA:A1U988"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A1U988"
FT                   /protein_id="ABL89396.1"
FT                   /translation="MSDGVSLEDQSVSPLVRKAAAWSWRLLIIFGALVAVLWLVARLEI
FT                   IVVPVALATMLAALLMPAVDFLDRRGAPRGGAVALVLLSGIAVVGGILTFVVSQFVEGM
FT                   PALGEQVTRSIDGMRRWLVEGPLDLSREQIDNAGNAAIEAVRNNQERLTSGALSTAGTI
FT                   TEIVTGALLVLFTLIFLLHGGRNIFGFITKVFPPDVRDRVRGAGRAGFHSLIGYVRATF
FT                   LVALVDAIGIGTGLAIMSVPLALPLASLVFLGAFVPLVGAVVTGFLAVIVALLTKGLVY
FT                   ALITLGLILAVQQLEGHVLQPLVMGRAVSIHPLAVVLAIAGGGVLAGIVGALLAVPAVA
FT                   FLNSAIRVLLARDQSAAVENLEADEGPRIQAEPDDVEEKVD"
FT   gene            complement(192592..193920)
FT                   /locus_tag="Mkms_0179"
FT   CDS_pept        complement(192592..193920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0179"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mmc:Mmcs_0170 protein of unknown function
FT                   DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89397"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1U989"
FT                   /protein_id="ABL89397.1"
FT                   /translation="MDGLSGAVDHLVASIAAMQTASIDELSHEQIVAELDRIKAAVWAV
FT                   PSVEHRLTARLMDADPHELGATSLKRLLADRLRISDKTAGERLTDARQLGPRHTLTGER
FT                   VQTELAHTADAVARGDIGTAHVRIIQDFVKKLPAWVSWDRREDYERDLVGHAVALRPED
FT                   FRKVADTLLGFIDQDGTEPDHHTHQRRREFTVGRQQADGMSRVQGWLTPEARAYWDVIA
FT                   AKYAAPGTSVPHDDAVTGRDDRTTGQRHHDALTRAMRHTVESGSLGHVAGVPATIVATT
FT                   TINELERAAGWAHTGGGNRLPIRDLIRMAAESRHYLAVFDDHTEEILYLGRAKRCATTA
FT                   QRLALFARDKGCTHPHCTVPFYWTEAHHTRDYAQGGCTDIDDLTLACQPANLLIEKTGW
FT                   TTHRPGNGRTQWTPPTNQDTGQPRINHHFHPQRYLTDNDDEPG"
FT   gene            complement(194100..197381)
FT                   /locus_tag="Mkms_0180"
FT   CDS_pept        complement(194100..197381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0180"
FT                   /product="drug exporters of the RND superfamily-like
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0171 drug exporters of the RND
FT                   superfamily-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89398"
FT                   /db_xref="GOA:A1U990"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:A1U990"
FT                   /protein_id="ABL89398.1"
FT                   /translation="MFAWWGRNVYRYRYIVIGVMVALCIGGGIYGISLGNNVTQSGFYD
FT                   EGSQSVQASVAGDEVYGRDRTSHVVAILTPPDGEKVDNPEWQREVVGELDALVKDHPDQ
FT                   VVSWVGWLRAPDAASATVQQMKTEDLSKTFVSVPLKGDTDDEILKNYQVIEPDLQEIND
FT                   GNIQLAGLNPLASELTGSIGEDQKRAEVAAIPLVCVVLFFVFGGVIAAALPGLIGGLTI
FT                   AGALGIMRLLAEIMPVHFFAQPVVTLMGLGIAVDYGLFMVSRFREELAEGYDTEAAVRR
FT                   TVMTSGRTIMFSAVILVASSVPLLLFPQGFLKSITYAIIASVMLAAVLSITVLAAALAI
FT                   LGPRVDALGVKTLIKFAEPDPISSDPAVQKTNTFAIASIPLGLLVPPVGIALGHIARKR
FT                   IKQTGEQGANLALIGLVLGYTVLYGAMAYGVIALKDNGTIGSGVYWMLLGIVAFLVIVT
FT                   FGLTLARYVPLARRPIVWWLHWLAEKTQKTKTRAEVEQGFWGKLVTHVMKRPGTFAFPI
FT                   IVVMILLIIPLGQLSLGGISEKYLPPDNSVRQAQEDFDRSFPGFRTEPLTIVLKSDNGD
FT                   PVTDQQVADIRAKAMSISGFIDPDNDPSKMWQERSVQEGGSEDPSVRVIQNGLENRNDA
FT                   ATKIEELRALSPPRGVSVWVGGTPALEQDSIHSLFDRLPLMVTILIVTTTILMFLAFGS
FT                   LVLPIKAALMSALTLGSTMGILTWMFVDGHGSGLMNYTPQPLMAPMIGLIIAVIWGLST
FT                   DYEVFLVSRMVEARARGLSTAEAIRVGTATTGRLITGAALVLAVVAGAFVFSDLVMMKY
FT                   LAFGLLLALLLDATIIRMFLVPAIMKMLGDDCWWAPRWMKRLQERLGLGEVELPDERKR
FT                   PLVRDPSEDQALVGAGAPVPPRPRPPHDPTHPGVEGRVGPTRIPPGPPRLNGPSVAGTS
FT                   RIPTNRPAPGHEPPTTRLSMAKNAVRGAVNTATTPRAPRPTGPAPKREEREIESWLGEL
FT                   RGGPAGPGGGQPPRPPQPSAEPTTAMRAGAPRPEPEPEGNEPTTAIPVQRPPQPEESDA
FT                   TTKIPTQQDAGTDSASTEKLNAPEEQKRRGGGMSAAELLRREGRM"
FT   gene            complement(197428..198126)
FT                   /locus_tag="Mkms_0181"
FT   CDS_pept        complement(197428..198126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89399"
FT                   /db_xref="UniProtKB/TrEMBL:A1U991"
FT                   /protein_id="ABL89399.1"
FT                   /translation="MSVTEDLPQEIPQVTPPPPPAGPPAGTQRVLLVWDAPNLDMGLGS
FT                   IIGGRPTAAHRPRFDALGRWLLGRTADLSAGREDVTLEPEATVFTNIAPGSADVVRPWV
FT                   EALRNVGFAVFAKPKIDEDSDVDSDMLDHIALRRREGLAAVLVASADGQAFRLPLEEIA
FT                   REGIPVQVLGFREHASWALASDTLEFVDLEDIPGVFREPLPRIGLDSLPEQGAWLQPFR
FT                   PLSALLTSRV"
FT   gene            complement(198123..198950)
FT                   /locus_tag="Mkms_0182"
FT   CDS_pept        complement(198123..198950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0182"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: mmc:Mmcs_0173 hypothetical protein; TIGRFAM:
FT                   tRNA (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89400"
FT                   /db_xref="GOA:A1U992"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U992"
FT                   /protein_id="ABL89400.1"
FT                   /translation="MRHHGRMHARESDVAGGPARDSAGGPARDSAGGPARDSAGDDSPS
FT                   AHRHRRVTSFRSRRSALSGGQQDTWERLWPELGTEARDDDGRPAALIDTAAWFGRTAPL
FT                   VLEIGSGTGTSTLAMAQDEPDIDVIAVEVYRRGLAQLLTGIDRAGVRNIRMIRGDGVDV
FT                   LEYMVASGSLTGVRVFFPDPWPKARHHKRRLLQPSTVALIADRLRPGGILHAATDHAGY
FT                   AEQIAAVGDAEPLLRRVDLTDDLPISVRRPVTKYERKALAGPDVAELLWEKVP"
FT   gene            199045..200055
FT                   /locus_tag="Mkms_0183"
FT   CDS_pept        199045..200055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89401"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U993"
FT                   /protein_id="ABL89401.1"
FT                   /translation="MPRFPRDPTRREGATIFVPDFDDVLTRFAQECGDAAVAAVAARLA
FT                   APLRVAVTGRAGVGRTTLARALARDGRRVAEHTPDVAVVVVAEAVKPEDVASVAGWRDA
FT                   DVPVVVVGNKADLTGPIPPDALRRYRSGEHGDVPVESVVALLAVVSLDDDALGALQLLA
FT                   AQPAELRSANAFLDAAHPLPRDVRMRLLRTLGLRGVEHSVRALRDGADPHDLPTLLREV
FT                   SGFDRVLDRLDALAAPARYDRIRAALAELQGRAAGDDRIAAFLADDDTVLAVMTAAVDV
FT                   VQAAGLAVDPGDDAATHLRRAVWWRGYSRGPVSPLHRACGADIARGSLRLFERRR"
FT   gene            200052..201545
FT                   /locus_tag="Mkms_0184"
FT   CDS_pept        200052..201545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89402"
FT                   /db_xref="GOA:A1U994"
FT                   /db_xref="UniProtKB/TrEMBL:A1U994"
FT                   /protein_id="ABL89402.1"
FT                   /translation="MSAASDPVAAADAVVAAVDPALDSPGVQSSDSVLVTGPWLAGVSS
FT                   LIAVLRDRLPEVSFVEADELPAGSAPVAVVFAVSAVSALAGSDCELLDLAADHTDCVIG
FT                   VVTKIDVHLDWREVMAADRELLGAHRRRYAALPWVGVAAAPDDGDPMVDDLVDLLRDTL
FT                   GDPEVLRRNRLRAWESQLEKVVARYRADGEGADRHARVSALRAQRDEIRRARRVEKSQR
FT                   AIALRSQIQQARVQLTYFARNRCASVRGELQEDIAELGRRRLDAFEQTVRGRAAEVMTE
FT                   VDEGVTTHLTAVAADLHLDDVPPPPQPIPVPDLPGPSLRSRRLETRLMMLLGAGFGLGV
FT                   ALAVSRLFSGVDPGLTVAGVLAGAAAGLAVAVWVVGIRGLLHDRGVLDRWVADVTATLR
FT                   SAAEEAVATRVLAAEAALTAALAAEEEADADAAAVRIAEIDAELREHAAATARAAALRD
FT                   RRLPGLQRALEAVCAELYDKKADEFTEANERNSGKNVGY"
FT   gene            201744..203573
FT                   /locus_tag="Mkms_0185"
FT   CDS_pept        201744..203573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0185"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   mmc:Mmcs_0176 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89403"
FT                   /db_xref="GOA:A1U995"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U995"
FT                   /protein_id="ABL89403.1"
FT                   /translation="MTSATIPGLDTAPTEHEGLLAWVREVAELTQPDRVVFTDGSEEEC
FT                   ARLTEQLCEAGTFQKLNEEKKPNSYLALSDPSDVARVESRTYICSEREIDAGPTNNWMD
FT                   PAEMRGIMTDLYRGSMRGRTMYVVPFCMGPLEAEDPKLGVEITDSEYVVVSMRTMTRMG
FT                   QAALDKMGTDGFFVKALHSLGAPLEPGEKDVPWPCNDTKYITHFPETREIWSYGSGYGG
FT                   NALLGKKCYSLRIASAMAHDEGWLAEHMLILKLISPENKAYFIAAAFPSACGKTNLAML
FT                   QPTIPGWRAETVGDDIAWMRFGKDGRLYAVNPEFGFFGVAPGTNWSSNPNAMKTIEAGN
FT                   TVFTNVAKTDDGDVWWEGLEGEPDHLIDWKGNDYILRETETKAAHPNSRYCTPISQCPT
FT                   LAPEWDDPQGVPISAILFGGRRKTTVPLITQARDWQHGVFIGATLGSEQTAAAEGKVGT
FT                   VRRDPMAMLPFLGYNVGDYFQHWIDIGKNADESKMPAVFFVNWFRRGDDGRFLWPGFGE
FT                   NSRVLKWAIERIEHKADGRSTPIGIVPTAQDLDLEGLDVDPEDVDAALAVKPEEWRQEL
FT                   PLIEEWFEFVGEKLPTGIRDEFDALKHRLAEEA"
FT   gene            203721..205241
FT                   /locus_tag="Mkms_0186"
FT   CDS_pept        203721..205241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0186"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0177 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89404"
FT                   /db_xref="GOA:A1U996"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U996"
FT                   /protein_id="ABL89404.1"
FT                   /translation="MQIRDTAVATPDKPAIIMYPSGTVVTFGELEARANRLAHLFRDAG
FT                   LVEGDAVAILMENNEHIHAVMWAARRSGLYYVPINTHLTAAEVAYIVDNSGAKAIVGSG
FT                   KLADTLAGLEAELPHGLPPVRLIAGAQLDGWQSYPDCVADKPDTPIADEIEGDLLQYSS
FT                   GTTVRPKGIKRELPHVPPSESPGMMAALVSFWMHPDAVYLSPAPLYHTAPSVWSMQTQA
FT                   GGITTVVMEKFDAEGALDAIAKYKVTHGQFVPVMFTRMLKLPEDVRKSYDVSSLERVMH
FT                   AAAPCPVEIKKQMIDWWGPIVDEYYASSEAHGSTLITAEEWLTHPGSVGRPLTGVLHIV
FT                   GEDGNELPPGQAGEIYFEGGYDFEYLNDPEKTASSRHPLGWKTVGDIGYLDEEGYLYLT
FT                   DRRHHMIISGGVNIYPQEAENMLITHPKVMDAAVFGVPDDEMGQSVRAVVQTVDPADAT
FT                   DAFAEELISWLRDRLAHYKCPRSLSFEPQLPRTDTGKLYKQELIKKYS"
FT   gene            205250..206125
FT                   /locus_tag="Mkms_0187"
FT   CDS_pept        205250..206125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0187"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0178 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89405"
FT                   /db_xref="GOA:A1U997"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1U997"
FT                   /protein_id="ABL89405.1"
FT                   /translation="MELAGGIRVAVETPCDDASFTLTEAPSDDPRLVTVASVADTLAEL
FT                   DERCRRWPQAAAVCDDVLRSFDPARSTFAGVITESLAYSTLQSGPEFGRWLAERGSAQA
FT                   PETANPVVAERNDGRLTVRFNRPDRHNAFSTGARAALLEALEVARLDPSVDEVVLSGVG
FT                   RSFSSGGDLAEFGSFDDPASAHLARTRHSPALVLDEVTARLGRRCRAQVHGQVLGSGLE
FT                   MAAFCGWVVSSPDAVFGLPELTLGLIPGAGGTVSITRRIGRWRTGYLVLSGRTIDPSTA
FT                   LRWGLVDAVE"
FT   gene            complement(206280..207023)
FT                   /locus_tag="Mkms_0188"
FT   CDS_pept        complement(206280..207023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0188"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; KR; KEGG:
FT                   mmc:Mmcs_0179 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89406"
FT                   /db_xref="GOA:A1U998"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U998"
FT                   /protein_id="ABL89406.1"
FT                   /translation="MLGHMTDSKIILVTGASSGIGAAVATHLARAGHHVIAGARREDRL
FT                   RELADGAADLERGSLSVRRLDVTDRAEMAAFVDDAVSTHGRLDVLVNNAGIMPLSRLDA
FT                   LLVDQWDAMIDVNVRGLLNGIAAALPHFHRLGGGHFVTVASIGAHEVVPTSAVYSATKY
FT                   AAWAITEGLRQESDPSIRVTTVSPGVVESELASTITDPGAAAAMQEYRAAAITPDAIAR
FT                   AIAYAISEPEEVDVNEVIVRPARQR"
FT   sig_peptide     complement(206928..207023)
FT                   /locus_tag="Mkms_0188"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.569 at
FT                   residue 32"
FT   gene            207065..207931
FT                   /locus_tag="Mkms_0189"
FT   CDS_pept        207065..207931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0189"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   mmc:Mmcs_0180 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89407"
FT                   /db_xref="GOA:A1U999"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:A1U999"
FT                   /protein_id="ABL89407.1"
FT                   /translation="MQHTQAPAPSRPYRGDMAELGDYLRSRRAQVQPRDAGLVATGTRR
FT                   VPGLRREEVAWLAGLSVDYYVRLEQGRERSPSAPVLDALAAALRLDHDGHRHLFRLAGL
FT                   APRLDVAKTPDRVDPALSRLMAAWPDNPALVYNRAYDVLAANPLAQALFGDFGAGENLM
FT                   LLAFGEPRAREFYVDWQDVAENAVAGFRLNHAAAPADPRVQAVLGELLNGSAEFRTLWE
FT                   RHDARGKSLTSKAFRHPEVGVLELTMQTFDVRSAPGQELVVYDAAPDSPSADALKLLGS
FT                   IAATAAT"
FT   gene            complement(207985..208587)
FT                   /locus_tag="Mkms_0190"
FT   CDS_pept        complement(207985..208587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0190"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; KEGG: mmc:Mmcs_0181 UbiC transcription
FT                   regulator-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89408"
FT                   /db_xref="GOA:A1U9A0"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A0"
FT                   /protein_id="ABL89408.1"
FT                   /translation="MRRAFQDLVAEGIVYRVPGRGTYARETGRYLRQLGSIEDLMSLSQ
FT                   DTTMEVLRGLTRRVDIQAASRLRLDDDVVHTVVFRRLHGPPGQGVPFVSTTVHLPPSIA
FT                   RHIAGDDALQTGAVSTHTVIGLLEPHLDAPIAQAAQSITVAPADEAVAGAVGCAPGHPM
FT                   LRVDRLYSDDADRPVELSVSHFLPEQYTYRVTLRRSG"
FT   gene            complement(208732..209889)
FT                   /locus_tag="Mkms_0191"
FT   CDS_pept        complement(208732..209889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0191"
FT                   /product="Butyryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.1"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0182 butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89409"
FT                   /db_xref="GOA:A1U9A1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A1"
FT                   /protein_id="ABL89409.1"
FT                   /translation="MSRLSEEETMLVETVRAFVDRDVKPTVREVEHANEYPEAWIEQMK
FT                   RIGIYGLAIPESYGGSPVSTACYVEVTQELARGWMSLAGAMGGHTVVAKLLTLFGTEEQ
FT                   KRTYLPGMATGEIRATMALTEPGGGSDLQNMTTTALPCEGDGLAVNGSKTWISNARRSG
FT                   LIALLCKTDPSATPRHKGISVVLVEQGTTGLSVSRDLPKLGYKGVESCELVFDDCRVPA
FT                   TAILGGEPGRGFAQMMKGLETGRIQVASRALGVATAALEDALRYAQERESFGQPIWKHQ
FT                   SIGNYLADMATKLTAARQLTRYAAERYDSGERADMEAGMAKLFASEVAMEIALNAVRIH
FT                   GGYGYSTEYDVERYFRDAPLMIVGEGTNEIQRNVIAAQLVARGGI"
FT   gene            209904..210950
FT                   /locus_tag="Mkms_0192"
FT   CDS_pept        209904..210950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89410"
FT                   /db_xref="InterPro:IPR016790"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A2"
FT                   /protein_id="ABL89410.1"
FT                   /translation="MYGHIDTANCALPACAPVTLYGQIAGGPYFDDLTAGQVFDSAPTM
FT                   TLSAGAAAVHQSILGDRLRLALDGELAAAVTGSTAPLAHPALVCDVAIGQSTLVTQRVR
FT                   ANLFYRGLAFHRYPVLGDSLFTRTEVVGLKQNSVKPGRPRTGLAALRMTTVDQLGRLVL
FT                   DFHRCAMLPLRDGAADTGHADDLSAIGADASAPEPTAEWDAQAWRTRVRSSFDAGLAGT
FT                   VLHSTADVVTSAPELARLTLNIAATHHDSRVGGGRRLVYGGHTIGLALSQATRLLPNLA
FT                   TVLAWESCDHTGPVYEGDTLYSALHVDGATPLPDGRGGVLKLRSLVYAVDDQDDRQVLD
FT                   WKFSALHF"
FT   gene            211043..212149
FT                   /locus_tag="Mkms_0193"
FT   CDS_pept        211043..212149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89411"
FT                   /db_xref="GOA:A1U9A3"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A3"
FT                   /protein_id="ABL89411.1"
FT                   /translation="MVSAFAIPAAVLTHAGRVAAGLPVGVDIPELLTGRAALLDLPAPG
FT                   RVSAGGASQLLRARDGWCALTLSRPDDLAAVPALLEADHIDVDPWRAIGDWLAACSADT
FT                   AVARARLLGMPAAMLVEAAPAQPVVQRITTQAPPRPWTDLLVIELASMWAGPLLGRMLV
FT                   RAGATVVKVESLARPDGTRRGSPEFFDWMNGGKHCITVDFDETTQLSALLAAADVVIEG
FT                   SRPAALARRGLGPDVVPAREGRVWVRITGHGTVGDRADWVAFGDDAAVAGGLVGAAADG
FT                   PVFVGDAIADPLTGLEAMHAVVESLHRGGGELVEVSMAAVAAGYAALPDEGTVEVAARA
FT                   PAPGPPAAHLGADNATVRAVVERRLAAC"
FT   gene            212143..213438
FT                   /locus_tag="Mkms_0194"
FT   CDS_pept        212143..213438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0194"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: mmc:Mmcs_0185
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89412"
FT                   /db_xref="GOA:A1U9A4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A4"
FT                   /protein_id="ABL89412.1"
FT                   /translation="MLIRRATLLDGTRVDIRAAERIGDVADSLVPERGETVLDAAGATV
FT                   IPGLHDHHVHVHAAAAALGSVRVGPADVGDRDGLLRALRSTTPGEDGWIRAVGYHEAVA
FT                   GPLDRALLDTLRPDVPVRVQHRSGVLWTLNSAGLTRLGLSGHPDGTLRSADGEWGAELE
FT                   RRQVPLGEFSRALARRGVTGITDATPDLDVTTVGDWSGEIVQRLHVLAPGKRILHDDAL
FT                   DLDELVAWMTDRHDGGTPVAVHCVTAAQLVVTIAALSIAGARPGDRIEHAAVVPDDCIP
FT                   DLVELGVTVVTQPNFVAERGDQYRADVPAPEHRELWRVGSLLKAHVRVAFSTDTPFGDG
FT                   DPWAAMRAAVHRLTPSGAPLGTTERVDAATALALFCGSADSPTTPRAVAPGEPGDLCIV
FT                   EGSPDEVLAELDGDRVRATIVGGEPVWGPGRA"
FT   gene            complement(213451..214386)
FT                   /locus_tag="Mkms_0195"
FT   CDS_pept        complement(213451..214386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0195"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   mmc:Mmcs_0186 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89413"
FT                   /db_xref="GOA:A1U9A5"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A5"
FT                   /protein_id="ABL89413.1"
FT                   /translation="MGFDGRDSDADTGPAVEETPYMEWTATVAGIALIAVIVRDVFHTL
FT                   FHPIGHGSIAPTVMKLIWRLLGLLPPQRRIASLTGPLGIAMVVLAWGVIAVAGWTLIYW
FT                   AQMPEGFAYGTELDPNERHDIVDSLYLSLVTIGTLGFGDVVPTSVTLRLAAPIEALFGF
FT                   MLLTAAVSWVLEIYPALHRRRVLALQLSTLRRAREGDPVLPIDSVPVEVLTSLAAGIVE
FT                   ARNDFTQYSATYYFRDLETDASLAASLEYATQLAAEAMASAQDHVRTAGRLMKIAVDSL
FT                   AELLDQEFLQLGGDTDAVVQAYAVDHRHIN"
FT   gene            complement(214433..216730)
FT                   /locus_tag="Mkms_0196"
FT   CDS_pept        complement(214433..216730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0196"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: mmc:Mmcs_0187 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89414"
FT                   /db_xref="GOA:A1U9A6"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A6"
FT                   /protein_id="ABL89414.1"
FT                   /translation="MTTHAESKTGTSFDQEVAETQRYLDSPRFEGITRLYTARQVVEQR
FT                   GTIPVDHTVAREAATAFYPRLRELFSQGKSITTFGPYSPGQAVTMKRAGIEGIYLGGWA
FT                   TSAKGSTDEDPGPDLASYPLSQVPDEAAGLVRALLTADRNQHYLRLRMSEEQRAAAPPP
FT                   VDFRPFIIADADTGHGGDPHVRNLIRRFVEAGVPGYHIEDQRPGTKKCGHQGGKVLVPS
FT                   DEQIKRLNTARFQLDIMGVPGIIVARTDAEAANLIDSRADERDQPFLLGATNLSIPSYK
FT                   SCFLAMMRSFHDAGVTALNGHLLYWLPDGEYETARAWLERHGIADVIAKAVEQWRSDGD
FT                   PSNDALYDDVESQFIAAWEEDAGLKTYAETVAARLEFAEGDGEAYAMGVDEWTQFAKRA
FT                   SLYTAGKKARELGVDVDWDCELAKTPEGYYQLRGGIPYAIAKQLAAAPFADILWMETKT
FT                   ADLADAREFAEAIHAEYPDKMLAYNLSPSFNWDTTGMTDDEMRAFPEELGKMGFVFNFI
FT                   TYGGHQVDGVASEEFATALRQDGMLALARLQRKMRLVESPYRTPQTLVGGPRSDAALLA
FT                   SSGRTATTKAMGKGSTQHQHLVQTEVPKKLLEDWLAMWSEHYQLGEKLRVQLRPRRAGG
FT                   EVLELGIYGERDGGEEKLADVLVDPIKDRYGRSILTVRDQNTYAEKLRKKRLMTLVHLW
FT                   LVHRFKADAVYYVTPTDDNVYQTEKMKSHGIFSDVHKDVGEIIVAEVNRARIEELLAPD
FT                   REALGRLIRKED"
FT   gene            216866..217654
FT                   /locus_tag="Mkms_0197"
FT   CDS_pept        216866..217654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0197"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0188 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89415"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A7"
FT                   /protein_id="ABL89415.1"
FT                   /translation="MKLTGYTALVTGASGGIGEEFATRLAADRVNLILVARRTERLEEL
FT                   RSRLLDRHPGIDIDVLSADLGVPGAAAALAQQVDALGRRVDVLINNAGIGLHGSFAEQD
FT                   PAANAAQIQLNCVTLVELTGCFLPAMIAAKRGVVLNVGSTAGFQPVPSMAVYGATKAFV
FT                   LSFSEALWQETRGSGVKVLTLCPGATETEFFDRTGKSFMTRGRQSSAQVVDTALKALDR
FT                   PFPTVVSGLHNRILALGYRIAPRPVLAMVSEQLMKARGQG"
FT   gene            complement(217651..218433)
FT                   /locus_tag="Mkms_0198"
FT   CDS_pept        complement(217651..218433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0198"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; protein of
FT                   unknown function UPF0074; UbiC transcription
FT                   regulator-associated domain protein; KEGG: mmc:Mmcs_0189
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89416"
FT                   /db_xref="GOA:A1U9A8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A8"
FT                   /protein_id="ABL89416.1"
FT                   /translation="MPTHSEELRRRIVADINAGIPGAKLGSERDLAERYGTSRSSLRQV
FT                   LAALEEAGMVHRVIGRAGGIFISHGQVERNLADVVGVPAFLANQGYVAGTRVLSTKIAP
FT                   VDDATQAALRLQPTDFVVEIQRLRLADGSPISLELAQFPADAFPGLLEQQLGGSIYEVL
FT                   ENRYGLVPGRADERIEAVNATTTEASLLGVKPKSALLLITRVTYDSDGTPCEFSRDLFR
FT                   GDRIYLAVTAQGRGIGKGLGSGPDTNTASVKLQSQLAV"
FT   gene            complement(218514..219293)
FT                   /locus_tag="Mkms_0199"
FT   CDS_pept        complement(218514..219293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0199"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0190 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89417"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9A9"
FT                   /protein_id="ABL89417.1"
FT                   /translation="MFTSLQGRSAIVTGGSKGIGRGIAAVFADAGVDVVVTGRNRADID
FT                   ATVADLGGKAGKVSGLAADVADPADCRRVVDTAVERHGGLDIVCANAGIFPSGRLEELT
FT                   PEDIEQVLSVNFKGTVYIVQAALSALAASGHGRVIVTSSITGPVTGYPGWSHYGASKSA
FT                   QLGFIRTAAMELAPKRITINAVLPGNIITEGLVDMGEDYMNQMAAAIPAGRLGSVADIG
FT                   NAALFFATEEAGYITGQSLIVDGGQILPESHQAIAEL"
FT   gene            complement(219329..220321)
FT                   /locus_tag="Mkms_0200"
FT   CDS_pept        complement(219329..220321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0200"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mmc:Mmcs_0191 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89418"
FT                   /db_xref="GOA:A1U9B0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B0"
FT                   /protein_id="ABL89418.1"
FT                   /translation="MGEVIADDVEVAERALADYDLPANSTLRLLNLSENATYLVECEDD
FT                   QSCSILRVHRQNYHRPHEIESELDWLEALRRDSDVTVPTVLPTRDGRRVVTVDHNGTAR
FT                   HVVHFGMVGGAEPDEGSVTLDDFRTLGAITASLHDHSRSWTRPAGFERFAWDWEHCLGS
FT                   EPRWGRWYDAEGVGPEERHLLDRAQDLLRQRLADYGSGPDRYGLIHADLRLANLLVDPP
FT                   TITVIDFDDCGFGWFFYDFGTAVSFIEDDPALPEWQASWVEGYRSRRPMTTADEDMLAS
FT                   FVFLRRLLLLAWMGTHSHSKESKTKAISYAAGSCALAERYLSTNGRRLA"
FT   gene            complement(220321..220974)
FT                   /locus_tag="Mkms_0201"
FT   CDS_pept        complement(220321..220974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89419"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B1"
FT                   /protein_id="ABL89419.1"
FT                   /translation="MPATASGTRTDIRVYLLVEDLQRQFAAYLGTPTRARGYPPYEGEH
FT                   ALIVEVSPALAIERVIDLALREVPGIQPGILYVERQFGVLEIHSASLSDVRRAGEAILT
FT                   GTGNKASDQLRPRVLYHDIITDITDQHAVILNRNRQASMILPGQSLLVYEMTPALFAAV
FT                   AANEAERAAPGLTVVDVQMIGAAGRLYIGGSVADVTTARDRITSVLAAIEGRDH"
FT   gene            complement(221019..221300)
FT                   /locus_tag="Mkms_0202"
FT   CDS_pept        complement(221019..221300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0202"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: mmc:Mmcs_0193
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89420"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B2"
FT                   /protein_id="ABL89420.1"
FT                   /translation="MPSNAIGLIETKGYVAALAAADAMVKAANVTITDRQQVGDGLVAV
FT                   IVTGEVGAVKAATEAGAEAASQVGELVSVHVIPRPHSELGAHFAVNAQ"
FT   gene            complement(221324..221578)
FT                   /locus_tag="Mkms_0203"
FT   CDS_pept        complement(221324..221578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0203"
FT                   /product="Ethanolamine utilization protein EutN/carboxysome
FT                   structural protein Ccml"
FT                   /note="PFAM: Ethanolamine utilization protein
FT                   EutN/carboxysome structural protein Ccml; KEGG:
FT                   mmc:Mmcs_0194 ethanolamine utilization protein
FT                   EutN/carboxysome structural protein CcmL"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89421"
FT                   /db_xref="InterPro:IPR004992"
FT                   /db_xref="InterPro:IPR036677"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B3"
FT                   /protein_id="ABL89421.1"
FT                   /translation="MIAATVTGNVWSTRRIEGIPAGAFLEVEVDGSGSRMIAFDVLGTG
FT                   LGERVLIAQGSVAANWFTGTPPPVDALIIGSIDDPSSTS"
FT   gene            complement(221575..222099)
FT                   /locus_tag="Mkms_0204"
FT   CDS_pept        complement(221575..222099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89422"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B4"
FT                   /protein_id="ABL89422.1"
FT                   /translation="MSTIDRAELRALVREVVREAAKDFAGANGGAAPKAAPAPAAPPPP
FT                   PPVQTVADQFGVTPSGPLAADGKHRAEAVRLTNDRELDAFVRALLKLFENPKSRADLKA
FT                   GRLTFRLAGVPTGGRGQTQRIDSGAVTERHIADVAAAGAALVLGPRAVLTPLAREKARA
FT                   LGVSIEKEKRR"
FT   gene            complement(222096..222701)
FT                   /locus_tag="Mkms_0205"
FT   CDS_pept        complement(222096..222701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0205"
FT                   /product="microcompartments protein"
FT                   /note="PFAM: microcompartments protein; KEGG: mmc:Mmcs_0196
FT                   microcompartments protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89423"
FT                   /db_xref="InterPro:IPR000249"
FT                   /db_xref="InterPro:IPR037233"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B5"
FT                   /protein_id="ABL89423.1"
FT                   /translation="MAELRSFIFIDRLQPQTMSYLGTWIKGALPRANMAAQIIEVAPGL
FT                   DIEGITDVALKHAEVKAGILVVERQFGYLEFHGETGAVKAAADAALESLHQEADSAVRP
FT                   TILASRIISSIDHQHAFLINRNKIGSMVLAGESLFVLEVAPASYAILATNEAEKAADIK
FT                   VVDFRMIGATGRVYLSGTEADIRQAAEAAQDALARSTV"
FT   gene            complement(222705..224282)
FT                   /locus_tag="Mkms_0206"
FT   CDS_pept        complement(222705..224282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0206"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0197
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89424"
FT                   /db_xref="GOA:A1U9B6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B6"
FT                   /protein_id="ABL89424.1"
FT                   /translation="MSDIPAGRAERREIAAAGHMLERARWAARAYADYDQAAVSAITTA
FT                   VADAAYGAADRFAAEAVAETGMGVVADKVLKNQACSRGILDYYREQDFVSPRVDPDSKI
FT                   VEIPRPAGVVLALTPTTNPVSTVYFKVLLALMTRNAVVVAPHPRAKRCSADAARLLADA
FT                   AIAAGAPDGIVQVVEEPSIPLVEALMADERTDVIVATGGTGVVRAAYSSGTPALGVGPG
FT                   NVPVLVDASADITAAAKRIVDSKAFDNSVLCTNESVLIVEDSVADALRSAMTRAGAHIL
FT                   DADATERLRAYMFADGHLNTDVVGRDAAWIAGQAGIRVTPKTRVLVAPFDHVISEEMLA
FT                   HEKLSPVIGMTTVPDAARGIRAARAVVRIGGAGHSAAIHSENASVITEFATQVPVLRVS
FT                   VNVGNSTGSSGLETNLAPSMTIGTGFVGRSSIGENLRPDNLMNWARIAYNSAPGVAMPS
FT                   FAGIDPWRSPAGPVPEYPRASNDRGAPPVSPSRSAPAARRAADPSIEALRAELRALVVE
FT                   ELAQLIKR"
FT   gene            complement(224279..225556)
FT                   /locus_tag="Mkms_0207"
FT   CDS_pept        complement(224279..225556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0207"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mmc:Mmcs_0198 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89425"
FT                   /db_xref="GOA:A1U9B7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B7"
FT                   /protein_id="ABL89425.1"
FT                   /translation="MYDYGTFSFESKTQVLDRAKAFWNPDKTQFWTDAGVDLVIDRRED
FT                   YFLWDMGGRRLIDMHLNGGTYNLGHRNPEVMQAVSQGMEIFDVGNHHFPSVARTALAQR
FT                   LVETAPDSISKVAFGSGGGEAIDIALKSARHATGRRKIVSIIKAYHGHTGLAVATGDER
FT                   FAKLFLSDRPDEFIQVPFGDVAAMEQALKGNDVAAVIMETIPATYGFPLPPPGYLEAVY
FT                   ALTQKYGSLYIADEVQTGLMRTGELWAITKHGIEPDILVTGKGLSGGVYPITAALLGDR
FT                   AAQWLDQDGFAHISTFGGAELGCVAAIKTLEITTRPEVRSMVHYIADIFDNGLRRIQDD
FT                   YPDWFIGIRQNGVVIGLEFDHPEGAKFVMRELYENGVWAIFSTLDPRVLQFKPGLLLGR
FT                   DLCEDVLDRLEVAVGRAKTAARKGRA"
FT   gene            225707..227239
FT                   /locus_tag="Mkms_0208"
FT   CDS_pept        225707..227239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0208"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0199 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89426"
FT                   /db_xref="GOA:A1U9B8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B8"
FT                   /protein_id="ABL89426.1"
FT                   /translation="MADQAVTPQKTPAQGVQRLKRNAVGTLGVIFMAVATAAPITAMVG
FT                   NVPIAVGFGNGSHAPAGYLVATIVLGLFAIGYATMAKHITATGAFYGYISHGLGRIVGM
FT                   ASGLLITMAYIVFEASLIGIFAFFFKNFLSSQFGVDVHWIIPALLMLALNAILTYFDVN
FT                   LTAKVLGVFLVTEIVMLALGALAVLFQGGGPEGFVVAETLNPIGAFTPAAIAGASAGLG
FT                   LFFAFWSWVGFESTAMYGEESKDPKRIIPRATMIAVLGVGLFYVFVSWMAIAGTGPSKA
FT                   LELAQDADTSSEIFFGPVRSTYGEWAITLFNILLVTGSFACGMAFHNCASRYLYALGRE
FT                   GLSSGLQKTLGATHHKHGSPYIASFVQSGIALILVLGFFAAGMDPYVHMYTLLAILGTM
FT                   AILIVQSLCAFAVIAYFHFHKEHPSSAHWFKTFLAPLMGGIGMLYVVYLLWEHKESAAG
FT                   TASGTLLFKLTPWIVVAIFVFGAAMATYFKYRDARRYDLIGRIVYDDSEIRD"
FT   gene            complement(227236..228141)
FT                   /locus_tag="Mkms_0209"
FT   CDS_pept        complement(227236..228141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0209"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0200 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89427"
FT                   /db_xref="GOA:A1U9B9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9B9"
FT                   /protein_id="ABL89427.1"
FT                   /translation="MPTPHIHAFHPDLRSVARYIPRQVITPVTLPVVRMVTRLQGKRTP
FT                   KDIEELTLPSGVRVRLFRPTGVPVPAPALLWIHGGGYVIGTAAQDDELCRRFCRKLGIT
FT                   VASVDYRLAPEHPYPTPVEDCYEALTWMARLPAVDPKRVAIGGASAGGGLAASLALLTR
FT                   DRGEIEPVAQLLVYPMIDDRTVERHGLDHPGHRLWNQASNKFGWSAYLGDADPDVAVPA
FT                   RREDLAGLPPAWVGVGTLDLFHDEDLAYAERLRAAGVPCQVEVVQGAFHGFDGVLPKAD
FT                   VSRAFFRSQCDTLRQAFASG"
FT   gene            complement(228248..230416)
FT                   /locus_tag="Mkms_0210"
FT   CDS_pept        complement(228248..230416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0210"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0201 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89428"
FT                   /db_xref="GOA:A1U9C0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C0"
FT                   /protein_id="ABL89428.1"
FT                   /translation="MRKSALAITDDHIALAESAQGRLDRSGSRAAARATLEGGAAHPAD
FT                   LWRAAADLGWHGLAVAEQFGGAGFGLSELAVVLEMQGRDLTPGPFLPSVAASVVLDRCA
FT                   GDDVRAELLPGLSSGATVAALGLTGTLTVGAAGSVAGKCPAVLGAPDADLLVLVADEDV
FT                   VVLDAKDAGVTVTALDGIDTTRSIGTVAVRDVHVPAGRVLTGAARRAQTVFRILGAAEA
FT                   AGVGWACLDMAVEYAKVREQFGRTIGTFQAVKHHAANMLVDAEQTTAAVWDATRADDLD
FT                   SAWFPAAVAASHAIRASVLLAQNNIQLHGGIAFTWEHDAHLYLRRARSLAALLADGTDP
FT                   LVDIVEAQRSGRARGASFALPAEADEYRAAARAAAAEWAALPPDRRRDFLVDSGYLVPH
FT                   WPKPWGRAAGTLEQLVIEEEFRDVDIPDMGITGWVTLTIAQAGTDDQRERWVEPVLRGE
FT                   VMWCQLFSEPGAGSDAAAVRTAAKRVDGGWRVTGQKVWTSLAHLCQWGLATVRTDPDAP
FT                   KHAGVTMMAIDMSADGVTVNPLRGLTGDSHFNEVFFDDVFVPDADVVGDVNRGWLVARA
FT                   TLGNERISIGGGSGAPTGFSADDLVALLDSAPADVAAAHVRRAGAVIAEAHTLRLLNLR
FT                   RASRAIAGAEPGPEGNVTKLLVAEQCQRQTELGMDLAGTAAVVGGAPTLTRAYLGNRAM
FT                   TIAGGTSEITRNTIAERILGLPRDPLLR"
FT   gene            230579..231802
FT                   /locus_tag="Mkms_0211"
FT   CDS_pept        230579..231802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0211"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0202 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89429"
FT                   /db_xref="GOA:A1U9C1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C1"
FT                   /protein_id="ABL89429.1"
FT                   /translation="MTVRPDTRYPGPTMWSRARWLLNAKPADHMLAMSVASASLPVIGK
FT                   HLEPLGALAAMGVWGYRQMPELLSASAKSWFDPGNAEVRQRERDMTHEVSHQALRGVVP
FT                   ASDLAIDWPAPEKVPPLWKTFEHRRNVHKSSVRYGPLPSQLLDVWRPKELPTEPAPVLV
FT                   FVPGGAWVHGSRLLQGYAMMSHLAEMGWVCLSIDYRVAPHNPWPAHLHDVKTAIAWARA
FT                   NVDKFGGDRNFVAIAGASAGGHLAALAGLTINDPEMQCELPEGSDTSVDAVVGIYGRYD
FT                   WEDRSTAERARFVDFLERVVVRRKISRHPELFRKASPMAQVHSEAPPFLVIHGSGDSVI
FT                   PVWQARSFVEKLKAKSRSVVSYMELPGAGHGFDMIDGARTGSMATAIGLFLNQIHKNRT
FT                   LVGAREVI"
FT   gene            231829..233247
FT                   /locus_tag="Mkms_0212"
FT   CDS_pept        231829..233247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0212"
FT                   /product="Diacylglycerol O-acyltransferase"
FT                   /EC_number="2.3.1.20"
FT                   /note="PFAM: protein of unknown function UPF0089; KEGG:
FT                   mmc:Mmcs_0203 protein of unknown function UPF0089"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89430"
FT                   /db_xref="GOA:A1U9C2"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C2"
FT                   /protein_id="ABL89430.1"
FT                   /translation="MKRLSGWDAFLLYSETPTVHMHTLKLAVIQLDDLGGRSFGVEEFR
FT                   QVIHSRLYKLDPFRYELVDIPFKFHHPMWRENCEVDLEYHIRPYRVESPGGRRQLDEAV
FT                   GRIASTPLDRSRPLWEMYFIEGLADGRIAVLGKIHHALADGIASANLMARGMDLQSGPQ
FT                   RDRDSYATDPPPGRGELVRSAFRDHLRQIGKLPATWRYTAEGLQRVRRSNRKLSPELTR
FT                   PFTPPPSFMNHKVDGVRKFATATLALADIKLTAKHLGVTLNDLVLALSAGALRQLSLRY
FT                   DGHADHPLLASVPVSFDFNPDRISGNYFTGVLVCIPVQVEDPLQRVQECHKAAASAKEG
FT                   HHLIGPELVSRWSSYFPPAPAEALFRWLANKDGQNKVLNLPISNVPGPRERGRVGGALV
FT                   TEIYSVGPLTTGSGLNITVWSYVDQLNISVLSDGATLEDPHELTDAMVEAFVEIRTAAG
FT                   LSDELTVVETAMAP"
FT   gene            complement(233252..234496)
FT                   /locus_tag="Mkms_0213"
FT   CDS_pept        complement(233252..234496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0213"
FT                   /product="LipO"
FT                   /note="KEGG: mmc:Mmcs_0204 LipO"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89431"
FT                   /db_xref="GOA:A1U9C3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C3"
FT                   /protein_id="ABL89431.1"
FT                   /translation="MARRRFPLLRAVAELVNAANGVRPLGRDGYITLPVFAFGWPTTEA
FT                   APLYLAGSMLDAGRRGLRGDFRGGRGRIALLVTAVAWALLGVIIRRNVTSKRYFDEPLR
FT                   ETLGDDYEMVAARAQPARPRNLIGVPPNELTRRRYVEKAGTVQYGPHPKVNFADIWRRS
FT                   DLPRDGRAPVLLQVPGGAWAIGMRRPQAYPMLSHMAEQGWIGVSIDYRVSPRHTWPDHI
FT                   VDVKRALAWIKEHIAEYGGDPDFVAITGGSAGGHLASLVALTPNDPQYQPGFEDADTSV
FT                   VAAVPIYGRYDWFSVEGPGRREFIAFLQKFVVKKRILEHRQEYLDASPITRVRPDAPPF
FT                   FVLHGQDDSIIPVGEGREFVDALRAVSRSVVAYAEIPHAQHAFDFFGSPRAHYTANAVD
FT                   QFLSWVNATRARAVA"
FT   gene            complement(234669..235463)
FT                   /locus_tag="Mkms_0214"
FT   CDS_pept        complement(234669..235463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0214"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   mmc:Mmcs_0205 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89432"
FT                   /db_xref="GOA:A1U9C4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016676"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C4"
FT                   /protein_id="ABL89432.1"
FT                   /translation="MPSSDIAKWDPGFTERVMSVLRPLLKTYHRAEMRGLESFPSAGGA
FT                   LVVSNHSGGLFAMDVPVFAAGFYEEFGYDRPVFTLSHDLLMTGPTAEFFTKTGFIRANH
FT                   ENADEALRAGGVVIVFPGGDYDVYRPTLAESKIDFGGRTGYVRAALNAGVPLVPTVSIG
FT                   GQESQFYLTRGEWLAKTIRLDKLLRAKILPISFGFPFGLSAVLPVNLPLPTKIVTRVLP
FT                   PIDIVAEFGEDPDVDEVDAHVRHVMQRALDELAAERRFPVLG"
FT   gene            complement(235545..235874)
FT                   /locus_tag="Mkms_0215"
FT   CDS_pept        complement(235545..235874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0215"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89433"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C5"
FT                   /protein_id="ABL89433.1"
FT                   /translation="MSQRGVRLGGSGFLDPRTTGGPTHAGRVGLVTARRLGPAVQFLEP
FT                   GVEHLEHRDAVAVLGLVVEQQPQMGFVERPDAMPQIGQRQLVVVLQRKFVTGSHAVGVP
FT                   VPAAR"
FT   gene            236020..236970
FT                   /locus_tag="Mkms_0216"
FT   CDS_pept        236020..236970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0216"
FT                   /product="pentapeptide repeat containing protein"
FT                   /note="PFAM: pentapeptide repeat containing protein; KEGG:
FT                   mmc:Mmcs_0207 pentapeptide repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89434"
FT                   /db_xref="InterPro:IPR002989"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C6"
FT                   /protein_id="ABL89434.1"
FT                   /translation="MKVSARSYLIAGVSLASAGLIVGGSNTPVLDTTRDDITVAPMAAT
FT                   TTAPQLDGPRVGGAASASGSVGAAFVGPAPAPDVTARIALPEVDGLDPEAGRPGVQLSL
FT                   LTGTPNLGYGNKGLFNAGVNNDGDFNIGGDNDGDFNIGTGNVGDFNIGYDNDGDFNIGG
FT                   DNEGGFNVGFDNRGGERNFGAGNTGSYNVGFFNTGEFNFGVGNTGVGNVGFFNTGDYTV
FT                   GAFNVGIRYAGNPGISTGRTVADTDDEDPGTSALRTRAAQSEDDNDEAAVTRSEKNDDA
FT                   SNSDSGHKASDKAGDTRAAKASDDKGDGNEGGDDE"
FT   sig_peptide     236020..236094
FT                   /locus_tag="Mkms_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.464 at
FT                   residue 25"
FT   gene            237001..237603
FT                   /locus_tag="Mkms_0217"
FT   CDS_pept        237001..237603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89435"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C7"
FT                   /protein_id="ABL89435.1"
FT                   /translation="MRHAFTGHIAGFGTDAGVRVVVGCWQTSPFGAFTDVMVQQPDEQR
FT                   VLLAPDRAVADFVAATYHFDRVEVGPVAATLEPDRLTVHSAVLDVKVSIGGPAPLDRLL
FT                   RLVPARLATAPWWLRAVDPVASRLVRGVHTAGTAGHGRREFYGVRRSRRITALAGRYRD
FT                   VDLGGLQPLRPPVSFGFASAPAAPQLVAVTTTIIDAG"
FT   gene            237642..237887
FT                   /locus_tag="Mkms_0218"
FT   CDS_pept        237642..237887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89436"
FT                   /db_xref="GOA:A1U9C8"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C8"
FT                   /protein_id="ABL89436.1"
FT                   /translation="MDTVTRLRHAQQRLLKAQRRLWLAQLAMWPTLIVTGVAVAAGAVW
FT                   LLRRRSAGGRHELPESPGAHRVETVAEHDGQGVIPN"
FT   sig_peptide     237642..237764
FT                   /locus_tag="Mkms_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.679) with cleavage site probability 0.575 at
FT                   residue 41"
FT   gene            complement(237891..238721)
FT                   /locus_tag="Mkms_0219"
FT   CDS_pept        complement(237891..238721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0219"
FT                   /product="protein of unknown function DUF1206"
FT                   /note="PFAM: protein of unknown function DUF1206; KEGG:
FT                   mmc:Mmcs_0210 protein of unknown function DUF1206"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89437"
FT                   /db_xref="GOA:A1U9C9"
FT                   /db_xref="InterPro:IPR009597"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9C9"
FT                   /protein_id="ABL89437.1"
FT                   /translation="MTDETGAAGAVRTATNHRGAQVAARVGYLINGILHLLIAYIIFRI
FT                   AIGSGHGDADQSGALAALAQTKGGFLALWGVAIALVPLTLWRLAETILGLHPSEHHDPD
FT                   PDPDDFLMVNRLKALGLAVVYAAVAAMAVQFALGSRHSSAERSVGLSIWLMRTPEGKAV
FT                   LAVIGLGVTAVGCYFAFKGASRRFRDDLNISGGRVLTVLGASGHVAEGLVLAVAGVLVV
FT                   VASVRADPSKATGLDGAVKALGQMPFGSVLIGAAAAGFAAYGLYSFALTRYARM"
FT   gene            complement(238737..238931)
FT                   /locus_tag="Mkms_0220"
FT   CDS_pept        complement(238737..238931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0220"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fra:Francci3_3804 CsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89438"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D0"
FT                   /protein_id="ABL89438.1"
FT                   /translation="MGVGDKARNKMQQIQGRMRATTGSAINDPGMRARGRGDERMAHLK
FT                   GAGEKLKDAFRSRRRPRGY"
FT   gene            239057..239902
FT                   /locus_tag="Mkms_0221"
FT   CDS_pept        239057..239902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0221"
FT                   /product="Arylamine N-acetyltransferase"
FT                   /EC_number="2.3.1.5"
FT                   /note="PFAM: N-acetyltransferase; KEGG: mmc:Mmcs_0211
FT                   arylamine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89439"
FT                   /db_xref="GOA:A1U9D1"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D1"
FT                   /protein_id="ABL89439.1"
FT                   /translation="MGHMTETAVDTPAYFTRIGYRGAGDPTLATLRALIAAHNRSIPFE
FT                   NLDPLLGTPVADLSAAALTDKLVYRRRGGYCYEHNGLMGYVLEDLGFGVERIAGRVVWM
FT                   RRDDTLPAQTHQLLTVTVPEVAGRYLVDVGFGGQTLSSPIRFETGVEQPTRHEPYRIRD
FT                   HGEGHVLESLIRGEWRPLYLFADRPQPLIDLEVGSWYVSTHPASVFAVGLTAALVTDEA
FT                   RVNMRGRHLTVHRAEGSEQIRFDTAAQVLDALDERFGIDLTDLGDRAAVEQRIHEVLDN
FT                   "
FT   gene            complement(239921..240931)
FT                   /locus_tag="Mkms_0222"
FT   CDS_pept        complement(239921..240931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0222"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   mmc:Mmcs_0212 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89440"
FT                   /db_xref="GOA:A1U9D2"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D2"
FT                   /protein_id="ABL89440.1"
FT                   /translation="MNDELRQLVDDLARRSYDARMGRHTRPESFDSELWQHLEETGLSR
FT                   LTTAEDAGPAEEAIVLAGLARRSAAVPVAETDLLAAWLAGRAGLEVPDSGPLTVAVCTG
FT                   ARRGGRITGTARQVPWPRDATIVAAVRTEDGLHATVLDAPEIADGVDLAGEPRGVVTID
FT                   VPESVCARTEPELTEELLRRGAWARCVQTIGAFDAAAELTAAHTRERVQFGRALSRFQA
FT                   VQHALAGMAGEIERARATVDLAVAAAAQYGFHSVATHYAVTVAKVTVGRAVEPVTTIAH
FT                   QLHGAIGVTVEHPLWLSTMRARSCVDEFGTTAQHAGVLGRLALSAADPWDVLVGP"
FT   gene            complement(240992..242218)
FT                   /locus_tag="Mkms_0223"
FT   CDS_pept        complement(240992..242218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0223"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0213 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89441"
FT                   /db_xref="GOA:A1U9D3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D3"
FT                   /protein_id="ABL89441.1"
FT                   /translation="MAAAHPQGHDNSCCVRAHYTPPPVGELEALCANDDDLAALRTSIR
FT                   EFLAADRAAHGWQPAVDCWLAAWDPEFSVRLAAAGFLGLTIPTEYGGHGLGHLHRYVVT
FT                   EELLAHGAPVAAHWIADRQVAPGLLTYGTEEQRRRLLPRIAAGRLSSAIGMSEHGAGSD
FT                   LAAVATRATEVDGGWRLDGTKVWTSGAHVADQVVVLARSAPVDPDHRHAGFSQFIVPTD
FT                   APGVTISPIVLMNGEHHFNEVLFDGVFVPHADVLGEIGNGWHQVTAELGFERSGPERIL
FT                   STATLVFEAVAALGRAGVDDRTAAEVGDLMARMVSLRQLSISVARELTAGRDANTRAAL
FT                   VKDLGTRFEQKSVEIVAGLLTSLDEDAPEAERLRGLLATGRLHAPLFTLRGGTNEVLRG
FT                   VVARGLGVR"
FT   gene            242229..243143
FT                   /locus_tag="Mkms_0224"
FT   CDS_pept        242229..243143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0224"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="SMART: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: mmc:Mmcs_0214 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89442"
FT                   /db_xref="GOA:A1U9D4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D4"
FT                   /protein_id="ABL89442.1"
FT                   /translation="MSEHATNPARRDRLRELLDAVVDVSNAEVGDMARSSYASEFHFSR
FT                   EVRRLTGEPPAALRRRIMLERAAWRLRRGEPVAAVAADEGWSSPEVFSRAFRRTFGVPP
FT                   SRAADVGFRVPAPNGLHFHPPQSLWLDGDGTTKEPDPSRLMVAHDVADTAYLIDRAREL
FT                   SEDQWWREVAPGQVVLHWDGPEPSVGAVLGALVWTKEVWLATIEGRDFPDRSRSTVDQL
FT                   AVRHADIGKRWSAMVSEYSAAGRMGDTVIDALCDPPESFQLYGIVAHVLTFSAHRRGLA
FT                   RTMLAALGVPTEQGDPLDWMRRH"
FT   gene            243145..243678
FT                   /locus_tag="Mkms_0225"
FT   CDS_pept        243145..243678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0225"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: mmc:Mmcs_0215 bifunctional
FT                   deaminase-reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89443"
FT                   /db_xref="GOA:A1U9D5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D5"
FT                   /protein_id="ABL89443.1"
FT                   /translation="MATVYYTASSLDGYIVDADDSLDWLISRDIDPDGPFHYDAFVDQV
FT                   GALVMGAATYEWIVKNQPGEWMYSQPTWVVTHRPDIVAAGHPVQTFAGDVTELHPELVA
FT                   AAGGKDVWVVGGGELAAQFVAAGLVDEMIVSYAPCTLGAGSPVLPIRSEWELVESAVNR
FT                   EFVCARWRVAALTG"
FT   gene            complement(243668..244287)
FT                   /pseudo
FT                   /locus_tag="Mkms_0226"
FT   gene            complement(244643..246118)
FT                   /locus_tag="Mkms_0227"
FT   CDS_pept        complement(244643..246118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0227"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0217
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89444"
FT                   /db_xref="GOA:A1U9D6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D6"
FT                   /protein_id="ABL89444.1"
FT                   /translation="MTQTVQEHKTTWDKLFIGGQWVAPSTSDVIEVFSPATGQKVGQVP
FT                   LAAEADVNAACAAARKAFDEGPWPRMSPDERAAVLGAAVKLMEERGAELKYLLAAETGQ
FT                   PQTIVDMMQYGAAMSSFTYFAGAADKFQWSEIRDGIYGQTLVTREPIGVVGAITAWNVP
FT                   FFLAANKLGPALLAGCTVVLKPAAETPLSVFAMAQMFAEAGLPEGVLSVVPGGAETGRA
FT                   LTANPEIDKYTFTGSSAVGKEIGKLAAEKLKPCTLELGGKSAAIVLEDADLDSTLPMLA
FT                   FSGVMNSGQACVAQTRILAPRSRYDEVVEKLANFVSAMPVGLPDDPNAAIGPLISEKQR
FT                   ERVESYIKKGTEEGARIVTGGSRPEGLDSGWFVQPTVFADVDNSMTIAQEEIFGPVLAV
FT                   IPYDTEDDAIRIANDSVYGLAGSVWTTDNKKALEVASKIRTGTYAVNMYAFDPGAPFGG
FT                   YKNSGIGRENGPEGIEQYCQAKSTLLPFGYTPE"
FT   gene            complement(246165..246923)
FT                   /locus_tag="Mkms_0228"
FT   CDS_pept        complement(246165..246923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0228"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0218 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89445"
FT                   /db_xref="GOA:A1U9D7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U9D7"
FT                   /protein_id="ABL89445.1"
FT                   /translation="MSATELFARRATLARSVRLLSEFRFEQSDPARFYGALADDTAAMV
FT                   ADLWQAATETTPGGRTVLDVGGGPGFFAAAFTRRGMEYVGVEPDPREMHAGPAAQVGGR
FT                   YVRASGTSLPFADGSVDVCLSSNVAEHVPDPWRLGNEMLRVTRPGGLAVLSYTVWLGPF
FT                   GGHETGLTHYLGGARAADRYTRKHGHRPKNDYGSSLFAVSAHDGLEWAASTGALIAAFP
FT                   RYHPRWAWWTNAVPGLREFVVSNQVLVLQP"
FT   gene            246960..248120
FT                   /locus_tag="Mkms_0229"
FT   CDS_pept        246960..248120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0229"
FT                   /product="glycosyl transferase, group 1"
FT                   /note="PFAM: glycosyl transferase, group 1; KEGG:
FT                   mmc:Mmcs_0219 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89446"
FT                   /db_xref="GOA:A1U9D8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D8"
FT                   /protein_id="ABL89446.1"
FT                   /translation="MSARPLRSVLLLCWRDTGHPQGGGSEMYLQRIGEQLAAPGVRVTL
FT                   RTASYPGAARREVVDGVHVSRGGGRYSVYPWALLVMALARIGLGPLRGARPDVVVDTQN
FT                   GVPFLARLVYGRRTAVLVHHCHREQWPVAGPVLGRLGWFVESVVSPRVHRRAQYLTVSL
FT                   PSSRDLTDLGVDGSRIAVVRNGLDEAPASTLTLPRSVTPRIAVLSRLVPHKQIEDALDA
FT                   VAALRPHIPDLHLDVLGGGWWQQKLVDHARLSGISDAVTFHGHVDDITKHEVLQHSWVH
FT                   VLPSRKEGWGLAVTEAGQHAVPTIGYRSSGGLTDSIVDGVTGLLVDDRDELVEALRQLL
FT                   GDHVLREQLGAKAQARSVEFSWRQSASAMREVFDAMLSGRYVSGVV"
FT   gene            complement(248169..249764)
FT                   /locus_tag="Mkms_0230"
FT   CDS_pept        complement(248169..249764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89447"
FT                   /db_xref="GOA:A1U9D9"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9D9"
FT                   /protein_id="ABL89447.1"
FT                   /translation="MTAPLLPPGYLLLRDAVSTPRSYLTDAALGLSEAAPRALPQDFAI
FT                   ALASQVLDGGVVVKVLLVAGLWAAGWGAARLASTVVPDAGAAGQCVAVTVAVWNPYVAE
FT                   RLLQGHWSLLVGYGCLPWVATAVLRLRDGSGPWWPLPFWIALAGLTPTGLLLAAVVAVV
FT                   SVCAPGAGRRRIAVLGAALGAAVVSAMPWLVAAAVSGSLAVSPAAGLPAFAARAEPGLG
FT                   TLGSLAGLGGIWNADAVPGSRTTLFAVVATAMLLAVVLAGVWVVRRRPAARPLLILAAA
FT                   AVLFPAVMATGPGLAVLEHTVRALPGLGVLRDGQKWVALAVPGYAVAGAGAVLAVRRVS
FT                   PAALGAVCCAALIAVLPDLAFGVGGQMRAVQYPPGWAAAAAVINADPRPVAVLPPDSMR
FT                   QFAWAGEAPVLDPLPRWVRAEVLSTGDLVIGGTTVPGEGVRARAVQDLVMRGAPVSELA
FT                   DAGVGWVVVESGSAALDLPVAYRDDDLAVYRVGGDRPGSADRWLLIGAHVAWLAVLVGS
FT                   LVAGVVGLRRWPVA"
FT   gene            complement(249812..251014)
FT                   /locus_tag="Mkms_0231"
FT   CDS_pept        complement(249812..251014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89448"
FT                   /db_xref="GOA:A1U9E0"
FT                   /db_xref="InterPro:IPR021424"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E0"
FT                   /protein_id="ABL89448.1"
FT                   /translation="MNRAVALRIAACGLMGLGAALLIAALLLSTYTKGKISKVPLDIDT
FT                   TLISDGTGTAFDPASLLGERFVVDRDIPMAFQQQITVESPSNADVVTLQVGSTLRRTDK
FT                   QQDNGLLLAMVDTVTMDRSSAMAVTSESNPGGAVQKPRAIEDDQPPTNIALPHDGLTYR
FT                   FPFDTEKKTYPLFDPIAQKAYDANYDGEEDVNGLTTYKFTQNVGYDAEGKLVEPVKYAS
FT                   LYEDDADAQVTARAALWGVEGDPEEPITMSRFYAAERTLWVDPVSGTIVKSDEHGYHYY
FT                   ARDALRPEVTFADYTVTTNEESVESQVASARSERDRVALWGRILPITFTAVGLVLLVGG
FT                   ALLGSFSLRAESALIDPGLDEADHGFFQRDDAGEPVPGAEAKTEKLPAQRPTDLPPDRP
FT                   V"
FT   sig_peptide     complement(250910..251014)
FT                   /locus_tag="Mkms_0231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.398 at
FT                   residue 35"
FT   gene            251142..252320
FT                   /locus_tag="Mkms_0232"
FT   CDS_pept        251142..252320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0232"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: mmc:Mmcs_0222
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89449"
FT                   /db_xref="GOA:A1U9E1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E1"
FT                   /protein_id="ABL89449.1"
FT                   /translation="MTSSEEIGGTRSFLPAVEGMRACAAIGVVVTHVAFQTGHTSGADG
FT                   RFFGRFDLAVAVFFALSGFLLWRGHAAAARGLRTAPPTAHYLRSRIVRIMPGYLVAVVI
FT                   ILSLFPDTKPDLTVWLANLSLTQIYVPLTLTAGLTQMWSLSVEVSFYLVLPLLALSVRR
FT                   VPVRARIPVIVGAAVASLFWVYIPSDPDSGHNLWNWPPAFFSWFAAGMVLAELTVTQVG
FT                   WAHRLARRRILMAAIVVAAFAVAASPLAGREGLQPGTIGQVILKTAMGAVVAGALLAPL
FT                   VLDRPDTPHRILGSRVMVTLGRWSYGLFIWHLAALAMVFPMVGEFAFNGHMPSVLALTL
FT                   LFGFALAAVSYACVESPAREALRRWEFRRATPTHRAPPLDSSVTDVPEPISR"
FT   gene            complement(252289..253764)
FT                   /locus_tag="Mkms_0233"
FT   CDS_pept        complement(252289..253764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0233"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0223 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89450"
FT                   /db_xref="GOA:A1U9E2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E2"
FT                   /protein_id="ABL89450.1"
FT                   /translation="MVDGVPPIGTQFSALAARDPDAPALTCAGRTVTRGELDVTTNRLA
FT                   RAYAELGVRQGDYVTILLPNSIAWVEAVLATWKLGAVPQPLSARLPDAELSALLALRPP
FT                   ALLVGRADPNDVSPSVPANFTPDPALPADPLPEAVSPAWKSMASGGSTGRPKLIEAGGD
FT                   SRVPSAIGLPLGAEEGDVNLVSVPLSHNTGFTTLAIGLLMGHHLVLMPRFEPHEFLRLV
FT                   SEHRVTFLTTVPTIMQRLLPVYRADPGAYDLSSIRRFWHVGAPCPPAVKEAWIGLLGPQ
FT                   VLWELYGGTELQALTFISGEQWLTHRGSVGTVVAGAMTVLDDDGNTCPPGVVGEIYMRR
FT                   SPGAAPTYRYIGSTAKSRDGWDSLGDLGYFDEDGFLYLNDRRVDMFTVGGRNVYPAEIE
FT                   SALSAHPDVLSCLVVGVPDDDLGQVPHALVQRAPGSALDEAAVTAFVAERLAGYKVPRT
FT                   VEFSEHPLRDDAGKARRSAVRAEVIARSARARP"
FT   gene            complement(253766..254743)
FT                   /locus_tag="Mkms_0234"
FT   CDS_pept        complement(253766..254743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0234"
FT                   /product="Aryldialkylphosphatase"
FT                   /EC_number="3.1.8.1"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: mmc:Mmcs_0224
FT                   aryldialkylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89451"
FT                   /db_xref="GOA:A1U9E3"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR017947"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E3"
FT                   /protein_id="ABL89451.1"
FT                   /translation="MPQLNTAAGTIDTADLGVTLMHEHVFIMTTEILLNYPDAWGDEAK
FT                   READAIARLDELKARGVDTIVDLTVVGLGRYIPRIARIAAATDLNIVVATGLYTYNDVP
FT                   FFFHFTGPGTALGGPEVMVDMFVRDIEHGIADTGVKAAILKCATDEPGLTPGVERVLRA
FT                   VAQAHRRTGVPISTHTHAATRRGLDQQRIFAEEGVDLSRVVIGHSGDTTDLDYLEALMA
FT                   AGSYIGMDRFGVDAFLGFEDRVATVAALCERGHADQMVLSHDASCYFDALPEETVAHTM
FT                   PNWHYLHIHNDVLPALRARGVTDEQLTTMLVDNPRRIFEHSGGY"
FT   gene            254842..256443
FT                   /locus_tag="Mkms_0235"
FT   CDS_pept        254842..256443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0235"
FT                   /product="protein of unknown function DUF894, DitE"
FT                   /note="PFAM: protein of unknown function DUF894, DitE;
FT                   major facilitator superfamily MFS_1; KEGG: mmc:Mmcs_0225
FT                   protein of unknown function DUF894, DitE"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89452"
FT                   /db_xref="GOA:A1U9E4"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E4"
FT                   /protein_id="ABL89452.1"
FT                   /translation="MATPQTRPVVSSWAPFSSPVYRALWIAQFVSNLGTWMQTVGAQWM
FT                   LVGDPGAAVLVPLVQTATTLPIMLLALPSGVLADLIDRRRLLIATQAAMASGVAALAML
FT                   TGFGLATPTVLLLLLFLIGCGQALTTPAWQAIQPELVPREQIPAAAALASMSVNGARAI
FT                   GPAVAGVLVSLSGPTTVFALNAFSFIGIVMVLLWWRRPVEEATMPLERPISALSAGRRY
FT                   IRSSPVIRRILLRTVLFTAPASALWGLLAVIAANQLNLSSSGYGLLLGALGVGAVLGAV
FT                   VLSRLHARFGQNQLMVMGAVGFAGATVVLATVHVLAAVLAALVVGGVSWLLTMSTLNAS
FT                   MQLSLPAWVRARGLSVYQLVFTGSQAIGSLVWGVVAGATSGVTALLISAALLIVCGVSV
FT                   AWWPLHPATGTLDVTPSAHWGEPALVFEPDPQDGPVVVLQSYVVAPKDEAGFLALMQRV
FT                   RRSRQRTGAMEWGIFRSGESADTFVELFLVRSWDEHLRQHLVRQTALDLALEREIEGYV
FT                   HGESTLRHFIAVRNGR"
FT   gene            complement(256418..260572)
FT                   /locus_tag="Mkms_0236"
FT   CDS_pept        complement(256418..260572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0236"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0226 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89453"
FT                   /db_xref="GOA:A1U9E5"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR021798"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E5"
FT                   /protein_id="ABL89453.1"
FT                   /translation="MAALVLTFAQSPGQISPDTKLDLTANPLRFLARAANLWNSELPFG
FT                   QAQNQAYGYLFPHGTFFLAGDLLGLPGWVTQRLWWALLLTVGFWGVVRVAEALGLGSPT
FT                   SRVIGAVAYALSPRVLTTLGALSSETLPMMLAPWVLLPVILALRGEGSARRLAARSAGA
FT                   IALMGAVNAVATLTGCLAAVLWWACHRPNRLWWRFTAWWFGCAALAVLWWVVPLLLLGR
FT                   ISPPFLDFIESSGVTTQWMSLTEMLRGTGSWTPFVAPTATAGSTLVTGSLAVLATTLVA
FT                   AAGMAGLALRSMPARGRLITMLLVGVALLAAGYAGGLGSPVAGAVQAFLDGDGTPLRNL
FT                   QKLDPVLRLPLALGVIHLLARIPLPGSAPRPVWLHAFAHPEKDRRVAVGIVVLAALTAA
FT                   TSLAWTGRLTPPGAFTAIPGHWHETAAWLDAHNTGDPTAGRVLVAPGAPFATQVWGSSH
FT                   DEPLQVLGESPWGVRDSIPLTPPETIRALDSVQRLFAAGRPSAGLADTLARQGISYVVV
FT                   RNDLDPESSRSARPVLVHRAIDGSPGLTRVAQFGDPVGPGTLEGFVSDSGLRPRYPAVE
FT                   IYRVDAQHNPSTPYLVDADAMARVDGAPEALLRLDERRRLLDRPPLGPMLLTADAERAG
FT                   LPAPLVTVTDTPTARETDYGRVDDHSSAIRTPDDPRNTFNRVPDYPSAGADVVYGRWTG
FT                   GRLSVSSSAADSTALPNVAPATGPTAAIDADTSTSWVSNALQAALGQWLQVDFDKPVTN
FT                   ATITVTPSATAVGAQVRRMEVATVNGTSTLRFEEAGKPLTVALPYGETPWVRITATGTD
FT                   DGSAGVQFGITDLSVTQYDANGFATPIHLRHTVEVPGPPAGSAVGLWDLGSELLGRQGC
FT                   VDSPDGVKCAAAMALSPEEPVNLSRTLAVPAPTSVQPTVWVRARQGPRLAELIRQPDTT
FT                   VVAGDADALDVLGSSYAAGDGDPRTAWTAPQRVVQHRTPPTLTLRLPAPTEVAALRITP
FT                   SKTEPPAHPRMVAVDLGNGPQARRLSGDGDTETIRLTPHRTDTIAVSLLDWNDIIDRTS
FT                   LGFDQLKPPGLAEVTALDRRGNPIGAADAGENRGRTVDVPCGEGPIIGVAGQFVPTRVT
FT                   ATVGALVDGEPVLAQPCRTEPIALPAGQQELLVSPGATFVVDGVQLAAPAARDITPAAT
FT                   TPADTGAWGPDRREVRVVPGQRDRVLVVPESVNPGWQARGPGGDLLTPVVVNGWQQGWV
FT                   VPADTEGAVTLSFRSNTLYRAGLIGGLALLPLLALLVWLPARRRRDDEPGRPWRVPTVA
FT                   AAVGVLGVGAVISGWAGVVVVGGVLGVRYLLRNRERLLDRFTLGVTAGGLTLAGAVLSQ
FT                   HPWRSVDGYVGFEPGVQLLALVSVAALAASAVPFNARSAPR"
FT   gene            complement(260664..260837)
FT                   /locus_tag="Mkms_0237"
FT   CDS_pept        complement(260664..260837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0237"
FT                   /product="small secreted protein"
FT                   /note="KEGG: mmc:Mmcs_0227 small secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89454"
FT                   /db_xref="InterPro:IPR022566"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E6"
FT                   /protein_id="ABL89454.1"
FT                   /translation="MDRFIVPAAASIVVGLLLGAAAVFGVTLMVQEDSKPPLQAGDPAS
FT                   SVLNRVEYGDRS"
FT   sig_peptide     complement(260760..260837)
FT                   /locus_tag="Mkms_0237"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.655 at
FT                   residue 26"
FT   gene            complement(260863..261381)
FT                   /locus_tag="Mkms_0238"
FT   CDS_pept        complement(260863..261381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0238"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0228 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89455"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E7"
FT                   /protein_id="ABL89455.1"
FT                   /translation="MTAHADVSARESVSEVHRQVGQEIMVIAYDGTANARRAVHYAGRF
FT                   LSANRAVVLTVWSPTLRGSEPPAVDLDGPPDPAPDDDEDIAYADAQRTNAEGIELARAA
FT                   GLSAEAMCVAATSTVWNTIIETADTLDADLIVTGTRGTTGLRSLLQSSVADRVLRHGHR
FT                   PVLIVPPGR"
FT   gene            261442..262647
FT                   /locus_tag="Mkms_0239"
FT   CDS_pept        261442..262647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0239"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: glycoside hydrolase, family 3 domain protein;
FT                   KEGG: mmc:Mmcs_0229 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89456"
FT                   /db_xref="GOA:A1U9E8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E8"
FT                   /protein_id="ABL89456.1"
FT                   /translation="MSEPMAWTRGLCALVATSGMLLACSSPKQEPAAAPADPAITAAPV
FT                   SAAPAVPLKAPVPLAPGAAACGQGAALLSEMTTRDKLAQLLMVGVSGAADARAVVDNHR
FT                   IGGIMIGSWTDLSMMGAPLAEIAASAGPLPLAVSVDEEGGRVSRLASLIGSQPSARALA
FT                   QSSTPDQVYGIALERGRAMRGLGVTIDFAPVVDVTGASAAIGDRSFGDDPATVTEYAGA
FT                   YARGLRDAGVLPVLKHFPGHGNASGDSHTEGVVTPPLSELQNSDLVPYRTLTAQAPVGV
FT                   MVGHMQVPGLTGSDPASLSPAAYQLLRSGGYGGPGFNGPVFTDDISSMRAITDRYGVAD
FT                   AALRALQAGADTALWVTTAEVPAVLDRLEQAVGSGELTMPRVDQSVLRVAAMKGPNPRC
FT                   GG"
FT   sig_peptide     261442..261585
FT                   /locus_tag="Mkms_0239"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.762 at
FT                   residue 48"
FT   gene            complement(262655..264109)
FT                   /locus_tag="Mkms_0240"
FT   CDS_pept        complement(262655..264109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0240"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase, major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   mmc:Mmcs_0230 Orn/Lys/Arg decarboxylase, major region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89457"
FT                   /db_xref="GOA:A1U9E9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9E9"
FT                   /protein_id="ABL89457.1"
FT                   /translation="MDSDRHTRAPLFEALRRFVERDQAPFYSPGHKGGRTLDPWFREHI
FT                   AAVDLNNLADLDTLHCPSGPILEAEELIADAWGAKASFILVQGSTGGNIAVALSALRPG
FT                   DPVLVQRNAHKSVLAGLVQSGARPIWLTPQWDADFGVAHGLPVDRVEAALTAETAAALW
FT                   ILHPTYFGTTADIAALTAVCRRHGIPLLADGAHSPHFAFHPDLPAAAETAGAAATVQSV
FT                   HKILSGLSQAAVLHVDTDQLDVPTVRRALQLVQTTSPHFAIMASIDLARRQMVEDGRRL
FT                   LDETLRRARDTAARLAQIPGLRVLSDHDLTGPGSGLHQRDETKLLIGTHGLAADASDIL
FT                   ARLTREHGVQPELAGAGHILCITTIGNTDADMDRLVDGLTDVALAVGRRDGGCPPDVGG
FT                   ALDLAPEIVLTPREAFFADVDTVSLRAAVGRIAAEPITPYPPGIPLVMPGERLSAEVVD
FT                   VLDGLRGAGNPISAADPTLERVTVVR"
FT   gene            complement(264099..265274)
FT                   /locus_tag="Mkms_0241"
FT   CDS_pept        complement(264099..265274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0241"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmc:Mmcs_0231
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89458"
FT                   /db_xref="GOA:A1U9F0"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F0"
FT                   /protein_id="ABL89458.1"
FT                   /translation="MPVGDRTDVFAGVAADVPDALAEHLRAVDLVDHHVHGTFNEAVDR
FT                   AGFEAAINEGSTDPVPSFMTQFDSPLGLAIRRWCAPVLDLEPLAGADEYWSRRAEFGPD
FT                   ELSERFLRAAGVSRWVVDTGFKGDLITTPGQMTALSGVPSSEILRLERLTEDLLEAGTS
FT                   PRDYPEAFRSALDEAVADQGTVGVKTIAAYRVGFDVDWSRPSEATAVDSAERLVARGAP
FT                   LRVDDPALIAFGVHEAAERGLPIQVHVGFGDRDLDLHRTDPLLLLPLLRAMTPVPVLLL
FT                   HCYPFQRQAGYLAQAFDHVNFDVGLAINYLGPRSTSVVAEALDTAPFAKQLYSSDAFGP
FT                   PELHLLGSILWRRAMGLVLGDWVRTGDCTEADAIRIVDMIGVHNAERVYGL"
FT   gene            complement(265345..266853)
FT                   /locus_tag="Mkms_0242"
FT   CDS_pept        complement(265345..266853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0242"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0232 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89459"
FT                   /db_xref="GOA:A1U9F1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F1"
FT                   /protein_id="ABL89459.1"
FT                   /translation="MTQTPPETNLAPETDQLPHRRLPFWVALAMSVALVGPTLAMSGNG
FT                   QGLIGTVGKAIPLVFLIGLIGVSLVGYSFVRLTRHLNHAGSAYGLVGGTIGPRAGFFSG
FT                   FAMLGAYVGFSIGTLALTAAFTNAFIAQLQPDAEDPYQVPWLLVVLVGAGISFLLAGRD
FT                   IRLLAKILLGIEGIGILAMVILVAVIFAKGGAPTTGVDFSVFTFDGVSASAVLSGVVAA
FT                   FLSWAGFEACASMGEETDDPRRNIPRALGGTLLLTGVLFVVVMFAQVIGFGTDEAGLAA
FT                   FQGSGNTLGDLGSTYVGQWFSLLIIFTATVAAFGCHLATSATSGRMLYAFGRDGFGPKA
FT                   LAHIHAETGGPRRATWLVVGVALVVDLICGALDWPDMGTGNDAIDTYFLFAVAGSVCLM
FT                   VCYLLVEIAAAWFVGAPKFVGVHGGTGKVLGLLLPLLGAVVIAVVLWFNVKDAETWSAA
FT                   PLLGLYWCAIGLIIALAASGIAKRVGESLSRELELSPPDGRPVS"
FT   gene            complement(266877..268190)
FT                   /locus_tag="Mkms_0243"
FT   CDS_pept        complement(266877..268190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0243"
FT                   /product="glutamine synthetase, catalytic region"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0233 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89460"
FT                   /db_xref="GOA:A1U9F2"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F2"
FT                   /protein_id="ABL89460.1"
FT                   /translation="MPQQDEELRAQGVALIAGSVTDLAGVTRAKYVPVRRLRAFEQSGM
FT                   GVSPSWSVFCVDSGIAFTPDIGVAGDLRIRIDGEHLRIIEDGIAWAPGDLHDQYGRPAP
FT                   LCPRSLLARVEQRAAERGLEVRVGGELECTMLAADSGPASAEPWSPYGIRTSLDRSAFL
FT                   VDLIGAAERAGLAVEQLHTEYGHDQLEMSLAPAGPVETADAIILARIVIGRAAARHGMK
FT                   ISFSPVPFADAAGNGAHLHLSLTDSAGPLLSGGDGPYGIRPEGSAAIAGVLDTLPDLLG
FT                   VYAGSALSALRLKPGNWAGASACWGLENREAAVRFIAATPGNPHGANAELKLVDPSANP
FT                   YLAAAAFLGSALHGIDRRLPLPPEVPEDPRRSGATPPALPTGQQAALEALENSATAAEL
FT                   LTTPIIEALIAVRRHELTTYGDRPPAETTQALRLAWSC"
FT   gene            268306..269100
FT                   /locus_tag="Mkms_0244"
FT   CDS_pept        268306..269100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0244"
FT                   /product="glutamine amidotransferase, class-II"
FT                   /note="PFAM: glutamine amidotransferase, class-II; KEGG:
FT                   mmc:Mmcs_0234 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89461"
FT                   /db_xref="GOA:A1U9F3"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F3"
FT                   /protein_id="ABL89461.1"
FT                   /translation="MCRLLGVVSAVPVSVSDAVGAPTLKDFVALTKIHGDGWGVAAVEE
FT                   AGRSPRVEVSAGSALDDPAFDAATAERRAVASMVHLRWATNGLAVRPENSHPFLADGIA
FT                   MAHNGSIKPMAPLDALLEPGIAATLRGTTDSERYFALIRQHRRTAPTLAEAVRRAVSEL
FT                   RDRYPEASLNALLLGEGQLVAVHAHARSRLPAEDIEEITAADLPTEHLEDYFALRWARP
FT                   DDGTLVIGSTGFGDLDWQPLPPECVTAVSIDDRSMTLHPLGP"
FT   sig_peptide     268306..268371
FT                   /locus_tag="Mkms_0244"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.321 at
FT                   residue 22"
FT   gene            269113..269976
FT                   /locus_tag="Mkms_0245"
FT   CDS_pept        269113..269976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0245"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: mmc:Mmcs_0235 transcriptional regulator, RpiR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89462"
FT                   /db_xref="GOA:A1U9F4"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F4"
FT                   /protein_id="ABL89462.1"
FT                   /translation="MPSPTGETVAALAAAALPALSRAERRVGRALLADYPSAGLASAAR
FT                   LAERADVSPPTVLRFAHSLGFEGFADLQVSLRAEISAMSSGPITRLPDAPAAGSPLDRL
FT                   LNQARAQNDRALETLAHLPGSSLEAAVALLADQTRPLFLHGGRFSVLLAHHLGAHLEQL
FT                   RPGVRLLADPSGRDLGAMMELTRRDVLVLFDYHRYQASAVDVAARFHRAGAAVVLITDD
FT                   LACPVAPDAEVVLAASSTVGTVYQSMAAGFLLTELLLPLVMEAIGEPARTRMALWEEQR
FT                   RGELLP"
FT   gene            270020..270676
FT                   /locus_tag="Mkms_0246"
FT   CDS_pept        270020..270676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0246"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0236
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89463"
FT                   /db_xref="GOA:A1U9F5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F5"
FT                   /protein_id="ABL89463.1"
FT                   /translation="MAGGTKRLPRAVREQQMLDAAVQMFSVNGYHETSMDAIAAEAQIS
FT                   KPMLYLYYGSKEDLFGACLDRELGRFVDEVRSKIDFSQGARDLLRNAVLSFLTYIDTNR
FT                   ASWMVLYTQATSSQAFAHTVREGRERIIELVSRLLREGTRHPEPDTDFEMMAVALVGAG
FT                   EAIATRVSTGDADVDEAAELMINLFWRGLKGTPSDAAGQERSDSGMSKGAAVASN"
FT   gene            complement(270680..271768)
FT                   /locus_tag="Mkms_0247"
FT   CDS_pept        complement(270680..271768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0247"
FT                   /product="hydroxyneurosporene-O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="PFAM: O-methyltransferase, family 2;
FT                   Methyltransferase type 12; KEGG: mmc:Mmcs_0237
FT                   O-methyltransferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89464"
FT                   /db_xref="GOA:A1U9F6"
FT                   /db_xref="InterPro:IPR001077"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016461"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F6"
FT                   /protein_id="ABL89464.1"
FT                   /translation="MATPKVPPVRLARAVERLRHVLDRAHQRSAPPSAVMLEKILGAWI
FT                   SQGITVAADLRVADALADGPLPIGELARRVGANPDALARLMRALIGEGVFTQRRDGRYA
FT                   LNALGRTLCTDATMSVAGMARMIGHPAHREHWSQLLDAIRTGEATVPKLRGMPGFEYLS
FT                   ENRELGEIFNDAMTNLSETAVAPLTAAYDFRGFGTIVDVGGGHGRFLSAILAATPSARG
FT                   VLYDLPQVVEGATELLGSHGVADRVEIVGGSFFDSIPAGADAYVAKNVIHDWPDADALT
FT                   ILRNIRSAAGTGATLLLAEFVIPDHHRAFIGNWTDMEMLMATAARERTEAEYRKLYQQA
FT                   GFRLTRVVPTVAPISLIEGKAV"
FT   gene            complement(271774..272172)
FT                   /locus_tag="Mkms_0248"
FT   CDS_pept        complement(271774..272172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0248"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89465"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F7"
FT                   /protein_id="ABL89465.1"
FT                   /translation="MIRACLVLSMAAALTVAGTAAAHAQPVPPCTFTLSAPSVVQNADG
FT                   AVVAATVTPLECGWGAEPNYSVACLQLSGNSGPTTCTQSRGRDAARILYAPHIPGAGYT
FT                   ATGRGCGRWVGQPPAHLCQHLGPQNATL"
FT   sig_peptide     complement(272098..272172)
FT                   /locus_tag="Mkms_0248"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.792 at
FT                   residue 25"
FT   gene            complement(272288..273133)
FT                   /locus_tag="Mkms_0249"
FT   CDS_pept        complement(272288..273133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0249"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   mmc:Mmcs_0239 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89466"
FT                   /db_xref="GOA:A1U9F8"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F8"
FT                   /protein_id="ABL89466.1"
FT                   /translation="MGGQPSGTRNLLRAAAGALPFVPRGESLPERTLTVDELAIDPANV
FT                   AAYADVTGLQFGDTVPLTYPFALTFPTVMALVTGFDFPFAAMGSVHIENHITQHRPIAV
FT                   SDTVSAAVHAENLREHRRGLLVDVVTDVKVGNELAWHQVTTFLHQQRTSLSDQPKPPPQ
FT                   KPPKLGPPNALLNITAGQIRQYASVGGDHNPIHTNPIAAKLFGFPTVIAHGMFSAAAVL
FT                   ANIEGQLPGAVEYSVRFAKPVVLPAKAGLYVERTADGGWDLTLRNSKGEPHLTGTVRGL
FT                   "
FT   gene            complement(273135..274496)
FT                   /locus_tag="Mkms_0250"
FT   CDS_pept        complement(273135..274496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0250"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0240 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89467"
FT                   /db_xref="GOA:A1U9F9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9F9"
FT                   /protein_id="ABL89467.1"
FT                   /translation="MASDIYTQIVHSGPGSFLAKQLGIPQPETLRRYKPGEPPLPGALL
FT                   IAGEGRVVEPLRTALADDYDVVANNIGGRWADKFGGLVYDATGITEPEGLKGLFEFFTP
FT                   LLRNVTPNARLVVIGSDPDVAGTPHEQIVQRALEGFTRSLAKELRRGATASLVYLSPEA
FT                   KTAATGLESTMRFILSGKSAYVDGQVYRVGADDATPPADWDKPLQGKVAVVTGAARGIG
FT                   ATIAEVFARDGAAVVAVDMKAPEGATDELAKVAEKVGGTALTLDVTAPDAVDKIAAHVR
FT                   DHHGGKLDILVNNAGITRDKLLANMDEGRWDSVIAVNLLAPLRLTEGLVDSGVLGEGGR
FT                   VIGLSSMAGIAGNRGQTNYATTKAGMIGLTDALAEKLHDKGITINAVAPGFIETKMTEA
FT                   IPFATREVGRRLNSLYQGGQPVDVAETIAYFANPASNAVTGNTIRVCGQAMLGA"
FT   gene            274607..275908
FT                   /locus_tag="Mkms_0251"
FT   CDS_pept        274607..275908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0251"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: mmc:Mmcs_0241 acetyl-CoA C-acyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89468"
FT                   /db_xref="GOA:A1U9G0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G0"
FT                   /protein_id="ABL89468.1"
FT                   /translation="MADSRSMRRVAVLGGNRIPFARSDGAYANASNQDMFTAALGGLVD
FT                   RYHLQGEKLGAVIGGAVLKHSRDFNLMRECVLGSALSSYTPAFDIQQACGTGLQAAIAA
FT                   ADGIAAGRYESAAAGGVDTASDAPIALGDDLRKTLLGLRRAKSNVDRLKLVGKLPAAVG
FT                   IQIPVNSEPRTGMSMGEHAAVTAKEMGIKRVDQDELAAASHRNMAAAYDRGFFDDLVTP
FT                   FLGVYRDNNLRADSSAEKLAKLKPVFGVRHGDATMTAGNSTPLTDGASVALLASEEWAQ
FT                   QHSIEPLAYYVDGETAAVDYVNGRDGLLMAPTYAVPRLLARNGLTLQDFDFYEIHEAFA
FT                   SVVLAHLQAWESEEYCKERLGLDSALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQLA
FT                   KQLAEKKKQTGQPVRGLISICAAGGQGVAAILEA"
FT   gene            complement(276325..278160)
FT                   /locus_tag="Mkms_0252"
FT   CDS_pept        complement(276325..278160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0252"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0242 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89469"
FT                   /db_xref="GOA:A1U9G1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR034188"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G1"
FT                   /protein_id="ABL89469.1"
FT                   /translation="MSHYKSNVRDQVFNLFEVLGVDKAMGQGDFSELDADTAREMLDEM
FT                   ARLAEGPIAESFFEGDRNPPVFDPKTHSVKLPEPFKKSMRALFDAGWDKAGMPEELGGM
FT                   PMPRALQWALIEHVLGANPAAYMYAMGGGMAHILHNLGTEEQKKWAVLAAERGWGATMV
FT                   LTEPDAGSDVGAGRTKAVKQDDGSWHIEGVKRFITSADSDDLFENIFHLVLARPEGAGP
FT                   GTKGLSLFFVPKFLVDFETGELGERNGAFVTNVEHKMGLKVSATCELSLGQHGVPAKGW
FT                   LVGEVHNGIAQMFDVIEQARMMVGTKAIATLSTGYLNALEYAKSRVQGADMTQMTDKTA
FT                   PRVTITHHPDVRRSLMTQKAYAEGLRALYLYTATFQDTAVAKAVHDVDSELAVRVNDLM
FT                   LPIVKGVGSEQAYAKLTESLQTFGGSGFLQDYPIEQYIRDAKIDSLYEGTTAIQAQDFF
FT                   FRKIVRDKGQALAYVAGQIEQFVKSESGNGRLKAERALLATALEDVQAMAASLTGYLMA
FT                   AQENPAELYKVGLGSVRFLMSVGDLVIGWLLQQQAAVAIGALDGGATGEDKAFYEGKVA
FT                   VASFFAKNFLPLLTSTRQVVEHLDNEIMELDEAAF"
FT   gene            278569..279309
FT                   /locus_tag="Mkms_0253"
FT   CDS_pept        278569..279309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0253"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: mmc:Mmcs_0243 response regulator receiver and ANTAR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89470"
FT                   /db_xref="GOA:A1U9G2"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G2"
FT                   /protein_id="ABL89470.1"
FT                   /translation="MTLARITMAADAVASLAAIPAVGESLDEALTRVADGAVAAVANAD
FT                   AVSITVLEPPAGRTVAYTDRRLLPLDKKQYTSRRGPCLEAADTGRAVRVAMASHEQRWP
FT                   EFVAAARTEGVRATLSIPLILASPTDRQDSELVGSLNAYSTTTDDFDLVDETLLGLYTD
FT                   AATQAIAHARGRQHLQDTVAQLERALTSRAEIEQAKGALRVVHACTADEAFALLIERSQ
FT                   RENVKLRDVARRVLKDLSRPTPGE"
FT   gene            complement(279328..290409)
FT                   /locus_tag="Mkms_0254"
FT   CDS_pept        complement(279328..290409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0254"
FT                   /product="beta-ketoacyl synthase"
FT                   /note="PFAM: beta-ketoacyl synthase; acyl transferase
FT                   domain protein; NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   phosphopantetheine-binding; Alcohol dehydrogenase,
FT                   zinc-binding domain protein; Alcohol dehydrogenase GroES
FT                   domain protein; KR; KEGG: mmc:Mmcs_0244 beta-ketoacyl
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89471"
FT                   /db_xref="GOA:A1U9G3"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G3"
FT                   /protein_id="ABL89471.1"
FT                   /translation="MSHRGRALTADAREDTNGMESAAYPHVPANRFAIVGYAARFPGAQ
FT                   DADEFWDLLRDGREAISEVPQDRWNVDEFFDPEPGAPGKVVTRRAGFVDDVTGFDAPFF
FT                   GMSTREVRLMDPQHRLLLETAWRAVEHSGTAPTDLANSNTGVFVGLATHDYLGMASDEL
FT                   SYPEIEAYMAIGTSNAAAAGRISYRLGLQGPAVAVDTACSSSLVAIHQACQALQLGECD
FT                   LALAGGANVLLTPATMITFSNAHMLAPDGRCKTFDAAADGYVRGEGCGVIVIKRLEDAL
FT                   RDGDRIRAVIRGSAINQDGASGGLTVPNGVAQQRVITDALKRAGVRAGDVGYLEAHGTG
FT                   TSLGDPIEAQAAGEVLGAGREPSRPLLIGSAKTNIGHLEAAAGIAGVIKVILSLEHETL
FT                   PKHLNFTTPSPHIPWDRLAVKVVTESTPWERNGRPRIAGVSSFGFAGTNAHVILEEAPE
FT                   STVTPAATPEPGERFSLLPLSARTPAALVRIADRYRSWMTTHPEATLADVCFTASTARA
FT                   HLEQRAALVVDSRESAVELLGALADDRPAPGLVRGESHDTPKTAWLFTGQGSQYPGMAR
FT                   ELFDTEPVFAETMKQCAAAVADVLEKPLLDVIFDAHGPEAAETLRQTSYAQPALFAVEM
FT                   GLARLWQSWGFEPDVVLGHSVGQYAAACVAGVLGLEDGARLMAERGRLFGSLPAGGRMV
FT                   AVFTAAERVENITDEYPRLSVAAYNGANTVLSGPAGDLEKAVATLAADGIRCDWLDTSH
FT                   AFHSALLDPILDEFESYAQQIEYAAPQRVLIDNRTGAALGWSAKLDGTYWRRHARQPVE
FT                   FAKSVRTLAELNCKVLLEIGPRPVLTAAALSAWPDPATAPRAIASLRRNTADHRQITEA
FT                   LADAYVLGHRPDFAAIQRPDAHKLDLPTYPFEHRQYSFRDNQAERPEQAGPPIHQAART
FT                   EAVGLLEDGRIEELAALLGDTDGDRQTFDVLSKLAAQHNQQRTSQSITDDRYEIRWEEL
FT                   TTASPAATGEPSTWIIVGDDTDAARPLIDAVTARGDRHRLVGSPVSDADEASLADALRA
FT                   SVDDASAPGGAVRILHIAALDATTAPSMRTLLSMQHRILGRTRRLFHAVTTTGLRTPIW
FT                   LITRGAQRVTATDTVAPDQSALWGFGRAASLELPHLWGGLADLPTGPGASEDEWSRLLD
FT                   RIAAPRHSDVTEDQVALRDGAVHVPRLVRRTGQPSGAPLRLRSDATYLVTGGLGAIGLE
FT                   IAGYLAAHGAGNIVLTSRRAPGDAAQQRIDALRDKFGCAIRVATADVADAHDVARLLAG
FT                   VQAELPPLAGIVHAAGEIGTTALSAMDDESQQAEVDRVFAGKVWGAWHLSEAAVDLQLD
FT                   FFISTSSIASVWGGFGQTAYGAANAFLDGLAWRLREQGIAATSVNFGPWSAGMADAESR
FT                   ARLEQRGVRTLDPADALAGLADVVAGPATQGVIARIDWARFLPLYQQAGRRAFLTELER
FT                   EAPVASTDAAPAVTASGKTPLVERLSGAPVQQRKKLLTDYLRDAVAEVTRVDSAEIRED
FT                   AGFFDLGMDSLMAVELRRRLEQGVGKEIPVTLVMDHPRLSDAADYLLGEVLGLAEQAPA
FT                   ESRPALASLASERTDDPIAIVAVSCRFPGAPDPEAFWDLLSGGVDAIREVPEDRFDIDE
FT                   FYDPDPDAAGKTYTRFGGFLDGIDGFDPEFFGISPREAVWIEPQQRLMLETVWEGIERA
FT                   GLSPADLRGSRTGVFVGVAANEYAHLLSSESIEKIEPHFITGNALNAISGRVAFALGLE
FT                   GPAVAVDTACSSALVAVHQAVQALHSGDCDLAVAGGVNVLLSPVTVVAASRARMLSPVG
FT                   RCKTFDASADGYVRSEGCGILVLKRLSDAVRDGDRVCAVIPGTAVNQDGASSGLTVPNG
FT                   GAQQRLIKTALTRAGLTGGDVDYLEAHGTGTPLGDPIEVQAAAAAYGASRDADRPLLMG
FT                   SVKSNIGHLESASGAAGLIKVVLSLQHGVLPQSLHFDNPSPHIPWDSLPVRVVDEAVPW
FT                   QPNGRPRRAGVSSFGFTGTNAHVLVEEAPQAPVSEDQESDTDDQPVHVLPLSARSPEAL
FT                   VALARRYDSWLGAHPDADLAGVCFTAGTGRSHFEHRAAMVVDSVASARQGLADLADNRT
FT                   RPGVVRGEHTNRPTTAWLFTGQGSQYPRMARELFDAEPVFAETVTRCADAVDGMLPLPL
FT                   LEVLFAADRETAERLRHTSYAQPALFAVEMGLARLWQSWGVTPDVVLGHSVGQYAAACV
FT                   AGVFSLEDGARLMAERGRMFGSLPEGGRMVAIFADAKQVEQIAGEFARVSVGAYNGPNT
FT                   VLSGPGEDLEQIVARFADEGIRCTWLETSHAFHSELLDPVLDEFESYAAQFEFAAPTMP
FT                   VVCNRTGAVLTGQTPLDAQYWRRHSRQPVQFAESVRTVATLGCSVLMEIGPQPVLTGAA
FT                   VQIWPEHLAAPRAIASLRKGVGDRRQIADALAAAYVGGLRPDFAALQGQPHHRLELPTY
FT                   PFQRRRFWPKTSSITVDGPATSGILGSAKDLASGDTVYTSRLSVKSQPWLSDHVIYGTV
FT                   VVPGATYAAMALAAVGTPARVKDVFFYEPIILPEKSSREVQLTLHILGDGEQKFQVHSR
FT                   SYGVRDAEWSLNAEGTVVRGVDDAPVSQDDPVDEAIERCNRMRPQELFETFADMELAWG
FT                   PTWSGSLKSLWLGDGEAIGDVLVGAELAEQLGSEPIHPVLMDLCTGVAFPAFPALLAAE
FT                   QGVSDLFLPLRYGQVTVQEKMPRRFYCRAKWHHSELDSETQVFDLDFISRDGRPLGGIR
FT                   EFTVKRAPREALLRGLGGDATRLLYTLGWHEVPLPAVDPAAPNGNWLIAGFDELAASVP
FT                   GCIPFDRTTDPEPLGQLLTQAHERGMAFSGVVWRAAAPKPDESSADVAARIETEIANLL
FT                   SAVHAVQRGEVKLPGGLWIVTERAVACESGEPVDPVQAALWGFGRTTINEEPALRCKLV
FT                   DCDGSPEAVEALSALLTTPVDEPELALRQGKLLASRLLHWARSGHLTVPRSTDYVLAPT
FT                   ERGAIDNLRLTETEVPPPAEGYVQVEVEAAGLNFRDVLNVLGLYPGDPGPIGGDFAGVV
FT                   TQLGDGVGSGRAERRDGIKLEVGQRVYGFMQGAFSSRFNVPAQLLAPIPDGVGAVEAAT
FT                   IPAAALTARLAFDWAQLEPGDRVLIHAASGGVGLAAIQLAQQHGAVVFATASTYKRATL
FT                   RKMGVEYVYDSRSTDFADQILADTDGAGVDVVLNSLTNEGFVEATVRATAQNGRFAEIA
FT                   KRDIWTHEQMAAARPDISYEIVALDTVTIQEPERIRGLLGEVSDGLGKGEWAPLPAEIY
FT                   PLTEARAAFRRMQQARHIGKIVVQMPSPLQPRPDRSYLITGGLGAIGLHTASYLAQLGA
FT                   GDIVLTSRREPDADTQQVIDEITDRHRCRIHTFAADVGDESQVEELLERIRAELPPLAG
FT                   VAHLAGVLDDALLSQQSVERFRTTLAPKAFGAYHLDHLTRDDDLDFFIVSSSVSSLFGS
FT                   PGQANYATANALLDGLVARRRAHGLPATGVNFGPWAQGGMASSEAATANISAQGLVPLE
FT                   PSAALSALAEVVANGTAQATVIKANWQRAAKVLGASRPPLLDLVLPSAAGEVTGDSELL
FT                   RQLQEIPVAQRAGFVTEFLQREVQNFLRLAQPPAASSRFLDLGTDSLMAIELRNRLHSQ
FT                   FGGAFTINATAVFDYPTIGGLAEYLVGQLPDAESPAAETAPAAEVPAAD"
FT   gene            290603..292024
FT                   /locus_tag="Mkms_0255"
FT   CDS_pept        290603..292024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0255"
FT                   /product="PapA3_1"
FT                   /note="KEGG: mmc:Mmcs_0245 PapA3_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89472"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G4"
FT                   /protein_id="ABL89472.1"
FT                   /translation="MRIGKITIGGLDEWALKPGTVTSWHPTPAAAEKARRAPVSSVPIS
FT                   YMQRQHLRNYRERTGAGLNFSRQIIASCEVSGECEIAAMDHAVNNYLRRHDTFRSWFED
FT                   IGDGEFVRHALEDPADIEFVPVHHGSMTVDEIQAHVVGIPSPLEWACFTFGIIQNDGHF
FT                   TFFAAMDHVHGDATLIGTTMLEANGMYSALSGGGEALTLPEAGSFDEFCVRERERTADL
FT                   TVDSKDVQAWIDFADSNGGGFPEFPLPLGNPQEATRSSMTTEVLMDVAQTERFDAACAA
FT                   AGARFVGGLFACLAQVEHELTGALTYYGLTPRDSRNATDNFMTQGWFTGLIPITVPIGA
FT                   GSFADAAWAAQASFDSNLNMAKVPYYRVLELAPWLNWPQPNFPVSNFFHAGAAPLNAVL
FT                   AAADMGLADNIGIYPDGRFSYQLTIYIFRYGEGTVMAIMHPDNPVAEKSVTRYMQAMRT
FT                   VSALVADSGHWGRVA"
FT   gene            292051..295047
FT                   /locus_tag="Mkms_0256"
FT   CDS_pept        292051..295047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0256"
FT                   /product="Transport protein"
FT                   /note="TIGRFAM: Transport protein; PFAM: MMPL domain
FT                   protein; KEGG: mmc:Mmcs_0246 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89473"
FT                   /db_xref="GOA:A1U9G5"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004707"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G5"
FT                   /protein_id="ABL89473.1"
FT                   /translation="MRRLADLVVRWPWVVIGVWVAMAVALPLSFPSLGEMAQKHPLAIL
FT                   PSDAPSSVAAQKMAEAFQQSESDNLLVVAFINETGLEPADEVTYREVVDALRDDPADVV
FT                   SVQDFVSTPQLRQFLTSEDKTTWVLPVSLQGELGTPRAFDSFNRVSDVVEHKLPDGDTL
FT                   DVYLTGPAATVADLTVAGERDRLPIEIAIAVLVLGVLLLVYRSVVTMLLPLVTIGSSLM
FT                   IAQGVVAAYSHLTGSGVSNQSIVFLSAIMAGAGTDYAVFLISRYHDYLRSGSGFDEAVR
FT                   SAMISIGKVITASAVTVGLTFLVMNFAQMGVFKTIGVSAAIGIGVAYLAGMTLLPAILV
FT                   LAGPRGWVKPRRELTSRFWRRSGIRIVRRPVPHLIASVLVLLLLGGAAGFARFNYDDRE
FT                   VVADSAPSSIGYAALERHFPISQSIPQYILVQSPRDLRTPQALADLEQMASRIAQLPDV
FT                   SLVSGVTRPLGEVPPEFRATFQAGIVGDRLAAGSAQIDQRTGDLDELAAGATTLADTLG
FT                   DVRAQVNEVAPSLQTLLDAVTQVRVEYGGDRLVRDVDTAAKLVKSVNELGLSMGVNFAA
FT                   VRDMFGWIGPVLMALNGNAVCDANPSCVNTRMQFEKLMDAREDGRLERINTLAGELEGL
FT                   DDRQSLNSTVKTLNAAMTNIVKAVDDLGLDSPAEAQKGLRDVRQGADRLASGSRQVAGG
FT                   VDELVEQIKVMADGLDQASTFLLTMRKDAAGSSMAGFNIPAEVLRAVEFQKAAETFISP
FT                   DGHSARYLVQTSLNPFSPEAMDQVNTINDVARGAQPNTTLADASISMGGFPASLRDTRD
FT                   YYERDIRFIIIVTLIVVLLTLAVLLRSLIAPLYLVGSVVLSYFAAIGIGVLTFQVLLGQ
FT                   ELHWSVPPLAFVVLVAVGADYNMLFVSRLRDESPHSVRYGVIRTLGSTGGVITAAGLIF
FT                   AASMAGLLFASIGIVVQGGFVIGVGILLDTFVVRTITVPAIAALVGRANWWPSRVTASP
FT                   GAERIGAHP"
FT   sig_peptide     292051..292164
FT                   /locus_tag="Mkms_0256"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.392 at
FT                   residue 38"
FT   gene            295047..296819
FT                   /locus_tag="Mkms_0257"
FT   CDS_pept        295047..296819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0257"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0247 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89474"
FT                   /db_xref="GOA:A1U9G6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR040097"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G6"
FT                   /protein_id="ABL89474.1"
FT                   /translation="MTPTSESSMLSMLHGRASLRPDDIAFTFTHYDRDPAGAPETLTWA
FT                   QLARRTMSVAREIRQYGSFGDRAVILAPQGLEYVLAFLGAMQAGLVAVPLPLPHRGSGH
FT                   DRVSAVLTDTKPAVVFTTSSTAGDVGDFVDASPLDTVPKIVEIDALNLDAEGEIRLDPA
FT                   GLPATAYLQYSSGSTRLPTGAMISHRNLQANYEQVMRTFFAGDGPSSTTTFVSWLPFYH
FT                   DMGLVLGICVPILSGHPAALTSPVAFLERPARWIRALAENPHAFSAAPNFAFDLAARKT
FT                   SDSDLAGLDLGGVRGIINGAERVEPATLERFADRFAHFDFHDHMLRPSYGLAEATVFVA
FT                   SGTWSETSPAAHFDADELGVGRVVPCAPGKGTALVKYDVPQSPVVRIVDTDTHRQCPDD
FT                   VVGEIWVHGDNVAAGYWSRPPEDQRCFGATLVDPSPGTPGGTWLRTGDLGFIHEGELFI
FT                   VGRIKDLLIIRGRNHHPEDIEATVQEITRGRVAAVSVPVNSTESLVTVIELKEPPVLDE
FT                   DALRRFGELKSDVTAAISNAHGISVGDVVLVASGSIPTTTSGKIRRTASAELYRKDGFA
FT                   RLDGGKGQHGHLAG"
FT   gene            296869..298002
FT                   /locus_tag="Mkms_0258"
FT   CDS_pept        296869..298002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0258"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0248 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89475"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G7"
FT                   /protein_id="ABL89475.1"
FT                   /translation="MRRLLAFGSALTIIGAAGGFGFGSASADEPPVPPPPAPADGPPPL
FT                   GTPGRAYALGGAHVLGIPYDEYIMRTGSDWFPGLDRQIVDYPAGQVQGHTLERLFPGIG
FT                   RLDDSFPGLGIDGPSVGESVDVGTPNVINAVREGGRGTAIGLSEGAMVLNDVQAKLAYD
FT                   PAAPPPDELSFAMYGDPVARHAFGESFLTQNFPVGSVVPSLDYRIPAPVESQYDTYHFV
FT                   SAYDSIADWPDRPDNWISVANAIVGLATGHTAVAFTEPSMVPERNIRTTVNSRGAKTTT
FT                   FMIPEEHLPLVLPFKYLGVPKDTLMELDSVLKPYVDAGYSRNDDPLTAPITVDPVNGYD
FT                   PAEVTAPATQAAFGGAADPVSQLLSGLQYVLNNQPTG"
FT   sig_peptide     296869..296988
FT                   /locus_tag="Mkms_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.446 at
FT                   residue 40"
FT   gene            complement(298051..298719)
FT                   /locus_tag="Mkms_0259"
FT   CDS_pept        complement(298051..298719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89476"
FT                   /db_xref="GOA:A1U9G8"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G8"
FT                   /protein_id="ABL89476.1"
FT                   /translation="MWIPLLVMAVAVSLEPFRVGMTVLMINRPQPRRQLLALLAGGFAM
FT                   GLTVGVIVLFVLRPALDSAHFTLPVVQIAVGAVVLVNAALVATGVWGRGRDAVSLADTR
FT                   FGPLATRTRRLLDGRSLWTAGIAGLGIALPSVDYLAALALIVASGAATTVQLGALMVFN
FT                   VVAFALVEIPLLCYLVAPERTRAALSALYEWLRAQGRRGVGALLAVIGCVLLGVGFAGL
FT                   "
FT   gene            298821..299306
FT                   /locus_tag="Mkms_0260"
FT   CDS_pept        298821..299306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0260"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: mmc:Mmcs_0250 flavin reductase-like, FMN-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89477"
FT                   /db_xref="GOA:A1U9G9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9G9"
FT                   /protein_id="ABL89477.1"
FT                   /translation="MSAIDLNPATLREAFGHFPTGVIAIAAEVDGIRVGLAASTFVPVS
FT                   LDPPLVSFCVQNTSTTWPKLKDLPRLGISVLGESHDAAARTLAAKAGDRFAGLETTSTD
FT                   EGAVFIHGTSVWLDSSVHDLVEAGDHTIVILRVEDITVHPDVAPIVFHRSTFHRLGG"
FT   gene            complement(299318..299479)
FT                   /locus_tag="Mkms_0261"
FT   CDS_pept        complement(299318..299479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0251 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89478"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H0"
FT                   /protein_id="ABL89478.1"
FT                   /translation="MTLSHTHSLNDIRTAIRELSTRADLARKQGRPSDAAEIERRIQGY
FT                   REELAQRP"
FT   gene            complement(299541..300293)
FT                   /locus_tag="Mkms_0262"
FT   CDS_pept        complement(299541..300293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0262"
FT                   /product="succinate dehydrogenase subunit B"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: ferredoxin; KEGG:
FT                   mmc:Mmcs_0252 succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89479"
FT                   /db_xref="GOA:A1U9H1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H1"
FT                   /protein_id="ABL89479.1"
FT                   /translation="MSYQAKMRVWRGDDEGGALQDYTVEVNEGEVVLDIIHRLQQTQTG
FT                   DLAVRWNCKAGKCGSCSAEINGRPRLLCMTRMSTFGESETVTVTPLRAFPVIRDLVTDV
FT                   SFNYEKAREIPSFTPPKDLQPGEYRMAQEDVNRSQEFRKCIECFLCQNTCHVVRDHEEN
FT                   KKEFAGPRYLMRMAELDMHPLDVHARRAEDSQEVHGLGYCNITKCCTEVCPEHIKITDN
FT                   ALIPMKERVADRKYDPVVWLGNKLFRRK"
FT   gene            complement(300290..302236)
FT                   /locus_tag="Mkms_0263"
FT   CDS_pept        complement(300290..302236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0263"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0253 succinate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89480"
FT                   /db_xref="GOA:A1U9H2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H2"
FT                   /protein_id="ABL89480.1"
FT                   /translation="MAASDPRPGDSSGIERHQYDVVVIGAGGAGLRAVIEARERGLKVA
FT                   VVCKSLFGKAHTVMAEGGCAASMGNTNPKDNWQVHFGDTMRGGKFLNNWRMAELHAKEA
FT                   PDRVWELETYGALFDRTKDGRISQRNFGGHTYPRLAHVGDRTGLEIIRTMQQKIVSLQQ
FT                   EDKEELGDYEARIRVFAECTVTDLIKDGDRIAGAFGYWRESGSFILFDAPAVVLATGGI
FT                   GKSYKVTSNSWEYTGDGHALALRAGATLINMEFIQFHPTGMVWPPSVKGILVTEGVRGD
FT                   GGVLKNSDGKRFMFDYIPDVFKGQYAESEDEADQWLKDNDSARRTPDLLPRDEVARAIN
FT                   TEVKEGRGTPHGGVYLDIASRMSSEEIKRRLPSMYHQFMELAEVDITTDEMEVGPTCHY
FT                   VMGGIEVDPDTGAAKTPGLFAAGECAGGMHGSNRLGGNSLSDLLVFGRRAGLGASDYVR
FT                   ALGNRPTVSEEAVEAALKLALAPFDGPSEGQPENPYTMQLDLQDTMNELVGIIRKADEI
FT                   IEAQGKLDELRDRFKRMKVEGNRHFNPGWHLAIDLRNMLLVSECVAKAALERTESRGGH
FT                   TRDDYPSMEAEWRRTLLVCRAQGDDVVVPSVTVTREDQVPMRDDLLELLDIEELQKYYT
FT                   DEELANHPARRGS"
FT   gene            complement(302278..303096)
FT                   /locus_tag="Mkms_0264"
FT   CDS_pept        complement(302278..303096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0264"
FT                   /product="putative succinate dehydrogenase (membrane anchor
FT                   subunit) (succinic dehydrogenase)"
FT                   /note="KEGG: mmc:Mmcs_0254 putative succinate dehydrogenase
FT                   (membrane anchor subunit) (succinic dehydrogenase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89481"
FT                   /db_xref="GOA:A1U9H3"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H3"
FT                   /protein_id="ABL89481.1"
FT                   /translation="MSAPTADREGTGVYSAGRAKIPQRTLRTDRWWVPSLLTNLGLAAF
FT                   VVYATIRAFWGSAYWVADYHYLTPFYSPCVSKGCIPEASHFGQILPDVWWLPYAAFSLP
FT                   FLLLFRLTCYYYRKAYYRSVWQSPPGCAVAEPHSTYTGETKLPLIMQNLHRYFFYVAVL
FT                   ISLINTWDAILAFHSPSGFGFGLGNVILVVNVVLLWTYTISCHSCRHVTGGRLKHFSKH
FT                   PVRYWMWTQISKLNTRHMQFAWITLGTLVLTDFYVMLVASGTISDLRFIG"
FT   gene            complement(303194..303550)
FT                   /locus_tag="Mkms_0265"
FT   CDS_pept        complement(303194..303550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89482"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H4"
FT                   /protein_id="ABL89482.1"
FT                   /translation="MWLASVAYCDSRHPSAQGGHLSTTTGFAELHELIGGLRRCVTALA
FT                   SQYGDSPAMRRIVNDAERILNDIDRLDIDAEELELGRGLSRHHHVGEKIPIPDTQYDTE
FT                   FWRGVDDEGLGGTH"
FT   gene            303601..304359
FT                   /locus_tag="Mkms_0266"
FT   CDS_pept        303601..304359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89483"
FT                   /db_xref="GOA:A1U9H5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H5"
FT                   /protein_id="ABL89483.1"
FT                   /translation="MPNHDLKQLADALLALHQPGNPVVLPTVWDAWSANLAVGAGFAAL
FT                   TVGSHPVADSVGRADNEGMTFDELLTRVAQITDAVDVPVSVDIESGYGEAPTRLIEGLL
FT                   GVGAVGLNIEDTVHGEGGRLRSAGEHAELVGALRAAADDAGVHVVVNARTDLFLRKDGD
FT                   DADRVDRAVARLKEAAEAGADVLYPVGRHDPDTQRRLTSELPLPVNAIGIPDQDDPASF
FT                   GPLGVARISFGPFLQAALATRANELLARWK"
FT   gene            complement(304456..304902)
FT                   /locus_tag="Mkms_0267"
FT   CDS_pept        complement(304456..304902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0267"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: mmc:Mmcs_0257
FT                   heat shock protein HSP20"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89484"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H6"
FT                   /protein_id="ABL89484.1"
FT                   /translation="MSNVALRVRPAWDLDRWVRDFFGPAAANDGFGGTAAPGFSPAAEI
FT                   ARDGDDATVRVELPGVDVDKDVTVEVDNGQLVIHGERRDERSEEKDGRTLREMRYGSFR
FT                   RSFRLPQHVTGDAISASYDAGVLTVRVAGAYAGAQPQRIAIENK"
FT   gene            305060..307702
FT                   /locus_tag="Mkms_0268"
FT   CDS_pept        305060..307702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0268"
FT                   /product="assimilatory nitrite reductase (NAD(P)H) large
FT                   subunit precursor"
FT                   /EC_number="1.7.1.4"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], large subunit;
FT                   PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; nitrite/sulfite reductase, hemoprotein
FT                   beta-component, ferrodoxin domain protein; nitrite and
FT                   sulphite reductase 4Fe-4S region; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: mmc:Mmcs_0258
FT                   nitrite reductase (NAD(P)H) large subunit, NirB"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89485"
FT                   /db_xref="GOA:A1U9H7"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H7"
FT                   /protein_id="ABL89485.1"
FT                   /translation="MGPSHEATSRQYTIPSLAPMSTSISNGPARNVVVVGHGMVGHRFV
FT                   EALRARDDADAWRITVLAEETDAAYDRVGLTGYTEHWDRALLALAGNDYAGDDLVDLRL
FT                   GQRVTSIDRAARTVKTADGTAFAYDALVLATGSYAFVPPVPGRDLPACHVYRTFDDLDA
FT                   IRADAARARETSRAPVGVVIGGGLLGLEAANALRGFGLTAHVVERSPRLMSQQLDDAGG
FT                   ALLSRMIADLGIEVHLDVSTDAITPAQRNRPLRRSEEDDSLRVMLGDGSFIDAGVVVFA
FT                   AGVRPRDELARDAGLVIAERGGVLTDLGCKTSDPSIYAVGEVAAIEGRCYGLVGPGYTS
FT                   AEVVADRLLGGAAEFPEADMSTKLKLLGVDVASFGDAMGRTPDCLEVVVNDAVNQTYAK
FT                   LVLSDDAKTLLGGVLVGDASAYGVLRPMVGEQLPGDPMALIAPAGSGGADGGLGVGALP
FT                   AAAQICSCNNVTKGDVTDAIAGGCCDVPGLKACTKAGTSCGSCVPLLKQLLEAEGVEQS
FT                   KALCEHFSHSRAELFEIVSATEIRTFSGLLERFGTGKGCDICKPTVASILASTSSEHIL
FT                   DGEQAALQDSNDHFLANIQRNGSYSVVPRVPGGDITPEQLILIGEIARDFDLYTKITGG
FT                   QRIDLFGARVEQLPEIWRRLVEGGMESGHAYGKALRTVKSCVGSDWCRYGQQDSVQMAI
FT                   NLELRYRGLRAPHKIKMGVSGCARECAEARGKDVGVIATEHGWNLYVGGNGGMTPKHAQ
FT                   LLAGDLDDETLIRYVDRFLMFYIRTADRLQRTAPWVEQLGLDHLREVVCDDSLGLASEF
FT                   EAAMARHVEGYACEWKGVLEDPDKLSRFVSFVNAPDVPDPTVTFTENAGRKVPVPIGMP
FT                   SIRPLQETP"
FT   gene            307699..308070
FT                   /locus_tag="Mkms_0269"
FT   CDS_pept        307699..308070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0269"
FT                   /product="nitrite reductase (NAD(P)H), small subunit"
FT                   /note="TIGRFAM: nitrite reductase [NAD(P)H], small subunit;
FT                   KEGG: mmc:Mmcs_0259 nitrite reductase (NAD(P)H) large
FT                   subunit, NirD"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89486"
FT                   /db_xref="GOA:A1U9H8"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H8"
FT                   /protein_id="ABL89486.1"
FT                   /translation="MTLLDDRNELNGPPDTRWTVACRYDYLIPCRGVGVLLPDGAQAAL
FT                   FRLDDGSLHAIGNIDPFSGAAVMSRGITGDRGGRAIVQSPIKKQAFAFDDGSCLDDPSV
FT                   SLPVYRTRRTADGIVEIEA"
FT   gene            complement(308074..308643)
FT                   /locus_tag="Mkms_0270"
FT   CDS_pept        complement(308074..308643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89487"
FT                   /db_xref="GOA:A1U9H9"
FT                   /db_xref="InterPro:IPR019251"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9H9"
FT                   /protein_id="ABL89487.1"
FT                   /translation="MNIHRILAGVEEVKSLDAPAHASARIASQVVDGARLGHVLRGSWL
FT                   GHPVHPLLVTLPIGTWMTSVVFDVVFKDVATARRLVGVGLVATPPTVLAGWADYVLLNK
FT                   RQQRVGLVHAVSNAVGVTLFGLAYRAYRKEKVRTARVYSLLGLGAISVGGALGGHLSYA
FT                   QGAGVFRWQPVRALTHRSPVEYRRAA"
FT   gene            308716..309411
FT                   /locus_tag="Mkms_0271"
FT   CDS_pept        308716..309411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0271"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: mmc:Mmcs_0261
FT                   response regulator receiver and ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89488"
FT                   /db_xref="GOA:A1U9I0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I0"
FT                   /protein_id="ABL89488.1"
FT                   /translation="MTAGVERLDEVLEHCLRHSTRRAQADLTGVLAGLTALAVSHLPGV
FT                   DHASVTLMADDDDIRCLAATDGHPLVLDNVQRGCGQGPCLDAATEHLRADDLTDESRWP
FT                   AFTAKSVDATPVRAILALPVFRDGRSSATLNLYADRPRGLDARTESSGAIVASHVAEAM
FT                   TAAYRTRSHGRSPRSTVINQAKTLLMRDFDVDVAQAYALLVKLAKQQNDSIEAVARQVV
FT                   AADGPSGRN"
FT   gene            complement(309415..310110)
FT                   /locus_tag="Mkms_0272"
FT   CDS_pept        complement(309415..310110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0272"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiX
FT                   protein; KEGG: mmc:Mmcs_0262 cobalamin (vitamin B12)
FT                   biosynthesis CbiX protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89489"
FT                   /db_xref="GOA:A1U9I1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I1"
FT                   /protein_id="ABL89489.1"
FT                   /translation="MSAPANRILVAHGTRKSSGVALIGDIADRVAATLGSPVGVAFVDV
FT                   LGPTPSDVLSALPDRPAVLVPAFLSRGYHVRSDIPAHVAASGHPDVTVADALGPDAQLV
FT                   RVVGDRLIESGWAPGDSVILAAAGTSDPLALRDLHTTAASLSAVTGARVDLAFAATGRP
FT                   RVDEAVAAARRSGARRVVVASYLLADGLFQDRLRASGADIVTAPLGTHPGLVRLIASRF
FT                   RRARIPIAA"
FT   gene            complement(310107..311255)
FT                   /locus_tag="Mkms_0273"
FT   CDS_pept        complement(310107..311255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0273"
FT                   /product="Uroporphyrinogen III synthase HEM4"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   Uroporphyrinogen III synthase HEM4; KEGG: mmc:Mmcs_0263
FT                   uroporphyrinogen III synthase HEM4"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89490"
FT                   /db_xref="GOA:A1U9I2"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I2"
FT                   /protein_id="ABL89490.1"
FT                   /translation="MSEPDWAPLTGFRVAVTSARRAEELSALLRRRGATVTSAAAIAMV
FT                   PLPDDDELRAHTQALIDAPPDIVIATTGIGLRGWIAAADGWGVAAELTAALAGARIVSR
FT                   GPKATGALRAAGLPEEWSPDSESSREVLRYLLDGGIADKRIAVQLHGATDDWDPFPEFL
FT                   DELRAAGADVVPIRVYRWRPAPRDGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRATE
FT                   MGVADRVLTALRTNVHAMCVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLQA
FT                   RTVRVAGHLLEIRGTCVLVDGVVKSLSPAGMATIRALAHRPGAVVSRTDLLGALPGSGT
FT                   DTHAVETAVLRLRTALGDKQIVSTVVKRGYRLTVDDDLAEAL"
FT   gene            complement(311388..312782)
FT                   /locus_tag="Mkms_0274"
FT   CDS_pept        complement(311388..312782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0274"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0264 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89491"
FT                   /db_xref="GOA:A1U9I3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I3"
FT                   /protein_id="ABL89491.1"
FT                   /translation="MSHRITDWDPEDTIAWEAGNKYIARRNLIWSVAAEHIGFSVWSIW
FT                   SVMVLFMPEAVYGFSAGDKFLLGATATLVGACLRIPYTLATARFGGRNWTVFSAFVLLI
FT                   PTLGTMVLLANPGLPLWPYLLCAALAGFGGGNFASSMTNINAFYPQRLKGWALGLNAGG
FT                   GNIGVPMIQLVGLLVIATAGNRQPYWVCAVYLVALAVAGIGAALYMDNLEQHKIDFTAM
FT                   KDILRERDTWVISLLYIGTFGSFIGFAFAFGQVLQINFAARGQSPAEASLHAAQIAFVG
FT                   PLLGSLSRVYGGRLADRIGGGRVTLAVFAGMILAAGVLVTVSTLDDGSPGAATAATMIG
FT                   YVVGFIALFLLSGIGNGSVYKMIPSIFEARSRSLDAGEEQRVAWSRAMSGALIGFAGAI
FT                   GALGGVGINLALRQSYLSSGSATTAFWIFAVFYVVASAVTWVMYVRRPSGDASVDRASR
FT                   PDLART"
FT   gene            complement(312878..313501)
FT                   /locus_tag="Mkms_0275"
FT   CDS_pept        complement(312878..313501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0275"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0265 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89492"
FT                   /db_xref="GOA:A1U9I4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I4"
FT                   /protein_id="ABL89492.1"
FT                   /translation="MAGTPRWYNDGVLPQLSSEVRGHGVIHTARLVHTADLDNETREGA
FT                   RRMVSEAFRGDFTDDDWEHALGGMHALICSHGVLIAHAAVVQRRLLYRDAALRCGYIEA
FT                   VAVREDCRGQGLGSAVMDACEQVLRGAYQLGALATSTMARPMYRARGWVPWRGPTSVLS
FT                   PGGRISTPGDDGSVFVYPVGSALGSTDLDTTAELTCDWRHGDVW"
FT   gene            complement(313516..314457)
FT                   /locus_tag="Mkms_0276"
FT   CDS_pept        complement(313516..314457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0276"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0266
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89493"
FT                   /db_xref="GOA:A1U9I5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I5"
FT                   /protein_id="ABL89493.1"
FT                   /translation="MQNSQVNRLFRRGGSTATPPPAAAPAWFAAAVGQRPRHHTIEVEG
FT                   CPIRVRAWGDPGNPPLVFVHGGGAHSGWWDHIAPFFTRTHTVVAPDLSGHGDSGTRQSY
FT                   AVAAWAREVLASASVSGSSARPTIVGHSMGGWVTAAAATRYGAQIDSVLIIDSPLRDRA
FT                   PEENRLRNRRRDSPGYRTEAEILARFKAVPAQEVTLPYIADPIARQSVRHTDNGWVWKF
FT                   DPEIFGGDLLEQTAAEHEIVEETFTRLPCRVGYLRCENGIVPPAMAEQIRSILQLRGPF
FT                   VELAEAGHHPMLDQPLPLVATIRTLLEFWSIT"
FT   gene            complement(314465..315343)
FT                   /locus_tag="Mkms_0277"
FT   CDS_pept        complement(314465..315343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0277"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: mmc:Mmcs_0267
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89494"
FT                   /db_xref="GOA:A1U9I6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I6"
FT                   /protein_id="ABL89494.1"
FT                   /translation="MTTLEILNTGPLALVEDLGRPGLAHMGVTRSGAADRRAHALANRL
FT                   VANPGDRATVEVMFGGLTARVRGGDVTVAVTGADTDPAVNGKPFGTNSIHYAHDGDVIS
FT                   LGMAQAGLRSYLAVRGGIDVAPVLGSRSYDVMSAIGPQPLKPGDVLPVGEHTEDFPELD
FT                   QAPVAAIDDDVLELMVVPGPHDDWFVDPEFLVRTNWQVTNRSDRVGMRLVGMPLDYRWP
FT                   DRQLPSEGATRGAIQVPPNGLPVILGPDHPVTGGYPVIAVVVDEDIDKASQARPGQTVR
FT                   LHWSRPRKPFA"
FT   gene            complement(315382..316047)
FT                   /locus_tag="Mkms_0278"
FT   CDS_pept        complement(315382..316047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0278"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   mmc:Mmcs_0268 allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89495"
FT                   /db_xref="GOA:A1U9I7"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I7"
FT                   /protein_id="ABL89495.1"
FT                   /translation="MTAVPDVMEPMVLGTVLDYGDRALLLQFDDTAQVLAWTDAVRAAG
FT                   LPGVVDIVPGSRTVLVKLDGPRYQAPTRQRLAALRIDRGAVAESASPPDRADAVIDVVY
FT                   DGADLADVARLTGMDTDQVVAAHTGTLWRVGFGGFAPGFAYLVGGDERLHVPRRAEPRT
FT                   KVPAGSVGLAGEFSGVYPRESPGGWQLIGHTDAVLWDVDRENPALLTPGMWVEFRVAE"
FT   gene            complement(316122..316802)
FT                   /locus_tag="Mkms_0279"
FT   CDS_pept        complement(316122..316802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0279"
FT                   /product="conserved hypothetical integral membrane protein"
FT                   /note="TIGRFAM: conserved hypothetical integral membrane
FT                   protein; PFAM: protein of unknown function DUF165; KEGG:
FT                   mmc:Mmcs_0269 protein of unknown function DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89496"
FT                   /db_xref="GOA:A1U9I8"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I8"
FT                   /protein_id="ABL89496.1"
FT                   /translation="MTVAPTDHRGSATIGSAYYPTLVAVFTGLVLISNVAATKGVAFGP
FT                   LLTDGGFLVFPLTYVIGDVLSEVYGFRAARRAVFIGFAMQALAVLVLWTTVRLPGAPDY
FT                   ANQDALATTVAAITGLAVAGLSGFLVGQLVNAWVVVQVKQRTKEQYLWARLLGSTVVGQ
FT                   FADTLVFCAIAAPIIGFGNMGSFAVYAALGWVYKTVIEAAMLPVTYRVIATIKRREPTY
FT                   EPAV"
FT   gene            complement(316815..317780)
FT                   /locus_tag="Mkms_0280"
FT   CDS_pept        complement(316815..317780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0280"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   mmc:Mmcs_0270 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89497"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9I9"
FT                   /protein_id="ABL89497.1"
FT                   /translation="MSTAWSRRNFLAMTATLAGSTVLAGCGGDAPGTVAKDGSVTVTHA
FT                   FGETRIPGPPTRVVSAGLTEQDDLLAVEVVPIAVTDWFGGEPFGVWPWARGQLGPAQPT
FT                   VLSLGDGIQIEAIRALNPDLIVATNAGLDADTYTTLSEIAPTVAQSGSAAFFEPWKDQA
FT                   TIIGQAVFKADEMAALIARVDEKFTNAASANPQFGGKKALLLRGPLYRDSVQAVRPGWR
FT                   TDFLTQMGFTVADPGDPLIPRDRMASVLDAADVLIWTTESEQEQGALLADPTIAGLKAV
FT                   AGGRTIFTDKELAGAIAFASPLSYPLVADRLPPLLAQILA"
FT   sig_peptide     complement(317673..317780)
FT                   /locus_tag="Mkms_0280"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.780 at
FT                   residue 36"
FT   gene            complement(317826..318623)
FT                   /locus_tag="Mkms_0281"
FT   CDS_pept        complement(317826..318623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0281"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0271 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89498"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J0"
FT                   /protein_id="ABL89498.1"
FT                   /translation="MRTPKSVFITGAAAGIGRKTAIAFARKGYTVGAFDIDEVGLKTLT
FT                   EELDRVQTPVVTGHLDVTDSDEMSQRIEEFTQVTGGRLDVLINNAGILRAGRFEELDLA
FT                   GHFKEIDINAKGVVNGLYAAFPHLRNTPGSVVVNLASASAIYGQAELANYSATKFFVRG
FT                   ITEALDLEWNRYGIRVIAMWPLYVQTAMTDNIKTGTTDSLGIRLTAQDIADAIVAAVEP
FT                   TALRRALHQVHFPVGAQSKVLATGARFSPAWLTRLVNKKLAHS"
FT   gene            complement(318935..319534)
FT                   /locus_tag="Mkms_0282"
FT   CDS_pept        complement(318935..319534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0282"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   mmc:Mmcs_0272 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89499"
FT                   /db_xref="GOA:A1U9J1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004777"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J1"
FT                   /protein_id="ABL89499.1"
FT                   /translation="MTYPVVLGFLSALTLIAAIGAQNAFVLRQGIRGEHVAAVVALCTV
FT                   SDVLLIGAGIAGFGALVTAHPAALDIARFGGAAFLIGYGLLAARRAARPAALTPSEQGP
FT                   ARLVGVLVTCAALTWLNPHVYLDTVVLLGALANEHREDRWLFGVGAVTASAVWFTALGF
FT                   GARRLGGLFSAPSTWRVLDALIAMIMIALGVAVALG"
FT   sig_peptide     complement(319469..319534)
FT                   /locus_tag="Mkms_0282"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.595 at
FT                   residue 22"
FT   gene            319799..320569
FT                   /locus_tag="Mkms_0283"
FT   CDS_pept        319799..320569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0283"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0273 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89500"
FT                   /db_xref="GOA:A1U9J2"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J2"
FT                   /protein_id="ABL89500.1"
FT                   /translation="MNRADLDRPLGAVGGLFGMALDAVRFTFRRPFQAREFLEQSWFVA
FT                   RVSLAPTLLVAIPFTVLVSFTLNILLRELGAADLSGAGAAFGAVTQVGPLVTVLIVAGA
FT                   GATAMCADLGSRTIREEIEAMEVLGINPVARLVTPRMLASGLVALLLNSLVVIIGIVGG
FT                   YAFSVFVQDVNPGAFAAGITLLTGIGEVIISCVKAALFGLIAGLVACYRGLSINRGGAK
FT                   AVGNAVNETVVYAFMALFVINVVVTAIGIRMTAG"
FT   gene            320573..321430
FT                   /locus_tag="Mkms_0284"
FT   CDS_pept        320573..321430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0284"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   mmc:Mmcs_0274 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89501"
FT                   /db_xref="GOA:A1U9J3"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J3"
FT                   /protein_id="ABL89501.1"
FT                   /translation="MGTLTTLGTAYPRVVSQFRKPASLVGRLGDHILFYGRALAGTPHA
FT                   AMHYRKEIVRLIAEISMGAGTLAMIGGTVVIVGFLTLAAGGTLAVQGYSSLGDIGIEAL
FT                   TGFLAAFINVRISAPVVAGIGLAATFGAGVTAQLGAMRINEEVDALETMGIRPIEYLVS
FT                   TRIIAGMIAITPLYSVAVILSFLASQLTTVVLFGQSGGLYDHYFNTFLNPVDLLWSFLQ
FT                   AILMALTVLFIHTYFGYFATGGPAGVGVAVGNAVRTSLIVVVAVTLLVSLSVYGSNGNF
FT                   NLSG"
FT   gene            321444..322631
FT                   /locus_tag="Mkms_0285"
FT   CDS_pept        321444..322631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0285"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0275 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89502"
FT                   /db_xref="GOA:A1U9J4"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J4"
FT                   /protein_id="ABL89502.1"
FT                   /translation="MKSISARNVAGTLAVVYIAAIVALAVGLFNGSFTRSATVTVVSDR
FT                   VGLVMNPDAKVKLHGAQVGKVAAIEALPDGRAAIRLAMDPSQLAIIPSNVLVNVGSTTV
FT                   FGSKAVELVPPANPSPDPLRAGQVLDAGHVTVEINTVFEQLVSVLAKVEPAKLNETLGA
FT                   LSQGLAGRGEKFGRTLVDLDTLLADLDPSMDNLSRDIAVAPGVLNAYADAAPDLLATAD
FT                   NASRISDTLVERQSDLDALLVSAIGLAEVGNDVVATNRGAFTDVMRLLVPTTDLTNQYH
FT                   TALNCGLAGMLPLAMAPPPPVPGVLLLDSFVLGTERYRYPQNLPKVAARGGPQCVGLPD
FT                   VGYETRAPYVVSDIDANPAQYGNQGILLNSEGLKQMLFGPLDGPPRNTSQIGQPG"
FT   sig_peptide     321444..321554
FT                   /locus_tag="Mkms_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.835 at
FT                   residue 37"
FT   gene            322628..323653
FT                   /locus_tag="Mkms_0286"
FT   CDS_pept        322628..323653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0286"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0276 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89503"
FT                   /db_xref="GOA:A1U9J5"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J5"
FT                   /protein_id="ABL89503.1"
FT                   /translation="MRRLGPTVVKFGVFAVVMVLFTAALVAIFGQYRAGSANEYSAVFG
FT                   DASSVKSGDSVRIAGIRVGTVNGVSLQPDNTVVVDFDARTDVVLTTGTRVAVRYLNLVG
FT                   DRYLELVDGPGATQIQPAGSRIPKDRTEPALDLDLLLGGLKPVIRGLNPEDVNALTHSL
FT                   IQILQGQSGDIESLFARTSSFTNSIAANGETVRQMIDHLNTVVETMSRDGDKFSGAVAR
FT                   LEELVTGLAQDRDPIGAAIESLDKGTASLADLMTEARPPLAGSIDQLNRVAPLLEKDKE
FT                   LLDISLQKAPGNYRKLVRLGAYGSWLNQYLCGLSVRVTDLQGRTAYFPWIKQDTGRCAE
FT                   P"
FT   sig_peptide     322628..322738
FT                   /locus_tag="Mkms_0286"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.378 at
FT                   residue 37"
FT   gene            323653..324735
FT                   /locus_tag="Mkms_0287"
FT   CDS_pept        323653..324735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0287"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0277 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89504"
FT                   /db_xref="GOA:A1U9J6"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J6"
FT                   /protein_id="ABL89504.1"
FT                   /translation="MLKYGGSSSVRAGFIGLVLIVLVIVVGLQPQQLWSMATSVKYRAV
FT                   FAEAGGLAAGNDVKVSGVTVGTVSDVVLDKGKALVTFSLDGKVRLGSDSTAHIRTGTLL
FT                   GERMLTVEPKGSRRLGPMEAIPVSRTSSPYSLTEAVSDFTANTADTDTATLNQSLDILS
FT                   ETIDRLAPQLGPTFDGLTELSRSLNDRDETLGDLLAGAADVTAILSERSQQVNTLLLSA
FT                   NDLLAVLEQRRYAIVNLLANTSAMSQQLTGLVRDNEQELAPALEKLNSVSEMLERNRDN
FT                   IGKALNGLAKYQVTQGEAVNNGFYYNAFIGNLIPGGALQPFLDYALGYRRGVNAGQPPD
FT                   NAGPRAEFPLPYNGIPGGSR"
FT   sig_peptide     323653..323760
FT                   /locus_tag="Mkms_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.733 at
FT                   residue 36"
FT   gene            324732..326168
FT                   /locus_tag="Mkms_0288"
FT   CDS_pept        324732..326168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0288"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0278 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89505"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J7"
FT                   /protein_id="ABL89505.1"
FT                   /translation="MIGRTKSAKVLTVALVALLAAGAAVIVRQEFFAPRTITAYFTSAT
FT                   SIYPGDEVRVVGVRVGTIESIEPVGEQARFTLAVDRGVSIPADAKAIIVAPNLIAARYV
FT                   QLTPAYESSGPVLPDDAVIGVERTAIPVEWDEVKEQLARLASELGPSGGVSDTSVSRFI
FT                   DSAANAMAGNGDKLRETISQLSGVGRILADGSGNIVDVIKNLQVFVTALRDSNVQIVQF
FT                   QDRLATVSSVVDGSRAEMDSALTNLAEAVGEVQRFIAGSRNQTAEQIQRLANVTQNVAD
FT                   NRVALENVLHVAPNAIGNGYNIYHPDTGTMLGGFAMGNFANPVQLICSAIGAVRNATAP
FT                   EASRICAEYLGPALRLLNFNYLPMPINAYLKKSPSPENLVYSDPALAPGGAGGSPTPPE
FT                   TPPAVSAFTGGGDVPPPAGWGTPPGPPGTYAPHGLPANPTPALLPGAPIPAGPSAPATL
FT                   DDMLLPAEAPPSPPQEGPPA"
FT   sig_peptide     324732..324851
FT                   /locus_tag="Mkms_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.564 at
FT                   residue 40"
FT   gene            326165..327364
FT                   /locus_tag="Mkms_0289"
FT   CDS_pept        326165..327364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0289"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0279 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89506"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="InterPro:IPR024516"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J8"
FT                   /protein_id="ABL89506.1"
FT                   /translation="MIGRRSTLRVAAVAACVTVIASGCTFDGLNSIPLPGTVGTGSGAT
FT                   TYRVQLANVGTLESNSPVMVSDVVVGTVGKMTLRGWHADVEVTVRPETVIPANAVATVG
FT                   QTSLLGSMHLALDPPVGKLPSGRLQPGTTLGLDRSSTYPSTEQTLSSLSVVVNGGGLGQ
FT                   AGDIIREFNATLNGREDKLRDLLVRLRDFVGMLDTQRDDINASLAALNRLGGTLAGQRE
FT                   VITSALQRIPPALDVLIAERPRLTTALDKLRIFSDSATGLVEDTQADLVRNLKNLEPTL
FT                   KALADVGPNLGTALAYAPTFPYTQGFIDRAIRGDYMNQFIIFDFTIPRLKRGLFLGTRW
FT                   GEEGTPMVPAPGDPWYLNYTLDPLNAPVAPPTAVAPVPELTETSDGVDTVDPSPSAGGN
FT                   "
FT   sig_peptide     326165..326296
FT                   /locus_tag="Mkms_0289"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 44"
FT   gene            327364..328902
FT                   /locus_tag="Mkms_0290"
FT   CDS_pept        327364..328902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0290"
FT                   /product="virulence factor Mce family protein"
FT                   /note="TIGRFAM: virulence factor Mce family protein; PFAM:
FT                   Mammalian cell entry related domain protein; KEGG:
FT                   mmc:Mmcs_0280 mammalian cell entry"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89507"
FT                   /db_xref="GOA:A1U9J9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR005693"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9J9"
FT                   /protein_id="ABL89507.1"
FT                   /translation="MLTRFVRTQLIIFTVTAVVAMGVMIFGYLQAPTLLGIGRMTVTVE
FT                   LPGTGGLYRFSNVTYRGVEVGKVTDVRATRQGAVATLSLGTNQDIPADLHAAVRSVSAV
FT                   GEQYVDLQPRTGSAPYLHDGSVIGVENTSIPQAVGPMLDEVSAMIDSIPKDKISGLLDE
FT                   SAKALNGSAYDLGSMLDSSATVVGDAKGVSGEMRSLIDDSGPLLEGQAQTADQLRTWAR
FT                   SLAGVTGQVAANDPQVRTLLGTGPGAADEASRLLNAVKPTLPVLLANLTTIGQVAVTYH
FT                   ASIEQLLVLLPPYVAATQTVGVSRNNPTGMSLGDFTLNLNDPPACTVGFLPPSSWRSPD
FT                   DESDIDTPDGLYCKLPQDSPIGVRGARNYPCMGQPGKRAATAEQCASDKPFEPLAMRQH
FT                   VLGPYPFDPSLVAQGIPPDDRVDSDEQLYGPVGGTPMPPPSPEPAPAPGGPAVAPSAFT
FT                   PGESGGPSVAIATYDPQTGKYATPDGKVFTQPALGSKDAGGQNKTWQDLLPTGA"
FT   sig_peptide     327364..327474
FT                   /locus_tag="Mkms_0290"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.446 at
FT                   residue 37"
FT   gene            complement(328907..329401)
FT                   /locus_tag="Mkms_0291"
FT   CDS_pept        complement(328907..329401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89508"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K0"
FT                   /protein_id="ABL89508.1"
FT                   /translation="MVTTVGALAAVASLAHPATASADPEWGLNGTYSATSNGEWAKKNE
FT                   VFRDEATVRAVWTIDTVCSYPTECTGTVRSDQGWEAPIYKKGGIWYVKHTVPRWEPCPD
FT                   GTAADGLQVFRFVPTVPDGSMTDPASTTLTGEDQTTGPSGACGVSRPLFITMPFKLVKL
FT                   S"
FT   sig_peptide     complement(329333..329401)
FT                   /locus_tag="Mkms_0291"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.917 at
FT                   residue 23"
FT   gene            329541..329921
FT                   /locus_tag="Mkms_0292"
FT   CDS_pept        329541..329921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89509"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K1"
FT                   /protein_id="ABL89509.1"
FT                   /translation="MRTPVFVVSAVVTAAVFASAPAGADPLGCEEPACVPGIAGNVTLG
FT                   APCANTSHFVFGTTDWGRLVFCGSPRRYAPRYFRSPPMEGIRVENTNCTGFENSVAQAP
FT                   DGLFLSCVASSGESLWVRGDNA"
FT   sig_peptide     329541..329615
FT                   /locus_tag="Mkms_0292"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            329918..330322
FT                   /locus_tag="Mkms_0293"
FT   CDS_pept        329918..330322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89510"
FT                   /db_xref="InterPro:IPR016793"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K2"
FT                   /protein_id="ABL89510.1"
FT                   /translation="MNRFAAPAAIAGLILGMAPQASAQGPVPHHVRYTVTADQPTKADI
FT                   YYRAVDPPNWADYSHNPYRFSPKAEVVLDPASPWVFDTTLVDPNRWAMVTATSGVGPDQ
FT                   PHFRCELAVDGVVVASHEGPKGALCSQRSW"
FT   sig_peptide     329918..329989
FT                   /locus_tag="Mkms_0293"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.938 at
FT                   residue 24"
FT   gene            330326..330955
FT                   /locus_tag="Mkms_0294"
FT   CDS_pept        330326..330955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89511"
FT                   /db_xref="GOA:A1U9K3"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K3"
FT                   /protein_id="ABL89511.1"
FT                   /translation="MIDSIETRALAEEAEAEAAEALAEAARARAERLRAEAAEPQDKRR
FT                   RLRRPGWSTVVAVLAVFVTAASLAASGYVTWHHREAMHRQQQSAEFEAAARQIAITLMS
FT                   IDAAKAEESVKQILDSSTGQFHEEFKSASEDFVKLTQDGKVVTDVKVKAAAVESMTEDS
FT                   ATVLVTTTSTVTNAAGADKQPRAWRLSVDIVRDVGRLKMSKMEFVP"
FT   gene            330970..331458
FT                   /locus_tag="Mkms_0295"
FT   CDS_pept        330970..331458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89512"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K4"
FT                   /protein_id="ABL89512.1"
FT                   /translation="MRQARWRLILTVLIAAASVGLAVVLYVTQYRTDVQTDGAAASAAV
FT                   RAASEGTVALLSYQPDSVDTDLTAAKTHLTGEFLTYYGKFSDEILLPAARERAVRSEAA
FT                   VVRAAEAEIHPDAAKVLVYVNQTTTSRERPDASQTASSVMVSLTKVGERWLISAFDPI"
FT   sig_peptide     330970..331095
FT                   /locus_tag="Mkms_0295"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.357 at
FT                   residue 42"
FT   gene            complement(331455..332036)
FT                   /locus_tag="Mkms_0296"
FT   CDS_pept        complement(331455..332036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0296"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0286 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89513"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K5"
FT                   /protein_id="ABL89513.1"
FT                   /translation="MNDGHEPLTESVRSLIDAVIRTEVDPEKIAAAHAHVAAALDILGE
FT                   QMMPGAYGVRAAPDGRRAPRGNVLIGERNAIAPPLIVDRDEAGLVSTEVDLGAAYEGPV
FT                   GHVHGGVCSLILDHLLGATAHRPDRPAFTGTLQLRYVRPTPLGPLRAEAWVEHEDGRKT
FT                   YARGRILSAGQTTVEAQGVFIRPRADRSAD"
FT   gene            complement(332033..333577)
FT                   /locus_tag="Mkms_0297"
FT   CDS_pept        complement(332033..333577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0297"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: mmc:Mmcs_0287 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89514"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K6"
FT                   /protein_id="ABL89514.1"
FT                   /translation="MSAFDEEVDVVVVGSGGGVAGAYTAAREGLSVALVEATERFGGTT
FT                   AYSGGGGMWFPCNPVAQRAGIDDSPEDALAYFHRVVGDRTPLDLQRAYVLGGPRLIEYL
FT                   ERDEHFQFAELPWPDYFGAVEHARADGRRHIVPVPLPAADVGPQAAQIRGPLDAERLGH
FT                   PVPALLTGGRALIGRFLAALARFPHARTHLGAPLVDLVDVDGAVVGAVINRDGENVRVR
FT                   ARRGVLLAAGGFEQNSRMRESFGVPGRAEDTMGCPGNTGAAHRAAIRVGAATDLMDQAW
FT                   WSPGLTHPDGRSAFALWFTGGIFVDQRGERFVNESAPYDRLGRAVIAEMDSRGMTLPFW
FT                   MVYDDREGEVPPVKATNVSMVEAAQYRDAGLWRTADTLDTLADLIGVPADALTATVARF
FT                   NAMVAGGRDTDFGRGDEPYDRAFSGGRSPMVAIEQPPFHAAAFGVSDLGTKGGLRTDTS
FT                   ARVLDTDGRPIPGLYAAGNTMAAVSGTTYPGGGNPIGASLLFSHLAAMDMAGAGPR"
FT   gene            333598..334344
FT                   /locus_tag="Mkms_0298"
FT   CDS_pept        333598..334344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0298"
FT                   /product="transcriptional regulator, PadR family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: mmc:Mmcs_0288 transcriptional regulator, PadR-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89515"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K7"
FT                   /protein_id="ABL89515.1"
FT                   /translation="MATAGKCRSRSVDHTKAQVTARCYPGWVKSGDGPNVTATGWALLG
FT                   VLSYQDELTGYDIKKWTEWSLRFFYGSPAYSQIYTELKKLENIGLLTSRVETDGGARSK
FT                   RLYKITKAGLDALRDWADEGPVDPPQLKHNPLLRVTFGHLTNPRRLKEIMQDHVAYADR
FT                   MQREAATEARWAEAEPAWAYGRVALQWAERYYAAERELAQSVIKDLDAAEEAFAKSAES
FT                   NQDGKPSLAKDYWYEIERRVRAEEGD"
FT   gene            334414..335640
FT                   /locus_tag="Mkms_0299"
FT   CDS_pept        334414..335640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0299"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   mmc:Mmcs_0289 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89516"
FT                   /db_xref="GOA:A1U9K8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K8"
FT                   /protein_id="ABL89516.1"
FT                   /translation="MGRERPTAADDIDPLQPAVLGPVTLRNRVIKAATSEGRSPDGLVT
FT                   DDLIAFHKRFADGGVGMTTVAYCTVAEDAASAPGQILMSRRAVPGLRRLADTVHQAGAA
FT                   VSAQLGHGGVVATRKVNKVTPKAPSRFVNPQSFDYCRPISRDEILTVVDQFGTAAQVAV
FT                   DAGFDAVELHLGHLYLPSSFLSPLMNRRKDEYGGSIDNRARFARQIAQRVREVVGNRAA
FT                   VIAKLSMEDGKRGGIALSESLRVVQLLDADRNLDAIELTQGSSVFKPMYLFRGDTPVDE
FT                   FAAVMPPPMNLGVRMVGKRVLGTFPYRDLYMLDAARQFVPVAAHTPLILLGGITTGEHM
FT                   QDAMREGFAFVALGRALLREPDLVNQIREQPGKRSLCNHNNKCMVTVFGKTHCVLDPGQ
FT                   RYGPVVSQS"
FT   gene            335649..336071
FT                   /locus_tag="Mkms_0300"
FT   CDS_pept        335649..336071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89517"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9K9"
FT                   /protein_id="ABL89517.1"
FT                   /translation="MLGAVLALAAVLSPPAAHAETPYGNFEMQIQGRYDFHTWLWAVSR
FT                   CPGECLRVQAIAQPVAKAFAFRADAHLVDGRYTMTVDVPDGLRCGNVYYGPVIPTRDVY
FT                   TWDDATRSGTLSSSFATGCDGAPGGTLTYPFRLVRL"
FT   sig_peptide     335649..335708
FT                   /locus_tag="Mkms_0300"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.985 at
FT                   residue 20"
FT   gene            336082..336933
FT                   /locus_tag="Mkms_0301"
FT   CDS_pept        336082..336933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0301"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0291
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89518"
FT                   /db_xref="GOA:A1U9L0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L0"
FT                   /protein_id="ABL89518.1"
FT                   /translation="MRIGVSTPVVVQVPGVAAEWERDAGIEDLRTVAQAADSLGFEYLT
FT                   CSEHVAVPAADALARGAVYWDPLATLGFLAACTSRIRLATSVIVLGYHHPLEIAKRYGT
FT                   LDRVSGGRLTLGVGVGSLAAEFELLGAQFGDRGRRADDALRALRASLSTTRPAYDGEFY
FT                   QYDSVVVEPCAAQPRVPIWVGGRTRRSLRRAVELADGWMPFGLSADRLSELLSTVDVPA
FT                   DFDIVLPVAPLDPSGDRDRAARRLRALDDLGATAVTCTLAATSAGHYCDQLEALRAVAE
FT                   DL"
FT   gene            complement(336944..337741)
FT                   /locus_tag="Mkms_0302"
FT   CDS_pept        complement(336944..337741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0302"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0292 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89519"
FT                   /db_xref="GOA:A1U9L1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L1"
FT                   /protein_id="ABL89519.1"
FT                   /translation="MSRYTDRRVLITGGGSGIGQACVLRILDEGGHVVAADVSEAGLKD
FT                   TVSKAQSAADRLSTLVMDVGDEESVRAGVAEAIGILGGLDTLVNVAGILRSARLEQTTL
FT                   TDFERVLRINLVGTFLVTREAISALRNGNGPAVVNFSSTSAHFGHPYMSAYAASKGGIL
FT                   SMTHTLALEFAKDGIRFNCVQPGSISSGMTDGTGQARQSVGPGLPDDADYSLFSRLQPM
FT                   LAIDGGAMFADPSAVASVVAMLGSADAFFVTGTEVRVDGGTHM"
FT   gene            complement(337761..339467)
FT                   /locus_tag="Mkms_0303"
FT   CDS_pept        complement(337761..339467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0303"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0293 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89520"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L2"
FT                   /protein_id="ABL89520.1"
FT                   /translation="MTTAHTATIPGGLPVRDTTVDLLVVGSGTGMGAALAARARGLSVL
FT                   IVEKSEFVGGSTARSGGALWLPASQVIDGDGGGDTSQRAATYLDAVVDGTAPASRSAAF
FT                   LEHVDATIDLLRRTTPMRLFWAREYSDYHPEQPGGSAAGRTCECRPLDTAVLGEYLPRL
FT                   RPGVMEVKIPMPTTGADYRWLNLMSRVPRKGIPLVAKRLGQGIGGLLLGRRYAAGGQAL
FT                   AAGLFAGVLRAGIPIWTETALQRLVTDDGGRVTGAVVDHRGQEITVTARRGVVLAAGGF
FT                   DHHMDMRWKFQSERLGEHASLGAETNTGDAIRVAQDLGAAIDLMDQSWWFPAVAALPDG
FT                   DPKVMLAERSLPGSLIVDQTGSRFVNESCDYMTFGQAVLDRERAGDPVEAMWIVFDQQY
FT                   RNSYVFAAELFPRMAVPKAWYDAGIAHRSESLDDLGRKMGVPDAQFVATVRRFNEMAHA
FT                   GQDSDLGRGRSAYDRYYGDLTVTPNPNLRALDRGPFYAVKMVLSDLGTCGGLRADDRAR
FT                   VLREDGTTIDGLYAIGNTAANAFGATYPGAGATIAQGLVYGYIAAQDAAQA"
FT   gene            339568..340362
FT                   /locus_tag="Mkms_0304"
FT   CDS_pept        339568..340362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0304"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0294 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89521"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L3"
FT                   /protein_id="ABL89521.1"
FT                   /translation="MTDLDRYGPWAVIAGGSEGVGAEFARSLAGDGFNLVLIARKPGPL
FT                   DETAESCRELGADVRTLSLDLLDPEATSRIAEATADIEVGLLIYNAGASTCNDPFLDAD
FT                   LAEWRKIIDLNMSRMLELTQHFGRRMVAQSRGGIILVGSLSGYMGSVRHAVYSGVKAFG
FT                   RMFAESLWLELREQGVDVLELVLGVTRTPAMERAGLRFDIPGFIVNDPADVAREGLEHL
FT                   GDGPVHVAGGNAEQAARNSGPDRARIVLESHLAIQRLIGAQP"
FT   gene            340359..340862
FT                   /locus_tag="Mkms_0305"
FT   CDS_pept        340359..340862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89522"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L4"
FT                   /protein_id="ABL89522.1"
FT                   /translation="MSSDRLAALEARLQRLEDERDIQRLIASYGPYVDAADADGAAALW
FT                   AEDGSYDVEGWRMTSRDDVRAMVSSDGHRALVAAGCCHFLGPSIVTVDDDEAVAVCESV
FT                   VLRTTGETPVGYAVWRAAANHFHLRRVGGVWQIAARTTRLLDGNPEAHRLLTAGVAGQR
FT                   SDLS"
FT   gene            340914..342050
FT                   /locus_tag="Mkms_0306"
FT   CDS_pept        340914..342050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0306"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mmc:Mmcs_0296 Rieske (2Fe-2S) region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89523"
FT                   /db_xref="GOA:A1U9L5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L5"
FT                   /protein_id="ABL89523.1"
FT                   /translation="MTSDIDEVRQIEADAAPTRFARGWHCLGLTRDFGDGKPHTVNAFG
FT                   QKLVVFRSGDGRINVLDGYCRHMGGDLSQGEVKGNEIACPFHDWRWGGDGRCKQVPYSK
FT                   RAPRLARTATWTTLEQDGMLFVWNDPERKPPPDDVTIPRIEGATSDEWTDWHWYTTVVD
FT                   TNCREVIDNVVDMAHFFYIHGSLPTHFKNIFEGHVATQYMNSAGRADLQPPEGPRMLGT
FT                   TSVASYHGPSFMIDDLTYHYEEADHHTVLINCHYPIDANSFVLQYGIIVKKSEALPDDL
FT                   AVQTAVSLGDFVKMGFEQDVEIWKNKARIDNPLLCEEDGPVYQLRRWYEQFYVDIADVT
FT                   PDMVDRFEYEVDTTRPREEWMKIVEANISARASATSAG"
FT   gene            342047..342337
FT                   /locus_tag="Mkms_0307"
FT   CDS_pept        342047..342337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89524"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L6"
FT                   /protein_id="ABL89524.1"
FT                   /translation="MSVRPDNRLDDAPMVPVACRACGAKVLARKSSWQQTSVQWSADAA
FT                   QRCPQRRDSEALAAHGRRTVFLSCSELSESIVEAVRAGRLSIVDETVDVAP"
FT   gene            342347..343159
FT                   /locus_tag="Mkms_0308"
FT   CDS_pept        342347..343159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0308"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0298 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89525"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L7"
FT                   /protein_id="ABL89525.1"
FT                   /translation="MTEHIDPPVAVVTGASRGAGRGIARALIAAGWRVYLTGRTVDSLG
FT                   EGSVAVPLDHRDDAAVGALFTRVEDEAGRLDLLVNNAAAVHDALTGRDPFWQKPVELGD
FT                   ILDVGLRSSYVAAWYAAPLLLRGPRGLIAFTSSPGSVCYMHGPAYGAQKAGVDKMAADM
FT                   AVDFRGTPVHTVSIWMGILLTEKLRGAFDGNPDGLAAMAEHAETPEFTGRVIDALYRDP
FT                   ARESLSGHTVIGAELAARYGITDEGGRQPVSHRGMLGAPRTPSDVVVR"
FT   gene            343228..344361
FT                   /locus_tag="Mkms_0309"
FT   CDS_pept        343228..344361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89526"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L8"
FT                   /protein_id="ABL89526.1"
FT                   /translation="MLDEKRRAAEAAAGVPANKRGRGLASEVALARHDCPNKGGRHLGF
FT                   ARVLVHEMPHTLAALECGALSEWRATLIVRESACLSVEDRRSLDTELCRDVSSLEGLGD
FT                   KRIEAEAKKIAYRLDPQAVVDRAARAASERTVTCRPAPDTMTYVTALLPVAQGVAVYAA
FT                   LKRSADTTFDDRSRGQVMADTLVERVTGCPAEVAVPVAVNLVITDEALLGGDPEPAVIS
FT                   GYGPVPAAVGRRLVDAAVTDKRSKATLRRLYRRPRSGALVAMESRARCFPKGLAAFIDL
FT                   RDQTCRTPYCNAPIRHHDHARPHRAGGPTSAANGLGECEQCNYAKEAPGWQVTAAIDET
FT                   GTHTAEFTTPTGAVYRSTAPSPPGVTPPDAAGEARAA"
FT   gene            complement(344376..345452)
FT                   /locus_tag="Mkms_0310"
FT   CDS_pept        complement(344376..345452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89527"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9L9"
FT                   /protein_id="ABL89527.1"
FT                   /translation="MLTDDRRLALSDVLRPASPPREVDDIYTDDQRERLLDVVRTQGPW
FT                   KLIIAQHFASAEELMATMSGAFPEGFEPSLDLFLTPTFRGYLANYGTVLYPELHDCFYN
FT                   EQFLAHAKSYWNAEYAKPEMMLFNINGPCANRDPGHLDSPSFRGVRHENAPTWLTSVMG
FT                   KSGLFQDHLIKMAQVITWFSLDEGSGFTYWPEGPLKAPQRLLPPVYNRGVVVQNEMMVH
FT                   RGEANGPLEQQTPAGLAFDTVFTGDPSDRDHWVLKNGDDVIARHHTDELRFLVHWSAEV
FT                   FSDYDELKKNMDHSDDLTIEQAIDTLVKDVNAQGISLKMPDNPLHDPQFIATLNAAYDL
FT                   GGPAAYPEEAPLSAFQLA"
FT   gene            complement(345544..346494)
FT                   /locus_tag="Mkms_0311"
FT   CDS_pept        complement(345544..346494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0311"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0301 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89528"
FT                   /db_xref="GOA:A1U9M0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M0"
FT                   /protein_id="ABL89528.1"
FT                   /translation="MTVPGLDPDAAARVASFGAIPPMRERGLDAVRRAVEATPHPDDTP
FT                   EMADVDDLSIPGPAQPIPVRIYRPTDDDSAPVLVYFHGGGMVMGSNRSFEPLARALAAH
FT                   SGATVVSVEYRLAPEAPTPAQFDDAYAATVWVAGNAEVIRVDASRLAVVGDSAGGSLAA
FT                   AVALAARDRGGPSILCQVLLYPGLDRDMTCESIQLLADAPMLTHADIDYMHELADQGAA
FT                   VPPDQYRFPALATDLTGLPPAIVVTAGCDPIRDWGERYATRLRDAGVQTTQTRYPGAYH
FT                   GFLMRSDATARGRLAIAETGALLRAKFACPVPVSR"
FT   gene            complement(346491..348095)
FT                   /locus_tag="Mkms_0312"
FT   CDS_pept        complement(346491..348095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0312"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0302 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89529"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M1"
FT                   /protein_id="ABL89529.1"
FT                   /translation="MNFGAMNYDVIVVGFGAAGAAAAIEAADRGARVLVLDRGYGGGAT
FT                   ALSGGIVYAGGGTAEQHAGGYHDSVEDMRAYLESEVGDSVSGETLDRFCRQSPAMIEWL
FT                   KAQGVEFRGGEVPTYKTSYPTDDFYLYYSGNEKAYPYAGRARPVPRGHRVLARGMSSGK
FT                   VLFDRLARSARHKGVEFIPLAQVHSLIQDDDGRIAGVRYRALDPAHPNARKHKVLTKLT
FT                   GKAGTWMPGLVEGLVARAEEMRTGASVDAEARAPAVILAAGGFVHNREWMQAHAPQFMK
FT                   VSPLGTVGDDGTGIALGLAAGGVTGKMDNVTAWRFLSPPSAFLEGLTVGADGRRIANED
FT                   LYGATHGNVLMRDFGGTGWAIYDAQTWRKVKSQIRTQTQIFQRLQLIYLFTIGHKKAAS
FT                   IEDLAAENGIDAEGLRRTVDEYHRGLDNGAGDPAHKDPELCPPLLTPPFYSIDISADSS
FT                   MFFPIPGLTLGGLLVDESTGEILGADGESVPRLYAAGRNAVGVCSKSYVSGLSLADCIF
FT                   SGRRAGAHAADGLGQPR"
FT   sig_peptide     complement(348015..348095)
FT                   /locus_tag="Mkms_0312"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.713) with cleavage site probability 0.619 at
FT                   residue 27"
FT   gene            complement(348107..348895)
FT                   /locus_tag="Mkms_0313"
FT   CDS_pept        complement(348107..348895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0313"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0303 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89530"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M2"
FT                   /protein_id="ABL89530.1"
FT                   /translation="MRITDRVFVVTGAGNGMGRQVTLDLLRRGALVAAADVDEVGLTGT
FT                   ARLAMAGTRLSTHVLDVTDRDAVAAMPGRVVDVHGRVDGLVNIAGVIHRFAPFIDLPPE
FT                   TADRIMAVNFTGTVDMCRAFLPVLLARPEANLTNMSSLSALLPFASQTLYSASKGAVKQ
FT                   FSEGLYAELCDTNVHVVTVFPGNVATELTSNSGVEMLDAGGKKVRSTTPEAAGRKIVDG
FT                   IAEDRFRVLIGADAHSLDVLARVSAKRTTRLVAKQIKSVL"
FT   gene            complement(348907..349767)
FT                   /locus_tag="Mkms_0314"
FT   CDS_pept        complement(348907..349767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0314"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0304 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89531"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M3"
FT                   /protein_id="ABL89531.1"
FT                   /translation="MNAGQTFGGGVAVITGAGAGIGAGLARHAARLGMTVVLADVDGDA
FT                   IAALRDELSDQGATAFDMVCDVRDFAAVEELAQRTYRDIGPVRLLVNNAGVEQFGYLWD
FT                   TPVENWQRVVDINVSGVFHGVRAFLPMMIEARTPAWVWNLSSIGGVAVVPLQAPYIMSK
FT                   HAVLALTECLALEVQLAEHDHIHVQAVLPGAVTSNIFESAGGVTDGDVGAAESQRLAML
FT                   DIKAAAMDPLAAAEVVFDQAADGRFYLLTQPEYVGNAMAERADVLTTQRAPLLRTKPRF
FT                   DPAQH"
FT   gene            complement(349772..350254)
FT                   /locus_tag="Mkms_0315"
FT   CDS_pept        complement(349772..350254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89532"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M4"
FT                   /protein_id="ABL89532.1"
FT                   /translation="MSNEIALSELQEFVAGFWYHYDEAHYDDMAAAYADDIRYISRSES
FT                   GASPFEELMSPELVGREAVMEWLSEHRKQSPYPLRHHATNLHRTGTDGDVTRARFYIFV
FT                   NQIANYVPFAVSSGVAEVAVRRGAGGLEFTEMEVILDTTNSVLLSEYSADPAAAGA"
FT   gene            complement(350317..351102)
FT                   /locus_tag="Mkms_0316"
FT   CDS_pept        complement(350317..351102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0316"
FT                   /product="Enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   mmc:Mmcs_0306 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89533"
FT                   /db_xref="GOA:A1U9M5"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M5"
FT                   /protein_id="ABL89533.1"
FT                   /translation="MTADMSGPLRITTTAAIQVWTIDLPHVGNAITDDGFIAAFEAAVH
FT                   AVNADNAIRAVILTGEGKIFSAGGNVKEMADRQGMFGLEPLDQRRAYLDGIQRIPRALE
FT                   RLEVPLIAAVNGAAVGAGCDLAMMCDIRIASDRASFAESFVQVGLIPGDGGTWFLPRAV
FT                   GYARAAEMTLTGDRIDAATAAEWGMVSRVVPHEDLLAEAQALAERITKNPAHVLRMAKR
FT                   LLQESRTGSLESTLGMAAAMQPLAHRDAEHERRISRWRS"
FT   gene            complement(351099..352517)
FT                   /locus_tag="Mkms_0317"
FT   CDS_pept        complement(351099..352517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0317"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0307
FT                   betaine-aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89534"
FT                   /db_xref="GOA:A1U9M6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M6"
FT                   /protein_id="ABL89534.1"
FT                   /translation="MHDYTRKTLFIDGRWATPDGGDAIEVIDPATEQVIGSVPDGTTAD
FT                   VDAAVAAARRAFDPLITVAERRERLDRVIAAMEKRLPDIGETITREMGAPVRIAQGVQT
FT                   KVPLAVARGIADVLATFEFEERMGNSLVVREPYGVVGAITPWNYPLYQVVAKVVPAIAA
FT                   GCTVVLKPSNEAPLSVFEFVEALDEAGLPPGVVNLVSGSGRVVGERIAEHPDVDLVSFT
FT                   GSTAVGQRVAELAAKTVKKVALELGGKSANVILEGGDLTTAVKVGVGNAYLNGGQTCMA
FT                   WTRMLVPESRYGEALELVEAAAARYTVGDPLDPATRIGPSASASQFATVRGFIERAQRD
FT                   GARLITGGAEKIRDIGYYVAPTVFADVDPDSELGQEEVFGPVLAVIPFRDEDDAVRIAN
FT                   GTPYGLAGAVWAGDLDHAIAFARRVQTGQLDLNGGAYNPVAPFGGYKKSGVGRELGRAG
FT                   FEEFLQTKSLQLPA"
FT   gene            complement(352532..353638)
FT                   /locus_tag="Mkms_0318"
FT   CDS_pept        complement(352532..353638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0318"
FT                   /product="Alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0308 alcohol dehydrogenase, zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89535"
FT                   /db_xref="GOA:A1U9M7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M7"
FT                   /protein_id="ABL89535.1"
FT                   /translation="MFEGRIARFDAPGQPFVIDTVDLADVGPGEILVKVTRTNICGSDL
FT                   HAWHGTFATRGLGGQLPTVLGHEMVGAVAALGDGVTADSNGVPLAEGTRVVFPYFYSCH
FT                   RCRNCLLGRRGACLNLKMAMLGRADEPPYFVGGYGDYYLLPAGAVVYTVPDVVSDEVAS
FT                   GANCALSQVMYGLERVDQQLGEVVVVQGAGALGLYAVAVAKARGAAKVIAIDGVPERLE
FT                   LATAFGADAVVDITEATTVKDRAKIVRTLTDGHGADVVVEVVGHPAAIDEGLKLLGQFG
FT                   RYVEIGNINIGKTFEFDPSRFVFGNKTMVGVSLYDPAVLSRALTFLEQHQDHLPLDRLA
FT                   AAHYPLDHINEAFAAADGKRDVRASIIP"
FT   gene            complement(353651..355264)
FT                   /locus_tag="Mkms_0319"
FT   CDS_pept        complement(353651..355264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0319"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0309 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89536"
FT                   /db_xref="GOA:A1U9M8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M8"
FT                   /protein_id="ABL89536.1"
FT                   /translation="MAGDRACLGFPMDAAMDPVVVQARSHTLGDIPRRSARRFPDKTAI
FT                   VDGDVVLTFAEFERLVDRAAAALQDNGFGPGDRIALLSHNCWQYAVLAFATARAAVVLV
FT                   PINFMLTAEEISYLLGHSGVRGFLVEADLTATAEEAMRLGGSVTTKVALVPDGDAPAEG
FT                   WDDFARWLTTESPAPSPHIDDDQLLRLMYTSGTESRPKAVMHSSRSLMWQYVSTIVAGS
FT                   MAGDDVEVHSLPLYHCAQLDNFLATDVYLGATSIILPRPEPELVLRTIERYGVTNYFAP
FT                   PTVWISLLRCPVFDEVDLSSLRKGYYGASAMPREILAELRERLPDLRLWNFYGQTEMAP
FT                   LASALGPDEQDAHAGSAGRPVVNVETTILDEDDTPVATGVVGEIAHRSPHLMLGYLDDA
FT                   AKTAEAFRGGWFHSGDLGYYDEHGLLHVVDRKKDMIKTGGENVASREVEETLYRHAGVQ
FT                   EAAVFGLPHPVWVETVVAAVVLRDGSAVTEDDIIAHCRAHLAGYKTPKQVFFVDTLPKN
FT                   PSGKLLKRDLRQRFSAAHSH"
FT   gene            355332..357215
FT                   /locus_tag="Mkms_0320"
FT   CDS_pept        355332..357215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89537"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9M9"
FT                   /protein_id="ABL89537.1"
FT                   /translation="MTTDAELRSHLRQADPGVLVAVLAQMTGDPSVIDEFAPAISHIPD
FT                   PPERAGVTDPDTMEALVDRIVEALDTPRSGGLAADDPNLFTRLLPVALGSDVEDEFVPL
FT                   LLEQGGFQLSQPTLPRDVPIPASTTVTIIGAGIAGIVAALAARDAGVAFEILDRNDEVG
FT                   GTWLTTKYPGIGVDTPSAYYSLSREVNPDWTNYYPQGAEYQAYLVSLADKYGLREHTRF
FT                   GTEVEALWWDDDRQEWQIHAVDRDGNRSVSHSRVVITAAGYLNRPRWPDIPGRDTFAGI
FT                   SVHSAQWDPSLDLTGKRVAIIGAGCTAVQIVDACVDQVEHLTVFQRQPHWVAPRKRLSD
FT                   DVPEYRRYLGRHLPYYANWHRLKSYWATADNNYPVIVRDPEWAERHLSISPANDVLLQM
FT                   CLEYIDRMFGEGTELAKKVTPDFAPYGKRIIRDPGGYYAALTRDHVDVEASEPAEVNAR
FT                   GIVTQDGRQIDLDVIVYATGYHLDFLSTVDIRGRGGRTLREEWGDSPRAYRGGTVPGFP
FT                   NLFITSAPNYSPGHGAGANFSMEVLAHYIMECLQLMASRRATTIEVTQEAYDDYVADID
FT                   DAMSRTVWCHTPNAHTYYRSGSGRVVVATPYRLIDVWQQHRAPVEDHFVIR"
FT   gene            357212..358099
FT                   /locus_tag="Mkms_0321"
FT   CDS_pept        357212..358099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0321"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0311 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89538"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N0"
FT                   /protein_id="ABL89538.1"
FT                   /translation="MSRLLSGKTALVTGSSRGIGRAIAQRLAAEGATVVVTARSHTPSP
FT                   SVRAGAAAALPGTIGETVEMIEAAGGTAYGVAADLEDQQQRLRLIDEVLDRTGRLDILV
FT                   NNAGYADYSVVEHMAMDTFDRTVEHYLRTPFVLSQCAIPHMRTQGAGWIVNIGSVTGMA
FT                   PVRPFREYNKSSGDVVYASVKAALHRFTQGLAAEVVDDDIAVNCVGPSTAVRTPGASQL
FT                   IPDTFPTEPVEYLAETVLAMCHLPAADRTGLVAFSLHYPWSQGLPVHTLDGSAVLPPLE
FT                   PPATANPNIRPAGL"
FT   gene            complement(358105..358725)
FT                   /locus_tag="Mkms_0322"
FT   CDS_pept        complement(358105..358725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0322"
FT                   /product="Stress responsive alpha-beta barrel domain
FT                   protein"
FT                   /note="PFAM: Stress responsive alpha-beta barrel domain
FT                   protein; KEGG: mmc:Mmcs_0312 stress responsive alpha-beta
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89539"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013097"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N1"
FT                   /protein_id="ABL89539.1"
FT                   /translation="MYSVIRLLDVDESERDDVLDTLRRSTFGAEWTLVEPTLPGVRNGG
FT                   DILVRLRFSDRHARADAVTKLDELLDRNAVRHVNGATYSGSSTPGADGIATVYRALLLR
FT                   VRPGTDEATVRRFEDDLRLLPRYVRTIHSWQLSRVEDAIGTSTWTHVFEQEFTDVDGLM
FT                   GPYLMHPIHWAYVDRWFDPECPDMIVRDRVCHSFCRNDAVVHA"
FT   gene            complement(358718..359059)
FT                   /locus_tag="Mkms_0323"
FT   CDS_pept        complement(358718..359059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89540"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N2"
FT                   /protein_id="ABL89540.1"
FT                   /translation="MAEVFVTDRVVTRPGRTREFVDAYLTGYAPGARQRGMTLQRVLVS
FT                   PPIWFEDQPNTVTVTWSLRSARAWWEMTWQGRPDPSIGEWWTGIDELVTERSREVAADA
FT                   ADVDGLCDV"
FT   gene            complement(359052..359984)
FT                   /locus_tag="Mkms_0324"
FT   CDS_pept        complement(359052..359984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0324"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: mmc:Mmcs_0314 alpha/beta hydrolase fold-3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89541"
FT                   /db_xref="GOA:A1U9N3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N3"
FT                   /protein_id="ABL89541.1"
FT                   /translation="MTGALDPQIADLIEGLDRGFPPVQTMTGAQARATIRSRFIAPAEP
FT                   EPVAAVEDRSVGEIPIRIYHPAGAGPLPVLVYAHGGGFVFCDLDSHDGLCRDIANQTAA
FT                   IVVSVGYRLAPEHPWPAAAEDVYAVTRWVADNCTALGADPGRIAVGGDSAGGNLAAVTA
FT                   LIARDRGGPSLVAQLLVYPMVTPDFTTESYRLFGSGYYNPAEALRWYWDQYVPNDFDRT
FT                   HPYVSPLHADLSGLPPAVVVIAGHDPLRDEGVRFGEALSAAGVPTVVRRFDGGIHGFMT
FT                   MPSLELAQTARAQLCQDAVALLTGVPAGG"
FT   gene            complement(359981..360841)
FT                   /locus_tag="Mkms_0325"
FT   CDS_pept        complement(359981..360841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0325"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory proteins, IclR; KEGG: mmc:Mmcs_0315
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89542"
FT                   /db_xref="GOA:A1U9N4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N4"
FT                   /protein_id="ABL89542.1"
FT                   /translation="MTVQPGLAPVSPESTPSAVIDRVSLVLDAFDGPGRLTLAQIVRRT
FT                   GLPRSSAHRMLERLVQLRWLRRNGRDYELGMRLVELGSLAVHQDRLHRAATPLLHDLHR
FT                   ATGLVVHLAVLDGADVVYLEKIGDRMVAALPSRVGGRQPAHCTAIGKALLAYNADACDD
FT                   VDLDNRRTKYSIGSAAQLANELAKTRAHGVAFDREESLPGFGCVAAPIGAPGEAVAALS
FT                   VCGPMGRMVFDQRLAAPVRMTAMGVWRNVEGGPQRVAPTLQQVRPLRSGPTPRPAHEST
FT                   ALQLA"
FT   gene            complement(361015..362478)
FT                   /locus_tag="Mkms_0326"
FT   CDS_pept        complement(361015..362478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0326"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: mmc:Mmcs_0316 fumarate reductase/succinate
FT                   dehydrogenase flavoprotein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89543"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N5"
FT                   /protein_id="ABL89543.1"
FT                   /translation="MTADDVRPVPASSVTSWDHEADVVIAGYGVAGAAAAVEAAHAGAD
FT                   VLVLERTGSWGGAASMAGGFIYLGGGTPIQKACGFEDSVDNMAAFLNAAMGPGADDRRI
FT                   ADYCEGSVAHFDWLVECGVPFKAEFFGEPGWEPMGDQGLMYSGGENSYPFNTIATPAPR
FT                   GHVPQMSDKKQGEASAGYMLMKPLVETATAAGARALYDVRVQRLVVEADGRVTGICARQ
FT                   YGTDVTIRARRGVVLATGSFAYNDAMVAQYAPRIAGRPAASIEQHDGQAIRMAQALGAD
FT                   LAHMDATEVAIFIDPQQLVRGVLVNERGQRFVAEDTYPGRVGQLTLYHQNNTAYLIIDG
FT                   DAQEEAMASLSPQLMMRPPTWVCETVAELEAEIGLAPGSLQTTIAAYNDGAARGEDPLL
FT                   HKKPQWLRPVGSPVGAIDLRESTGGFTLGGLQTSLDGEVLHVDGEPIPGLFAAGRSTAG
FT                   LAAWGYASGISLGDGSFYGRRAGRAAAKG"
FT   gene            complement(362475..363383)
FT                   /locus_tag="Mkms_0327"
FT   CDS_pept        complement(362475..363383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0327"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mmc:Mmcs_0317
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89544"
FT                   /db_xref="GOA:A1U9N6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017626"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N6"
FT                   /protein_id="ABL89544.1"
FT                   /translation="MTVLKSLGYVTVQTADIDRWRHFAFQVLGFAEGSGPDDSCLYLRM
FT                   DERAARIIVRPGDTDRIVTVGWEVRDHAALEQVKRDLDAAGTPFKQLSLEEADARRVEE
FT                   VIAFEDPAGTALEVFHGAVLDHSPVVTPFGARFVTGAQGLGHVVLPALDVNGVFEFYTG
FT                   VLGFRSRGAFRVPVPPEFGPVRVRFLGINDRHHSLAICPASTVRDPGLVHLMVEVDSLD
FT                   AVGQALDRVAADGYQLSSTLGRHTNDKMVSFYVRAPGDWDIEFGTEGMRVDETYYTAEE
FT                   ITADSYWGHQWVGDLPAAMRP"
FT   gene            complement(363399..364580)
FT                   /locus_tag="Mkms_0328"
FT   CDS_pept        complement(363399..364580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0328"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: mmc:Mmcs_0318 acyl-CoA dehydrogenase, type
FT                   2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89545"
FT                   /db_xref="GOA:A1U9N7"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N7"
FT                   /protein_id="ABL89545.1"
FT                   /translation="MTERVIDRVMELADQFREQAVEAERIGKISDTTVKNMKAVGNIRL
FT                   LQPEEYGGYEVHPREFAETVMATAALDPAAGWVNGVVGVHPYQLAYADPKVAQEVWATD
FT                   VDTWIASPYAPQGVAKPVDGGYLFNGRWQFSSGTDACDWIILGAMVGDADGRPVMPPQI
FT                   LHMILPRSDYEIVDDSWDVVGLRGTGSKDVVVRDAFVPAYRTMDGLKVMDGSAQVEAGM
FT                   TKTLYKMPWSTMFPLGISSATIGICEGALAAHLDYQRERVNASGVAVKDDPYVMYAIGE
FT                   AAADIQASRQALLANVDRIFDMVDTGTEVTFADRAAVRRDQIKAVWRAVTAVDQIFARS
FT                   GGNALRMDKPLQRYWRDAHAGVAHAIHTPGTIYHASALSSLGVDPQGALRAMI"
FT   gene            complement(364668..365708)
FT                   /locus_tag="Mkms_0329"
FT   CDS_pept        complement(364668..365708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0329"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mmc:Mmcs_0319 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89546"
FT                   /db_xref="GOA:A1U9N8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N8"
FT                   /protein_id="ABL89546.1"
FT                   /translation="MIADVDSPSEPRTVRLTVTDVIEESHDARSLVFAVADGARFDYRP
FT                   GQFLTLRVPGEQGGAVARCYSLASSPHTDAAPKVTIKRVDGGYGSNWLCDNVVAGQVIE
FT                   ALPPSGVFTPGDLDRDLVLWAGGSGITPVMSILKSALAVGSGRVVLVYANRDERSVIFA
FT                   AELRDLTARHPDRLTVVHWLESVQGLPRQDQIATLARRFTGGEAYLCGPAPFMAAVQAA
FT                   LAEAGVPRDAVHTEVFRSLTGDPFAEVAPVPVDGDAADLQVELDGGKHSLRWPRQATLV
FT                   DAMIAAGLDVPYSCREGQCGSCAATLLRGRVDMPDTEILEPEDIEAGTILGCQARPASD
FT                   EIHIEF"
FT   gene            365799..367421
FT                   /locus_tag="Mkms_0330"
FT   CDS_pept        365799..367421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0330"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mmc:Mmcs_0320 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89547"
FT                   /db_xref="GOA:A1U9N9"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9N9"
FT                   /protein_id="ABL89547.1"
FT                   /translation="MDTSADQLPNQVDAVVVGAGFAGLYALHKLRSQGLTVRVFEAAPD
FT                   VGGTWYFNRYPGARCDVESVDYCYSFSEELQQEWNWSEKYATQGEILRYINWVADKLDL
FT                   RSGITFNTKVTSAVLDEDTLRWTVTTDAGTVLSARFAIMATGPLSAALTPQFPGLDTFA
FT                   GDIYHTADWPHEDVDFTGKRVAVIGTGSSGIQSIPIIAEQAAQLYVFQRTPNYSVPAGN
FT                   RPLTAEDIATVKANYDERRQLSWRSGGGSPHVAHPKLTMEASLEERRAAFERRWELGGV
FT                   LFSKTFRDQMIDPQANDEARKFYEEKIRAVIDDPEVADLLIPKDHPIGTKRICTDTNYF
FT                   QTFNRPNVELISVRKTPIESVDPAGINTSDAHYELDVIVLATGFDAMTGALAKMDITGR
FT                   DGEKLADDWRDGPRTYLGLGVDGFPNLFIVSGPGAPAVLANMVLHAEAHVNWIADCIDY
FT                   LDSHGYAAIEATPQAVDDWGAELSRRADATLFTQANSWYMGANVPGKPRVFMLFIGGFG
FT                   VYLDICAEVADAGYKGFELLKID"
FT   gene            367421..368221
FT                   /locus_tag="Mkms_0331"
FT   CDS_pept        367421..368221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0331"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_0321 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89548"
FT                   /db_xref="GOA:A1U9P0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P0"
FT                   /protein_id="ABL89548.1"
FT                   /translation="MPRLLDKVVVVTGAARGTGRVHCERFAEEGADVIALDVAAVADEL
FT                   SGTAAAVARHGRRCVTGEADVRDFAALTAAIDRGVEELGRLDVVVANAGVHPAGAPAWE
FT                   LTGEAWRQALDVNVTGVWHTVKAAARHMDSGGGAVIVISSTNGLRGTPNSAHYTTSKHA
FT                   VVGLARTLANELGPRSIRVNTVHPGAVATPMVLNEATFRRLRPDLEEPTADDAAEVLRA
FT                   RNLLPVPWVDPVDVANAVVFLASDEARYITGSQLVVDAGLTQKV"
FT   gene            368218..369057
FT                   /locus_tag="Mkms_0332"
FT   CDS_pept        368218..369057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0332"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0322 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89549"
FT                   /db_xref="GOA:A1U9P1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P1"
FT                   /protein_id="ABL89549.1"
FT                   /translation="MTVGRLAGKVALITGAARGIGRAQAVRFAQEGADIIALDICGPVD
FT                   DTVVVPSATRRDLDETACLVAEVGVRVVTEVVDVRDPDALQAATDAAVTDLGGIDIVCA
FT                   TAGITSRGAATQMPEDTWQTMLDVNLTGVWHTCKVSAPHLIARGAGSVILVSSIAGLRG
FT                   LVGVAHYTAAKHGVVGLMRSLAHDLAPHGIRVNSVHPTNVDTPLIQNTAVSSAFRPDLD
FT                   RPPTRAEFAAAARPMNLLAIPWIDPVDVANASLFLASDEARYITAVSLPVDAGSTQR"
FT   gene            complement(369063..369920)
FT                   /locus_tag="Mkms_0333"
FT   CDS_pept        complement(369063..369920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0333"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0323
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89550"
FT                   /db_xref="GOA:A1U9P2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P2"
FT                   /protein_id="ABL89550.1"
FT                   /translation="MTATSDQLPLQELTTPSGTLRYYDTGAGPTVLFLHGSGPGVTGWR
FT                   NFRGVLPAFSAHFRCLILEFPGFGVSDDAGGHPMIDAQGAVAPFLDGLGVDRVDIVGNS
FT                   MGGGVGINFAIHHPDRIRRLVTIGGIGTNVFSPGPSEGIRLLQEFTEDPTRARLVDWLR
FT                   SMVYDEALVTEELIAERWELATDPETLAAARRMYGKAAFTQMMAFMRKSEAPLPWAQMH
FT                   RVAAPTLLTWGRDDRVSPLDMALIPMRTIPNAELHVFPNCGHWAMIEAKAAFEAAVLSF
FT                   LLRE"
FT   gene            complement(369955..370560)
FT                   /locus_tag="Mkms_0334"
FT   CDS_pept        complement(369955..370560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0334"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0324
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89551"
FT                   /db_xref="GOA:A1U9P3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P3"
FT                   /protein_id="ABL89551.1"
FT                   /translation="MDSTITAVTRRDRVVAAALHLAADGYDAVHIRTVAELAGVAPSTV
FT                   YQHFASKDDLLVASLHRWLSACETDARAPLDRIAEPYDRLLYVADFITQRLWAEPLLAD
FT                   ALTRAYLCAESVAATNADRVRTSLSRMLTSAMGRELPTARQRHIGDLVADIWASSMLAV
FT                   AQNRATADGSRERLARTIAVIARHDAEESLPSAGLRAV"
FT   gene            370611..371984
FT                   /locus_tag="Mkms_0335"
FT   CDS_pept        370611..371984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0335"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mmc:Mmcs_0325 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89552"
FT                   /db_xref="GOA:A1U9P4"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P4"
FT                   /protein_id="ABL89552.1"
FT                   /translation="MGFRPTGAPGNAKIGDMDETATPDPALLRRVAISSLLGTAIEYYD
FT                   FLVYGTMSALVFGIIFFPESDPAVATIAAFGTLAAGYVARPVGGILFGHFGDRIGRKSM
FT                   LVLTMTLMGVASFLVGVLPTFAAIGVAAPILLVALRVIQGVAIGGEWGGATLMVTEHAE
FT                   PHRRGAWNGVMQMGSPIGSLLSVAVVTAITLMPDESFMSWGWRVPFLVSLLLLGLGIYV
FT                   RLSITESPVFEQAKRADDRPQGPPLVEVLRRPGNLVLACAVGIGPFALTALISTYMISY
FT                   ATAIGYHRTDVMTALIFTSTTALITIPLFSALSDRVGRRAVIVTGAIGIVCYAWPFYAL
FT                   VDMGSVPLLTVAMVIAQVLQSLMYAPLGALFSEMFGTRVRYTGASMGYQFAALLGAGFT
FT                   PLIASSLLAEGVSRTPLVVLAAGCGVVTIVAIWRVSETRGADLTDAGRLPRGAAAADR"
FT   gene            complement(371981..372820)
FT                   /locus_tag="Mkms_0336"
FT   CDS_pept        complement(371981..372820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0336"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0326 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89553"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P5"
FT                   /protein_id="ABL89553.1"
FT                   /translation="MGTYAVTGSASGMGRATAERLRADGHRVIGVDVKEADVVADLSTP
FT                   DGRARAVSQVVSAAGGHLDGAVLAAGIGPGSGKGRLRLIAEVNYRGVVELLDGWRPALA
FT                   SAGNAKVVVVSSNSTTTTPLVPKRAVKALLAGDVDKAVRAVRLFGPVGSALIYAASKIA
FT                   VSRWVRRHAIRPEWAGAGIRLNALAPGAIMTPLLEEQLASKQQAKAVQRFPVPVGGFGD
FT                   AGQLADWIRFMLSDAADFLCGSVIFVDGGTDAHFRTDDWPKPVPARRLVSYLKRFRN"
FT   gene            372918..373295
FT                   /locus_tag="Mkms_0337"
FT   CDS_pept        372918..373295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89554"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P6"
FT                   /protein_id="ABL89554.1"
FT                   /translation="MAEPPTTEDGHHVVVNGRKWRATDPSIPADRRAELTRILMSWRRE
FT                   VRRTEGTDQERAARAGVQAAKVALGERGTPPWWEQTDEQRRARWQADVPAPGGPLPPEA
FT                   PVREHRGDHPHPGNGERTEHA"
FT   gene            373288..374184
FT                   /locus_tag="Mkms_0338"
FT   CDS_pept        373288..374184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0338"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: mmc:Mmcs_0328 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89555"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P7"
FT                   /protein_id="ABL89555.1"
FT                   /translation="MPENTSAVVVGIDGSDSALQAARWAGAVAAACGAPLHILHGMPSL
FT                   GRNLTETAAAIQAAIMSYQRDSALIFLRAAADAVHEDRPDLSVTTEASETPVDEALIEA
FT                   SATARLIVLGGQDVTGAAALILGSTTLRVATHADCPAVAFRGDDVTVSDKPIVVGVDNT
FT                   AAGAGVLATAFEFADAMKVKLIVVRSWTTRAPAGDVTIPFLIDWEALEAAEWAALTELV
FT                   DGWRQRYPDVDAECVVETMSPARALLSHATGAQLVVVGSRGRNALAGLVLGSTSMNLLH
FT                   HSQVPVMVTRAHAPEGD"
FT   gene            complement(374245..375165)
FT                   /locus_tag="Mkms_0339"
FT   CDS_pept        complement(374245..375165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0339"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0329
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89556"
FT                   /db_xref="GOA:A1U9P8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019921"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P8"
FT                   /protein_id="ABL89556.1"
FT                   /translation="MKLVFNLPHMLRLKAMMQPWEAAVTGADQTRMAKCADAWGYDMIA
FT                   VPEHFVIPNDHVELSGPHYLQSTVAQAYLAGATERIRLNSCITVLPLQHPIVLAKALAT
FT                   ADWMSGGRMMVTFGVGWLEKEFELLGVPFHERGRMADEYLAAIVELWTSDSPSFHGKYV
FT                   SFDDIAFEPKPVQKPHLPVWIGGDADAALRRAAKFASGWWSFLTPPEKIAERLEFIKSQ
FT                   PGYDGRPFDVVHGLGTTRVGEGHVARDDPHGRPGMNAAEIVDRLCWLGEQGVTVSAVPL
FT                   PPVSGVDEYLDYAQWVVEEIKPQVP"
FT   gene            complement(375194..376033)
FT                   /locus_tag="Mkms_0340"
FT   CDS_pept        complement(375194..376033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0340"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0330 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89557"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9P9"
FT                   /protein_id="ABL89557.1"
FT                   /translation="MGGRVDGKVAFITGAARGQGRSHAVRLAEEGADIIAVDVCGPISS
FT                   HTDIPPATPDDLAQTADLVKGLNRRIVTAEVDVRDFDALDAVVRSGVEQLGRLDIVVAN
FT                   AGIGNGGQTLDKTSEDDWRDMIDVNLSGVWKTVKAAVPHLLSGGRGGSIILTSSVGGLK
FT                   AYPHTGHYIAAKHGVIGLMRTFAVELGQHSIRVNAVCPTNVNTPLFMNEGTKKLFRPDL
FT                   ENPGVDDLAVAAQFMHVLPVGWVEPIDISNAVLFLASDESRYVTGLPVTVDAGSMLK"
FT   gene            complement(376113..376700)
FT                   /locus_tag="Mkms_0341"
FT   CDS_pept        complement(376113..376700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0341"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0331
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89558"
FT                   /db_xref="GOA:A1U9Q0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q0"
FT                   /protein_id="ABL89558.1"
FT                   /translation="MSAPRKPKADISARQRLIEATAKIMREEGYAAATSRRVAAEAGVK
FT                   QALVYYYFPTMDDLYVEVLRAGAEASLERMREALTADEPLHTLWTMNSDLRLTGLNTEF
FT                   MALANHRKAIRAELKSYAERVRDIETAAVAVALRERGVDLQEYPPTAVSMLIAQTARSL
FT                   CNESAVGVTLGHDEFRAFMERLLDRLTAGQDG"
FT   gene            376813..378090
FT                   /locus_tag="Mkms_0342"
FT   CDS_pept        376813..378090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0342"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0332
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89559"
FT                   /db_xref="GOA:A1U9Q1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q1"
FT                   /protein_id="ABL89559.1"
FT                   /translation="MTDLASVDFFSDPDISQNPYGYWDALREQGPVVREPHHGVVAVTG
FT                   YQEVLAAFRDHDHFSAVNAIGGPFPPLPFEPQGDDITEQIEAHRHLFPIHEHMVVMDPP
FT                   AHERARSLLSRLLTPRRLKENEDFMWQLVDQQIDQIIGNGRCEFLSEYAKPFATSAIID
FT                   LLGVPEDDRPEFLAALGAETRQGTRVGALDGESVGLDPLQYLDDKFAGYLADRRREPRD
FT                   DVLSGMATATYPDGSTPELMEVVKPATFLFAAGQETVTKLLSAAVQTLGDHPEYQDLLR
FT                   EDPRRIPTFIEEALRMHAPTKVDFRLVRKTTTLGDVHLPAGTIVMLCLGAANRDPLKFD
FT                   DPHEFRPDRKNVREHLAFGRGIHTCAGAPLARVEGVVTVRRLLDRLRDIGIDESVHGPA
FT                   RRRNYVYEPTFLLRGLTSLHIEFTPA"
FT   gene            complement(378087..378896)
FT                   /locus_tag="Mkms_0343"
FT   CDS_pept        complement(378087..378896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0343"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   mmc:Mmcs_0333 carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89560"
FT                   /db_xref="GOA:A1U9Q2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q2"
FT                   /protein_id="ABL89560.1"
FT                   /translation="MSHSAETNADAYERVRHAYTDVMGVAAPEPHSSAMARLYDFVFAE
FT                   VWQRPVLSRRDRRFITLACVAAADAETPLRDHVYAALSSGDVTIAEMQEMVLHFAVYAG
FT                   WPKASRFNMIVDELWERIHAERGHQLPSPEPLLPLTTPSDPEDRLAVGEQAFKDVNCLA
FT                   FAPTRDNPFSGAGILNFVFGEVWLRPGLGMRERRLITVTCVGFQDAPYPIVSHVYAALK
FT                   SRDLSFDEMDELALHFAAHYGWPKAAHLAEAIREQKQRVTAEWADTG"
FT   gene            complement(378880..379689)
FT                   /locus_tag="Mkms_0344"
FT   CDS_pept        complement(378880..379689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0344"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR; KEGG:
FT                   mmc:Mmcs_0334 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89561"
FT                   /db_xref="GOA:A1U9Q3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q3"
FT                   /protein_id="ABL89561.1"
FT                   /translation="MNERNGRVAGKRVVVTGAARGMGRSHAVRLAEEGADLILVDICRS
FT                   LPELEYPLATAEELDETGRLAETHGARVVTHVVDVRDGAALAAAVDDGVAQLGGLDAAV
FT                   ANAGVLTVGTWDTTTSEQWRAVVDVNLIGTWNTCAAAIPHLLEHGGSLVNISSAAGVKG
FT                   TPLHTPYTASKHGVVGMTRALANELAAKSIRVNTVHPTGVETGMRPDSLRGVLESRPDL
FT                   VPLFLNALPVVMADAVDISNAVLFLISDESRYVTGLEFKVDAGVTLR"
FT   gene            complement(379686..380516)
FT                   /locus_tag="Mkms_0345"
FT   CDS_pept        complement(379686..380516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0345"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   mmc:Mmcs_0335 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89562"
FT                   /db_xref="GOA:A1U9Q4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR023985"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q4"
FT                   /protein_id="ABL89562.1"
FT                   /translation="MGSLDGKVAFITGAARGQGRSHAVRLAADGADIIGVDICADIESN
FT                   GYPMATRDELDETVALVEAQGGKMLGSVADVRDFHALRTALDAGVEHFGRLDIVCANAG
FT                   IATMAFRELTIEEDLEMWNDVVDVNLVGSFHTAKAAIPHLIAGQRGGSIVFTSSTAGLR
FT                   GFGGLQGGGLGYAASKHGIVGLMRTLANALAPHSIRVNTVHPTAVNTMMAVNPAMTAFL
FT                   ENYPDGGPHLQNPMPVQLLEPEEISSAIAYLVSDEAKHVTGVTFPVDAGFCNKL"
FT   gene            380604..381212
FT                   /locus_tag="Mkms_0346"
FT   CDS_pept        380604..381212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0346"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0336
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89563"
FT                   /db_xref="GOA:A1U9Q5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q5"
FT                   /protein_id="ABL89563.1"
FT                   /translation="MGEPGDRSDDRLLAVVVEILDTDGYDAVQLREVARRARVSLSTIY
FT                   KRYATRDELILAALEAWMEDNRYSGVVPHPKASDASLHEALMDLFRTIFEPWEQHPGML
FT                   TAYYRARSSPSGQTLLQRGLDVVVPAGLELLADVDESFIDDLNAVVSSVVYGLLGRFST
FT                   GEIAITEILPTLDRAVYWLTTGYEAAKGSVAAVHTRDVR"
FT   gene            complement(381177..381866)
FT                   /locus_tag="Mkms_0347"
FT   CDS_pept        complement(381177..381866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0347"
FT                   /product="protein of unknown function DUF899, thioredoxin
FT                   family protein"
FT                   /note="PFAM: protein of unknown function DUF899,
FT                   thioredoxin family protein; KEGG: mmc:Mmcs_0337 protein of
FT                   unknown function DUF899, thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89564"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q6"
FT                   /protein_id="ABL89564.1"
FT                   /translation="MTTGITGLPPEVDQQTWRAALEDLRRREKAATRELDAIAAQRRRL
FT                   PMVRMPDYTLIGAEGPVRLADVFKGRSQLITYNHMWTDGQEWQCGGCTGFTSQFTRLEF
FT                   LDNYDARFVIVTNGPIEEALAYKDKVGNKMEWYSSSESSFGADVDAPPGGGFGVNVFLR
FT                   DGDTVFRTWHTNGRGTEQLSHTFALIDLLPWGRQEEWQDSPDGWPQRPTYSGWLDSPDI
FT                   ARMYGSH"
FT   gene            381915..383393
FT                   /locus_tag="Mkms_0348"
FT   CDS_pept        381915..383393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0348"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: protein of unknown function DUF222; SMART: HNH
FT                   nuclease; KEGG: mmc:Mmcs_0338 protein of unknown function
FT                   DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89565"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q7"
FT                   /protein_id="ABL89565.1"
FT                   /translation="MCARKSSPRFDFLAHARGLLETSFVTVVSIVTSPAVLSDPRTSVR
FT                   SMDGLSGAVDHLVASIAALQTASIDELSYEQIVAELDRIKAAVWAVPSVEHRLTARLMD
FT                   ADPHELGATSIKEVLANHLRISRKTAGDRLTDARQLGPRYTLTGERVQTELAHTADAVA
FT                   RGDIGTTHVRIIQEFVRKLPAWVSWERRDHYERDLVGHASALRPEDFRKVADTLLGFID
FT                   QDGTEPDHHTHQRRREFTVGRQQADGMSRVTGWLTPEARAHWDLIAAKYAAPGTNLPHD
FT                   DAHTGRDDRTTGQRHHDALTTVLRDAVTSGSLGQVAGVPASIVATMTLSELERAAGWAH
FT                   TGGGNRLPIRDLIRMAAHSRHYLAVFDDHTEEILYFGRARRTASTAQRLALFARDKGCT
FT                   HPGCTVPFYWTEAHHTHDYSRGGRTDIDDLTLACQPANLLIEKTGWTTHRPGNGRTEWT
FT                   PPADHDTGQPRINNHFHPHRYLTDNDDGQDDEPE"
FT   gene            complement(383430..384095)
FT                   /locus_tag="Mkms_0349"
FT   CDS_pept        complement(383430..384095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0349"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0339 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89566"
FT                   /db_xref="GOA:A1U9Q8"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q8"
FT                   /protein_id="ABL89566.1"
FT                   /translation="MPLATTRRAGLVDQVIAQLRASVSAGEWPVGTRIPTEPALVAALG
FT                   VGRNTVREAVRALAHSGILEVRQGDGTYVRATSEVSGAVRRLCGSELREVLEVRRCLEV
FT                   EGARLAATARTAEDLAEIRATLARRDALDARDEFVRADAEFHFAVVRASHNAVLTELYR
FT                   GLTEVVTASVATTVETHAFDRIPHDGLVEAIARGDVDRAGHEAGGFLEELIEELPDRR"
FT   gene            384142..385353
FT                   /locus_tag="Mkms_0350"
FT   CDS_pept        384142..385353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0350"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0340 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89567"
FT                   /db_xref="GOA:A1U9Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Q9"
FT                   /protein_id="ABL89567.1"
FT                   /translation="MKGHTRVDATAGQASEAGVRAAGGVLLTIAVILTALNLRPAITSV
FT                   GPMLGEMRTSMGASATWAGVLTTLPGLCFAAAGLTAPWLSRRFGLSRAISAALTILSAG
FT                   LLIRVLDGPYVVLGGTLVATAGIALTNVLIPVVIKGSFPTRVGLMTGVYTAALQGGGAL
FT                   GSAVTPGLEAVFDDWRTALASWAVVAVVALVFWILASRGIAGGQPSTTRVNGRSLLRNR
FT                   MAWTVTLFFGCQSLLAYVMMGWLPEVFIDSGVSKSTAGLLVGLMSLIAVPISIFVSPLA
FT                   ARSSSQSPWIVGLGTIGVAGVIGLLIDPGAAPLLWSILVGLGLSVFSLALTVIALRART
FT                   TEDTAQLSGMAQGFGYLLAGLGPFLFGLLHDVTDGWTVPWAMVLVVYLVQMTMGALAGR
FT                   NRYV"
FT   gene            complement(385355..385750)
FT                   /locus_tag="Mkms_0351"
FT   CDS_pept        complement(385355..385750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0351"
FT                   /product="putative alanine and proline rich membrane
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0341 putative alanine and proline
FT                   rich membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89568"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R0"
FT                   /protein_id="ABL89568.1"
FT                   /translation="MWTWWQARPPSYDAAAQAGAKDTACAAYTQVRTGVATNTHLASPG
FT                   GDDDVTGVLAVAANARVALMGGGQYLLDILDPATPPELADAVRQFAMKLMQFGAAATAG
FT                   APDSDPGQQAVKRDLDALTATLDGLCG"
FT   gene            385788..386477
FT                   /locus_tag="Mkms_0352"
FT   CDS_pept        385788..386477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0352"
FT                   /product="peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysin"
FT                   /note="PFAM: peptidase M15B and M15C, D,D-carboxypeptidase
FT                   VanY/endolysins; KEGG: mmc:Mmcs_0342 peptidase M15B and
FT                   M15C, D,D-carboxypeptidase VanY/endolysins"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89569"
FT                   /db_xref="GOA:A1U9R1"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R1"
FT                   /protein_id="ABL89569.1"
FT                   /translation="MTDRAVDRERAAPIGCGPGGMGEIVIRSRGAGRSWHGGGVGVWRT
FT                   VCRVSVAVGCACGVLFGAAPSHADPAEPGVDTLVGPAATDTFGGYLPEDGTLTAFDVEN
FT                   PIVGRLDPALLAAVQEASRAAAADGVEVEINSGWRSIGFQERLFEDGVRTYGSVEVARQ
FT                   FVASPQTSMHVVGRAVDVGGPGAAAWMSRNGPRFGLCQVYANELWHYELTADANGACPP
FT                   MKPNATG"
FT   gene            386537..387187
FT                   /locus_tag="Mkms_0353"
FT   CDS_pept        386537..387187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0353"
FT                   /product="FadD16"
FT                   /note="KEGG: mmc:Mmcs_0343 FadD16"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89570"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R2"
FT                   /protein_id="ABL89570.1"
FT                   /translation="MTTGVAGSLILTSDYRVADPSRVWPLLERRRAELAAIGAHHVFVH
FT                   TSISEPDRVLVTMALHTVEPVADLLRSHVFFDWFDAVGVADLPAVFAGELVDRFHIEPG
FT                   HHWTAKAPAVVIAGVTVVRDVDTLLGQVHRTRDLFRRNGIENVWIFRALDDPHEVMFLQ
FT                   DVADEASARRWLERPETAEKWLAEAGVGAYPPVFVGALRHVMRIDVAEHVNGP"
FT   gene            complement(387184..388464)
FT                   /locus_tag="Mkms_0354"
FT   CDS_pept        complement(387184..388464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89571"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R3"
FT                   /protein_id="ABL89571.1"
FT                   /translation="MSGDWVVGDHLGLPIPATAAALRDGGETFLTNAFRAFGALTEDNR
FT                   VVRIGRCDEMTGGSTGRKMLLDVEYARPEPGLRTDLFVKFSRDFDDPVRDRGRTQMASE
FT                   VVFAALSRTPGFPIAIPHPRFGDYHAGTGTGILITDRIPFGCNGVERQYEKCLDEDMPH
FT                   PDEHYRALVTALARLAGAQRSGRLPEQLSAAFPVDLRAATVGEPVTLSPDRLQRRLSRL
FT                   GEFTETHPGLLPPHVRTSGFLARLGEEAHEVLRREQAIWRSLRDADDHIALSHWNANVD
FT                   NAWFWRDGGGVLQCGLMDWGCVSRLNLAMALWGALCAAETDLWDNHFDELLVLFCTEVE
FT                   GAGGPRPDPVLMRRHLMLYMALMGITWLLDVPARIGNRLPDADVHTTRHDPRIRGDESL
FT                   RAPLQMFTNMLNLWQTRGLSGHLEGLD"
FT   gene            complement(388464..388730)
FT                   /locus_tag="Mkms_0355"
FT   CDS_pept        complement(388464..388730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89572"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R4"
FT                   /protein_id="ABL89572.1"
FT                   /translation="MPEHDMRAYDYEKMKKDAEPFIKFEKDVENRIAYITFDRPEAQNS
FT                   TTMGMRQNYADLIHKCNVDDDVKDNDLNFPPEWRLSRSGRNKP"
FT   gene            complement(388823..391093)
FT                   /locus_tag="Mkms_0356"
FT   CDS_pept        complement(388823..391093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0356"
FT                   /product="trehalose synthase"
FT                   /note="TIGRFAM: trehalose synthase; PFAM: alpha amylase,
FT                   catalytic region; KEGG: mmc:Mmcs_0346 trehalose synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89573"
FT                   /db_xref="GOA:A1U9R5"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012665"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R5"
FT                   /protein_id="ABL89573.1"
FT                   /translation="MSEAPETDYDDQAGSGTDDQTNEPSEITYDEYLHPARPRALRFRP
FT                   RVKSPFTRRSVAQDGPARADNPAYVSWLLSQSMLADANEISQQFSGQGSMWQNPYATPS
FT                   PRGAVETASVWFTAYPLSLITRPNESFLKALADDEMWKAFADIGIEAIHTGPVKRAGGI
FT                   SGWQTTPSVDGHFDRISTEIDPAFGTEEEFRKMCGTANWYGGTIIDDIVPGHTGKGADF
FT                   RLAEMKYADYPGIYHMVEVDPRDWEHLPAVPPGVDSVNIDQATEEWLDKAGYIIGRLQR
FT                   VIFYAEGIKETNWSVTRPVLGVDGVERRWVYLHYFKDGQPSINWLDPSFAGMRLVIGDA
FT                   LHSLADLGTGGLRLDANGFLGAEKTAAEDSTAWSEGHPLSEAANHLIASMVRKVGGFTF
FT                   QELNLTIDDIRQIGEAGADLSYDFINRPAYQHALATADTEFLRLTLRTTLELGVDPASL
FT                   IHALQNHDELTYELVHWSNGHRDDIYTYKGEEITGEALGETIRRDLSVRLTGENAPYNL
FT                   VFTTNGIACTTATVIAATLGITDLDEIDDDPVRIDRIRRAHLLLAMFNALQPGVFALSG
FT                   WDLCGMLTLPAGQVGELLRGGDTRWIHRAAHDLMGVNPGATQSLAGMPRGRSLYGSIPD
FT                   QLDDETSFLRQLQAILRVRSHYGIATSRQVDIPEVSHRGMLVLVHQLADEGRYQLTVLN
FT                   FANEEVAGTVRSEALPPGAEVSDMFTGHAFATVDDLHSFTVEMPAHHGMSLLVEVTADD
FT                   SET"
FT   gene            complement(391273..392652)
FT                   /locus_tag="Mkms_0357"
FT   CDS_pept        complement(391273..392652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0357"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   mmc:Mmcs_0347 aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89574"
FT                   /db_xref="GOA:A1U9R6"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R6"
FT                   /protein_id="ABL89574.1"
FT                   /translation="MTLTNETTLPNGLSVDDARAEAARAYELDRKHVFHSWSAQAEISP
FT                   MVITAAQGSYIWDGEGRRLLDFSCQLVNTNIGHQHPKVVAAIQAQAAKLCTVAPQHAND
FT                   ARSEAARLIAERTPGELNRIFFTNGGADAVEHAVRMARLHTGKYKVLSRYRSYHGGTET
FT                   AINLTGDPRRWPNDHGNAGVVHFFGPFLYRSQFHATTEAEESARALAHLEDIVRLEGPS
FT                   TIAAIVLESIPGTAGIMVPPPGYLAGVRDICDRYGIVMIADEVMAGFGRSGKWFSIDHF
FT                   DVTPDLLTFAKGVNSGYVPLGGVAIGPAIAETFAHRPYPGGLTYSGHPLATAAAVATIN
FT                   AMEEEDIVGNAARIGAEVLGPGLAELAARHPSVGEVRGTGVFWAIELVANPQTREPLAP
FT                   YGASSAAMNAVVAACKANGLLPFANFNRIHAVPPCTVTADEVREGLAILDQALDVADSH
FT                   L"
FT   gene            complement(392739..394232)
FT                   /locus_tag="Mkms_0358"
FT   CDS_pept        complement(392739..394232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0358"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: aldehyde dehydrogenase; KEGG: mmc:Mmcs_0348
FT                   methylmalonate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89575"
FT                   /db_xref="GOA:A1U9R7"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R7"
FT                   /protein_id="ABL89575.1"
FT                   /translation="MANTVQHWCNNDVFAGGSQATAPVTNPATGEVTGQVALAGVEDAR
FT                   TVIEAAAAAFPAWRDTSLAKRTSVLFNFRELLNARKHELAAIITAEHGKVLSDALGEVS
FT                   RGQEVVEFACGIPHLLKGGFTENASTNVDVYSIRQALGVVGIISPFNFPAMVPMWFFPV
FT                   AIATGNTVVLKPSEKDPSASLWLARLWKEAGLPDGVFNVLQGDKTAVDELLTHPKVKAV
FT                   SFVGSTPIAQYVYATGTAAGKRVQALGGAKNHAVILPDADLDLAADAMVNAGFGSAGER
FT                   CMAISACVAVGPIADDLVAKIGERARALRTGDGTKDSDMGPLVTKAHRDKVASYIDAGE
FT                   ADGAKVVVDGRQVSADGGENGFWLGPTLLDNVTPEMSVYTDEIFGPVLSVVRVETYDEA
FT                   LELINSNPYGNGTAIFTNDGGAARRFQNEVEVGMVGINVPIPVPMAYYSFGGWKNSLFG
FT                   DSHAHGTEGVHFFTRGKAITQRWLDPSHGGINLGFPQNN"
FT   gene            394313..395941
FT                   /locus_tag="Mkms_0359"
FT   CDS_pept        394313..395941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0359"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix, Fis-type; purine catabolism
FT                   PurC domain protein; KEGG: mmc:Mmcs_0349 purine catabolism
FT                   PurC-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89576"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R8"
FT                   /protein_id="ABL89576.1"
FT                   /translation="MTMTVADVIGLPVVARGEPEVLSARRWEDPIRWVHVGDVADLSAL
FT                   LQGGELVLTTGAGLAADPRRYLQGLADAGAVGVVVELGTAMTAVPQWVVAHAERLDLAL
FT                   VALHRQIKFVAVTEVVHRRIVAAQYDEVAFDRRVHETFTELSMKRASPAGIVDAAARIL
FT                   GEPVVLEDLAHQALAVAPGGDAAATLLQNWERRSRASAADGDWAVTSVGPRGEEWGRLI
FT                   VPAAPPDRARATMVLERAAAALALHRMIERNRSGLHQQAQSGLIDDVVAGRITDEREAA
FT                   ARAHALGLRRSARYLPLVVRVDRGAVTMDPVVAQRRNVELLDAVAHTVNAAGHTALCSI
FT                   RRDGEIGALVALDPGRGGWDRALTALGERVHAEVRRRDGGARSEGRSVCAVGDPAAEIV
FT                   EAIHGLGEAAHVGEVAIAMHGHGQAVYRASDVRLRGLIALLRDDPRVQQFAETELRALL
FT                   LDDDERVPSNLEVLRQYLQVAGNKAALAQRLHMSRPALYKRLAAIGRTLGVDLDDAESM
FT                   TSLHVAVLILDAQRRAAPAVLTRGG"
FT   gene            396121..400293
FT                   /locus_tag="Mkms_0360"
FT   CDS_pept        396121..400293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0360"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: mmc:Mmcs_0350 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; Stage II sporulation E family protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein;
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89577"
FT                   /db_xref="GOA:A1U9R9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9R9"
FT                   /protein_id="ABL89577.1"
FT                   /translation="MGVEEAGAASLTSSASALFGADPEVGRHLAMVDWASTALGDPTAW
FT                   PQSLRTAVNILLSSRFPMWMAWGPELTFFCNAAYRRDTLGRKYPWALGRPASEVWAEIW
FT                   PDIGPRIESVLSTGRATWDSALLLFLERSGYSEETYHTFSYSPLRDDGGQVVGMLCVVS
FT                   EDTERVIAERRMTTLRDLGSDPSVVRTERQMLDFAAEQLGRNRHDLPFTLTYLFGDDGD
FT                   AVLAASSGITPGHAAAPETLSADGMSVWPVRQPAEGETVLLEIDGESLALPRGVWPDPP
FT                   TQALVVPLLQQGADPVGFLVAALNSHRRLDAPYRGFIELVAGHIAAGIGSARSYGAQQR
FT                   RAEELAELDLAKTTFFSNISHEFRTPLTLILGPLAEMLRTSELDVRVREELELAHRNGL
FT                   RLAKLVNTLLDFSRIQAGRMRAQFEPVDLAAVTAELASVFRSAIERAGLEFTVDCPPLA
FT                   EPVFVDRDMWEKVVLNLLSNALKFTREGAVTVRVTADDGVAVVTVADTGVGIPEAEMPR
FT                   LFERFHRVETVDARSTEGSGIGLALVKELIGLHGGTIGAQSEEGRGTTFTIQMPFGAAH
FT                   LPADEVVPHGRVSGVSANADPYLQEALRWLPASDPESDSRDPIAAPVPATGGSGTGTAV
FT                   PARILIADDNADMRAYLTGLLRGAGYEVTAVSDGRQALESIRAELPDLVVSDVMMPGLD
FT                   GLELVAALRAESRTAALPVLLLSARAGQESSIEGLHAGADDYLVKPFAAAELLARVHAN
FT                   VALARLRNHHSRWRTALIDSLQEAFFVCDEDGAVVEINAAFSQILGYGPEGLPYQPVQP
FT                   WWPDPDTDPEGYRQTSQAFGGVMGQSRGEFTFPVVHRDGHRLWVNANFNPARDPDTGRR
FT                   VAVGTFRDVTAEHYIVQREMALAALNAQLAEADTLDGALRAAVAELHRLWQARRVLAVT
FT                   FPGADGDVTPDVICAGEAVQWSDLPAGQRDTITALRTADLLTADTEEYGTAGITLQHPR
FT                   GVLVLWIELLEQRPFTPEDRTLLTVLAGRLGQGLQRVHRLDQQRETALTLQHAILGPAR
FT                   LPGGFAVRYHPATRPLQVGGDWYDVVDLDGDCIALVVGDCVGHDLEAATVMGQLRSACR
FT                   ALLLDQPSPGAALAGLDRFAARLPGARCTTVWCAVLSPETGELVYSSAGHPPPILVGPD
FT                   DGHRVLDDARGFALALRPDQERPEARVTLSARTTLLLYTDGLVERRRASLETGIGRAAD
FT                   LVADGRSDALDAVADQLMSRLAPDGGYQDDVALLLYRQPAPLDLVFPARNEYLASSRTA
FT                   LRRWLTKAGVGPDQAMNVLIAAGEAVANAIEHGHRDRPDGRVTLRATAMVDRLQVSILD
FT                   TGSWKTPRTEVDTRRGRGVALMEGLMDDVTIRPGDDGTTVHLEAGIL"
FT   gene            400293..400625
FT                   /locus_tag="Mkms_0361"
FT   CDS_pept        400293..400625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0361"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mmc:Mmcs_0351 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89578"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S0"
FT                   /protein_id="ABL89578.1"
FT                   /translation="MATPLTVNADRHTDGTPLLVAAGEIDLSNVETFTRALITVIAAAD
FT                   GAGGTVTVDLSAVEYLDSAAIGALSVHADQVPQMRLVANPYLIPVLRISGIDQLATVEP
FT                   AQPTDG"
FT   gene            400636..401799
FT                   /locus_tag="Mkms_0362"
FT   CDS_pept        400636..401799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0362"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: mmc:Mmcs_0352
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89579"
FT                   /db_xref="GOA:A1U9S1"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S1"
FT                   /protein_id="ABL89579.1"
FT                   /translation="MIGWFDRLQQRSRAMGYVIAVVYKYVDDQGGYLAALITYYAFVSL
FT                   FPLLLLLTTALGVVLVGRPELQRQIVESTVNQFPLIGEQLAQPEQLSGGAVAVVVGILG
FT                   ALYGGSGVGQAVQNAMNSVWAVPRNVRPDPIRSRVRSLLLLLVLGSAAIAATLLSAVGR
FT                   AVDDLGVLGTAGVVVGTIAINTGILLVAFRTTTSRELTYRQVLPGALAGALIWQFLQWF
FT                   GAGYVARTVSSASATNTVFALVLGLLAFLYLISVSLVLCAELNVVRVDHLYPRALLTPF
FT                   TDSVTLTSADRRTYTRKAKAERVKGFQHVAVTFRPSRSHSHEGLDPAAGEVEEEAGGHD
FT                   PQQRADLAGLPGAGADDHPRDEPDTDSVGDGVGERHGGDGEDDRQRH"
FT   gene            complement(401590..403005)
FT                   /locus_tag="Mkms_0363"
FT   CDS_pept        complement(401590..403005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0363"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   mmc:Mmcs_0353 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89580"
FT                   /db_xref="GOA:A1U9S2"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S2"
FT                   /protein_id="ABL89580.1"
FT                   /translation="MNRLDRFFEISARGSTLGAEVRGGLVTFIAMAYIIVLNPIILSSS
FT                   DDVEGNSLQFAQVSATTALAAGVMTILFGLIARLPFAFAAGLGINSFLATTVVGDVTWP
FT                   EAMGLVVINGLIIVLLAVTGLRRLVFDAVPMQLKLAITAGIGLFILFIGLVDAGFVNST
FT                   GLASPPVGLGAGGLGSINTVPTLIFVITLLVTGVLVARRVRGGILIGLVAGTVIAVVVE
FT                   AIWDLGSAQDKAGGWSLSVPQLSGSPFALPDLSLVGEFSLTGAFERIGILAAVMLVFTL
FT                   VFANFFDAMGTFTGLSREAGLSDDRGTFPRLRSALIVEGAGAAVGGASSASSNTVFIES
FT                   GAGIEEGARTGLANLITGALFLAAMFVSPLASIVPTEVAAAALVVVGAMMVSHLRHIEL
FT                   SEFSVALPVVLTVAAMPFTYSIANGIGVGFISWVVVRSGAGKAREISPLLWVVAAGFLF
FT                   YFARSWIETLMGV"
FT   gene            403080..403994
FT                   /locus_tag="Mkms_0364"
FT   CDS_pept        403080..403994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0364"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; KEGG: mmc:Mmcs_0354
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89581"
FT                   /db_xref="GOA:A1U9S3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S3"
FT                   /protein_id="ABL89581.1"
FT                   /translation="MATAHSRTRDEVRLGADQLAALAAVIEFGSFDAAAEHLHVTPSAV
FT                   SQRIKALEQRVGQVLVVREKPCRATASGIPLLRLAAQTALLEAEALGELGGPGAALVPR
FT                   VAVAVNADSMATWFTAVLGDVSEVLFDIRIEDQDHSARLLREGVVMGAVTTERSPVPGC
FT                   RVQSLGVMRYLPVASAGYVERYLPDGFTAVAAAHAPSLAWNRDDALQDMLIRRAFRRAI
FT                   TRPVHYVPTAEGFGAAVRAGLGWGMYPEQLAVPELAGGSLVRVADVHLDVPLYWQCWKL
FT                   DSPLVARLTGAVRSAAAGLARRR"
FT   gene            complement(403999..405210)
FT                   /locus_tag="Mkms_0365"
FT   CDS_pept        complement(403999..405210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0365"
FT                   /product="sulfide-quinone oxidoreductase"
FT                   /EC_number="1.8.5.-"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0355 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89582"
FT                   /db_xref="GOA:A1U9S4"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S4"
FT                   /protein_id="ABL89582.1"
FT                   /translation="MDPTAEPADRCFDVLVVGGGNAGVSAAARLIRKGVTDVALIEPQR
FT                   VHTYRPLLSYVGGGQAAMRDAERTQRSVTPRRCTWLQDAAAMIDAPNRTVSCSSGRRYR
FT                   YRDLILGTGLVPDTDALPGIHTALDTPAVASNYVDRAEETWQLVQAMPPSGRAVFTVPR
FT                   PPVSCTATTLKPLFLAAAHWKRTGRFPGVDITLVVDRPHLLPAPRIDDRLRDHLRALEV
FT                   RVLFDTAVTALSPDQRNITVTGRDGSSETLPYDMLHLVPPFRGVRWLEGSGLTNGRPHG
FT                   LIDIDPETLRHRTHPEIWAAGDAAAVETDPSGGALRRQVSILVENLLAAREGGDLQRYD
FT                   GYTVAPVTTDAHHLIPGEYDRTGSVASSLPSFVDPLESRRTAWAFDRYVLPRTYWNLIL
FT                   RGRV"
FT   gene            405328..406413
FT                   /locus_tag="Mkms_0366"
FT   CDS_pept        405328..406413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0366"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: mmc:Mmcs_0356 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89583"
FT                   /db_xref="GOA:A1U9S5"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S5"
FT                   /protein_id="ABL89583.1"
FT                   /translation="MHWFRRWWRQPDHFDWITGYLAARGMLGVARWNLASSTVALALVP
FT                   AVLAMSSRGPDAGPDQVLSRIAVLGGLCAATLWVVRWPTRAQSVAYILAANLFITLACY
FT                   VQDDPMVGLMGCTVFATTGGYIALFHTPGYMLYNFGVALYVGVLQTVRLAVETSDPALA
FT                   VGLLLLVLVLNVAVPFAVQAIVHALGVDLLRAARDPLTGLLNRRAVYQQIEQLLSSHRD
FT                   RHVHLAVAVVDLDDFKQLNDSHGHAIGDEALVAVAQALRAGAGEGAVVGRLGGEEFVLA
FT                   ELLEAGQIDHWAQRMCTAVDVVPFPVTASVGVAAVCLPLPADDDAQTVIHMLIGAADHA
FT                   MYAAKRAGGNQFRHDDRSACC"
FT   gene            406427..407116
FT                   /locus_tag="Mkms_0367"
FT   CDS_pept        406427..407116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0367"
FT                   /product="4-amino-5-aminomethyl-2-methylpyrimidine
FT                   deaminase / thiaminase"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: mmc:Mmcs_0357
FT                   transcriptional activator, TenA family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89584"
FT                   /db_xref="GOA:A1U9S6"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S6"
FT                   /protein_id="ABL89584.1"
FT                   /translation="METPDESTTNTWSQRLWHETEPIFSAIMAHPFISGLTDGTLDPEV
FT                   FAHYVAQDVHYLRDYARALAVVGAKAPRLADTAMFARHSAEIVEVELSLHETLLPEIGL
FT                   DPAELDRVPVAPTTRAYTSYLLATVYGGSFADGLAAILPCYWIYARVGEELIGRGSPDS
FT                   RYQRWIDSYGGDEFAATVKEVLELTDRVGPTLKPAEEAAARAHYVTTARYEWMFFDAAH
FT                   RREAWPV"
FT   gene            407119..407769
FT                   /locus_tag="Mkms_0368"
FT   CDS_pept        407119..407769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89585"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S7"
FT                   /protein_id="ABL89585.1"
FT                   /translation="MAPHSFDAPVRRWEDIPGWFGWRQAQEEAVAHFGDGDRFSAPRFV
FT                   APRFVEVGSYLGRSLCSLAEVVRQSGREIGIVGVDTCRGSGPEGAREINAHGPAVEFGG
FT                   GTFAGLLHRNVIACGFADTVALLITDSVSAARMFDDESLAWVHIDARHDYESVRADIAA
FT                   WAPKVGPGGWLSGDDYHPEWWPGVVAAVEEALPDAREWTPGQWRWRKPPASDR"
FT   gene            complement(407870..408325)
FT                   /locus_tag="Mkms_0369"
FT   CDS_pept        complement(407870..408325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0369"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: mmc:Mmcs_0359 anti-sigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89586"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S8"
FT                   /protein_id="ABL89586.1"
FT                   /translation="MTLTSTSTGSHSAFHYGNPSFDCDRVRMRARCRQLATVVTVTGDI
FT                   DADNLSCVADYARRFVLAEKPFILDLSGVSTFAAEGLSLFYEIDARCAEADVEWSVIGS
FT                   QPVLQVLRASGTLDDMPVTASVPEALHHFSEGILARRRLLPLLTKTA"
FT   gene            complement(408478..409782)
FT                   /locus_tag="Mkms_0370"
FT   CDS_pept        complement(408478..409782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89587"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9S9"
FT                   /protein_id="ABL89587.1"
FT                   /translation="MADMAGPRAQGLTLDIAGRTLTVTHPDKVVFETHQGRPPISKLDL
FT                   IEYYLAVADGALRGVADRPMILKRFVKGITEEAVFQKRAPAKRPDYVDVAELKYASGTS
FT                   AKEAVIHDAAGLAWAVNIGCVDLNPHPTRSGDLAHPDELRVDLDPMPGVDWQQIVAVAM
FT                   VAREVLEDHGLTAWPKTSGSRGFHIYARIEPRWPFKFVRLAAQTIAREVERRAPDLATS
FT                   RWWKEEREGVFVDFNQNAFDRTVASAYSVRATPDARVSTPLRWDEVPGCRPEAFTVATV
FT                   PARYAEIGDPWESMDDHPGRLDALLDLADRLGPAEKAPRGAKRQGAGATGRRQSVMPLI
FT                   EIARTKTKDEALAALDTWRQRHPAAAERLQPPDVLVDGMRGPSSIWYRIRINLRHVPEE
FT                   QRPPQEPLLADYSPWENYTGPQWASQSRHGPDTDR"
FT   gene            409840..411573
FT                   /locus_tag="Mkms_0371"
FT   CDS_pept        409840..411573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0371"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mmc:Mmcs_0361 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89588"
FT                   /db_xref="GOA:A1U9T0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T0"
FT                   /protein_id="ABL89588.1"
FT                   /translation="MPKLTELPSQVAAKAKLYLDRGSAELHYARKMFEAGALQLEPPQN
FT                   MAAFVADMRRWGEFGMIPALNARRTPDRNAVIDDEGEMTYAELDEAAHAVAHALLAKGI
FT                   KGGDGVAVLARNHRWFLVAVYGAARTGARIILLNSEFSGPQIKEVSEREGAKLIIHDDE
FT                   YSKAVSQAKPELGYLRALGTNPDNSEPSESDAQTLADIVAGGDKAPAPKVTKHSSVIIL
FT                   TSGTTGTPKGANRKPPMSLAPIGGILSHVPFKSGEVTLLPAPMFHALGYLHATIGMMLG
FT                   STLVLRRRFKPATVLADVEKYRATAMVVVPVMLSRLLDHIEKTDTKPDLSSLRIVFVSG
FT                   SQLGAELATRAMKDIGPVIYNLYGSTEIAFATIARPEDLQKNPATVGPVVKGVRVKLFD
FT                   ENGKEVPRGEVGRIFVGTTFPFEGYTGGGHKQIIDGLMSSGDVGYFDEDGLLYVSGRDD
FT                   EMIVSGGENVFPAEVEDLISGHPDVVEATALGVEDKEWGHRLRAFVVKAEGASVDEDAI
FT                   KGYVKEHLARYKVPREVVFLDELPRNPTGKILKRELREMDVDGSDGSDGSDGSGGDTKA
FT                   E"
FT   gene            complement(411577..411885)
FT                   /locus_tag="Mkms_0372"
FT   CDS_pept        complement(411577..411885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0372"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89589"
FT                   /db_xref="GOA:A1U9T1"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T1"
FT                   /protein_id="ABL89589.1"
FT                   /translation="MTNDVEKRWHDPQAFHSAVTYVVAVIAVAGVCFAFYAIPDDHSLI
FT                   AAILVPVVLFAGGVGAFIQTYRVWKFRGTWPIWHGAGWFLFMLFLLCLSVPGSALTD"
FT   gene            411946..412851
FT                   /locus_tag="Mkms_0373"
FT   CDS_pept        411946..412851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0373"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   mmc:Mmcs_0363 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89590"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T2"
FT                   /protein_id="ABL89590.1"
FT                   /translation="MGDASVRSRIRAGLLAYAAGDAAGVPWEGCLAAEIDRPGIDELPR
FT                   RGDWPPGATSDDTALTLLVAEYLRDRGAVVEEADFLTRLAAAAPHIRGIGPSTRAAVDR
FT                   FRTRGALHAETGDTNGAAMRALPIGWAVADDGLRRTVTTGLSRTTHGAASAVAAACIAS
FT                   AMASAAVDGSSLFDAAATEIDWAETQFGIELRPVRDAVDGRWRPGRNGVSLEAVGAVAA
FT                   VVDVVRHADVGHLSVADALRYAVSLGGDTDTAAAIAGGILGGRVTGTPDIPWLDRVDLP
FT                   DGATLDGLSAALAELRASTG"
FT   gene            complement(412811..414097)
FT                   /locus_tag="Mkms_0374"
FT   CDS_pept        complement(412811..414097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0374"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0364 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89591"
FT                   /db_xref="GOA:A1U9T3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T3"
FT                   /protein_id="ABL89591.1"
FT                   /translation="MWRTVPILMALYFVNYLDRTNLGIARADISAHLQLSATMFGFASG
FT                   IFFIGYVLVEVPSNLALHRFGARRWLARIAVSWGLVVVAIGFAPNAPTLLALRFLLGVA
FT                   EAGLFPGVILYLSRWFPTAYRARVVAMFMLASPIAAAVGTPVGAWLIDVGDGLFGLAGW
FT                   QFMMICSGLPAIALGVVCWIALTDRPADANWLPDDEKRWLIGVLAAEEHAVSSRFDFPL
FT                   RRALRSPRVWALAVVYFGVAYGLYALAFFLPSIIAGFREDFGLTLSIEQVGLITAIPYA
FT                   FAAVAMYLWSRRADRTGAHTRHVAVPMLLGGLAIPVALYLDSPVLVMIPVTLAAMGVFS
FT                   AIPSFWALPSRFLTGAAAAGGIGLINSVGNLGGFAAPYVTGALDDALGSARAGMWAVGL
FT                   MMVISAGVVFTLSNDRLSPSTPATPPARR"
FT   gene            complement(414184..414477)
FT                   /locus_tag="Mkms_0375"
FT   CDS_pept        complement(414184..414477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89592"
FT                   /db_xref="InterPro:IPR025242"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T4"
FT                   /protein_id="ABL89592.1"
FT                   /translation="MTVDYDAPRRKQEDLESDSLDELPVGRADARTAVLDDDAEEVDTV
FT                   DLPGADLSGEELTVRVIPKQADEFTCSSCFLVFHRSRLARDSNGTMICADCA"
FT   gene            complement(414579..416771)
FT                   /locus_tag="Mkms_0376"
FT   CDS_pept        complement(414579..416771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0376"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   mmc:Mmcs_0366 acyl-CoA dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89593"
FT                   /db_xref="GOA:A1U9T5"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T5"
FT                   /protein_id="ABL89593.1"
FT                   /translation="MPIAITEEHNDLADSVRSLVARVAPSEMLHDALENPIPNPPPFWR
FT                   AAAEQGLQGVHLPESVGGQGFGILELAIVLAEFGYGAVPGPFVPSAIAGALIAAHDPDA
FT                   KVLSGLASGDVIAAYAIDSGLTATRHGDGLVIRGEVRAVPAAAQASVLVLPVAIDSSDE
FT                   WVVLDAGQLEIEPVASIDPLRPVAHVRANAVDVADDRVLSNLTPALARALIVTLLSAEA
FT                   IGVARWATDTASGYAKIREQFGRPIGQFQAIKHKCADMIAQTERATAAVWDAARALDEV
FT                   RENVTDEPHFEFAAAVAATLAPTAAQHCVQECIQVHGGIGFTWEHDTNVYYRRALVLAA
FT                   AFGRRADYPQHIVDTATTTGMRPINIDLDPDTEKLREEIRAEVAALKALPREERTVAIA
FT                   EGGWVVPHLPTPWGRGAGPVEQILIAQEFAAGRVKRPQMGIAAWLIPSIVAFGTDEQKQ
FT                   RFLPPTFRGEMIWCQLFSEPGAGSDLASLTTKATKVDGGWRVTGQKIWTTGAQYSQWGA
FT                   LLARTDPNAPKHNGITYFLLDMNSEGVEVKPLRELTGNAMFNTVFIDDVFIPDELVVGE
FT                   VNRGWEVSRNTLTNERVSIGSSEPPFLATLDGFVEFIRDGHFDQIGQNKAGQLIAEGHA
FT                   AKLLNLRSTLLTLAGGDAMPSAAISKLLSMKTGQGYAEFAVSSFGTDGVLAEPESLEFK
FT                   WVEYLLGSRATTIYGGTSEVQLNIIAERLLGLPRDP"
FT   gene            complement(416831..417448)
FT                   /locus_tag="Mkms_0377"
FT   CDS_pept        complement(416831..417448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0377"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0367
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89594"
FT                   /db_xref="GOA:A1U9T6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T6"
FT                   /protein_id="ABL89594.1"
FT                   /translation="MGQVRPYRGVEAPERLAQRRQRFLEAGLDLLGSAEQDLAELTVRA
FT                   ICRRAGVTVRYFYECFTDKDDFVAAVFDWVINGIATTTQAAAAAAPPRAQSRAVMTDII
FT                   RTVSEDPRIGRLLFSSQLSNTVVVRKRAESGALFAMLSGRHASAALRQSENDRIKAAAH
FT                   FVVGGVGQTISAWLAGSFALDPDGLVDQLTAMVDQLADPRLY"
FT   gene            417523..418434
FT                   /locus_tag="Mkms_0378"
FT   CDS_pept        417523..418434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89595"
FT                   /db_xref="InterPro:IPR018713"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T7"
FT                   /protein_id="ABL89595.1"
FT                   /translation="MTVSEPLPHVERPVSAPAHPDKLTPPPALARRAASMEDGLMGVAL
FT                   LAGPANVIMQLARPGVGYGVLESRVESGRVDLHPVKRARTTFTYLAVATRGSDAQKAAF
FT                   RRAVNKAHAQVYSTDESPVKYHAFDKDLQLWVAACLYKGAVDVYRLFVGEMDDQAAEEH
FT                   YRDSMTMGTTLQVPPEMWPADRAAFDKYWQESLDKVHIDDTVREYLYPIAASRLRGLKL
FT                   PGPLQRRNEELALLITTGFLPQRFRDEMRLPWDADRQRRFDRLIGVLRTVNHLLPRFIR
FT                   QFPFNVLLKDLDRRIRTGRPLI"
FT   gene            418451..419353
FT                   /locus_tag="Mkms_0379"
FT   CDS_pept        418451..419353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0379"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0369
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89596"
FT                   /db_xref="GOA:A1U9T8"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U9T8"
FT                   /protein_id="ABL89596.1"
FT                   /translation="MRHDNDSWDITTSVGSTALFVAASRALEARKPDPLAVDPYAEVFC
FT                   RAAGGDWAGLFDAGADPKPDHVLFSEFGEQFVNFQGARTRYFDAYFAAASDAGVRQVVL
FT                   LAAGLDSRAYRLPWPDGTVVYELDQPRVLEFKREVLAERGEQPVAQRREVAVDLRDDWC
FT                   AALTAAGFDPARPSAWLAEGLLMYLPATAQEALFSGIDALSAPRSWAAVEESVPMPAEV
FT                   FAYKREEERAAGEEGTFFTLVYNERHAPAERWFGERGWAAEPTSLADYLTRVGRPAPVD
FT                   DPEFGAMISAIRLVTATKG"
FT   gene            419549..421333
FT                   /locus_tag="Mkms_0380"
FT   CDS_pept        419549..421333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0380"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: mmc:Mmcs_0370 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89597"
FT                   /db_xref="GOA:A1U9T9"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023835"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9T9"
FT                   /protein_id="ABL89597.1"
FT                   /translation="MVSRFATCCRALGLTVNDRQRPADVSAARTGFAALTHIAHDQCDA
FT                   WVGLAAAGDVSARVVEAIWSTRHSAGALQRHLEMAPGALGFHYDSGLYLQFRATDGDDF
FT                   QLAYAAALCDNGAYADADALVGELIERRPGWPQARWLRVAIHHRTQRWSDVVRLLTPVV
FT                   NDPSLDATYAHAARVTLGIALARLGMFAPAMSYLAEPAGPIAVAAVDGGLAKGLTLRAQ
FT                   GEEEDAADALQELYAANPENAEIEAALTDPTFGLVTTTAARIEARSNPWDPETEPSESD
FT                   FVDPGAKDRKAHLLVEAEAELADFIGLEEVKYQVARLKSSVAMSIRRQERGLAVAQRTN
FT                   HLVFAGPPGTGKTTIARVVAKIYCGLGLLRKETVREVHRADLIGQHIGETEAKTNAIID
FT                   AALDGVLFLDEAYALVSTGAKNDFGLVAIDTLLARMENDRDRLVVIIAGYRKDLDMFLD
FT                   ANEGLRSRFTRSIDFPSYSPGELVEMAVRMAEKRDSVFEPAAHDDMEKLFAQLAESSSP
FT                   DANGVDRRSLDIAGNGRFVRNLVERSEEEREYRLDHSGDHSAEADDFTDEELMTITVDD
FT                   VRKSAEPLLRGLGLTVSA"
FT   gene            421330..422880
FT                   /locus_tag="Mkms_0381"
FT   CDS_pept        421330..422880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0381"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690; KEGG:
FT                   mmc:Mmcs_0371 protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89598"
FT                   /db_xref="GOA:A1U9U0"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="InterPro:IPR042485"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U0"
FT                   /protein_id="ABL89598.1"
FT                   /translation="MTTPDDRRSFSSRTPANENPERITYRRGFVTRHQVSGWRFVMRRT
FT                   ASGVALHDTRMLVDPLRTQSRAVLTGALILITGLAGCFVFSLIRPAGSAGTDTVLADRS
FT                   TAALYVRIGEQLHPVLNLTSARLIAGRADNPTTVKTSEIDQFPRGNLVGIPGAPERMVQ
FT                   NDSRDAEWTVCDASSGANAGVTVLGGPVASGGERARPLADDQAVLVSGDAGAWLLWDGR
FT                   RSPVDLANRAVTDALGFGATPTTPRPIAAGLFNAIPEAPPLAAPPIPDAGAPPRFPLPV
FT                   AAPVGAVVAAFEADNTIRYYAVLPDGLQPVPQVLAAILRNTNSYGLNQPPRLGADEVSR
FT                   LPVSQLLDTDAYPADPVTLVDPAADPLTCAHWSKAADAEQSSLGLLSGAALPMPEGMRT
FT                   LDLVGGGNGVTANRVALTSGRGYFVQTVGQEPGSPTAGSLFWVSDTGVRYGIEPGENGQ
FT                   TIAALGLTAAPVPAPWSVLAQFAAGPTLSRDDALLAHDALTRDPNPARLENLTLQENP"
FT   gene            422877..426842
FT                   /locus_tag="Mkms_0382"
FT   CDS_pept        422877..426842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0382"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0372 cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89599"
FT                   /db_xref="GOA:A1U9U1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR023836"
FT                   /db_xref="InterPro:IPR023837"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U1"
FT                   /protein_id="ABL89599.1"
FT                   /translation="MSRLIFEAHRRVPPPATRKGTITIEPPPELPRLVPPSLLRRVLPY
FT                   LIVLLIVGMIVALIATGMRLISPTMLFFPFVLLLAATAMYRGTDNKMRTEEVDAERADY
FT                   LRYLSVVRDNVRAHAAEQRAALEWSHPSPDVLATIPGTRRQWERDPRDADFLVLRAGLH
FT                   DTPLDTTLRVKDTADEIDLEPVSHTTLRGLLDVQRTVRDAPKGIDVTKVSRITVFGEAD
FT                   EVRGALRAWIAQAVTWHDPSVLGVALAAPDVDGDDWSWLKWLPHTDIPGEADGVGPARY
FT                   LTTDIEALRAALAHVLADRAAFPGDPDRALRHLLVIVDDPDADVEDLIRSPGLAGVTVV
FT                   HRIATPPHREQYPNPERPILRIADGRIERWQTGGWAPYVDTADTMGAADARHIARRLSR
FT                   WDSNPSHARSTTTGGSTFTTLLGIPDASALDVASLWAPRSREEELRVPIGVTATGEPLY
FT                   FDLKDEAEGGMGPHGLMIGMTGSGKSQTLMSILLSLLTTHSAERLNVIYADFKGEAGAD
FT                   IFRDFPQVVAVISNMAEKRSLADRFADTLRGEVARREQLLKETGRRVQGSAFNSVTEYE
FT                   NAVAAGHDLPPLPTLFVVADEFTLMLADHPEYANLFDYVARKGRSFRIHILFASQTLDV
FT                   GKIKDIDKNTSYRIGLKVASPSISRQIIGVEDAYHIESGREHKGEGFLVPAPGAVPIKF
FT                   RSTYVDGIYEPPRAERSIVVRALPQPQLFTASRVEPEPDTVIPSSAPEAEAAPPRKLIA
FT                   TIGQQLAQYGPKAPRLWLPPLDEPIRLVEVLQRSAVPTRQWRWPLGEIDKPFEMRRDPL
FT                   VFDATSSAANMVIHGGPKSGKSTALQTFMLSAAALHSPRDVTFYCLDYGGGKLAPMADL
FT                   AHVGSVATPLEPERIRRTFGELEQLLRARQALGARGEGTSGEAYPETFLVIDNLYAFSR
FT                   DNTDTFNTRNPLLARVTELVNSGLAYGIHVVITTPNWLEVPLNMRDGLGLRLELKLHDS
FT                   HDSNVRIVGGLRRPAESVPADQPGRGLTMAAEHFLFATPALDLIPAINARFPEQTAPPV
FT                   RLLPHDLAPEAIGPLYPGPERVVIGQREEDLAPVELDFAQNPLLMVFGDNRSGKTTLLR
FT                   HLIRTVREHSEPDDVAFTVIDRRLQLVDEPLFPDNEYTANIDRITPAMLGLSALIEKRR
FT                   PPAGLTPAELSRWSYQGHTHYLIIDDVDQIPDGPAVNGPYVGQRPWTPLVGLLSQAGDL
FT                   GLRVIVTARATGSAHAVMTAPLLRRLNDLQATALMLSGNPQDSGKLRGHRFSRLPAGRA
FT                   MLLGDTDTPTFLQLVNPLVAESVASAGSTHTNGKDYR"
FT   gene            426842..427150
FT                   /locus_tag="Mkms_0383"
FT   CDS_pept        426842..427150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0383"
FT                   /product="PE domain protein"
FT                   /note="PFAM: PE domain protein; KEGG: mmc:Mmcs_0373 PE-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89600"
FT                   /db_xref="InterPro:IPR000084"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U2"
FT                   /protein_id="ABL89600.1"
FT                   /translation="MTLRVVPEGLTAASAAVEALTARLASAHAAAAPLIGTVLPPAADA
FT                   VSLQTAAGLSANGGRHEAVAAQGVQELGRSGVGVGQSGASYAAGDAMNASAYMIARG"
FT   sig_peptide     426842..426931
FT                   /locus_tag="Mkms_0383"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.778 at
FT                   residue 30"
FT   gene            427151..428728
FT                   /locus_tag="Mkms_0384"
FT   CDS_pept        427151..428728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0384"
FT                   /product="PPE protein"
FT                   /note="PFAM: PPE protein; KEGG: mmc:Mmcs_0374 PPE protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89601"
FT                   /db_xref="GOA:A1U9U3"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U3"
FT                   /protein_id="ABL89601.1"
FT                   /translation="MVPPIWMALPPEVHSALLSSGPGPGSLLAAAGAWQSLSAEYASAA
FT                   AELTGILGSVQAGAWEGPSAEQYVAAHTPYLAWLAQASANSAATAAQHETAAAAYTTAL
FT                   ATMPTLGELAANHATHAVLLATNFLGINTIPIAVNEADYVRMWIQAATSMSTYQAVAGA
FT                   AVAAAPTTAPAPYLLAPGVGEAGQAMASVQQLGAQAQASESGSALNISDSINQLLEQYL
FT                   QSAPGGQEIIDFLRDPLGNLQTLINDFMTNPSAALVTWGPLLSAVAYQVFTNLVGWPTW
FT                   AMIFASPFLLAALIPLGIAGLVLIIDALKPELTQPPAEQTEPAPAPAPRPDQQVLPVAG
FT                   VPAPGAPATPGTAPAGSSAAAPAAPAPAAAAAAPLVPYAVRGGDPGEGFTPTVRDSTGA
FT                   KAPAGDIPAAAAAAAAASAAERRKRRRRKITEVKGRGYADVYMDYEDDPDEPPIVEPRV
FT                   AASSRGAGAMGFTGTAPGAADARATGLTTLSPDAFGTGPVSPMLPGTWNPDSEPDQPAE
FT                   GQEGGPRT"
FT   gene            428778..429071
FT                   /locus_tag="Mkms_0385"
FT   CDS_pept        428778..429071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89602"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U4"
FT                   /protein_id="ABL89602.1"
FT                   /translation="MSMLDAHIPQLIASEAAFGAKAALMRSTMAQAEQAAQSSQAFHMG
FT                   ESSAAFQAAHARFIEVSAKINALLDIAQVNLGDAAGTYVAEDAAAATTYTAI"
FT   gene            429101..429388
FT                   /locus_tag="Mkms_0386"
FT   CDS_pept        429101..429388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89603"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U5"
FT                   /protein_id="ABL89603.1"
FT                   /translation="MSQIMYNYPAMLAHAGEMSSYAGAMHAVGADIASEQAALAGAWQG
FT                   DTGMTYQAWQAQWNASLEELVRAYRAMASTHEMNTMSMSARDQAEGAKWG"
FT   gene            429425..430369
FT                   /locus_tag="Mkms_0387"
FT   CDS_pept        429425..430369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0387"
FT                   /product="putative DNA-binding protein"
FT                   /note="KEGG: mmc:Mmcs_0378 putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89604"
FT                   /db_xref="GOA:A1U9U6"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U6"
FT                   /protein_id="ABL89604.1"
FT                   /translation="MGPNAVELTAAQAWFVADAVGAGSLPWVLAVTPPYSQEADRAPFT
FT                   AETVASLETLGVLSGDGVVDARVADWVRVVCRAEQWLDLRFVSGRGALLRGVVARRADQ
FT                   TVVALRSRSLITFTRMAIDHPHALVPVLCAGLSGRAPARFAEFTLPAAVGARADEQIRQ
FT                   GTPLAEVLDFLGIPPSARPVVEAAFDTSRTYVEIVAGEHRDGHRVTTQVGVSVVDTTEG
FT                   RVLVSPVRAFDGEWVSTFAPGTPFAIAAAVERLTGSLPSGAWFPDLHLTRDFDTRPRDE
FT                   YDTREPRTRHARHHDTVRQHCDADRAGGRTRRW"
FT   gene            430332..431726
FT                   /locus_tag="Mkms_0388"
FT   CDS_pept        430332..431726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0388"
FT                   /product="protein of unknown function DUF571"
FT                   /note="PFAM: protein of unknown function DUF571; KEGG:
FT                   mmc:Mmcs_0379 protein of unknown function DUF571"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89605"
FT                   /db_xref="GOA:A1U9U7"
FT                   /db_xref="InterPro:IPR006707"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U7"
FT                   /protein_id="ABL89605.1"
FT                   /translation="MPIVRVAVLAGGDDGGRLTEMALPAGLPLREILPAVQRMARPHDD
FT                   GDRDDPAPQPARLSLAPIGGAPFSLDATLDTVGVVDGDLLALQPVPAGPSAPRIVEDIA
FT                   DAAVIFSAAREKRWGPTHIRRAAAAAVVGLILVVTGLSVAHRLVTDDGIGLIVVCAVAV
FT                   AAVLGALLSRASSPALASTLALSALPAVAAAFALAVPGDFGAAQILLAAAGVTAWSVIS
FT                   LTTGDRAVAVFTTTAATGFGVLLTAAAASLWTLSETVLGCVLILTGLLVTVQAAQLSAM
FT                   WARFPLPVIPAPGDPTPSAQPLRVLEDLPRRVQLSQSHQTGFLAAGVVLGVTGSLVLVG
FT                   QQDVSRWAWYVVVAVAAGAVLRARVWDSAPCKAWLLAHPLLLGVVLLVLFAATDRFDAA
FT                   WWALAATAAVVVVWVIVALNPSIASPETYSLPMRRLVGFAATAVDASLIPVMALLVGLF
FT                   SWVLNR"
FT   gene            431723..433108
FT                   /locus_tag="Mkms_0389"
FT   CDS_pept        431723..433108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0389"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: mmc:Mmcs_0380 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89606"
FT                   /db_xref="GOA:A1U9U8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023834"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U8"
FT                   /protein_id="ABL89606.1"
FT                   /translation="MIRSLALLAVTGAVALLAAPSAAAVTPPQVDPATPPPSGTAGPVQ
FT                   PMAQRGDCVVGGVLAGSDPGAVSPNQLALNLSGAWRHSRGEGQTVAVIDTGVKPGPRLP
FT                   NVEPGGDFLGSTDGLTDCDGHGTLVAGLIAGQPGADGFSGVAPGARIVSIRQNSPRFSP
FT                   VNPGEDPAVSRAAADVASLARAVVRAADLGARVINISVVSCLPAGRSVDQTELGAALRY
FT                   AAREKDAVIVAAAGNDRAGMNTGSACESNPPGDAARPDDPRNWAGVTSVSIPSWWQPYV
FT                   LSVGSLTSTGQPSDFTMSGPWVGIAAPGENITSVSNGPDGGLANGLPNDRDELFPVSGT
FT                   SYAAAYVSGVAALVRSRFPELTAEQVVARLTATAHGGPRSPSNVVGAGSVDPVAALTWR
FT                   VPSATAAAAVASKPIAAPPNPPVPDHTPRTVALIGTAALALTVLAALAWRSGATRPRKD
FT                   EAS"
FT   sig_peptide     431723..431797
FT                   /locus_tag="Mkms_0389"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            433105..434058
FT                   /locus_tag="Mkms_0390"
FT   CDS_pept        433105..434058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0390"
FT                   /product="putative conserved transmembrane protein"
FT                   /note="KEGG: mmc:Mmcs_0381 putative conserved transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89607"
FT                   /db_xref="GOA:A1U9U9"
FT                   /db_xref="InterPro:IPR021368"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9U9"
FT                   /protein_id="ABL89607.1"
FT                   /translation="MTARITLALLFALPAALAYPWQTDTDWWLLGVAIAVVVLLFAWWR
FT                   GLFVTEMVRRRFAILTRNRRGGHRQEPAEHFATVALRVDEAPTGDVPLALLAGYADRYG
FT                   VRAHKVRVVSRDLAGERTTWIALTVGAADNLAALRARSPRLPLRQTTEIAARRLTDHLR
FT                   ELGWTVTPVDETAAPVPHPVRETWRGLRSEHGHVAAYRVTVDDQVSDTLAAVAALLSAE
FT                   TWTAIDIVCGAESPEIVVGCAVRTEDRPKAKAPLPALTPQRGRHRPAAEALHPLADQRL
FT                   EGRPVPVTGDGLHRLRWPVDHPPVTELVEVGTSDPQ"
FT   gene            complement(434044..435033)
FT                   /locus_tag="Mkms_0391"
FT   CDS_pept        complement(434044..435033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0391"
FT                   /product="malate dehydrogenase (NAD)"
FT                   /EC_number="1.1.1.37"
FT                   /note="PFAM: Lactate/malate dehydrogenase; KEGG:
FT                   mmc:Mmcs_0382 lactate/malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89608"
FT                   /db_xref="GOA:A1U9V0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V0"
FT                   /protein_id="ABL89608.1"
FT                   /translation="MIGAVTTPPASPEVRSARPKVSIIGAGSVGTAIAYACLIRGSAGT
FT                   LALYDTNSAKVRAEVLDLNHGSQFVPECRVGGSDDIAVTAGSAIVVVTAGAKQHPGQSR
FT                   LDLAAANVAMAQTLTPQLLEHSPDAVVIFVTNPVDVVTYAASSVVDAQPGQIFGTGTVL
FT                   DSSRFRYLVAQRAAIAVGNVHALVIGEHGDSEIPLWSTLSIGGVGADAYRVDGRLVFDE
FT                   PTRTAVATDVVNAAYEIIAGKGATNLAIGLATARVVEAVLGDQHRVLPVSTVQDGAYGI
FT                   TGVALSLPTVVSAGGARRVLEVELSPGELDGLRRSAQTLADVRRSLGI"
FT   gene            435136..436983
FT                   /locus_tag="Mkms_0392"
FT   CDS_pept        435136..436983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0392"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="PFAM: pyruvate kinase; KEGG: mmc:Mmcs_0383 pyruvate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89609"
FT                   /db_xref="GOA:A1U9V1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V1"
FT                   /protein_id="ABL89609.1"
FT                   /translation="MSSAHTPVVSRLETADRALEQLDELIERLEKAEDAWSDWLTAVSP
FT                   EHRASATNMVHYWSLRQSDLRDLQRRLAGLGLSSLGRSEPHVEGTLRLVHAAVAAMRHG
FT                   SWHPPGVTAVDANVGDELLREHAVDLFGPAPAERATRIMVTLPSSAATDPDLVRDLIAR
FT                   GMNVARINCAHDDAEAWTAMAGHVRRAAESTGRKCLVAMDLAGPKLRTGPIRPGPRVIK
FT                   LRPTRDALGRVVTPFRLRLTASEEPTGSSESAMAVVPVDEAWLARRRDGDVVGFHDARG
FT                   AKRQLVLSRPDEMAGAVIATGDKTSYLATGTVLHAGAHDPCEVGLLPEREQTLMVQRGD
FT                   ELTLTRDCAPVPADHGGAPRIGCTLPEVFDHARPGEKIRFDDGRIGGEIVAVERDALRV
FT                   RIDRTAPGGSKLGSAKGVNVPDTHLPIAALTDKDVEDLATVVAIADIVQISFVQRPSDI
FT                   TQLHDELHRLGGDHLGVVLKIETRRAFEHLPQLLLTAMRWPRVGVMIARGDLAVEVGYE
FT                   RLAEVQEEVLWLCEAAHLPVIWATQVLESLAKSGLPSRAEISDAAMGERAECVMLNKGP
FT                   HIVDAVVVLDDILRRMNEHHYKKNALLRQLRSWRPDATE"
FT   gene            complement(436990..437397)
FT                   /locus_tag="Mkms_0393"
FT   CDS_pept        complement(436990..437397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0384 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89610"
FT                   /db_xref="GOA:A1U9V2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V2"
FT                   /protein_id="ABL89610.1"
FT                   /translation="MSAESQPVSILPESECWRLLDSVALGRLVTCAGGQPEIFPVNFAV
FT                   QDRTVLFRTAAGTKLTSAAISNQVLFEADAHTATEGWSVVVKGVARTVHGDDELEKAAG
FT                   AQLFSWTATTKQHFVRIRPDRVTGRRFGFVA"
FT   gene            complement(437453..438649)
FT                   /locus_tag="Mkms_0394"
FT   CDS_pept        complement(437453..438649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0394"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89611"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V3"
FT                   /protein_id="ABL89611.1"
FT                   /translation="MTQSADPVDPPVPVLDIPGADAGARGLPRQADLTLRQRMIVDSSA
FT                   VADIALRTGVASMVGAAMLPSVVASALRPSTTGADAEHLRFYGELAAAKDPEVSFPAPT
FT                   VPPRISSRPANPVAEWTAHGRVHNIRFRSSFEAVNPALRDRCHGYRRNNVVHAQHWRHE
FT                   DGPRPTLCVIHGFMGSAYLFNGQFLSLPWFYRSGYDVLLYTLPFHGRRAEKYSPYSGYG
FT                   YFANGFAGFAEAMAQAVHDFRSLIDHLEFTGVDRVAVTGISLGGFTSALLACVDDRIQA
FT                   VIPNVPVVTPDRTVDEWFPANKLVALNRRIAGLDPELEAAASRYPSPLNYAPLVPRDRR
FT                   LIITGLGDRLAPPQQAELLWEHWERCAFHWFPGNHLLHVSQPDYLRRMTRFLRDFMFD"
FT   gene            438776..439540
FT                   /locus_tag="Mkms_0395"
FT   CDS_pept        438776..439540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0395"
FT                   /product="Trans-aconitate 2-methyltransferase"
FT                   /EC_number="2.1.1.144"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mmc:Mmcs_0386 trans-aconitate
FT                   2-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89612"
FT                   /db_xref="GOA:A1U9V4"
FT                   /db_xref="InterPro:IPR023149"
FT                   /db_xref="InterPro:IPR023506"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U9V4"
FT                   /protein_id="ABL89612.1"
FT                   /translation="MWNPEAYLSFADHRGRPFFDLLARVGADAPRRVVDLGCGPGNLTV
FT                   VLRHRWPEAVVEAWDNSPEMVAAARERGVQANLGDVRGWSPQPDTDVVLSNATLQWVPE
FT                   HPELLTRWAGALAAGSWLAMQVPGNFDAPSHQAVRRLADREPWAPLLHDIPFRVGKVVE
FT                   TPADYAALLTDAGCSVDAWETTYIHELTDAHPVLEWITGTALRPVRSRLTDEQWDRFRA
FT                   ELIPLLDEAYPVRADGRTFFPFRRVFVVARTG"
FT   gene            complement(439537..441396)
FT                   /locus_tag="Mkms_0396"
FT   CDS_pept        complement(439537..441396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0396"
FT                   /product="sulfate adenylyltransferase subunit 1 /
FT                   adenylylsulfate kinase"
FT                   /EC_number="2.7.7.4"
FT                   /EC_number="2.7.1.25"
FT                   /note="KEGG: mmc:Mmcs_0387 sulfate adenylyltransferase,
FT                   large subunit; TIGRFAM: small GTP-binding protein; sulfate
FT                   adenylyltransferase, large subunit; PFAM: protein synthesis
FT                   factor, GTP-binding; adenylylsulfate kinase; elongation
FT                   factor Tu, domain 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89613"
FT                   /db_xref="GOA:A1U9V5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V5"
FT                   /protein_id="ABL89613.1"
FT                   /translation="MGTRQLLRITTAGSVDDGKSTLIGRLLHDTDSLPLDHLEAVTDEE
FT                   GVADLAALSDGLRAEREQGITIDVAYRFFSTANRSYILADTPGHERYTRNMFTGASNAH
FT                   VAVLLVDARAGVLRQTNRHARIAKLLGIKHFVAAVNKIDLVDFDGDRFAEVAAELQTLS
FT                   ARLGGLDITVIPLAAKHGDNVVHRSDRTPWYDGPTLLEYLEGVELVPPQPEPNKLRLPV
FT                   QWVSRPTAEQRRRYTGRLSAGTLSVGDTVVSLPAGTRSTVTVVDTLDDDRPVAVAPLSV
FT                   AIELADDIDVGRGDVFVSGADDATLPVLARELDATVCWFADAPLRAGDRLALKQGTRTV
FT                   RATVQALHSRLDPETLDEFDNPVELVLNDIGSLTLRTSSVVVTDAYADNRDSGAFILID
FT                   ESSNDTVGAGTILEPREVTPGAQTRNDIRWHPSSLDRTHRWTSTGQRGATIWFTGLPAS
FT                   GKSTVAVAVERALVESGQVAYLLDGDNIRHGLSDDLGFAAGDRAENIRRVGHLTRLFAD
FT                   AGVVALASLVSPLKSDREIARTLSDAAKLPFLEVYVSTPVEECEKRDPKGLYARARAGE
FT                   LKGLTGVDAPYEPPDAPDLVLDTTGADIADLVKQVIDLLDSRR"
FT   gene            complement(441396..442316)
FT                   /locus_tag="Mkms_0397"
FT   CDS_pept        complement(441396..442316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0397"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /EC_number="2.7.7.4"
FT                   /note="KEGG: mmc:Mmcs_0388 sulfate adenylyltransferase,
FT                   small subunit; TIGRFAM: sulfate adenylyltransferase, small
FT                   subunit; PFAM: phosphoadenosine phosphosulfate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89614"
FT                   /db_xref="GOA:A1U9V6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V6"
FT                   /protein_id="ABL89614.1"
FT                   /translation="MTTTDIDALRVDELRLLEAEAVHIIREVVAELERPVLLFSAGKDS
FT                   IVLLRLAEKAFRPSPLPFPVMHVDTGHNFDEVIEFRDRRVTGHGHKLIVASVQESIDRG
FT                   RVPDPGPGASRNRQQTRTLLDALEEGGFDAAFGGARRDEERARAKERILSFRDEFGQWD
FT                   PRAQRPEPWSLYNGRIKKGEQVRVFPLSNWTELDVWRYIQLENLELPSIYFAHRREVFA
FT                   RDGILLAVSQYAQPRDGETSAVEWVRYRTVGDLTITGAVRSEATDIERVIAEISAATVS
FT                   ERGETRADDRTSVAAMEDRKREGYF"
FT   gene            complement(442313..443116)
FT                   /locus_tag="Mkms_0398"
FT   CDS_pept        complement(442313..443116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89615"
FT                   /db_xref="GOA:A1U9V7"
FT                   /db_xref="InterPro:IPR015124"
FT                   /db_xref="InterPro:IPR024628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V7"
FT                   /protein_id="ABL89615.1"
FT                   /translation="MPSRSTAYLVLASQRSGSTLLVESLRATGVAGEPQEFFQYLPETS
FT                   QAPQPREWFADIEDESILRLLDPLDEGKPDLAPATIWRDYIRTVGRTPNGVWGGKLMWN
FT                   QTPLLLDRAKDLPDRSGDGLLSAIRDVVGSDPVLVHVYRPDVISQAVSFWRAVQTRVWR
FT                   GRPDPNRDARAEYHAGAIAHVVRMLRAQEDGWRNWFAEENVEPIDVPYPVLWRNLTQVV
FT                   ADVLDRLGQDPRLAPAPVLERQADQRSDEWVDRYRADAERDGLPT"
FT   gene            complement(443183..444580)
FT                   /locus_tag="Mkms_0399"
FT   CDS_pept        complement(443183..444580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0399"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: mmc:Mmcs_0390 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89616"
FT                   /db_xref="GOA:A1U9V8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V8"
FT                   /protein_id="ABL89616.1"
FT                   /translation="MTGQPRVTPQDRANVLIVHWHDLGRYLGAYGHPDVQSPRLDRFAA
FT                   ESILFTRAHATAPLCSPSRGSLFTGRYPQSNGLVGLAHHGWEYRAGVRTLPHILSENGW
FT                   HTALFGMQHETSYPPKLGFDEFDVSNSYCEYVVERATGWLLDAPQRPFLLTAGFFETHR
FT                   PYPRDRYEPADATTVALPDYLPEDREVRQDLAEFYGSITVADAAVGQLLDTLAATGLDR
FT                   STWVVFMTDHGPALPRAKSTLYDAGTGIAMIIRPPLDAGIAPGVYDDLFSGVDLLPTLL
FT                   DVLGVDIPGEVEGLSHADNLLGGAEKTREVRTAVYTTKTYHDSFDPIRAIRTKEFSYIE
FT                   NYAQRPLLDLPWDIAESAPGRIVGPRARTPRPARELYDLRTDPTEQHNLLTSENKINAE
FT                   AVATDLALLLDDWRVKTNDVIPSDFAGTRISDRYTETYLRIHRREVTSRSAIAAERGVK
FT                   GERRTAQ"
FT   gene            444670..445092
FT                   /locus_tag="Mkms_0400"
FT   CDS_pept        444670..445092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0400"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: mmc:Mmcs_0391 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89617"
FT                   /db_xref="GOA:A1U9V9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9V9"
FT                   /protein_id="ABL89617.1"
FT                   /translation="MDEFSAEVVAFLSEGTRTGKLGYVASDGRPLVAPVWFIVEGNQLV
FT                   FNTDRDTAKGRALRRDPRVVLCVDDERPPFSFVQVQGLASTSEDPDGLLDTATRIGGRY
FT                   MGADRAEEFGRRNGVPGELVVRITPTKVVAVFDLAD"
FT   gene            complement(445117..445599)
FT                   /locus_tag="Mkms_0401"
FT   CDS_pept        complement(445117..445599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89618"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W0"
FT                   /protein_id="ABL89618.1"
FT                   /translation="MAVFLRKLLRIGRLPDEMRAQSEAEGILHLSEFVPVTRRFTGSIP
FT                   GKRASGSVSGYTGALVLTRERVLATLSTVPGLAGRTIDQRWDTPADGPVGVEIAPDGLH
FT                   FEVDVHRVDPRSHGELSMHYKSDIPDDVLAVLPTRSLRISVPPEWVFRAVGVPYRP"
FT   gene            445647..446306
FT                   /locus_tag="Mkms_0402"
FT   CDS_pept        445647..446306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0402"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related; KEGG:
FT                   mmc:Mmcs_0393 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89619"
FT                   /db_xref="GOA:A1U9W1"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W1"
FT                   /protein_id="ABL89619.1"
FT                   /translation="MSNRRWLIGSAVSAAAVFVLMWIGYAHWAWLFEADLAVLEPLDRF
FT                   GAAHPGWVTGWDIYCTVLGPTVLRLAGVVVIVVSLVRRQYRTALFLVLTVELSGLLLVA
FT                   AKAIADRPRPATALVAAQSTSFPSGHALGVMVCVLAFLAVLSPTLAPAARRWAIALGVV
FT                   LIVTIGVARVVLNVHHPSDVVAGWALGYVYFVMCWLWYPPRVSPAAETPAAPGTAP"
FT   sig_peptide     445647..445727
FT                   /locus_tag="Mkms_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.742) with cleavage site probability 0.740 at
FT                   residue 27"
FT   gene            complement(446260..447750)
FT                   /locus_tag="Mkms_0403"
FT   CDS_pept        complement(446260..447750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0403"
FT                   /product="phosphoesterase, PA-phosphatase related protein"
FT                   /note="PFAM: phosphoesterase, PA-phosphatase related;
FT                   diacylglycerol kinase, catalytic region; KEGG:
FT                   mmc:Mmcs_0394 phosphoesterase, PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89620"
FT                   /db_xref="GOA:A1U9W2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W2"
FT                   /protein_id="ABL89620.1"
FT                   /translation="MDLSIRRRGSSLRQIGKGLGSLDREVFEAVAESPSPLLDATMPRL
FT                   TRAADHSKLWFAIAAGLMASGGPRTRRGATRGVLSLAVTSLVANQGAKRIWRRARPSYL
FT                   PVPLARRGRRFPTSNSLPSGHSASAAAFAVGVGLESPPIGLGLALLAGLVGLSRVATGA
FT                   HYPGDVFAGFGLGAAVSVLGGRVVPPTTPTKLPTAEPLRVPTPPRPEGAGVVLVINPAS
FT                   GGGNGARVVDEVRDALPRAEVVELDEGDDLQQVLREAAGRAEVLAVGGGDGTVATAAGI
FT                   AKEAGLPLAVFPGGTFNHFAKDIGCDSVARTVDAIRRGSVACVDLVCLNEEHMVINTAS
FT                   IGAYPQFVQTREKLEHKVGKPVAGLYAMFHTLRRAEPVRIQYDNRTLQTSLFFLGNSTY
FT                   LPSGFAPAQRHRMDDGLLDVRILETGKRFSRVRILTALMLGRLERSPLYHEMRVPEFTF
FT                   TAIDGPTVLACDGEVGTECQTASFTAQYRVLPVFRPLD"
FT   gene            447813..448406
FT                   /locus_tag="Mkms_0404"
FT   CDS_pept        447813..448406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0404"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: mmc:Mmcs_0395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89621"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W3"
FT                   /protein_id="ABL89621.1"
FT                   /translation="MLDVDVIADPAAAVVALDPVRSRLLAELTEPASAAALATRVGITR
FT                   QKVNYHLRALEQHQLVAVAGERKWGGLKERLLVATASSYVVAPGALGAAAADPARSRDR
FT                   LSASYLIALSARAVQEVGDLWREARAKDKRLATLSLDATVRFRSAADRADFTRELSEAV
FT                   TTLVARYHDDTAPGGRAHRVVLAAYPQPRDQEDA"
FT   gene            448445..449230
FT                   /locus_tag="Mkms_0405"
FT   CDS_pept        448445..449230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0405"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: mmc:Mmcs_0396 activator of HSP90 ATPase 1-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89622"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W4"
FT                   /protein_id="ABL89622.1"
FT                   /translation="MELLVPGTPEQVWDAMATGPGMSAWFTPTTVEERVGGELHFDFGG
FT                   GATQRGVVTGWEPPRRLTYEEHDWSGIGSPGPLATEITVTGRRGGECVVRMVHSLFTDA
FT                   DDWDDELEGFEGGWPGFFAVLRLYLRDFAGQPAAPVRVMAEYPGEVADGWSRLASALAL
FT                   TGVDVGQRVASPSGAPEFGGVVERVHQTRESRDVMVRLDHPGNGIAVVGMYPMGDAARA
FT                   MVSLYRYGDAAADTAADQRQVWAQWLDGVLGRDPIVSER"
FT   gene            449266..449919
FT                   /locus_tag="Mkms_0406"
FT   CDS_pept        449266..449919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0406"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mmc:Mmcs_0397 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89623"
FT                   /db_xref="GOA:A1U9W5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W5"
FT                   /protein_id="ABL89623.1"
FT                   /translation="MRRLLTLLCAAAVCLVAGAPVAPATAPWFASSVGAATQVISVVGV
FT                   GGSSAKMDVYQRTAVGWQPVAAGIPAFIGAKGMAPQTHDGEMKTPMGVFTLDFAFGTEP
FT                   NPGGGLPYVQVGPDHWWDGDMKSPTYNTMQVCKKEQCRFNTSLSAGTENLDIPQYRHAV
FT                   VMGVNKARVPGNGGAFFVHSTDGGPTAGCVAIDDGTLVEVMRWLRSGALIALSK"
FT   sig_peptide     449266..449373
FT                   /locus_tag="Mkms_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 36"
FT   gene            complement(449924..450382)
FT                   /locus_tag="Mkms_0407"
FT   CDS_pept        complement(449924..450382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89624"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W6"
FT                   /protein_id="ABL89624.1"
FT                   /translation="MGDIDEIKSVKYRYLRALDTKDWAAFADTLTEDVEGDYGESLGED
FT                   HRFTDREALVSFMRTSLGPEVITEHRVDHPEIVIEGDEATGTWYLQDRVIAPDFNFMLI
FT                   GAAFYRDRYRRTPEGWKICATGYDRTYDASMSLDNLNFKLKRGRALNL"
FT   gene            450489..451202
FT                   /locus_tag="Mkms_0408"
FT   CDS_pept        450489..451202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89625"
FT                   /db_xref="GOA:A1U9W7"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W7"
FT                   /protein_id="ABL89625.1"
FT                   /translation="MAVVAGPGRFEEAASAALGLALLTLWVGRRRGVPVHALEAFGVAF
FT                   FAVLAVLGLIAPPDTIRWLELWAGEMSNVALALFAVATLLTRRPFTLAYAKDTAPQEYW
FT                   DSPVFLRINYVISAVWASAFLVSAAAGAYADGVLGDNDNFWFSWIVPLAAIIFAGAFTD
FT                   HYPDRATGESTASWARVFDWLPIFVVITGIVGWVSDSTSDTVGIALIVIGSVGSALMRK
FT                   VFPDEPAKIPGPSQS"
FT   gene            complement(451197..452711)
FT                   /locus_tag="Mkms_0409"
FT   CDS_pept        complement(451197..452711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0409"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase, FAD-binding; Rieske [2Fe-2S]
FT                   domain protein; FAD dependent oxidoreductase; KEGG:
FT                   mmc:Mmcs_0400 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89626"
FT                   /db_xref="GOA:A1U9W8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W8"
FT                   /protein_id="ABL89626.1"
FT                   /translation="MTSLWLAGRPEQAVAPNPLDETTRSADVVVVGAGLTGLVTAVLLA
FT                   RAGRDVMVLEAFRAGAGATGNTTAKISLLQGTKLSKIVGKHGPGVAKKYVEGNLEGQEW
FT                   LIQRCENHGISVQREDAFTYAQSDTGLPAARAELEACQAAGLDAEWVDGSHGAHVPFPF
FT                   EGGVRLAGQAQFDPMPLLDSLIVELDERGGRLIQGVRVQRVSGTDDGLTLHVRTSEGDE
FT                   FDVDTRQCVLATGIPILDRGGFFARLKPARSYCMAYKVPGTITRGMYLSTDSPTRSVRY
FT                   APTQDGDRLIVGGAGHPVGREKHPSSSVQELDAWAKQHYPGAMQTNYWSAQDYSPADEL
FT                   PYVGPILPGQDKIYVATGFDKWGMTNGAAAALALSSSILGGRMDWADAFASWSPHELSG
FT                   IPKAVQANVEVGINLAKGWITPVTRIADRTPQSGGVVSGPPWALEARSVVDGVEHRVSP
FT                   VCPHLGGIVNWNDSDESWECPLHGSRFAPDGTLLEGPATRDLTRSL"
FT   gene            452794..454578
FT                   /locus_tag="Mkms_0410"
FT   CDS_pept        452794..454578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0410"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0401 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89627"
FT                   /db_xref="GOA:A1U9W9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9W9"
FT                   /protein_id="ABL89627.1"
FT                   /translation="MSDPLGLSIGTTNLVAARVGNPPVIRRSTLSLFSDRTPQVGLPAE
FT                   QSGGVVLDGFVERVGDPVPLVAADGTSYRADALLVEALDAMTEAVDAAPSGDIAIAVPA
FT                   HWGTATVYALRNALRTNPVFTSNGAPARLVSDAVASLTALRANPGLPTDGVVALLDFGG
FT                   SGTSITLADAAAGFAPVDETTRFTEFSGDLIDQALLTHVLTGITDAGGVDPAGTAAVGS
FT                   LTRLRERCRDAKERLSAVTAADVAAELPGYHSTIRITRAELEEMLQRPLAGVLAALDAA
FT                   LERTRIGWAGVSAVVTIGGGASIPLITQQLSAHTRVPVITTRQPALDAAVGAALFAAYS
FT                   AAAEAPTGMAAAAPVTAMIDDAPGSATFRALAWSQDDTTSDEPVPYTGDDAYEPYNPFG
FT                   PAPTGARPEVQYLPADEPEDGRRGWHVPQLAFGAAAVVAAIAVGGVAYALTSTSADSTP
FT                   VTEFETTRLPAGAPLPEPSSAPPPPVVTVTTAPPAPAPPPEPGTPLPPPPPVTPVTTTP
FT                   TTTTTTTTTTTTTTTTTTTTTTQPTTTTTQPTTTQPTTTQPTTTQPPVTTTTQPPVTTT
FT                   YVTVPFVPIPIPIQVPNN"
FT   gene            454809..455915
FT                   /locus_tag="Mkms_0411"
FT   CDS_pept        454809..455915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0411"
FT                   /product="fatty acid desaturase"
FT                   /note="PFAM: fatty acid desaturase; KEGG: mmc:Mmcs_0402
FT                   fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89628"
FT                   /db_xref="GOA:A1U9X0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X0"
FT                   /protein_id="ABL89628.1"
FT                   /translation="MAITDVAQYAHLSNTDIESLGAELDTIRRDIEESLGARDAAYIRR
FT                   TIAFQRALDVGARLLIAAGSGKTAWIAGTAALAFAKTVENMEIGHNVGHGQWDWMNDPE
FT                   IHSNTWEWDMAGPSSQWRYSHNYLHHVFTNVIDMDEDLGFGVMRVTRDQPWEPRYLLQP
FT                   LRNIALAIGFEWGIALHDIHAAKERAQTPGEKHAQSRLIRKKIARQMVKDYLIFPALSR
FT                   SRWRRTLGANVAANIVRNLWAYVVIFCGHFPDGAEKFTAAVLEQESKPEWYLRQMLGTA
FT                   NFNAGPLMAFASGNLCYQIEHHLFPDLPSNRYAQIAVRVRAQCEKFDLPYTTGSLMRQY
FT                   WQTLRTIHRLALPDGDDGHRGVSATRKR"
FT   gene            455951..456826
FT                   /locus_tag="Mkms_0412"
FT   CDS_pept        455951..456826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0412"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0403
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89629"
FT                   /db_xref="GOA:A1U9X1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X1"
FT                   /protein_id="ABL89629.1"
FT                   /translation="MNDVEYVELHGERVAYRDAGSGEVLLLIHGMAGCSDTWNAVLPRL
FT                   AENYRVIAPDLLGHGRSAKPRTDYSLGAFAAGLRDLLDELGVDRATIVGQSLGGGVAMQ
FT                   FMYQHPQYCRRLILISSGGLGPDVGWVLRLLAAPGAEVLLPVVAPKPVVALGNRLRPVL
FT                   GALGLGSPQAAQTWQSYSSLSDPPTRAAFQRTLRSVVDHRGQSVSALSRLGMHLEVPSL
FT                   VIWGDRDPIIPVAHAYSVQAARPGSALKVLPGVGHYPHVEAPDEVVDAIRQFFLDTAAD
FT                   DPHHHPGAVT"
FT   gene            456916..457773
FT                   /locus_tag="Mkms_0413"
FT   CDS_pept        456916..457773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0413"
FT                   /product="endoglucanase, family 26; S-layer domain protein"
FT                   /note="KEGG: mmc:Mmcs_0404 endoglucanase, family 26;
FT                   S-layer domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89630"
FT                   /db_xref="GOA:A1U9X2"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X2"
FT                   /protein_id="ABL89630.1"
FT                   /translation="MGAGLQLGLSTPAGVFGLDEVAATGAAVDRHVDLVLWYEDFAAPP
FT                   PVSGVTKVSATGAVPVITWEPWLWRTDVTVAGAETISEIAAGAHDDHLFAWAAALTITG
FT                   EPVHLRFAHEFNGDWYPWTPAHGATPDAYVAAWRHTHDLFRRAGATNVRWMWSPDAIGG
FT                   GEVPLRAWFPGDDYVDVVGIDGYNWGTTRPWSRWTPPVELFEPAVTEIRALTGRPMMIA
FT                   EVGCAEDGGDKAEWISSFVGWAAAQPDVDAVIWFEHDKETDWRITSTPAATAAMAGALR
FT                   AVMQ"
FT   gene            457770..459011
FT                   /locus_tag="Mkms_0414"
FT   CDS_pept        457770..459011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0414"
FT                   /product="putative GAF sensor protein"
FT                   /note="PFAM: GAF domain protein; Stage II sporulation E
FT                   family protein; SMART: protein phosphatase 2C domain
FT                   protein; KEGG: mmc:Mmcs_0405 serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89631"
FT                   /db_xref="GOA:A1U9X3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X3"
FT                   /protein_id="ABL89631.1"
FT                   /translation="MTAETPVSPFALPPEVEDERVRSLAQLHVLDTPPEDRFARITRMA
FT                   RAVFGIPMAAVALVDRDRQWFKQVDGLDIGTNLPRNQTICQATIARSYEQPDNPALIIE
FT                   DAAARPEFAMVPGIGEPGGIRFYAGYPLYGPGGHPVGTFCIYDTEPRSLTEAELTTFTE
FT                   LASWAQRELEHSDDLERAADVQRHLLPRPLGDLPGYSVCAMCLPAYAVGGDFYDHYRVE
FT                   GGAVFTVADVMGKGLGAAILAASVRSALRGASSAFARVERPLAPEDVVDAVALQLSEDL
FT                   SSTDTFVTLFHCQLDSATGTVRFVDAGHGIALVVRADGRVEGLDSAGLPLGVMPGDTWD
FT                   CGEVTLGEGDTLIIASDGVLDLIGDGSDARPALRFVATHPEPADLCARARALVAEKSPL
FT                   DDVTLVAVRREPTA"
FT   gene            459008..460984
FT                   /locus_tag="Mkms_0415"
FT   CDS_pept        459008..460984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0415"
FT                   /product="Cellulose synthase (UDP-forming)"
FT                   /EC_number="2.4.1.12"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   mmc:Mmcs_0406 cellulose synthase (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89632"
FT                   /db_xref="GOA:A1U9X4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X4"
FT                   /protein_id="ABL89632.1"
FT                   /translation="MRHQLPEISPGKYPSPWLRLLILCTALLGINYIVWRWFGSINWAA
FT                   WWIAVPLVIAETYSVIDSLLFAMTMWKMLRRNPPPPPPDDATVDVFITTYNEPIDMVLE
FT                   TAEAAQRIRFPHSTWILDDGDRHDLAEAAAERGIGYITRSSSWTPDKPRHAKAGNLNNA
FT                   LFETHGEFILVLDADQVPEPEILDRTLGYFRDPHMALVQTPQYFHNVPFSDPLGSQAPL
FT                   FYGPIQQGKDGWNAAYFCGSNAVLRREALMRLGIRGYVRAVEEGVRRTLYAARKMIRTA
FT                   RKQPGADQPEVQEALESVLQAVRDARRQLRDKRALADITFDFQQRVDAAARTVVDADIT
FT                   AMRADLEVITALSEHPEATATTVVFDDEALESLAGREWSPLGAIESIGAMIRAVDVGRD
FT                   DEAQPMLPMATISVTEDMATCMRLHALGWRSAYHHEVLARGLAPDDVRTMLTQRLRWAQ
FT                   GTIQVMLRENPFVQKGLSIGQKLMYWATMYSYLAGFAALAYIAAPAIYLIFGIMPVTAY
FT                   SWDFFGRLIPFLVLNQLMFIIISRGTPTWRGQQYSLALFPVWIRACYTAFLNVVFGRPL
FT                   GFAVTPKTRQEATAIPWHLVKWQLAAMAMLVVASIIGIVQLYFGAISVLGVGVNLFWVI
FT                   FDLLILSVVIQAVRFRGHQDEGV"
FT   gene            460984..461325
FT                   /locus_tag="Mkms_0416"
FT   CDS_pept        460984..461325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0416"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   mmc:Mmcs_0407 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89633"
FT                   /db_xref="GOA:A1U9X5"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X5"
FT                   /protein_id="ABL89633.1"
FT                   /translation="MSRYPTRTTDSGVLVIRPEGRLNMVAAPALRKQIHELVDGGSARV
FT                   VVDLSATEFIDSSGLGALISGLKVARQAGGDLRIAAPTRQVTTVLELTNLNRVLSTYDS
FT                   ADGAFDGDA"
FT   gene            461312..461725
FT                   /locus_tag="Mkms_0417"
FT   CDS_pept        461312..461725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0417"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: mmc:Mmcs_0408 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89634"
FT                   /db_xref="GOA:A1U9X6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X6"
FT                   /protein_id="ABL89634.1"
FT                   /translation="MATHDPSVVLETTTGPDTLDAVQRTLDTLWAEHDVDEMVRMHVDL
FT                   AVGEIAANIIEHSGGGDPVRMRMEVSLDPDVVRTTFFDDGHPSPIDLGEVSMPEELSDR
FT                   GRGLAIAHRVLDELSYRRDSDGNHWTLVRSRTP"
FT   gene            461763..462341
FT                   /locus_tag="Mkms_0418"
FT   CDS_pept        461763..462341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0418"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0409
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89635"
FT                   /db_xref="GOA:A1U9X7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041347"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X7"
FT                   /protein_id="ABL89635.1"
FT                   /translation="MSVPEKQSGLRERKKLQTRETIRREALRLIKERGYQNTTVEQISA
FT                   AADVSPRTFSRYFPTKEAVLLSDDHIAPIIEAFVDAPADLSVIEAYRHAVARTFGALSE
FT                   EQRAEAIFGQRLMYAIPEARGLIYTEYVRLIELITEALTKRPGQPADTVERRVLAGAIV
FT                   GVLIAASHNTPLPGDPISRFLQVLDDKLK"
FT   gene            complement(462393..462641)
FT                   /locus_tag="Mkms_0419"
FT   CDS_pept        complement(462393..462641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0419"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89636"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X8"
FT                   /protein_id="ABL89636.1"
FT                   /translation="MNKLGFATIVASGLTAAFLGLAAPAQAAPAGPGNAQDTINSLEDR
FT                   GYAIRVNHHGMVKPLDESKIVSVRYDNGDRVVYVDVR"
FT   sig_peptide     complement(462558..462641)
FT                   /locus_tag="Mkms_0419"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 28"
FT   gene            462981..465086
FT                   /locus_tag="Mkms_0420"
FT   CDS_pept        462981..465086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89637"
FT                   /db_xref="InterPro:IPR025442"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9X9"
FT                   /protein_id="ABL89637.1"
FT                   /translation="MDASAYIGRVGGLAVALGVGAAVMVGAPGTAFAETGEPTSQTPPD
FT                   DSPKPAAEQDDPGQEQAEERAEEQAEEPDPEALEGLPDDDGDEPVVEEPVVEEPVVEEP
FT                   VVVEDDAEKDAEGADPDVTLPIVDPTTFERESRNRPDSTLQTEKSSEPEGFETLSETAD
FT                   VASFVVDTAHEASEQPAAAARTVLVDNVEEMVQTVLSPAAAAVTAITAPTAARNSAPVI
FT                   NRLLAAFGLGSLRNLPSLPSPAWALSALLALGSRRELERSVATRSVSTSTPTVSLAAAA
FT                   TPYDPAKDYVVTPVSVSGNTVRITNVTGPGGLNNTTTRFGIGGTDLGIMWDNGIKDNPN
FT                   TAVNEHQVLIAFGDTFSNRTPVRTGVWRMNTLFRSTDTVLSNGMYVADGIPHDPGMYSG
FT                   SPMSDPNFSREIIGNYHYGIGPEVTMIPTAAISVPGAGKDGATRQYINYMAVKSWDSPG
FT                   RWTTNYSAIAYSDDNGQNWTVVPQSSVRPAAAGRTILPFVNGDQNFQQGAYVRKYTVDP
FT                   VTGKPLKNAAGQEITDGYIYSYGTPAGRTGTAYVSRVAEADILDKTKYEYWNGTSWTPG
FT                   NPAAAKPILPSTTTTSFFGLIKTTTYPTVSEMSVQYNSYEKKYIMLYGDKNNNIVMRKA
FT                   DSPEGPWSAPITLVTSSKMPGLYAPMIHPWSSTDNVSAADQQYLYWNLSTWDDYQVKLM
FT                   RTDLTKV"
FT   sig_peptide     462981..463082
FT                   /locus_tag="Mkms_0420"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 34"
FT   gene            465118..465594
FT                   /locus_tag="Mkms_0421"
FT   CDS_pept        465118..465594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89638"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y0"
FT                   /protein_id="ABL89638.1"
FT                   /translation="MKRRTLAALAVGAAVLSLPATAVAHAAPPAPQPGAGCAPAVDRAL
FT                   AHTADDTVVQCSAGRWEVYAGPYPSSDRWFSGGDGLDLHGQGMRNPEMLSGPWTGIPQD
FT                   PATRCRAEQTAVVSAGKVGEPQVAEGEPGQPLRFEVLPVMFSIQLTGDCLWQAD"
FT   sig_peptide     465118..465198
FT                   /locus_tag="Mkms_0421"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 27"
FT   gene            465689..466972
FT                   /locus_tag="Mkms_0422"
FT   CDS_pept        465689..466972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89639"
FT                   /db_xref="GOA:A1U9Y1"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y1"
FT                   /protein_id="ABL89639.1"
FT                   /translation="MDLVLGVSVTSTALRFVLVEGATGDGATVDSGTLAMPVSGDSLDA
FT                   LVGAVSGEGPYAAAPGQRPLAVGVTWTESVTEQAAGLMTALTARGVRNVVALSPAESAA
FT                   ALAAGLGDLAAQTDVAVCVAEPDVALVAVVTADTVHVDQIDRAGAGALARQVRETADST
FT                   AVYPEAVYVLGSADDVDAVVAALAGLVTAPVLSAAEADLALARGAALASAQGSVGVDAP
FT                   LALAQVTADAPRSWLTWRIPALTSVLVAAVVTFVVSLSVALGLELTPQMRSDDAATRQV
FT                   ASASDQAKAAVDAPAPEALPKAAPKPAAPPPPPEAPPAPPPEAVTVVDIAPAAPAPAPE
FT                   VAPVIEPVYAAPEVAPPPAPVYVPPAPPVYVPPAPAYVPPPAPVAPAYTPPQAGYVPPV
FT                   APQQPRLRDRIIERLPIINRFHEPQYPY"
FT   gene            467343..467948
FT                   /locus_tag="Mkms_0423"
FT   CDS_pept        467343..467948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0423"
FT                   /product="putative conserved exported protein"
FT                   /note="KEGG: mmc:Mmcs_0414 putative conserved exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89640"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y2"
FT                   /protein_id="ABL89640.1"
FT                   /translation="MLAAPAAVVLAAGADVHREAQTVAAPAPPPPPQLPPYDLEVVASG
FT                   AVGGPADLKVAPSETVSVANWKVANRASYRALPVGVAPERGLQVKTILAARAISAVFPE
FT                   IQQIGGMRPDALRWHPNGLAIDVMIPNPGSAEGIALGNQIVAYVIKNAERFGMQDAIWR
FT                   GVYYTPNGPRGSGNGHFDHVHITTTGGGYPTGSETYFR"
FT   gene            468089..468943
FT                   /locus_tag="Mkms_0424"
FT   CDS_pept        468089..468943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89641"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y3"
FT                   /protein_id="ABL89641.1"
FT                   /translation="MSSTSRVGISSLFACALLFGSTAVTPDISQAQPGPGGATVLTLAP
FT                   AFNELKSNWLRGELFAAPNVKVKVPYTNIPSATNTHKGADKLNEMLHAYPGPKIVAGHS
FT                   QGAQVADDWLRRYGPTSDIDPATVQFVLTGDLESKYNGCANVPGSGCVAAYGGNNFPDD
FT                   TPYTVKVIARQYDYFADCPNDLSNETAKKNRNASQVVGGKGELNSVHTNYSNIGLNDPG
FT                   NKTFVEGNATYILGAPATYFLPVVTQKWTSNESKVVEDAELRPIVESAYNRPMGAPPAP
FT                   PAP"
FT   sig_peptide     468089..468184
FT                   /locus_tag="Mkms_0424"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 32"
FT   gene            469026..469877
FT                   /locus_tag="Mkms_0425"
FT   CDS_pept        469026..469877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0425"
FT                   /product="glycoside hydrolase, family 16"
FT                   /note="PFAM: glycoside hydrolase, family 16; KEGG:
FT                   mmc:Mmcs_0416 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89642"
FT                   /db_xref="GOA:A1U9Y4"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y4"
FT                   /protein_id="ABL89642.1"
FT                   /translation="MDRRSAMLMFGVGVAAAALPVAKAGAQPVIGDTPPGPGVPEAGVP
FT                   GLLFSDEFNGPAGAPPNPASWFIVPARETIRNPVEWDKPFNMGRYVTDQEHVFQDGAGN
FT                   LVIRATRGPGANIQEKYASGKVIGNWRGGVGTTWEARIKLNCLTDGAWPAFWLINDNPV
FT                   RGGEVDLVEWYGNRDWPSGTTVHARLDGTQFQTHKHPVDSDWHTWRMTWQPQGMYFWKD
FT                   YQPGMEPFFTVLANSLPEWPFNDPGYTMAPVFNIAVGGSGGREPAGGNYPAEMLIDWIR
FT                   VF"
FT   sig_peptide     469026..469106
FT                   /locus_tag="Mkms_0425"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.817 at
FT                   residue 27"
FT   gene            complement(470192..470314)
FT                   /locus_tag="Mkms_0426"
FT   CDS_pept        complement(470192..470314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89643"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y5"
FT                   /protein_id="ABL89643.1"
FT                   /translation="MLTVVLVVVLVTTLVDVLGSAVVVGGGVLVSVIVTVSVSV"
FT   gene            complement(470381..470806)
FT                   /locus_tag="Mkms_0427"
FT   CDS_pept        complement(470381..470806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89644"
FT                   /db_xref="GOA:A1U9Y6"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y6"
FT                   /protein_id="ABL89644.1"
FT                   /translation="MRRLVVRAGAVVGAVVTSGCGLTGSPPSEPSAQAGQITLDGQTRE
FT                   TRSVECSQIEWSLMIDAGAEPGRAHAYLRLGGQEPVVETVSIDDIGPVNGVAGGDLGKA
FT                   EATLDDTIYTITGTVVGPDPANPGQSQTMPFEIKAPC"
FT   sig_peptide     complement(470702..470806)
FT                   /locus_tag="Mkms_0427"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 35"
FT   gene            complement(470885..471910)
FT                   /locus_tag="Mkms_0428"
FT   CDS_pept        complement(470885..471910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0428"
FT                   /product="PE-PPE, C-terminal domain protein"
FT                   /note="PFAM: PE-PPE, C-terminal domain protein; KEGG:
FT                   mmc:Mmcs_0419 PE-PPE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89645"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y7"
FT                   /protein_id="ABL89645.1"
FT                   /translation="MLLGNGSRPNGGLMSRFDGAYIPILDVSFIGPTPTTTAGATPGEI
FT                   TTYDIARQYDLFADFPTNPLNILAVANAFAGQLFVHPDYGSVDMSQAVFQGTYGDTAYY
FT                   LIPTYPLPLLMPLTWIPVIGPIAVDMLDPVLRVLVEAGYDRTINPGVPTPANFLYLPDP
FT                   VTLGSSLLHAIPTGLTYGTQDILHLREPGTPPPGVAGQDAYGIGGPSVTLPNQTPPPAP
FT                   PVQTVAAPSTPKVPSATPTTAVPLSDGVNDSVIPSTSPPAPKQHIVDEPIGGSSSNGAV
FT                   KRSASTADDAPADASTQSRPKSSGTTDRPSGAGNSNGKGGSSSSSTGNSNGKGSSSSTG
FT                   D"
FT   gene            complement(471947..472384)
FT                   /locus_tag="Mkms_0429"
FT   CDS_pept        complement(471947..472384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89646"
FT                   /db_xref="InterPro:IPR013228"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Y8"
FT                   /protein_id="ABL89646.1"
FT                   /translation="MRILARSGLALLVAVGTVLLALVSTVTLVFTLAASTYVIRGTEYG
FT                   VPFCLPFCHGNPTPEELAMPYVDGTVNNPPDGIVVVDYPASFWPFSDGYFVDPTYDDAV
FT                   EQGVNALPPPGQFQDLDGSVIFGYSQGTQVATLYKREFNEY"
FT   sig_peptide     complement(472283..472384)
FT                   /locus_tag="Mkms_0429"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 34"
FT   gene            complement(472594..473043)
FT                   /pseudo
FT                   /locus_tag="Mkms_0430"
FT   gene            complement(473086..474333)
FT                   /locus_tag="Mkms_0431"
FT   CDS_pept        complement(473086..474333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0431"
FT                   /product="transposase, mutator type"
FT                   /note="PFAM: transposase, mutator type; KEGG: mmc:Mmcs_5364
FT                   transposase, mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89647"
FT                   /db_xref="GOA:A1U8V0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:A1U8V0"
FT                   /protein_id="ABL89647.1"
FT                   /translation="MTAPHIVDPAGLLGEALSEASPDLMRSLLQTVINALLSADADAVV
FT                   GAEWGQPTPGRRSQRNGYRHRGLDTRVGTIDVAVPKLRKGTYFPDWLLERRKRAESALI
FT                   TVVADCYLAGVSTRRMDKLVKTLGIDSLSKSQVSRMATDLDEHVEQFRHRPLDSAGPFT
FT                   FVAADALTMKVREGGRVVNGVVLLATGVNGDGHREVLGMRVVTSETGPAWNEFFADLVA
FT                   RGLAGVRLVTSDAHAGLREAIAANLPGAAWQRCRTHYAANLMSICPKSMWPAVKAMLHS
FT                   VYDQPDAPAVAAQFDRLIDYVTDKLPAVAEHLSAAREDILAFTAFPKDVWTQIWSNNPA
FT                   ERLNKEIRRRTDAVGIFPNRDAIVRLVGAVLAEQNDEWAEGRRYLGLDILARCRLTTIT
FT                   NDNPEIGADDMPALTA"
FT   gene            474632..476032
FT                   /locus_tag="Mkms_0432"
FT   CDS_pept        474632..476032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0432"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain; KEGG: mmc:Mmcs_0422 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89648"
FT                   /db_xref="GOA:A1U9Z0"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z0"
FT                   /protein_id="ABL89648.1"
FT                   /translation="MTAEPSRIVVTGASGNVGTGVLRALASQLPDAEVVGVCRRPPTDG
FT                   EPYERVRWHTVDLSAPSAVADLEPALRGADVVIHLALAVHPVRDEHYLYRANVLGTQAL
FT                   LKAMTAAGVRQLVYASSLGIYAPGSGPPVTEDWPTTGQTTSVYSRHKVMVEQVLDEFEL
FT                   DHPEVTVSRFRPTVVVQREAAWLIKSLYLGPLVPRSVLELLRRRELPVLPVPAPLALQF
FT                   VHADDVGDAVVRMVTQQVRGSFNIAADVLDTAALADLVGARPVSVPPQAVRTLIAALSA
FT                   VRVVALTPGWYDVAFKTPLMDTSKARRTLGWEPARSSAESARELIEGLADGAVGTSAAM
FT                   GWRLRPRRDVRAAVDRAHDVTLVSWGALALLRAAGMRRARVVDAVVVASNLATGTPMAL
FT                   DRILERRADPVALLAPVAVLAALGATLCGGWPAVAVTGALQVLRMSERNQRKAKLVSNA
FT                   EVPAGSRG"
FT   gene            476042..476917
FT                   /locus_tag="Mkms_0433"
FT   CDS_pept        476042..476917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0433"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; Male
FT                   sterility C-terminal domain; KR; KEGG: mmc:Mmcs_0423
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89649"
FT                   /db_xref="GOA:A1U9Z1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z1"
FT                   /protein_id="ABL89649.1"
FT                   /translation="MDESAATPEVVVVTGASSGIGEETALRYAGRGARLVLAARTEDAL
FT                   QRVADACRAAGAEAVLVQATDIADAAEVEELFGVAEGHFGRIDIVVQSAAITAFGRFED
FT                   VPAGVFDSIVRTNLIGSANVARSALAHFHKRGRGHLVLIGSLLGTAAAPYQSAYVASKF
FT                   ALNGLVRTLRQENRHLSGIKIHGVYPGPVDTPVYGTASNYFGRAPRVPPTAVKPSSVVS
FT                   AIVRATDRGRSSERQVGVFNRPVIAMYRLAPPVYDVLMGVFLRTFGFTSESTEPTHGNA
FT                   FARDRHPKAD"
FT   gene            complement(476929..478272)
FT                   /locus_tag="Mkms_0434"
FT   CDS_pept        complement(476929..478272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0434"
FT                   /product="Triacylglycerol lipase"
FT                   /EC_number="3.1.1.3"
FT                   /note="PFAM: secretory lipase; KEGG: mmc:Mmcs_0424
FT                   triacylglycerol lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89650"
FT                   /db_xref="GOA:A1U9Z2"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z2"
FT                   /protein_id="ABL89650.1"
FT                   /translation="MDDYSATQVRAAHAPHDELRRGERPIPPDHDPFYRAPEGYEHAEP
FT                   GTVLRSRDVEIGFLGLVGQPVKAVQLLYRTTNLHEEPEVAVTTVLVPAQREPDVAYPML
FT                   SYQCAIDAVASRCFPSFAMRRGAGPIGAFTQAEYLLVTAALAEGWAVCVPDHEGCHGMW
FT                   GAPVEPGYRILDGLRAAQQCERLDLSPSAPVGLWGYSGGGLASAWAAELCERYAPELNI
FT                   VGAVLGSPVGDPGSVARRLNGSFFAGLAALMISALTQVFPGAQNVVDEHATDEGKALLE
FT                   KLQTMTTAQAVWQLRNVDIGSYVDMTADELWDLPEVRHIFDETKLGKSTPKPPVLVIQA
FT                   VHDGIISVDDVDALVAEYERIGAAVTYHRDRFCGHLLLHPLSAPMTLRWLRDRFTDRPV
FT                   YEHKTRTVWPTMFNPSTYLGMVKLGVITAKVVLGRSVERQPLSTTDAP"
FT   gene            complement(478389..479642)
FT                   /locus_tag="Mkms_0435"
FT   CDS_pept        complement(478389..479642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89651"
FT                   /db_xref="GOA:A1U9Z3"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z3"
FT                   /protein_id="ABL89651.1"
FT                   /translation="MQDHLPPRAVPRSVRVWGPIVLSVALALYVAAYLRWPSLASQVDL
FT                   LVYRFGAERAWDGQDLYSVGLTGNPDTMLFIYTPFSALCFLPLIGLSQPGVLVLGLLVN
FT                   VACMGYIVSRMLSAAGIRTATGLWGLTALLMAPIIWLEPVRLSLQLGQINVLIMAIVVA
FT                   DLLAQPSRRWTGMGIGVAAGIKLTPALFIVFLVATGRRREALVAGLTFVSTIAVGFVLL
FT                   PADSTEFWLQKRFQDVGRISSDPLANTSLAGLLTRFNWVPPWPTVAAGVFAIVAIAIAA
FT                   LAWRRGQRLLSVAIAGMTSAAASPFSWSHHWVWFAPLLVHLGYLGYVHRSRVAALAMWV
FT                   LAAIFGGWFVASRSLPPQAGLMSLRHPGTWDQLLPAAYLFALTIVLICSVCGLWRARQH
FT                   PPAGVDATVESSRQRASI"
FT   gene            complement(479962..481254)
FT                   /locus_tag="Mkms_0436"
FT   CDS_pept        complement(479962..481254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0436"
FT                   /product="protein of unknown function DUF222"
FT                   /note="PFAM: HNH endonuclease; protein of unknown function
FT                   DUF222; SMART: HNH nuclease; KEGG: mmc:Mmcs_0426 protein of
FT                   unknown function DUF222"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89652"
FT                   /db_xref="GOA:A1U9Z4"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z4"
FT                   /protein_id="ABL89652.1"
FT                   /translation="MSSNASSGAVALLPKERLEVLFEEVAELAGQRNAIDARLVEIAAE
FT                   IDHDGLGGITGAKSVAHLMAWKTGSSSRNGKTIAAIAHRIAEFPRCVQALRDGRLSLDQ
FT                   VGVIAEGAGAGSDEHYAELARSASVTQLRTAIRLEPRPAPEPEKDADGEPKPVPVAQAS
FT                   IRKTSDEQYTYWRIALPHVEAAVFDAALRSHHDALIAQWKRDHDTPTDTPAGTPAGGRP
FT                   PMPALADAFAALVEAGWDTEVTRRPHGQRTTVVVHLDLDERIAALHLGPLLSEADRRYL
FT                   GCDATCEVWFERHGQPIGAGRTTRMISRRLRRALEHRHRTCAVPGCGATRGLHAHHIQH
FT                   WEDGGATDLDNLVLLCPYHHRAHHRGVITITGPADQLPVTDSTGRHLTSGSLARPPNQP
FT                   PPTVAPYRGPSGERADWWWYTPFQPPPPTTN"
FT   gene            481399..483033
FT                   /locus_tag="Mkms_0437"
FT   CDS_pept        481399..483033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0437"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Tetratricopeptide
FT                   TPR_4; KEGG: mmc:Mmcs_0427 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89653"
FT                   /db_xref="GOA:A1U9Z5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z5"
FT                   /protein_id="ABL89653.1"
FT                   /translation="MVRDARAEASTAYERHGWEDAYNLLSSADAQDSLAAEDLNRLATA
FT                   AHLTGRFDAAGEAWERAYRAYVEHGHVAEAVRCSFWHALTLMLRGEHARGSGWLVRAQG
FT                   LLEEAGLDSVERGYLRIPVALQALGGGDPSAAYAEFDAIAAVARRFGDPDLRALGQLGR
FT                   GQALVARGEAARGTAIFDEAMLAVTTGEVSAIAAGIVYCAVIISCQQVFDVRRAAEWTA
FT                   TMSRWCAEQQGLKAFRGQCLVHRSQIMQLQGEWSDAMEEVRRACDALSDVPGDPVLGMA
FT                   HYQQAELLRLRGELDRAELAYREASGWGHPVQPGLALLRLAQGRVDDALAAIRRAMAAA
FT                   EGPVERSRVLAAYAEIALAAGDVEAARSAAEQLETIAADFESPYLRAVGEYARGSVLLA
FT                   GGDPAAACTVLRRSWAAWQELDAPYEAARVRLRMAQACRRMNDDDTAAMELDAARRVFE
FT                   QLGAAPALAQVAEVSTNAPAGAPSGLTTRELEVLRLLATGATNREIAHTLVISEKTVAR
FT                   HLGNIFNKLDVSSRTAATAYAYQHDLV"
FT   gene            483270..484106
FT                   /locus_tag="Mkms_0438"
FT   CDS_pept        483270..484106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0438"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Cyclopropane-fatty-acyl-phospholipid synthase;
FT                   UbiE/COQ5 methyltransferase; Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: mmc:Mmcs_0428
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89654"
FT                   /db_xref="GOA:A1U9Z6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z6"
FT                   /protein_id="ABL89654.1"
FT                   /translation="MNIHAPSQDLIRDAWDAIAPRFDEFVTPESMQYGAHALRQLHIGR
FT                   GTRFLDVACGSGALSLPAARLGADVVAVDISQAMTERVAARARAQGLSNIWCRVMNGQD
FT                   LDLADDTFDIAASQHGVSLFPDVDAGLAEMVRVTKRGGTVLVIAFGALPKAEFLAFFVA
FT                   AIKAAVPGFAVLPLDPPPLPFQLADRELFRSKLITAGLNDVTVERTAWEMPFRSGAHMC
FT                   TMVTSSNPLGAQLVAGLTAAQRADVEHVLDGILRERSGGQPGAVLYADVNVGVGTK"
FT   gene            484153..484809
FT                   /locus_tag="Mkms_0439"
FT   CDS_pept        484153..484809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89655"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z7"
FT                   /protein_id="ABL89655.1"
FT                   /translation="MRGAQPSTHLVLIRPSGSGTRGSLCHLPERVAPGTAGFPPTTNRV
FT                   YPLVNATGTVLVTDVIGTGAPGDPLSTILTLCRPGEMPVVVEIPGPPVGKGLGADGTVT
FT                   YAASTASGSTFTVLRPGQPAVTISTPGLVSNGPVVGPDGTLYQVTDDRVSGRTNLTIVT
FT                   AAGEVTRLDFAGSSPSLAIDPDGGKVVLVMTTREGGIETRTGYEIAVVTGAASSV"
FT   gene            complement(484820..484893)
FT                   /locus_tag="Mkms_R0004"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(484820..484893)
FT                   /locus_tag="Mkms_R0004"
FT                   /product="tRNA-Gly"
FT   gene            484953..485525
FT                   /locus_tag="Mkms_0440"
FT   CDS_pept        484953..485525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0440"
FT                   /product="dCTP deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="TIGRFAM: deoxycytidine triphosphate deaminase; PFAM:
FT                   deoxyUTP pyrophosphatase; KEGG: mmc:Mmcs_0430 deoxycytidine
FT                   triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89656"
FT                   /db_xref="GOA:A1U9Z8"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1U9Z8"
FT                   /protein_id="ABL89656.1"
FT                   /translation="MLLSDRDIRAEIDAGRLGIDPFEDSLVQPSSVDVRLDTLFRVFNN
FT                   TRYTHIDPAKQQDELTSLVEPSPGEPFVLHPGEFVLGSTLETCTLPDDLAGRLEGKSSL
FT                   GRLGLLTHSTAGFIDPGFSGHITLELSNVANLPITLWPGMKIGQLCLLRLTSPAEHPYG
FT                   SAKVGSKYQGQRGPTPSRSYQNFIKLS"
FT   gene            485801..487612
FT                   /locus_tag="Mkms_0441"
FT   CDS_pept        485801..487612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89657"
FT                   /db_xref="GOA:A1U9Z9"
FT                   /db_xref="UniProtKB/TrEMBL:A1U9Z9"
FT                   /protein_id="ABL89657.1"
FT                   /translation="MKVLVVGSFGSGAPGRHNRYSKLLEGLVDIVLGVSMTPTTVRMVL
FT                   VEGEKADGVTVDHDVFDINAVEGSATSNAADQVVAAVLGTQESAAAGGHHLRSVGVAWS
FT                   DHASAAALRDTLTARGIEDVMLVSEGHAAASLAQAVGRAVGYTATALFFIDRDAATLSV
FT                   VQTDDGSVTKVLSRSLHSTDAMAVLTEMAAAVDAQDSPPQGMFVVGSGVDVSEVKAHLG
FT                   RLLSLPINAPEEPELALARGAALASAHAPDFEASTVGLAYSQDPEEGTTAGSSYAAFGA
FT                   AATQLAPVSSAAAAPPMVFAAPEAVPTPADDENRKPFLLVGSALSSIFVVGVVALVISL
FT                   AVNIRPTADQRPSPAEAAIVPSAQAPRPAPAPEAQPAVAPPAPPAETIKAPVPVVREAP
FT                   APAAPRTVYVEKAPVPAAPPAPAPLPAAPPAPVPAPIPAAPVPAPVPVLPAPVFRPPVV
FT                   LPPPVIRLPRPQLPPIFRDDDEPERPSWPNPWQPKPQTPPKQDDDYWPQRPTVPTVPQA
FT                   PKPVVPQVPQTPYVPSVPQTPYVPSVPQAPSNPYYPPSSSGGGSGSSRGDYGSGSGSGS
FT                   GSGSYDGGGSSGGEDSVWPFPSFGGGD"
FT   gene            487605..487961
FT                   /locus_tag="Mkms_0442"
FT   CDS_pept        487605..487961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89658"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA00"
FT                   /protein_id="ABL89658.1"
FT                   /translation="MTERTVAFPAMSPVYALNLFDVANRDEYLAYARRSPAAVTAHGGR
FT                   VVALGKFRESVTGDIEPRQVLILVEWESKEAFDSYRNDPDLADLHPHREDGSSAYVWHL
FT                   FDRLDDLRPLLKLE"
FT   gene            487961..489304
FT                   /locus_tag="Mkms_0443"
FT   CDS_pept        487961..489304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0443"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0433
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89659"
FT                   /db_xref="GOA:A1UA01"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA01"
FT                   /protein_id="ABL89659.1"
FT                   /translation="MVHDSSGATVRQRVRWLALHGFVRGMSRLGMRRGDPQARLIADPT
FT                   VRANPAAFADEHRVKGPLIRGRVGLITFDHAVAHELLRSDDFRVSSLGGELPKPLRRVI
FT                   DRTDTGLLHPIEPPSLLSIEPPDHTRCRKLVSSVFTTRAVTALRDGVETTAVKLLDDLE
FT                   RDATGSGPVDIVARYCSLLPVSVISDVLGVPEADRAQILHYGELGAPSLDIGLSWQQYL
FT                   RVHSGIVGFNAWLVNHLENLRRNPGDDLLSQLISATEDGAGLSERELQATAGLVLAAGF
FT                   ETTVNLLGNGIKMLLDHPDQLAKLRDRPELWPTAVEEILRLDSPVQMSARVAKKDVEVA
FT                   GVPVRAGELIIIHLAGANRDPKVFDDPHRFDIERDNAGKHLSFSGGRHFCLGAALARAE
FT                   GEVGLRTFFDRFPDAKLAGTASRRDTRVLRGWSTLPITLGTARAALGS"
FT   gene            489306..490055
FT                   /locus_tag="Mkms_0444"
FT   CDS_pept        489306..490055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0444"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   mmc:Mmcs_0434 protein of unknown function DUF1503"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89660"
FT                   /db_xref="GOA:A1UA02"
FT                   /db_xref="InterPro:IPR010872"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA02"
FT                   /protein_id="ABL89660.1"
FT                   /translation="MDFRAALLEQTNSFGDLIATGDPETPVTTCGDWTLRQLFRHVGRG
FT                   NRWAAQIVAERRHEPLDPREVRDGRPPEDPDGAIQWLREGARLLIHAVDSVGSGTKVWT
FT                   FLGTRPAGWWIRRRVHEVAVHRADAALALGQPYDLPPDLAADALSEWIELAAVQAGRRG
FT                   LPIERGHTLHLHATDESLGGVGEWMITSTEDGIDWTHEHGKGDVAVRGPVADLLLAVTR
FT                   RRTLADSGLEAFGKTEIWDRWLEQTPF"
FT   gene            490076..490444
FT                   /locus_tag="Mkms_0445"
FT   CDS_pept        490076..490444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0445"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89661"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA03"
FT                   /protein_id="ABL89661.1"
FT                   /translation="MTTSEKATVLAWHDALNARDIDTLLELSSDDIEIGDAHGAAQGHA
FT                   ALRDWARALDVNAEPGRLYIRDGVVVVEQQITSVTGETGTAASAFRVVHDKVTSMFRHA
FT                   DLSSALAATELGEEDLTG"
FT   gene            490444..491307
FT                   /locus_tag="Mkms_0446"
FT   CDS_pept        490444..491307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0446"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: mmc:Mmcs_0436
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89662"
FT                   /db_xref="GOA:A1UA04"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA04"
FT                   /protein_id="ABL89662.1"
FT                   /translation="MRGIILAGGSGTRLYPITLGASKQLLPVYDKPLIYYPLSTLIMAG
FT                   IRDIQVITTAEDAPAFHRLLGDGAHFGVNLTYAVQDEPDGLAQAFVIGADHIGTDSVAL
FT                   VLGDNIFYGPGLGTGLRRFHDVSGGSIFAYWVANPSAYGVVEFSADGTALSLEEKPATP
FT                   KSHYAVPGLYFYDNDVIEIAKSLKKSARGEYEITEINQRYLDQGRLTVEVLARGTAWLD
FT                   TGTFDSLLDASDYVRTIERRQGLKISVPEEVAWRVGFIDDEQLAARGHSLLKSGYGAYL
FT                   LELLDR"
FT   gene            complement(491308..493398)
FT                   /locus_tag="Mkms_0447"
FT   CDS_pept        complement(491308..493398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0447"
FT                   /product="xanthine dehydrogenase, molybdenum binding
FT                   subunit apoprotein"
FT                   /EC_number="1.17.1.4"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mmc:Mmcs_0437
FT                   aldehyde oxidase and xanthine dehydrogenase, molybdopterin
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89663"
FT                   /db_xref="GOA:A1UA05"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA05"
FT                   /protein_id="ABL89663.1"
FT                   /translation="MTLLDPQAIGAPMARLDGRAKVTGAAPYAFEQRVDDPAYLHPIQS
FT                   TIARGRVAAVDTDAARAIDGVLDVLTVFDAPELADTSDGELSILQDDRVHFRGQIIGGV
FT                   VAETAEIARHAAGLVQVRYTEESHDVELTADHPGLYTPEQVNAGYPSDTDEGDVEAALA
FT                   SAEVTVDQTYSTPIEHNNPMEPHAAIAIWTADGVTMFDSTQGVHAARKALAPLFGLEPD
FT                   QLRVIAPHVGGGFGSKGAPHAHDVLALLAAQRSGGRPVKLALTRQQMFALVGYRTPTIQ
FT                   RIRLGANQDGTLTALAHEVVEQTSAVKEYAEQTAVTSRKMYAAPNRRTAHRLAALDVPV
FT                   PFWFRAPGECPGAYAAEVAMDELAAACGVDPIELRVRNDPEVDPETGNPWSGRHLVECL
FT                   RLGAERFGWSSRDPVPAQRFSGDWYVGLGVASATYPAMQMPGNSARITYADEGRYLVQI
FT                   GAADIGTGTWTTLTQIAADALGCDVAAVDLQIGDSALPEASVAGGSSGINSWGRAIVTA
FT                   ARQFRRDHGDPPAIGATTVAEAPENPESEKFTMQSFGAHFVEARVNRDTGEIRVPRMLG
FT                   VFSIGRAINARTLRSQLIGGMTMGLSMALHEESVRDPRFGHVVTQDFATYHISAHADVA
FT                   DIDAIWLDEADEHANPMGSRGAGEIGIVGSAAAVVNAVYNATGVRVRDLPVTLDKVLSG
FT                   LP"
FT   gene            complement(493395..494387)
FT                   /locus_tag="Mkms_0448"
FT   CDS_pept        complement(493395..494387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0448"
FT                   /product="molybdopterin dehydrogenase, FAD-binding protein"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0438 molybdopterin dehydrogenase, FAD-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89664"
FT                   /db_xref="GOA:A1UA06"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA06"
FT                   /protein_id="ABL89664.1"
FT                   /translation="MRAFDYHLAESPADAVATLTAHPDAAYLAGGTNLVDHMKLGVATP
FT                   DLLVDVSRLPLDEVTATDDGGVRIGATVRNSDLAAHPVIRSRYPVLSRAMLSAASGQLR
FT                   NSATTAGNLLQRTRCVYFQDVTTPCNKRSPGSGCSAIGGYVRYHAILGASEHCIAVHPS
FT                   DMAVAMSALDGVVVVEGSDGERRIPIDEFYRLPVDEPHRDTVLRHGELITAVELPAPPP
FT                   GAVSEYRKVRDRASFAFALVSVAAELSLSDDRIGSARIAFGGVAHKPWRARRAEEVLTG
FT                   APPTDNTFAAAADAELSAADPQPGNEFKVALARRTLIAELRALTGRGRP"
FT   gene            complement(494398..494919)
FT                   /locus_tag="Mkms_0449"
FT   CDS_pept        complement(494398..494919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0449"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mmc:Mmcs_0439 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89665"
FT                   /db_xref="GOA:A1UA07"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA07"
FT                   /protein_id="ABL89665.1"
FT                   /translation="MTQPTGHREVTLEVDGRPHTLHLDNRVTLLDALREHLGVTAPKKG
FT                   CDHGQCGSCTVLRDGRRVTTCLTFAVAADGAHITTAAGLGDGDDLHPVAQAFSDEDGFQ
FT                   CGYCTPGQICSAVGMLDEVKSGAPSFVSDDLEAVPELTDDEIRERMSGNLCRCAAYPNI
FT                   VAAIERASVQ"
FT   gene            complement(494916..496190)
FT                   /locus_tag="Mkms_0450"
FT   CDS_pept        complement(494916..496190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0450"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: mmc:Mmcs_0440
FT                   YibE/F-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89666"
FT                   /db_xref="GOA:A1UA08"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA08"
FT                   /protein_id="ABL89666.1"
FT                   /translation="MSHSHPHSHSLSGPSPLGPLAARIVVGLLALIGVAVAIGAVLLWP
FT                   SQQKADIPLPFQNAEGGAVTTEAGQVRATSLAPCGSPSAGQVLTADPVPTPADGSQCVQ
FT                   VLVAIDSGPNKGANTLLEFSGGPGQPQLAAGDDIRLSRQVSPGGATSYTFYDYARGWPL
FT                   ALLAAAFAVVVVAVARWRGLRALVGIVVAFAVLVVFLLPALRDGASAVPVALVASAVIL
FT                   YAVIYLAHGVSLRTSAALLGTLTSLLLAAVLSWGAIEIAHLTGLSEDQNNEVAAYLGNV
FT                   SITGLLLAGFIIGSLGVLNDVTVTQASTAFELAELEGSSRRAVFVGAMRVGRDHIASTV
FT                   YTLVLAYAGSALPLLLLFSVANRSLVDVLTSESVAIEVARSAVGGIALALSVPLTTGIA
FT                   AVLATPRADNHPRRFAVRPWGIRPP"
FT   sig_peptide     complement(496077..496190)
FT                   /locus_tag="Mkms_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.666) with cleavage site probability 0.265 at
FT                   residue 38"
FT   gene            complement(496194..497480)
FT                   /locus_tag="Mkms_0451"
FT   CDS_pept        complement(496194..497480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0451"
FT                   /product="aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   mmc:Mmcs_0441 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89667"
FT                   /db_xref="GOA:A1UA09"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA09"
FT                   /protein_id="ABL89667.1"
FT                   /translation="MDDVTMPQTPAERTWHPQGHQPRPRTFTQSSKLQDVLYEIRGPVH
FT                   EHASRLEAEGHRILKLNIGNPAPFGFEAPDVIMRDIIQALPYAQGYSDSKGIMPARRAV
FT                   FTRYELVDGFPRFDVDDVFLGNGASELIQMVLQALLDNGDQVLIPAPDYPLWTACTSLA
FT                   GGTPVHYLCDETQGWNPDVADIESKITDRTKAIVVINPNNPTGAVYSRETLERIADLAR
FT                   KHQLLLLADEIYDKILYDDAKHISLASVAPDVLTLTFNGLSKAYRVAGYRSGWLVITGP
FT                   KEHASSFIEGISLLANMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWEK
FT                   LNEIPGVSCVKPAGALYAFPRLDPEVYEIHDDELLVLDLLLQEKILVVQGTGFNWPTPD
FT                   HLRIVTLPWARDLANAIERLGNFLVSYRQ"
FT   gene            complement(497563..500703)
FT                   /locus_tag="Mkms_0452"
FT   CDS_pept        complement(497563..500703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0452"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: mmc:Mmcs_0442 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89668"
FT                   /db_xref="GOA:A1UA10"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA10"
FT                   /protein_id="ABL89668.1"
FT                   /translation="MDTQILIRLIVGLLMTGIVIALAAKRVLWLTKLIRSGAPTSEANN
FT                   RKDNLGKRITTQFEEVFGQTRLLRWSIPGIAHFFTMWGFFILASVYLEAYGLLFDHDFH
FT                   IPIIGTWDALGFLQDFFAVAVLLGIITFAIIRIVREPKKHGRDSRFYGSHTGGAWLILF
FT                   MIFNVIWTYALVRGAAADVGNLPYGNGAFFSQFMGWVLSPLGHDVNEWVETIALLLHIA
FT                   VMLVFLLIVLHSKHLHIGLAPINVTFKRLPNGLGPLLPMEYNGEPIDFEDPAEDAVLGR
FT                   GKIEDFTWKGYLDFTTCTECGRCQSQCPAWNTGKPLSPKLVIMNLRDHMFAKAPYILGD
FT                   KESPLENTPEGGLGEELRGEKESEKHSHDHVPESGFERIMGSGPEQATRPLVGTLEQGG
FT                   VIDPDVLWSCTTCGACVEQCPVDIEHIDHIVDMRRYQVMMESEFPGELGVLFKNLETKG
FT                   NPWGQNAKDRTNWIDEVDFDVPVFGKDVESFEGYEYLFWVGCAGAYEDRAKKTTKAVAE
FT                   LLAIAGVKYLVLGEGETCNGDSARRSGNEFLFQQLAAQNVETLNDLFEGVERVDRKVVV
FT                   TCPHCFNTLGREYPQVGGNYTVLHHTQLLNRLVRDKKLVPVTPADGGADITYHDPCYLG
FT                   RHNKVYEAPRELIGASGAKLTEMPRHADRGLCCGAGGARMWMEEHIGKRVNVERTEEAM
FT                   DTASTIATGCPFCRVMITDGVDDVAATRNVEKAEVLDVAQLLLGSLDKSGVTLPEKGTA
FT                   AKEAEERAAVRAEETAAAAPAPEKAPEKEPEAPAEAPAAKASTATESKPAAAAPAKGLG
FT                   IAGGAKRPGAKKTATEKTAAAPAEAKAEAPAAAPAKGLGLAAGAKRPGAKKTATEKTTA
FT                   APEAKAETAGTTEAPAEAKPEPEVKGLGLAAGARRPGAKKAPAKASPNEGAATVVQPPN
FT                   ADPDQAEAGTEAPDTADSDRGLETKPEPEVKGLGIAAGARRPGAKKKPAAPAAAPAKPA
FT                   EPEPQAQPEAQAEPAPEPEPEAPSQPASGNGDARVVGDEPPVKGLGIAKGARRPGKR"
FT   gene            complement(500840..503377)
FT                   /locus_tag="Mkms_0453"
FT   CDS_pept        complement(500840..503377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0453"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2; KEGG: mmc:Mmcs_0443 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89669"
FT                   /db_xref="GOA:A1UA11"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA11"
FT                   /protein_id="ABL89669.1"
FT                   /translation="MASPAPHRPAELPAAAREAVTAIEADPAAPAKVLVTGGIGTGKST
FT                   VLAAVRAALRSAGRPVLSRPRRPDDPAEAAVVVDDAHLLDPGDLDRLTDLVADSGSTVV
FT                   IATQPLAHNAPLRALVTALERENPAVALGSVTAVEVGRAAAATLGAAPAPEVVRLLTAV
FT                   TAGLPFLLRPALAAVGDGAAAVRQAARIALIERLRRLDEPLLDTLLVASLSPELGPDDV
FT                   AAALHIPSDAALAVVDRARASGLLEPAYHHSFLRTVHEGIAQLVGAARHHDIEVSLLCS
FT                   QLELSTLTADLALRMAEHGLRDERLGTALADLAAQTANDPARSARLYRAAADAGATALS
FT                   AQLADALALTGDCATAGRIADELLTSQDPDERAAAVRISASIAMHDGSAAQAFDLFRWL
FT                   GPSPDALLSAAGTVAALAAADGDTARELARTQATGPPTSIARAARSLADGLMLSLDQPY
FT                   PVAAARLGQSLNADAGVVTPDTPAALVTLAALHGGDPVRARSVMGRAVRSGRDDGSGDA
FT                   IFVTYRHRLLLGWTHMQDGQLQAAATALPRPTADLHRRDALWAAALQTAIARRSGDSGA
FT                   MQMHWYSAMEVLAEYSVDLFALLPLGELWVAAARLRQVERLQHTLDEAFALLTALGDPV
FT                   LWSVPLHWAGVHAGILANSPEAVAPHGQALTAASRDGRAQSAFAKALASAGRTWLRVLA
FT                   NHVDVDEVSAAARGLAQFGHTWDATRLAGQAALQTPDGRVSQAMLQIARDLKQSVAGAE
FT                   VLTETTGMDAPTPAAATPAATPARAAPAQLSEREREVAELLLLGMPYRDIGAQLFISAK
FT                   TVEHHVARIRRRLGAESRSEMLSMLRALLAPSG"
FT   gene            complement(503387..505192)
FT                   /locus_tag="Mkms_0454"
FT   CDS_pept        complement(503387..505192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0454"
FT                   /product="conserved hypothetical proline and threonine rich
FT                   protein"
FT                   /note="KEGG: mmc:Mmcs_0444 conserved hypothetical proline
FT                   and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89670"
FT                   /db_xref="GOA:A1UA12"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA12"
FT                   /protein_id="ABL89670.1"
FT                   /translation="MTEPLGLSIGMTNLVAARVGRPPVIRRAILTLFADRAPEVGVPSE
FT                   WSANPTEPGLVLSGFVDRVGDPVPLVASDGSAHRGELVLAEALDAMARTVDGGSPIAIA
FT                   VPAHWGPGTVGALRGALRNRPNLAPHWVPAALIPDSTAALAALQAAPGLPDHGVVVLVD
FT                   LGGSGSSISLADAGANLDAVGQTVRYPEFSGDAIDQALLNHVLVGIADAGSADPASTAA
FT                   VGSLARLRDECRQAKERLSADTATAVPVDLPGVQSDIRVTRPELEQLISEPLGGLLNAI
FT                   EDTLQRNQIPVANVTAVATVGGGAAIPLVTQRLSEHLRAPVVTTPESQLNVAAGAALVA
FT                   NQSADADAPTGMAPAADAPTSMGAAAWAAGAAGLAAGAAAADGASSATFRALAWSQDDE
FT                   PAGEPVPYAGADYDPSATGARPPVAFAPDDTGYGAGYGEEPGPLPWYKRPPVLFGAAAA
FT                   AALAALSGLAITLTGTEGDSTPVTETATTFSMEPSPQAPPPPVTTVTIGPDGVATTTVS
FT                   QPPPPPPTTTQQTTTTTQPTTTTTTTTQQTTTTTQPTTTTTRPTTTQPPTTTQPPPTTT
FT                   AAPPPTTVDPPDPPVTTVPVPDDGA"
FT   gene            505440..505964
FT                   /locus_tag="Mkms_0455"
FT   CDS_pept        505440..505964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0445 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89671"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA13"
FT                   /protein_id="ABL89671.1"
FT                   /translation="MANSLLDFVMSLVRDPDAAARYAADPAAAIADAQLTDVTSVDVDN
FT                   LIPVVTESMPMAAASTGLDPFGAEAAGNVWSSGAATAAFDAFADPAPASAVIDTTSAVI
FT                   DTTDHFDQAADPLTGSDTLVDSLSTQLTDPALDEATPAGTGLDDVWGAALDDVQPADHD
FT                   PGQNPGFDLFD"
FT   gene            506080..507300
FT                   /locus_tag="Mkms_0456"
FT   CDS_pept        506080..507300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0446 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89672"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA14"
FT                   /protein_id="ABL89672.1"
FT                   /translation="MGMGSHPLRGSLSEGWQPRWPGVSNSITWCPDRRRAGETTSPGNR
FT                   EDTKGSHMNIIDFILDLFRSPAAAASFVVDPDGALRDAGLPNVTAAQLASVAATAAPAG
FT                   YALGGGDPIVGLQRAVADHHQLASNFASPFSPQTSFAPTTEFASRNDTDLLSGNNVPIA
FT                   SPDQAAGANAQNGAFNLGFGDITLGDKTTQTATNGGVVVGGDNDGDIVSGDGAVLGDGN
FT                   TMNNGDILAGSGSNVVVGKDNEVEDNSQTAGGDLIADNDAPVLNDVDTSGGNGGGADGG
FT                   GSLIGIGGGNAAGGDGGNGGGIIITDNDVNAGTQIDGDYGSDNVEDNSVSTSVETNTST
FT                   STESKIEDNSSSYESNIGSGNDTAIGSGNETNTSLFSGNDTGFETNTGIDTDVASNNDT
FT                   NTGLDVF"
FT   gene            507396..509255
FT                   /locus_tag="Mkms_0457"
FT   CDS_pept        507396..509255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89673"
FT                   /db_xref="GOA:A1UA15"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA15"
FT                   /protein_id="ABL89673.1"
FT                   /translation="MTRPNGPRNVADTRKVVTELIEHTTKIAEAQDRGDLVARLARART
FT                   RIGDPQIRVVIAGQLKQGKSLLLNSLLNMPVARVGDDESTVLATVVSYAEQPSARLVVA
FT                   RPDGEEPELVEIPTTDLGKDLRRAPQADGREVLRVEVTVPSPLLKGGLAFVDTPGVGGH
FT                   GQPHLSATLGLLPDADAMLMISDTSQEFTEPEMTFIRQALEICPVAAIVATKTDLYPHW
FT                   RQVVDANAGHLHRAGITTPLIPASSTLRSHAVQLNDKELNEESNFPAIVKFLSEQVLAR
FT                   NTDRVRDQVVNEIRAAAEHLSMAVQSELSALDDPAAGGTLTADLERRKKEAEEALQQTA
FT                   LWQQVLNDGIADLTADVDHDLRQRFRNITFHTERVIDAGDPTLHWAEIGAELEESVATA
FT                   VGDNFVWAYQRAEALAAEVARTFMEAGLDAVRMPAIDAREMGAEFGEFRSLAHLEAKPL
FT                   KIGHKIVTGMRGSYGGVLMFGMLTSFAGLGMFNPLSLGAGFVLGRKAYKEDMENRMLRV
FT                   RSEAKTNVRRFVDDVAFVVGKESRDRLKGIQRQLRDHYREIANQTTRSLNESLQATIAA
FT                   ARLAESERNARTKELQRQLNILRQVIEHAEKLGTPTAAPVAAP"
FT   gene            509342..510850
FT                   /locus_tag="Mkms_0458"
FT   CDS_pept        509342..510850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0458"
FT                   /product="isoniazid inducible protein IniC"
FT                   /note="KEGG: mmc:Mmcs_0448 isoniazid inductible gene
FT                   protein IniC"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89674"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA16"
FT                   /protein_id="ABL89674.1"
FT                   /translation="MRAILGGTIAAYRDDPAYRQRPEVHNELERIGARLNQPIRIALAG
FT                   TLKAGKSTLVNALVGEEIAPTDATEATRIVTWFRHGPTPKVTANHRGGRRSNVPIARRS
FT                   SGPADERGLTFDLARLDPDDVLDLDVEWPAAELIDSTIIDTPGTSSLSRDVSERTLRLL
FT                   VPGDGVPRVDAVVFLLRTLNAADIALLKQIGELVGGSSGALGVIGVASRADEIGAGRID
FT                   AMLSAKDVATRFTEEMDRTGICQAVVPVSGLLALTARTLRQSEFVALEKLAGVDPAELA
FT                   KAMLSVDRFVREDSPLPIDAATRAALLDRFGMFGVRISIAVLRAGVKDSVALADELLER
FT                   SGLVALRDVIDQQFAQRSDLLKAHTALLSLRQFVQLNPIYATPYIIADIDPLLADTHAF
FT                   EELRLLSQLRSRTTTLTDDEMASLRRLIGGSGTDAASRLGLQPEDPYDGPRAAFAAAQR
FT                   WRRRAEHPLNDPFTARACRAAVRSAEALVAAYAAKGRSYRDGPA"
FT   gene            510881..512716
FT                   /locus_tag="Mkms_0459"
FT   CDS_pept        510881..512716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0459"
FT                   /product="conserved hypothetical proline rich protein"
FT                   /note="KEGG: mmc:Mmcs_0449 conserved hypothetical proline
FT                   rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89675"
FT                   /db_xref="GOA:A1UA17"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA17"
FT                   /protein_id="ABL89675.1"
FT                   /translation="MRTSLGVSLGAANLVAVADGRPTIQPAVLTVGGSTITGFVDRVGD
FT                   PVPLVAADGSAHYGGQLAAAAIEALTRAAHPLRRPDVVAVAVPAHWSTAAVAALRAVVP
FT                   HVTVVSDAVAALTALQANPGLPARGVVALCDFGATGASITLADAGEGFRVIGETVRCDD
FT                   FSGDLIDQAVLQHVLADLAAGVPADPSGTSAVASLSALREQSRAAKERLSVHTATALAG
FT                   PHGDIRLTRPELESLLAGPLAGFVDTVLDVLHRNGVVPAQLAAVATVGGGARIPIVTQR
FT                   LSEALRLPVITGPYAQVVAAAGAELIATRGSEQDAVTALAPVFDDAPATEAAIPLAWSA
FT                   ETEDFEAATHYAQPVYDPALARPGIHFDPEPVEDSPDGSAWYRRPGALFAGAACLAALA
FT                   ATGLILTSQTGEADAVQAGSSQITAPVATQPIEQPAPQRAAAPQGAAPAPVVTERVAAA
FT                   APAPAPRAVQPPSRPNPNAPAERRVASKQVAPAPRAPAPAPARVPAPAPAPAPAPSMGL
FT                   PRIPLPEFTLPRPAPPSSTPAPAPAPEPEPQPTQEPQPTQEPEPEPTVAPEPEPTVVPE
FT                   PTVAPEPESTAAPEPSAEAPAEPQPECVPDAETVC"
FT   sig_peptide     510881..510982
FT                   /locus_tag="Mkms_0459"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.568 at
FT                   residue 34"
FT   gene            complement(512825..513343)
FT                   /locus_tag="Mkms_0460"
FT   CDS_pept        complement(512825..513343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89676"
FT                   /db_xref="GOA:A1UA18"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA18"
FT                   /protein_id="ABL89676.1"
FT                   /translation="MARPPEDPNYSDNEPTQYSNAYSDEPTQYGDYTGAYDQPPPGEPQ
FT                   PWYRKPGALIALGAIAALLVAVIVWLVVQLVSGDDSGESTTTTTTTTTTSEAPSVVPPQ
FT                   TVTESPTETTAPTETTAPPETTTTTPSETTTTTTAPTTTTTSPAATTTVETSTSTVTIT
FT                   VPTLVPPGG"
FT   gene            complement(513370..513834)
FT                   /locus_tag="Mkms_0461"
FT   CDS_pept        complement(513370..513834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0461"
FT                   /product="conserved hypothetical protein, unknown function"
FT                   /note="KEGG: lma:LmjF31.2670 hypothetical protein, unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89677"
FT                   /db_xref="GOA:A1UA19"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA19"
FT                   /protein_id="ABL89677.1"
FT                   /translation="MTGARDDDEHSGRQVDASTPWHHSTAKVLGASIAGLAAIGLIVTG
FT                   VMFASRSGESPQAPANFVDPSFSSMTTRSSSATTSTTTTRISPPLTTDLDLPPELPSST
FT                   PPSPSETSSTRGRSTTQEEESEESEEESSPRTTTRNRPRLNETRTLYPRP"
FT   gene            complement(513875..514813)
FT                   /locus_tag="Mkms_0462"
FT   CDS_pept        complement(513875..514813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0462"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0451
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89678"
FT                   /db_xref="GOA:A1UA20"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA20"
FT                   /protein_id="ABL89678.1"
FT                   /translation="MAAVDFRVFVEPQQGARYADQLAVARAAEQLGYSAFFRSDHYLAM
FT                   SGDGLPGPTDSWVTLAGIARETSSIRLGTMVTSATFRHPGPLAVSVAQVDEMSGGRVEL
FT                   GLGAGWFEAEHKAYAIPFPPLGERFDRLTEQLDILTGMWATPVGETFDYSGTHYTVVDS
FT                   PALPKPVQAVPPVIIGGQGAKRTPALAAKYAGEFNVPFVPLDTLSTQFDRVRAAVAEAG
FT                   REPDSMVYSAAFVLCAGADDAEIARRADAIGREVDELRSNSPMVGTPAEIVDKLGPFAE
FT                   AGVERVYLQMLDMADLDHLALVAGQVLPQLR"
FT   gene            complement(514815..515432)
FT                   /locus_tag="Mkms_0463"
FT   CDS_pept        complement(514815..515432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0452 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89679"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR017519"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA21"
FT                   /protein_id="ABL89679.1"
FT                   /translation="MTAAQRERAALVDAMRAKGPDAPTLCAGWKTRDLAAHLYVREHRP
FT                   DATAGIAVPALAKYTEKVQNRAAEGDWDELLDKIAAGPPLYSPFKLLDPVANLAEMFIH
FT                   CEDVRRAQPGWEPRTLDDATVNGLTRTLSLMARLTLAKAPARAALRTPEGKTLVTAGKG
FT                   DPVTVTGRPEELLLFAVGREARVEFEGDPAAVQALRDAPKGL"
FT   gene            515707..516615
FT                   /locus_tag="Mkms_0464"
FT   CDS_pept        515707..516615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89680"
FT                   /db_xref="GOA:A1UA22"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA22"
FT                   /protein_id="ABL89680.1"
FT                   /translation="MPEVQLHHDGYPKYRRMVRFDWSETPVHWVPGDPFSTHMMNVLHL
FT                   LLPEGERHFIKAVLEASSLVDDPELEGSIKPFIQQESWHAWAHQIVLDHLAEQGIDTKP
FT                   YTERLGRSLSMTLGDPPRFLPARLHRWWLYRRLADVAALEHFTAVLGQWVLQNRALDYA
FT                   GADPVMLDLLRWHGAEEVEHRSLVFDVYQNVCGSYWIRAISMLTTAPLFIGWWIAGARY
FT                   LMKNDPTIDQTWRWRDWLRAARQYRLPGPGSLLFTIPVRYLRRGHHPDHEASTEMAVQY
FT                   LEYSPAARAARERAGLAPQTT"
FT   gene            516666..516857
FT                   /locus_tag="Mkms_0465"
FT   CDS_pept        516666..516857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0465"
FT                   /product="ferredoxin (3Fe-4S)"
FT                   /note="KEGG: mmc:Mmcs_0454 ferredoxin (3Fe-4S)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89681"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA23"
FT                   /protein_id="ABL89681.1"
FT                   /translation="MKVSVDFDTCDGNAVCMSICHEVFELDDDGYLHLLQENPSEELRE
FT                   QVIGAERSCPTQAITVEG"
FT   gene            516861..518063
FT                   /locus_tag="Mkms_0466"
FT   CDS_pept        516861..518063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0466"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0455 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89682"
FT                   /db_xref="GOA:A1UA24"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA24"
FT                   /protein_id="ABL89682.1"
FT                   /translation="MPVDRQLEKILVVGTGVAGMRAAETLRLDGYRGELTVVGAERHAP
FT                   YQRPPLSKKLLSGAVHRAGADLAPRMDLEARVLRGASVRELDMSTRTAHLRDGSDDVSV
FT                   PFDGLVVATGAAARQWPDGPVPDGVMALRTVDDCLAIRERLESRPRVVVVGGGFIGAEV
FT                   AATCRSMGLSVTLIEKSSAPMASALGEEMAACWERLHRGNGVELRSGVGVESFAGDDRV
FT                   EAVHLTDGTRLPADLVIIGLGVTPSVDWLSGSDLRLDNGVVCDATGAVEGVTDVVAAGD
FT                   VASWWHPRYERYLRIEHWEHAERQGVAAAHTLLAGPERAQEFDALPYFWTDQYDVKMQM
FT                   LGVPDGYDSVAVVEGGPDRWDFVAAYGRDGRVIAVLSTIPGRVHAYRDAVFGAFPPAPP
FT                   G"
FT   gene            complement(518073..518420)
FT                   /locus_tag="Mkms_0467"
FT   CDS_pept        complement(518073..518420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_2715 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89683"
FT                   /db_xref="GOA:A1UA25"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA25"
FT                   /protein_id="ABL89683.1"
FT                   /translation="MIVKRLALMLGLVALLVGVVGLLTPVSVSPERQVVDCGSALGPDL
FT                   SEAQALDDGNAANVPVDGGLLVDVAYTDLCRAELHDRRVWTVSLAVAGAAVVAAVGVLG
FT                   VGSRRRERQES"
FT   sig_peptide     complement(518331..518420)
FT                   /locus_tag="Mkms_0467"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.483 at
FT                   residue 30"
FT   gene            518518..518985
FT                   /locus_tag="Mkms_0468"
FT   CDS_pept        518518..518985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89684"
FT                   /db_xref="GOA:A1UA26"
FT                   /db_xref="InterPro:IPR008691"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA26"
FT                   /protein_id="ABL89684.1"
FT                   /translation="MVDRLRGLGLAPRRPLTRVAATALALSAVLAGCSEQQPTEPPVSR
FT                   ATVTVNDTAVASLVPRCERQQKYLSVRAGNSRGEITGVLDVGGARPVAKWVKIRDLGGF
FT                   SGDFWEGGVGSIKTVRNDGDTTELGGTAYGVYTARPHELAQTARFSFEVQC"
FT   sig_peptide     518518..518658
FT                   /locus_tag="Mkms_0468"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.971) with cleavage site probability 0.551 at
FT                   residue 47"
FT   gene            518979..519455
FT                   /locus_tag="Mkms_0469"
FT   CDS_pept        518979..519455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0469"
FT                   /product="Mycobacterium tuberculosis paralogous family 11"
FT                   /note="PFAM: Mycobacterium tuberculosis paralogous family
FT                   11; KEGG: mmc:Mmcs_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89685"
FT                   /db_xref="GOA:A1UA27"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA27"
FT                   /protein_id="ABL89685.1"
FT                   /translation="MLSAGRATGVVERMLRCRPLVRAPILLYRCGLGFMLGDRFLMLEH
FT                   VGRSTGRRRYVVLEVVAHRTRDSYTVASGFGEQAQWLRNVAAQPRVRVSTGRRISVPAT
FT                   ARRLTGPEADDALTDYRSRHPRAWRALRGVLERNLGGRVEPPGTELPVVEVALD"
FT   gene            complement(519463..520878)
FT                   /locus_tag="Mkms_0470"
FT   CDS_pept        complement(519463..520878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0470"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: mmc:Mmcs_0459 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89686"
FT                   /db_xref="GOA:A1UA28"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA28"
FT                   /protein_id="ABL89686.1"
FT                   /translation="MSEQRPAPHIFVLFGATGDLAKRKLFPGLYRLAAAGRLPEEYAII
FT                   GSGRHSPGGDDEFRDSVGDGLRDSVDDIDDRVLSNLLQSLSFQTSDSDDGSDLAEAVRS
FT                   ARTRLGDGAQTLIYLSVPPRAMQPMIGMLGREGLAEGARVVVEKPFGTDLDTARELDAT
FT                   LKDVVDEDQVYRIDHFIGKEAVQNILAVRFANGLIEPAWHRNHLVSVQIDVPEELTIEG
FT                   RGSFYESTGCFRDMISTHLCQVLGFVAMEPPVHLDPVSLRNEKAKVFEAMRPLDPDRVV
FT                   FGQYDGYREEEGVADDSQVETFVALEAFIDTERWQGVPFYLRTGKALGATRRTVTLTFR
FT                   SPPMALFGADDNEHSPNQLVLELTDSPEFQVRLLAKRPGPDLGLMPLDLSLGVADEDSD
FT                   DTPLEAYERLLLDVMRGDQTLFTRADEVDRLWQVCQPVLDAPPPALTYASGSWGPQEAL
FT                   ALPGAAGWRLPDA"
FT   gene            complement(520931..521491)
FT                   /locus_tag="Mkms_0471"
FT   CDS_pept        complement(520931..521491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0471"
FT                   /product="putative lipoprotein LpqJ"
FT                   /note="KEGG: mmc:Mmcs_0460 putative lipoprotein LpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89687"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA29"
FT                   /protein_id="ABL89687.1"
FT                   /translation="MRSKVVMAGVVTVATLLTGCQNDTSGTAVRSPDSLIEPTEPTVPT
FT                   PRPSRTSTPAPPPRTLTPAPPSASAPPSAAEVLAPQNGYVFIQTKSGKTRCQLSTEEVG
FT                   CEAQFTDSPEVGGLPANGVRLSADGQVEWVLGNLGDIPAVTLDYRRYSAVGWTIDASSD
FT                   GTRFTNDRTQRGMFVSVERVQTF"
FT   sig_peptide     complement(521408..521491)
FT                   /locus_tag="Mkms_0471"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            complement(521501..522244)
FT                   /locus_tag="Mkms_0472"
FT   CDS_pept        complement(521501..522244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89688"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA30"
FT                   /protein_id="ABL89688.1"
FT                   /translation="METTVDEIAPGVFRLSTYVPEITEHGFTFNQFLLTGDEPFLFHCG
FT                   QRQLFPLVSAAIQRVIPLEKLRWISFGHLEADECGAMNLLLASAPNAQVVHGQLACMLS
FT                   LTDMCDRPPVAATDEPLDTGGHSLRFIATPHVPHNWEAGLWFDDATGTLLAGDLFTHVG
FT                   RCPALTENDCVAPALEAEAFFHATGLCTDLVPTLTTLAELRPTTLAIMHGSSFTGDGEH
FT                   QLRRLADGYTDMMRASLQSLTPQPP"
FT   gene            522460..524328
FT                   /locus_tag="Mkms_0473"
FT   CDS_pept        522460..524328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0473"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: mmc:Mmcs_0462 chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89689"
FT                   /db_xref="GOA:A1UA31"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UA31"
FT                   /protein_id="ABL89689.1"
FT                   /translation="MARAVGIDLGTTNSVVAVLEGGDPVVVANSEGSRTTPSVVAFARN
FT                   GEVLVGQPAKNQAVTNVDRTIRSVKRHMGTDWNTEIDGKKYTAQEISARTLMKLKRDAE
FT                   SYLGEDITDAVITVPAYFNDAQRQATKEAGQIAGLNVLRIVNEPTAAALAYGLDKGEKE
FT                   QTILVFDLGGGTFDVSLLEIGEGVVEVRATSGDNHLGGDDWDERVVTWLVDKFKASSGI
FT                   DLTKDKMAMQRLREAAEKAKIELSSSQSTSINLPYITVDADKNPLFLDEQLTRAEFQRI
FT                   TQDLLDRTRQPFQSVIKDAGISVGDIDHVVLVGGSTRMPAVSELVKEMTGGKEPNKGVN
FT                   PDEVVAVGAALQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKLIERNTTIPTKRSET
FT                   FTTADDNQPSVQIQVFQGEREIASHNKLLGSFELTGIPPAPRGVPQIEVTFDIDANGIV
FT                   HVTAKDKGTGKENTIRIQEGSGLSKEEIDRMIKDAEAHADEDRKRREEADVRNQAETLV
FT                   YQTEKFVKEQREAEGGSKVPEDVLTKVDGAISEAKTALAGTDIGAIKAAMEKLGTESQA
FT                   LGQAIYEATQAEQAAGGGAGGADGSSSSSDDDVVDAEVVDDDRENK"
FT   gene            524325..524972
FT                   /locus_tag="Mkms_0474"
FT   CDS_pept        524325..524972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0474"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: mmc:Mmcs_0463 GrpE
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89690"
FT                   /db_xref="GOA:A1UA32"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA32"
FT                   /protein_id="ABL89690.1"
FT                   /translation="MTRPFNSESDPQEPVTVTDKRRIDPVTGEVREPSGPAPSGPAPDA
FT                   APDSFAGETPEEADKAGELLADLQRVQADFANYRKRALRDQQLTADRAKAGVMAQLLPI
FT                   LDDLDRARSHGDLDTGPLKAVADKLVSTLEGLGLTPYGEEGDEFDPALHEAVQHEGEGT
FT                   HPVVGTVMRRGYKVGDQVVRHALVGVVDTVPAGDTAENASAAGREAAESDNQ"
FT   gene            525001..526179
FT                   /locus_tag="Mkms_0475"
FT   CDS_pept        525001..526179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0475"
FT                   /product="chaperone protein DnaJ"
FT                   /note="TIGRFAM: chaperone protein DnaJ; PFAM: DnaJ central
FT                   domain protein; heat shock protein DnaJ domain protein;
FT                   chaperone DnaJ domain protein; KEGG: mmc:Mmcs_0464
FT                   chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89691"
FT                   /db_xref="GOA:A1UA33"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA33"
FT                   /protein_id="ABL89691.1"
FT                   /translation="MAQREWVEKDFYKELGVSSDASADEIKKAYRKLARDLHPDTNPDP
FT                   SAAERFKAVSEAHSVLSDAAKRKEYDETRRLFAGGGFGRGRFNGGGGGFGGFGGADGGV
FT                   EFNLNDLFDAAGQTGGANIGDLFGGLFGRGASPRPSRPRRGNDLETETELSFLEATKGV
FT                   AMPLRLTSPAPCTNCHGSGARPGTSPKVCPNCNGAGVVNRNQGAFGFSEPCTECKGSGS
FT                   IIEHPCGECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHV
FT                   RPDKVFGRDGDDLTVSVPVSFHELALGTTLSVPTLEGKVGVRVPKGTSDGRILRVRGRG
FT                   VPKRGGGHGDLLVTVKVAVPPNLEGEAAEALEAYAKAERASGFDPRAGWAGA"
FT   gene            526182..526571
FT                   /locus_tag="Mkms_0476"
FT   CDS_pept        526182..526571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0476"
FT                   /product="putative transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: mmc:Mmcs_0465
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89692"
FT                   /db_xref="GOA:A1UA34"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA34"
FT                   /protein_id="ABL89692.1"
FT                   /translation="MAAKRNEEARTFLISVAAELAGMHAQTLRTYDRLGLVSPQRTSGG
FT                   GRRYSERDVDLLREVQRLSQDEGVNLAGIKRIIELTNQVEALQSRVKELVREVEELRAN
FT                   QRRDLAVPAKSTALVVWQPRHGRGR"
FT   gene            527431..528747
FT                   /locus_tag="Mkms_0477"
FT   CDS_pept        527431..528747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89693"
FT                   /db_xref="GOA:A1UA35"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA35"
FT                   /protein_id="ABL89693.1"
FT                   /translation="MASISMERSTVARGVMTRRCRHLTRVAPWLLAVSLALRFVGSIPF
FT                   LDMLFVDLRVYILGGEALTQPGTLYGLTYIDSYGDHLPFIYPPFAALLFYPLHFLPFPV
FT                   VAWIWQLAVVAGLYGLVRISQRMLGGGSHRVAMLWTAAGIWFEPIRTILTCSQVGVFLT
FT                   LAVLYAAYTSRSWLSGLLVGLSAGVKVTPAITGLYFVGMRRWAAVCFSLAAFLATVLVS
FT                   AVIAPQETRQFFGGLFSRVPMPTATCLNQSWRGTVSRIVGYDAGRSLVLLVAIGVTAVL
FT                   ALLAWRELGRGPGGRDALASLLVVQLFGLTASPISWAHHWVWVVPLTIWLLHGPWRGRA
FT                   GARVLGSGWIALMVIGVPTLLSGQQADLSTFSRPWYLAVAAAVYVPMTLVTFAWIIVAS
FT                   RTGTRRTCPPSEPKAESAPSTSAVVFTPAASHAERPTNR"
FT   gene            528744..530030
FT                   /locus_tag="Mkms_0478"
FT   CDS_pept        528744..530030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89694"
FT                   /db_xref="GOA:A1UA36"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA36"
FT                   /protein_id="ABL89694.1"
FT                   /translation="MTRLPLPIPRSDGAKAAPTVGRYSRPMRAASALKVRPCLARVVAL
FT                   APILLAVSIIARLASTMVYYFFAGDAFFDLHVYVIGGAALNHPGTLYDVVYVDPTKGER
FT                   LPFTYPAFAAMVFYPLHLLPFGLLAFLWQIALIAAIYASIRISQRLIGDGAGGPRVAML
FT                   WTAVAIWLEPVASSVQTGQVGVFLMLAVLYAAYSSRWWLSGLLVGAGAGVKLTPAITGL
FT                   YFVGMRRWAAAAFSAVTFFATVGLAYVALPADAGRYFPDQMTEAGTTLPIGSSWNQSWL
FT                   GGLSRILGYDPGLHPLVIAAVAVTALLAALAWRALGSADGRDRLASLLVVQFLGLMASP
FT                   VSWIHHWVWVIPLIIWLIHGPWRERAGARLLGLGWLALMVISVPSLLSLAQPDIWEISR
FT                   PWYLAWAEMVYIVASLSTLAWIIRTGRRA"
FT   gene            530023..531291
FT                   /locus_tag="Mkms_0479"
FT   CDS_pept        530023..531291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89695"
FT                   /db_xref="GOA:A1UA37"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA37"
FT                   /protein_id="ABL89695.1"
FT                   /translation="MPESGVPAGRRRLLAPLLLVTSAAALLAVTMANPPDLVDFHVYML
FT                   GGVALDRPDTLYSFAYSDQSPDQPLPFVYPPFAAILFRPLTALPFVVAGVLWQLGILAA
FT                   VYGIVRISQRLLGGGSHRTAMLWTAGLIWLEPVRVALDLGQVGIFLTLAVLYAVCSRRW
FT                   WLSGLLVGLAAGVKLTPAITGLYFLGVRRWTAAAFSAVVFVATIGLSYLVVGDQVRNYF
FT                   TRVMGDTSINPIGIALNQSWRGAISRFLGHDAGGSALVIAAIAGTAVLALFAWAALGAG
FT                   SRPRDRLGSVLVVQLFGLLMSPISWVHHWAWVVPLVLWLLSGPWRNEPGARVLGWGWLA
FT                   LTFVGVPSQLSLLEPSLWEISRPWYLAWAGLAYVVAAVATLGWIVLTGRRNAAPTPPVR
FT                   RRFARVVGTRGKQIACEEHRAGR"
FT   sig_peptide     530023..530121
FT                   /locus_tag="Mkms_0479"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.994 at
FT                   residue 33"
FT   gene            complement(531288..532190)
FT                   /locus_tag="Mkms_0480"
FT   CDS_pept        complement(531288..532190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0480"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: mmc:Mmcs_0469 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89696"
FT                   /db_xref="GOA:A1UA38"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA38"
FT                   /protein_id="ABL89696.1"
FT                   /translation="MAEHQPVTLSDPSSSVTATYVPAAGMICTSLADGGVEFLGQRRGV
FT                   EAYITSGKTMGIPLLYPWANRLSSSKYAIDGGVVTLTPGVAGVRTDENGVPIHGVLGAY
FT                   PGWVVTERSDNTLVAEVDWTDKPRLLATFPFPHVLTMSVTLADRTLTVDTTVTPSAAAP
FT                   VPLCYGYHPYLQIPDVARAQWQLQSPTMRHLRVDAWGLPTGATEEWAGGTAPLGDRELD
FT                   HGFDQVGDGALFVLAGGDRRVEVTFEKGYPAAQLFAPSADDLVAVEPMAAPTDALRREN
FT                   YRVAAPGEPDTSRFTIRVT"
FT   gene            complement(532238..533404)
FT                   /locus_tag="Mkms_0481"
FT   CDS_pept        complement(532238..533404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0481"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: globin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mmc:Mmcs_0470 oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89697"
FT                   /db_xref="GOA:A1UA39"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA39"
FT                   /protein_id="ABL89697.1"
FT                   /translation="MGLDDRDALAVLRDAVDPRRGSDPLIADFYTRWFAADLSVRDLFP
FT                   PDMARQRTAFAEAMTWLFGELIAQRAEEPVAFLAQLGRDHRKYGVVQRHYDTMGDALYA
FT                   ALRSGLADQWSDRVAEAAHDAVALATGVMRGAADAEEGPPFCDGTVIEHIRATRDVSVV
FT                   RLKLDQPLAYHPGQYVTVQVPQWPRRWRYFSPAIPADPDGYVEFHIRSVPGGMVSTAIV
FT                   NETRVGDRWRVSNPHGALAVDRDGGDVLMVAGSTGLAPLRTLIMDMTRFGVNPRVHLFF
FT                   GGRFPCDLYDLMTLWQIASTNPWLSVTPVSEYSSDPPWAADYPDPSPPRGLHVRQTGRL
FT                   DEVVTRYGNWGDRQILICGGVAMTEATKAALIAKGAPPERIQHDPLTT"
FT   gene            complement(533421..534422)
FT                   /locus_tag="Mkms_0482"
FT   CDS_pept        complement(533421..534422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89698"
FT                   /db_xref="GOA:A1UA40"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA40"
FT                   /protein_id="ABL89698.1"
FT                   /translation="MTTTSSPHTPTRHHEPPPAFRAAGIVIALAAVVAIVALAFALPAA
FT                   KSGPHDVPIGVAGPQAANGRIAAMLDERAPGAFAVTYYPGEDALRDAIADRQVYGGLTV
FT                   GPDGRKLLIASGAGPAVAQVLTQLGTGMAAQTGSTPTIEDVAPLPDTDPRGTGLAASAL
FT                   PITLAGILPAIALVLALRREVWTRLAAAVVFSGVAAWTITALLYYVLGSFDQNFWGVTA
FT                   GLTLGLLACGLPILGFGSLFGRVGLACGAALALLVGNPLSGLNSAPEMLPRGWGEVGQL
FT                   FPQGATATLLRSTAFFGGAGATSAIVVAICWAAAGAVLVALAALRERARTGD"
FT   sig_peptide     complement(534297..534422)
FT                   /locus_tag="Mkms_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.522 at
FT                   residue 42"
FT   gene            534576..535157
FT                   /locus_tag="Mkms_0483"
FT   CDS_pept        534576..535157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0483"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0472
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89699"
FT                   /db_xref="GOA:A1UA41"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041678"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA41"
FT                   /protein_id="ABL89699.1"
FT                   /translation="MSREVVLAAAKNRFATDGYERTTLRAIAKDAHVDPSMVLYLFGSK
FT                   LDLFRESLRLILDPERLVEALSEAGGDVGSRMARVYLQIWESPETGPSMVVMLQSATSN
FT                   SEAHEAFRTFMQTYVLAAVSGVLGGDEHARLRAMLAATTLVGTAVLRYVMKIPPLATIP
FT                   TEDLVALLAPTVTRYLTADAEELGLPAQSV"
FT   gene            complement(535145..535810)
FT                   /locus_tag="Mkms_0484"
FT   CDS_pept        complement(535145..535810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0484"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89700"
FT                   /db_xref="GOA:A1UA42"
FT                   /db_xref="InterPro:IPR021315"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA42"
FT                   /protein_id="ABL89700.1"
FT                   /translation="MTGSWGTVLTELIPLALVIALSPLSIIPAVLMLQTPRPRPTALAF
FT                   MAGWLIGLGALTAIFVAVSGAIGGFEKPPSWASWLRIVIGAALIVFGLVRFARRHSSSH
FT                   QPKWLRNLTTLGPGRAAGTAAVLTVANPKVLFICVAAGLAIGSAGLGNAVWAAVVYFAA
FT                   IAGCSVAVPILAYAVSGGRLDDPLARLKDWMERNHATLMAVILVVIGLLVLYKGIHTL"
FT   gene            complement(535958..536287)
FT                   /locus_tag="Mkms_0485"
FT   CDS_pept        complement(535958..536287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89701"
FT                   /db_xref="GOA:A1UA43"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA43"
FT                   /protein_id="ABL89701.1"
FT                   /translation="MTEGPGELQVSPAHLRELSDKQNRAAHQIAAATTLTNGVAAEVER
FT                   THGRVCAPAFAAAAAAEEARVKACAAVQSVSEAFAGSLELAQAQYLTTDANARDELDGM
FT                   MHPGR"
FT   gene            complement(536321..537064)
FT                   /locus_tag="Mkms_0486"
FT   CDS_pept        complement(536321..537064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0475 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89702"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA44"
FT                   /protein_id="ABL89702.1"
FT                   /translation="MGLFDDYGKVLEKVGSTMSSFDPFGPIGAAGEMLSGVAQTAQLID
FT                   QNGVDALWNLAADSAEMASVAAGMLPLAKQTLIIQGGLKAVLAMQYECGFTNEPERADG
FT                   YSMGAQRFNEVTETLAGATPDQRWTGAASDAYATANERQQLRMKKMVDADLDVRMALSA
FT                   EAGAVETTRRILNNAATMMGNAIAPALAARAGKVRQSAVALDRDSCGRRIGADLRLVHE
FT                   RTGESVREIGSEYRSSHAPLRGSGR"
FT   gene            537451..537981
FT                   /locus_tag="Mkms_0487"
FT   CDS_pept        537451..537981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89703"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA45"
FT                   /protein_id="ABL89703.1"
FT                   /translation="MVVSTSLPNEPSGTLHFQMSEPGGTPMLSITRFAERQHRLEIRDS
FT                   AGGVIGQIRQTSTRGQAFRKARMAVVLESRRQPLACADLTIDPSQNRYANLETPIRGAA
FT                   GAVIATIERQGGYTGRGDDPLVYELRCAQPTGEPLPMLLLVTAFMHSLYDGVVDRGPFG
FT                   AVGRWLSRPTWES"
FT   gene            537978..538757
FT                   /locus_tag="Mkms_0488"
FT   CDS_pept        537978..538757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89704"
FT                   /db_xref="InterPro:IPR018929"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA46"
FT                   /protein_id="ABL89704.1"
FT                   /translation="MSGTAPGWFTDPWDPRQTRYFDGDRWTGSIAPHPGYAPSAPGHPI
FT                   GEPILLLRAIPFPRDVDVSCALETQSGQQVGLIRPRSNRSSAINREVADLSYEVLGPGG
FT                   APILSLKRLGGLARRHTIVVEDATGRHLGRIRQTSSVWRQMRTTRITVALEVGGHQVAT
FT                   TDICIHPRDRFAAVCEPIGPTVGPAIATVERQWRSVGTSSDFFDYTLSCLQPTVHPLPE
FT                   LLLATAFAHYLYDRLAVGGPLETYQSFGRGGTWHDPR"
FT   gene            538888..541434
FT                   /locus_tag="Mkms_0489"
FT   CDS_pept        538888..541434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0489"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; Clp N
FT                   terminal domain protein; ATPase associated with various
FT                   cellular activities, AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: mmc:Mmcs_0478 ATPase AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89705"
FT                   /db_xref="GOA:A1UA47"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA47"
FT                   /protein_id="ABL89705.1"
FT                   /translation="MDSFNPTTKTQAALTSALQAASAAGNPQIAPAHLLMALLTQNDGI
FT                   AAPLLEAVGVEPATVRAETQRLLDRLPSASGASSQPQLSRESLAAVTAAQQLATEIDDE
FT                   YVSTEHLMVGLATGDSDVAKLLTGHGASPQALREAFVKVRGSARVTSPDPEGSYQALEK
FT                   YSTDLTARAREGQLDPVIGRDTEIRRVVQVLSRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVAGDVPESLRGKTVISLDLGSMVAGSKYRGEFEERLKAVLDDIKNSAGQIITFIDELH
FT                   TIVGAGATGDSSMDAGNMIKPMLARGELRLVGATTLDEYRKYIEKDAALERRFQQVYVG
FT                   EPSVEDTVGILRGLKERYEVHHGVRITDSALVSAATLSDRYITARFLPDKAIDLVDEAA
FT                   SRLRMEIDSRPVEIDEVERLVRRLEIEEMALAKEEDDASKERLEKLRGELADYKEKLAE
FT                   LTTRWQNEKNAIDIVRELKEQLEALRGEADRAERDGNLEKAAELRYGRIPEVEKKLDAA
FT                   VPQAEARDDVMLKEEVGPDDIAEVVSAWTGIPAGRMLEGETAKLLRMEDELGKRVVGQR
FT                   RAVQAVSDAVRRTRAGVADPNRPTGSFMFLGPTGVGKTELAKALAEFLFDDERAMVRID
FT                   MSEYGEKHSVARLVGAPPGYIGYDQGGQLTEAVRRRPYTVVLFDEIEKAHPDVFDVLLQ
FT                   VLDEGRLTDGQGRTVDFRNTILILTSNLGAGGTEDMVMAAVRSAFKPEFINRLDDVIVF
FT                   DGLNPEELVSIVDIQLQQLAKRLAQRRLTLEVSLPAKKWLADRGFDPLYGARPLRRLIQ
FT                   QSIGDQLAKMLLAGDVHDGDIVPVNVSPDGESLVLG"
FT   gene            541639..542505
FT                   /locus_tag="Mkms_0490"
FT   CDS_pept        541639..542505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89706"
FT                   /db_xref="GOA:A1UA48"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA48"
FT                   /protein_id="ABL89706.1"
FT                   /translation="MVPLWFTLSALCFVGAAVLLYVDIDRRRGLGRRRKSWAKSHGFDY
FT                   EHESADILKRWKRGVMSTVGDVTAKNVVLGQIRGEAVFIFDLEDVATVIALHRKVGTNV
FT                   VVDMRLKGIKEPRENDIWLLGAIGPRMVYSTNLDAARRACDRRMVTFAHTAPDCAEIMW
FT                   NEQHWTLISMPVTSTRAQWDEGLRTVRQFNDLLRVLPPIPQTDSVQAVARRSGSPSRPI
FT                   NPAPHRPPEPPQGRPDVGRPGSAAPARPYAQRPEAGRPDGPPAARPDTARRTPPARNGH
FT                   QSANFQR"
FT   gene            542521..543297
FT                   /locus_tag="Mkms_0491"
FT   CDS_pept        542521..543297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0491"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0480 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89707"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA49"
FT                   /protein_id="ABL89707.1"
FT                   /translation="MPRPVVLITGPTSGLGEGFARRYAADGHDLVLVARDEARLEALAG
FT                   ALRAETGAGVEVLPADLADADDRAKVAERLSSRVRVLVNNAGFGTSGEFWTADYQVLQS
FT                   QLDVNVTAVMQLTHAALPPMLDAHAGTVINVASVSGLLPGRGSTYSASKAWVIAFSEGL
FT                   ANGLGGTGVGVHALCPGFIHTEFHQRAGIEMSGLPSWMWLEVDDVVGDCLTAVAKDRVV
FT                   IVPGVQYKAMTTVSRLVPRHLVRAMTRTVGRGRGRT"
FT   gene            543304..544200
FT                   /locus_tag="Mkms_0492"
FT   CDS_pept        543304..544200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89708"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA50"
FT                   /protein_id="ABL89708.1"
FT                   /translation="MRALVAVVVTVLLVAVTGCSKAEGRSDTYSAPTAKVGESLAVSGW
FT                   NISVSNLRFEADHVLVDVDASHSGEGESVAPESLRFGLYGALVHPIEANGLGSCQNVDA
FT                   LNVNPMSAPSPDRLSGTVCLGPQRDQSQVRGIYAYSPQDRMAGTTVAYAAAFPVGLLPT
FT                   RDTETGLTLTTTSLDAFRADGAQLNQAALGDPEAFSGNGYMLLGLQIDGLASRYREDSM
FT                   RRGGPLMVVVAPTLPGKGLSYACAAYGASVLVLPEASREAVNMRASLCTQGEINRALLF
FT                   ASVSVVGTHAALWTTGD"
FT   sig_peptide     543304..543378
FT                   /locus_tag="Mkms_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.554 at
FT                   residue 25"
FT   gene            544193..544837
FT                   /locus_tag="Mkms_0493"
FT   CDS_pept        544193..544837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0493"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mmc:Mmcs_0482 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89709"
FT                   /db_xref="GOA:A1UA51"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA51"
FT                   /protein_id="ABL89709.1"
FT                   /translation="MTEAPGPTEWGEAPGVGPWPGDLPDDPRYDPELLRDGDTRNVVDA
FT                   YRYWTREAIIADIDRRRHPLHIAIENFGNDANIGSVVRTANAFAVDTVHIVGRRRWNRR
FT                   GAMVTDRYQRLRHHDSTAELLDFAAEAGLTAVAVDNIPGAVPLEHTDLPRECLLIFGQE
FT                   GPGITEDAKTGARLTVSIAAFGSTRSINAAVAAGIAMHTWIVQHADLGKAW"
FT   gene            complement(544730..546307)
FT                   /locus_tag="Mkms_0494"
FT   CDS_pept        complement(544730..546307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0494"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0483 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89710"
FT                   /db_xref="GOA:A1UA52"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA52"
FT                   /protein_id="ABL89710.1"
FT                   /translation="MTRRWLALSVLTLAVLVIGIDGTVLALATPFISSDLHTSATELLW
FT                   IGDIYSFVLASLLITMGSLGDRIGHRRLLLCGATLFAAVSVVTAYAPTAEALIGARALL
FT                   GVAGATLAPATLALIRGIFADARQRSMAVGIWAAAFSAGAALGPMVGGVLLEHFWWGSV
FT                   FLINAPVMAVLVIGGLTLLPEHRNPEPGPWDLPSVGLSMLGILSVVYAIKETAAHGPRL
FT                   SALATAVVGVSALTVFVRRQLRLPSPLIDVRLFGNRAFSGVVGANLLSVLGLSGLVFFL
FT                   SQYFQLVQGYSPLGAGLAELPAAVTATVFGVLAGFAVRRWTQRAVLTTGLALVGVAMAT
FT                   LTTIHPTSPYPHLGIALFVVGVGLGLAFTVASDVILASVPRERAGAAAAVSETAYELGM
FT                   ALGIAVVGSILTGVYRTLVVPPGLSPAAATQARDSLAAATDVAAGLPPAQAGALLDAAR
FT                   ESFSSGLAVASGVGAALMLTSAVTVWVLLRERLPRLAEVGVLNDPGVHGDAGGDGRVDT
FT                   ACGAERGN"
FT   sig_peptide     complement(546227..546307)
FT                   /locus_tag="Mkms_0494"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.798 at
FT                   residue 27"
FT   gene            complement(546304..546864)
FT                   /locus_tag="Mkms_0495"
FT   CDS_pept        complement(546304..546864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0495"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0484
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89711"
FT                   /db_xref="GOA:A1UA53"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA53"
FT                   /protein_id="ABL89711.1"
FT                   /translation="MRYSRFMVTDRESVLRAAADFLGRRPNATQDEIAAAVGVSRATLH
FT                   RHFAGKPALMAALDDLAIAEMRTAVDAARLSEGSAADALRRLVAACRPVSPYLALLYSQ
FT                   SQDIDGDQSMQGWAESDAAITALFERGQRSGEFRPDLTAAWLTEALYSLVAGAGWCIQV
FT                   GRAAGRDFERMISELLLSGVQNS"
FT   gene            546938..548101
FT                   /locus_tag="Mkms_0496"
FT   CDS_pept        546938..548101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0496"
FT                   /product="glycoside hydrolase, family 76"
FT                   /note="PFAM: glycoside hydrolase, family 76; KEGG:
FT                   mmc:Mmcs_0485 glycoside hydrolase, family 76"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89712"
FT                   /db_xref="GOA:A1UA54"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR014512"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA54"
FT                   /protein_id="ABL89712.1"
FT                   /translation="MDQLWANRAASAEAAITQRHLRRLWGLPGTQLGVVAWPAAGPHKQ
FT                   FRTWHYWWQAHLLDCLVDAQLREPDPDRQRRITRQIRAHRIRNIGRWTNDYYDDMAWLA
FT                   LALERAGRLAGVARPRALGTLCEQFLNAWVPEDGGGIPWRKQDQFFNAPANGPAGIFLA
FT                   RYDNRLRRAQQMADWIDEVLIDPDTQLVFDGIKGGSLVRAQYTYCQGVVLGLETELAVR
FT                   IGGDDGGGEHALRVHRLVAAVAEHMAPDGVIKGAGGGDGGLFNGILARYLALVATTLPG
FT                   DTADDVAARDTARRIVLASAEAAWGNRQTVGADGGALPLFGAFWERTAELPTAAGRQAE
FT                   SVEGAVNASEIPERDLSVQLSGWMLMEAAHAVSDQPAESADPGPAET"
FT   gene            548098..549939
FT                   /locus_tag="Mkms_0497"
FT   CDS_pept        548098..549939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0497"
FT                   /product="sodium/proton antiporter, NhaA family"
FT                   /note="PFAM: DSBA oxidoreductase; Na+/H+ antiporter NhaA;
FT                   KEGG: mmc:Mmcs_0486 Na+/H+ antiporter NhaA; TC 2.A.33.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89713"
FT                   /db_xref="GOA:A1UA55"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UA55"
FT                   /protein_id="ABL89713.1"
FT                   /translation="MTEASARTIGPLPSRFSRDPKTPRSTDNAAAALLLAFTVLAILWA
FT                   NSPWAQSYSIFWDTDVAVSFGEYRAELSVKHLVNDGLMAFFFFIVGLEVKSEFVIGELT
FT                   DRSRAAVPVVAAIAGLIVPAVIFLTFNPSGPDAQAWGVVISTDTAFLVGALAVIKPKFP
FT                   ARLRIFLLTLAVVDDVGALGAIALFYTDDLKLAPLAVAALLIAALAMVRRLPSLRGPAY
FT                   AVLGFALWIALYLAHVHPTLAGVAVAVLIPVFTPERRQVEQTVDLVRAFRQSPNPQYAR
FT                   AVTRGLRESISINERLQTAVGPYVSFVVLPIFALANAGVHLDEQTITAAMSSTLTWGIV
FT                   AGLVVGKFVGITAATALMSATGWGQLAPGLSLRRVAGGAALSGIGFTISLFIVDVAIED
FT                   PARQDEARVGVLIASVLAFTLSWALFRITDWISPPEPVGLTLVRPVDPERDHIRGDPDA
FT                   PLVLVEYGDYECPFCGRATGAIDEVRTHFGDDLLYVWRHFPLERAHPRSFDAARASEGA
FT                   AAQGKFFEMGRELFAHQDDLEWSDMYRYAVAIGLDIEQFDQDVRVHASKVLHRVRDDAQ
FT                   DAEVMDLNSTPTFFVNGKRHKGPWDAASLIRALEAGR"
FT   sig_peptide     548098..548250
FT                   /locus_tag="Mkms_0497"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.830) with cleavage site probability 0.461 at
FT                   residue 51"
FT   gene            complement(549945..550901)
FT                   /locus_tag="Mkms_0498"
FT   CDS_pept        complement(549945..550901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0498"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: mmc:Mmcs_0487 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89714"
FT                   /db_xref="GOA:A1UA56"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA56"
FT                   /protein_id="ABL89714.1"
FT                   /translation="MTPAQLRAYSAVVRLGSVRAAAEELGMSDAGISMHVTQLRKELDD
FT                   PLFSRTSAGLAFTPGGLRLASRAIEILGLQQQTAIEVTEAAHGRRLLRIAASTMFAEHA
FT                   APGLIELFSARADDLTVELSVHPTSRFRDLIESRAVDITLGPAPADPGPALVVRPFLKY
FT                   QIITVAAPETAAGPGMQAPAQLREHDWMLGPSAGGVDGEVATMLRNLSIPESRQRIFQS
FT                   EAAALEEVQRAGGVTLTLGFAVSRDLSSRRLVQIKGAGLQTSGEWFASTLTPAARPPAS
FT                   SELMRFITTPRCTQAMIRGTGVGVTRFKPKVHVTLWS"
FT   gene            550937..552097
FT                   /locus_tag="Mkms_0499"
FT   CDS_pept        550937..552097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0499"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mmc:Mmcs_0488 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89715"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA57"
FT                   /protein_id="ABL89715.1"
FT                   /translation="MRDVLSALSAVWRTGGTAGLATVVRTFRSAPRQPGAAMVVAPDGT
FT                   VTGSVSGGCVEGAVYELAGDVVGSGTPALQRYGVSDDDAFAVGLTCGGILDVFVEPVSP
FT                   ATFPDLDAVVEDIESHRPVALATVIAHPDAARVGRRLVVRSDEVSGTLGSSRADAAVTD
FT                   DARGLLATGRNEVLTYGPDGQRRGAGMEVFVAAYAPRPRMLVFGAIDFAAAVAQQGSFL
FT                   GYRVTVCDARPVFATAARFPTADEVVVDWPHRYLAAQVAAGDVDARTVICVLTHDPKFD
FT                   VPLLEVALRLPQVAYIGAMGSRRTHDDRLTRLRDAGLTDAELDRLASPIGLDLGARTPE
FT                   ETAVSIAAEIVAVRWGGTGRRLTDTDGRIHHDQGKDSEFSDRLTRY"
FT   gene            552155..553030
FT                   /locus_tag="Mkms_0500"
FT   CDS_pept        552155..553030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0500"
FT                   /product="carbon monoxide dehydrogenase, medium subunit"
FT                   /note="PFAM: molybdopterin dehydrogenase, FAD-binding; CO
FT                   dehydrogenase flavoprotein domain protein; KEGG:
FT                   mmc:Mmcs_0489 carbon-monoxide dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89716"
FT                   /db_xref="GOA:A1UA58"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA58"
FT                   /protein_id="ABL89716.1"
FT                   /translation="MQVPGPFEYERATSVDHAIGLLDRLGDGAMIVAGGHSLLPMMKLR
FT                   IANPEYLVDINDLTRELGYITVDARAVRIGAMTRHRQVLESAELAEVCPIFADAERMIA
FT                   DPVVRNRGTLGGSLCQADPAEDLTTVCQTLGAVCVARGPSGQREIPIDEFLEGPYETSL
FT                   SHNEILLEVRIPVRPNTSSAYTKVERRVGDWAVTAAGAMVTLEGDTITAARIGLTAVNP
FT                   DAAALAAVGAALVGRTADEDAFAEAGRQAADACAPDSDMRGSADYKRHLASELTVRNLR
FT                   TAVRRVRERA"
FT   gene            553033..553608
FT                   /locus_tag="Mkms_0501"
FT   CDS_pept        553033..553608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0501"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: mmc:Mmcs_0490 (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89717"
FT                   /db_xref="GOA:A1UA59"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA59"
FT                   /protein_id="ABL89717.1"
FT                   /translation="MQVSMTVNGEQVSADVEPRMLLVHFLRDELRLTGTHWGCDTSNCG
FT                   TCVVSLDGEPVKSCTMLAVMADGHDVRTVEGLEVDGKLDPVQEGFMQCHGLQCGFCTPG
FT                   MMITARALLDRNPHPTEHEIREAISGQICRCTGYTTIVRSVQWAAGHARGRDVESGPSA
FT                   TDFAPQSQTDDTLGPVAGDHLIETGSPS"
FT   gene            553605..555995
FT                   /locus_tag="Mkms_0502"
FT   CDS_pept        553605..555995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0502"
FT                   /product="carbon monoxide dehydrogenase, large subunit
FT                   apoprotein"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, large
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase,
FT                   a/b hammerhead; aldehyde oxidase and xanthine
FT                   dehydrogenase, molybdopterin binding; KEGG: mmc:Mmcs_0491
FT                   carbon-monoxide dehydrogenase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89718"
FT                   /db_xref="GOA:A1UA60"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012780"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA60"
FT                   /protein_id="ABL89718.1"
FT                   /translation="MTAVDERPDAQADNDRKPCGYGRMLRKEDPRFVRGRGNYVDDVTL
FT                   PGMLHLAILRSPYAHARIANIDISAAEAHPKVKAVVTGADLAEKGLAWMPTLSNDVQAV
FT                   LATDKVRFQGQEVAFVVAEDRYSARDGVELIDVDYEPLDPVIDVRRALDPDAAVIRTDL
FT                   DGKTDNHCFDWETGDAAATDAAFAKADVVVKQEMVYPRVHPAPMETCGAVADLDPVSGK
FT                   LTLWSTTQAPHAHRTLYALVAGLPEHKIRVISPDIGGGFGNKVPIYPGYVCAIVGSLLL
FT                   GKPVKWMEDRSENLTSTGFARDYIMVGEIAATSDGKILAVRSNVLADHGAFNGVAAPTK
FT                   YPAGFFGVFTGSYDLEAAYCHMTAVYTNKAPGGVAYACSFRITEAVYFVERLVDCLAYE
FT                   MKMDPADLRLRNLLKPDQFPYHSKTGWTYDSGDYETTMRKAMDMIGYEQLRAEQAAKRE
FT                   RGELMGIGMAFFTEAVGAGPRKDMDILGLGMADGCELRVHPTGKAVVRLSVQTQGQGHE
FT                   TTFAQIVAEELGIPPDDIDVVHGDTDQTPFGLGTYGSRSTPVSGAAAALVARKVRDKAK
FT                   IIASGMLEASVADLEWDKGAFHVKGDPAASVTIQDIAMRAHGAGDLPEGIEGGLDAQIC
FT                   YNPENLTYPYGAYFCVVDVDPGTAVVKVRRFLAVDDCGTRINPMIIEGQVHGGIVDGIG
FT                   MALMEMIAFDEEGNCLGGSLMDYLIPTALEVPELETGHTVTPSPHHPIGAKGIGESATV
FT                   GSPPAVVNAVVDALAPFGIRHADLPLTPSRVWEAMQGRPTPPI"
FT   gene            555998..556768
FT                   /locus_tag="Mkms_0503"
FT   CDS_pept        555998..556768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0503"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   mmc:Mmcs_0492 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89719"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA61"
FT                   /protein_id="ABL89719.1"
FT                   /translation="MRSADTMHDRAQQLLQTRIPFVRATVVRAQQPTSAHPGDEAILLS
FT                   DGTIEGFIGGECAQSSVRKAALGALQANQSVLLRVLPDGDVHFPDAPGACVVVNPCLSG
FT                   GALEIFLVPQVPAPLVRICGDTPIAEALAQVCAVLGYEVTRSAGEPAGATAVVIASHGG
FT                   PEAEMIRAALDADVGYIGLVASRVRGAAVLEGLHLTAAERARVHTPVGLPIGARTAAEI
FT                   AVSIAAELIAAIRVDAAAPHPAEVGAAEDHHRCH"
FT   gene            556941..557645
FT                   /locus_tag="Mkms_0504"
FT   CDS_pept        556941..557645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0504"
FT                   /product="putative oxidoreductase"
FT                   /note="KEGG: mmc:Mmcs_0493 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89720"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA62"
FT                   /protein_id="ABL89720.1"
FT                   /translation="MCGAPLIRLQCYEGLSAGEALYDWNYQRQLLSIRLAEARGDHITE
FT                   ADLYAEKYLADRPILRCVRHPGPTPPVLLIDEIDRADDEFEALLLEFLGESSVTVPEIG
FT                   TFVAAVPPIAVLTSNRSRDLHDALRRRCLYHWIDYPQPERAVAILRRTVPGATTALIEQ
FT                   AAQFVGAARELDLDKPPGIAETIDWVAALVTLGVAELVESVDTVLAGFSALAKTPDDRA
FT                   VLRDALVDHSWT"
FT   gene            557658..558326
FT                   /locus_tag="Mkms_0505"
FT   CDS_pept        557658..558326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0505"
FT                   /product="carbon monoxide dehydrogenase subunit G"
FT                   /note="PFAM: carbon monoxide dehydrogenase subunit G; KEGG:
FT                   mmc:Mmcs_0494 carbon monoxide dehydrogenase subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89721"
FT                   /db_xref="GOA:A1UA63"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA63"
FT                   /protein_id="ABL89721.1"
FT                   /translation="MKIANEFTVGVPIEQAWDVLTDLEQVIPLMPGAAMTGRDGDDVMG
FT                   KVKVKVGPVTSEFNGKVHFVEQNRAEHRAVIDGRGKEARGTGNAAATVTAQLHPDGDRT
FT                   RVTVDTDLKIVGKLAQFGSGMLQQVSEKLLGQFVESLEAKLAGDATPPAAAQEVATPVA
FT                   GGDGDAPRPQVVPAPPAEAPPIDLLELAGGGAVKKYGPPAVGALLLLVLLLVALRRRRR
FT                   "
FT   gene            558323..559591
FT                   /locus_tag="Mkms_0506"
FT   CDS_pept        558323..559591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0506"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="PFAM: VWA containing CoxE family protein; SMART: von
FT                   Willebrand factor, type A; KEGG: mmc:Mmcs_0495 VWA
FT                   containing CoxE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89722"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA64"
FT                   /protein_id="ABL89722.1"
FT                   /translation="MSAPLLLRGVDLAAFAVALVARLRGGGVVVSASGSAEFVHAMRAL
FT                   RPGRRTELYWAARLTLVNRADDLETFDRVFEAVFADAVLGLDPPAMKHRSADPDPSRPV
FT                   ARPGQGPPEDVDGLPWVTRPTNIRAAAGSEGTITLPDVLPSGMTARADEPFDQFEPEDL
FT                   RLLGQWLEDAAPHWPRRRTLRRRPHPRGDRIDLRRTVRASRGTGWETIRLTRTRRRQRD
FT                   RRIVLVCDVSRSMQAYATVYLHLMRAVMMRRDRLRPEVFAFSTSLTRLTPVLSHRSPEL
FT                   ALARANETVADRYGGTHVGRSIGELVSGPHGAVLRGAVVIIASDGWDSDAPEVLVHALA
FT                   RVRRRAYRVVWLNPRAAHVDYRPLAGSMAAALPFCDEFMPAHSISGLRDLFEVLGESSA
FT                   SGDRPRAVVRGRSRPAARRRMPC"
FT   sig_peptide     558323..558421
FT                   /locus_tag="Mkms_0506"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.810 at
FT                   residue 33"
FT   gene            559585..560439
FT                   /locus_tag="Mkms_0507"
FT   CDS_pept        559585..560439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0507"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mmc:Mmcs_0496
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89723"
FT                   /db_xref="GOA:A1UA65"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA65"
FT                   /protein_id="ABL89723.1"
FT                   /translation="MLSGMDQYRRDGLVFEVRDEGPADGPVVVLLHGFPQRNTSWDAII
FT                   ERLTAQGYRCLAPNQRGYSPGARPRRRRDYRIPELIADVGALIDASGAERVHLVGHDWG
FT                   AAVAWGVAAEMPERLATVVPVSVPHPAAFLKSIPTSRQGLASWYMYFFQLPYVPELLLT
FT                   RRRGALALGALRRTGQSEAAAERDVAAMLDPGALTAGLNWYRAMPFMDPRATGGKITVP
FT                   TMFVWSDRDSALLPKGAYDTARYVSGEYRFEIMSGASHWLPEERADELAALLLEWFAAH
FT                   PIT"
FT   gene            560469..561380
FT                   /locus_tag="Mkms_0508"
FT   CDS_pept        560469..561380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89724"
FT                   /db_xref="GOA:A1UA66"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019922"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA66"
FT                   /protein_id="ABL89724.1"
FT                   /translation="MSESSRPTIEFPARIGVWWASETWSITDAQDVAREIEALGYGSLF
FT                   IPEVTGKECLTQSAAFLSATDRLVIGTGIANIHIRLPSAAETGGRTLGALHPNRFVLGL
FT                   GVSHAPLVEHGMGGTYSKPLATMRGYLEKMAAVSEAIEPGAPRPTRLLAALGPKMIELS
FT                   GTHADGAHPYLVTPEQTRTTRDILGPDKWIVSEQAVAIGGDDADQLRRAHQHLEVYSGL
FT                   PNYRNSWLRQGFDESDLVRGGSDRLARGIVGMGSVDAAAASVTAHLDAGADHVVLQVLG
FT                   DDPMADPRPALRELAAALGLNG"
FT   gene            561457..562866
FT                   /locus_tag="Mkms_0509"
FT   CDS_pept        561457..562866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0509"
FT                   /product="selenium-binding protein"
FT                   /note="PFAM: selenium-binding protein; KEGG: mmc:Mmcs_0498
FT                   selenium-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89725"
FT                   /db_xref="GOA:A1UA67"
FT                   /db_xref="InterPro:IPR008826"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA67"
FT                   /protein_id="ABL89725.1"
FT                   /translation="MAHPSIDPTFYRTAADAAAAPGEQLAYVVAFDRAAHDHDAMTVVD
FT                   VNPGSERYGRVVGWTEVPGLGDELHHFGWNACSSALKHEGHDMHGLERRYLLVPGLRSS
FT                   RVHVFDTRPDPRNPTLVKTIDASTLSETAGYSRPHTLHCGPDGVFLTCLGGREGDDDGP
FT                   GGIALLDHATFDVLRAWETDRGPQHFHYDAWWHLNQNVLISSEWGSPSMIENGIVPELL
FT                   LGQKYGHAIHFWDLAKGEHRQRLDLGAQHQMVLEVRPSHDPEATWGFVGVVISTDDLSG
FT                   SVWRWFRDGDEWKAEKVITVPAEPADPDILPPALKPFAAVPPLISDIDLSVDDRFLYVS
FT                   CWGTGELKQFDVSDPANPKQVGSVRLGGIVDRAPHPAMPDTPLAGGPQMVEVSRDGKRV
FT                   YFTNSLYGAWDDQFYPDGVGAWMVKLDADPDGGMSIDESFFPHGEEFRGLRVHQIRLQG
FT                   GDASSDSYCYR"
FT   gene            complement(562857..563543)
FT                   /locus_tag="Mkms_0510"
FT   CDS_pept        complement(562857..563543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0510"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0499 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89726"
FT                   /db_xref="GOA:A1UA68"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA68"
FT                   /protein_id="ABL89726.1"
FT                   /translation="MNTENVVALVSGANRGLCRHFAEQLIARGAKVYAGARKPETVDLP
FT                   GAIPVQLDITDPESIRRAAEFAADVNVVINNAGVSTQSTLLDGSLDDIRLEMETHYFGT
FT                   LQVLRAFAPIIERNGGGAVLNVLSVLSWFHPPTSGAYSAAKAAAWALTDAVRTELAPKG
FT                   IHVAALHVGYMDTDMVSYIPADQKSDPGAIAELALDGLFAGENEILGDALTRDVKAALS
FT                   GAPRQR"
FT   gene            563630..564652
FT                   /locus_tag="Mkms_0511"
FT   CDS_pept        563630..564652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0511"
FT                   /product="nitroalkane oxidase"
FT                   /EC_number="1.7.3.1"
FT                   /note="PFAM: 2-nitropropane dioxygenase, NPD; KEGG:
FT                   mmc:Mmcs_0500 2-nitropropane dioxygenase, NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89727"
FT                   /db_xref="GOA:A1UA69"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA69"
FT                   /protein_id="ABL89727.1"
FT                   /translation="MTSPLSALGVRLPVIAAPMAGGATTTDMVVAAARAGSLGLLAAGY
FT                   KTPDALQAEIATVRAASIPFGVNVFAPNPVPIGIAAYRRYAALIQPEADRFGLTLPPDP
FT                   IDDDDAFGAKVDLLRADPVPIVSFTFGLPASDVIRALQKAGTTVVQTVTSPQEAEAAAA
FT                   AGVDMLAVQASVAGGHSGTFTPDRMDAPVVLTELVRAVVTRVGLPVIAAGGLATPADVT
FT                   AVLHAGAAAAAVGTVLLRADESGASATHRAALADPTRTETVITRAFTGRPARGLRNRFI
FT                   DRFEADAPLGYPAVHHLTSPLRKAAAAGGDADLVHLWAGTGYRHAAEKPTATILTELAS
FT                   "
FT   sig_peptide     563630..563698
FT                   /locus_tag="Mkms_0511"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.461 at
FT                   residue 23"
FT   gene            complement(564649..565344)
FT                   /locus_tag="Mkms_0512"
FT   CDS_pept        complement(564649..565344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89728"
FT                   /db_xref="GOA:A1UA70"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA70"
FT                   /protein_id="ABL89728.1"
FT                   /translation="MTTTHLALMPDFLDPLVLLGYFGGWALVGLLVVIFVESGVLFPVL
FT                   PGDSLLFVAGMLAAGTAAVAESGGEPINFHLWQLLVFIPIAAILGGQVGYWIGRSVGTA
FT                   MFKPNARILKQRYLEEAHLFFEERGPFAIVIARFVPIVRTLAPLTAGAARMSYPVFALF
FT                   NILGAVVWGVGLTLLGYWLGRFEMVQKLLEPIVIAIVIVSVAPMLLEWYKRRKAAKRAG
FT                   IAAPPIEPA"
FT   gene            565432..566445
FT                   /locus_tag="Mkms_0513"
FT   CDS_pept        565432..566445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0513"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   mmc:Mmcs_0502 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89729"
FT                   /db_xref="GOA:A1UA71"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA71"
FT                   /protein_id="ABL89729.1"
FT                   /translation="MATHKAVHVAAAGEPLTLADVETPSPPPGHLRIDVAACGVCGTDH
FT                   GFVNGNFPGLSWPITLGHEIAGTVAELGDGVDEFAVGDRVAVGWFGGNCNKCIPCRRGL
FT                   FMQCVNMQVPSWHYPGGYAESVVVPATAPARIPDGLSFVEAAPMGCAGVTTFNGLRQTR
FT                   ARAGDLVAVLGIGGLGHLGVQFARAMGFETVAIARGAAKEDDARALGAHHYIDSTAGDV
FT                   AAALQKLGGAAVVLATAASSAAMGQTVGGLGPQGELIVVGVTPEQLPISPLDLINSGLS
FT                   VTGHPSGTARDVEETMHFAVLSGVRARVEEKPLAEAAEAYAAMDEGRARYRMVLTM"
FT   gene            566476..567513
FT                   /locus_tag="Mkms_0514"
FT   CDS_pept        566476..567513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0514"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: mmc:Mmcs_0503 fructose-bisphosphate aldolase,
FT                   class II; TIGRFAM: ketose-bisphosphate aldolases;
FT                   fructose-bisphosphate aldolase, class II; PFAM:
FT                   ketose-bisphosphate aldolase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89730"
FT                   /db_xref="GOA:A1UA72"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA72"
FT                   /protein_id="ABL89730.1"
FT                   /translation="MPIATPEVYAEMLDRAKKHSFAFPAINCTSSETVNAAIKGFADAG
FT                   SDGIIQFSTGGAEFASGLGVKEMVTGAVALAEFAHVIAEKYPITVALHTDHCPKDKLDT
FT                   YVRPLLAISADRVAAGGNPLFQSHMWDGSAVPIDENLTIAQELLKQAAAAKIVLEVEIG
FT                   VVGGEEDGVEAEINDKLYTTSEDFEKTIDALGAGEHGRYLLAATFGNVHGVYKPGNVKL
FT                   KPEVLAEGQKVAAAKLGLDSDAQPFDFVFHGGSGSLKSEIEDSLRYGVVKMNVDTDTQY
FT                   AFTRPIAAHMFTNYDGVLKIDGEVGNKKVYDPRSYLKKAEAGMAERVIEACRDLHSEGR
FT                   SVTAD"
FT   gene            complement(567510..568343)
FT                   /locus_tag="Mkms_0515"
FT   CDS_pept        complement(567510..568343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89731"
FT                   /db_xref="GOA:A1UA73"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA73"
FT                   /protein_id="ABL89731.1"
FT                   /translation="MSNPRGPGQGDEPTEPSAAGGPGDQTGPDDATRPSPTADHEPATE
FT                   VIASSSPGADQFEPSEGERRFTAPSGFDAGSTQKIDPPPDPATEVFPRSEGGLPGSGTD
FT                   PFAAQKAAGPQVIPPRGDAPRPPQQGRRSWGWVVAVVLVIAALVAIAILGTILLTRGSG
FT                   STASQEDQVRATIEQFDVAIQNGDLATLRGITCGAKRDSYVNYDDKAWAETHKRVAAAK
FT                   QYPVVASIDQIVVNGDHAEANVTAFMAYAPQTRSTRSFDLEFRDDQWKICQAPSP"
FT   gene            568403..568858
FT                   /locus_tag="Mkms_0516"
FT   CDS_pept        568403..568858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89732"
FT                   /db_xref="InterPro:IPR014487"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA74"
FT                   /protein_id="ABL89732.1"
FT                   /translation="MTARRDRHGTMLSMTRMGDLLGPDPVLLPGDPEAEAELEASENPA
FT                   IVAAAHPSASVAWAALAEEALADDKAVTAYAYARTGYHRGLDQLRRNGWKGFGPVPYRH
FT                   EPNRGFLRCVAALARAADTIGETDEYQRCLDLLDDCDPSARAEFGLS"
FT   gene            complement(568884..569780)
FT                   /locus_tag="Mkms_0517"
FT   CDS_pept        complement(568884..569780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0517"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   mmc:Mmcs_0506 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89733"
FT                   /db_xref="GOA:A1UA75"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA75"
FT                   /protein_id="ABL89733.1"
FT                   /translation="MGAGHDHQHGTDTRVSRMLIAAAVLTAFFVLELVTALWIDSIALL
FT                   ADAGHMLTDLVAMFMGLTAVLLARRGSASPARTYGWHRAEVFTAVANAVLLLAMAVFIL
FT                   YEAVERLGDAPDVPGVPMIVVALAGLAANAVVVLLLRSHSKESLAVKGAYMEVVADTVG
FT                   SIGVLIAGIVTVTTSWPYADVVVAVFVALWVLPRAISLARAALRILSESSPAHIDVDEL
FT                   KTALCAVEGVTEVHDLHVWTLVPGKDVVTAHLTSARDSARVLDDARAVLAARGLDHATV
FT                   QVEPPGETDCNCESNDW"
FT   gene            complement(569837..570616)
FT                   /locus_tag="Mkms_0518"
FT   CDS_pept        complement(569837..570616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0518"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: mmc:Mmcs_0507 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89734"
FT                   /db_xref="GOA:A1UA76"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA76"
FT                   /protein_id="ABL89734.1"
FT                   /translation="MSIRPLRQSVRPSPVFLAVVAITVAGGALAWMAADTVAPLAYAGV
FT                   FVLVIAGWLVSLSLHEFGHAYTAFRFGDRDVEIRGYLTLNPLKYSHPMLSLGLPVLFIA
FT                   LGGIGLPGGAVYLRTSWMTARQKTLVSLAGPSANLVLAVLLLGSTRLLYDPAHGVFWAG
FT                   LAFLGFLQVTAFVLNMLPVPGLDGYGALEPHLSPDTQRALVPVKQWGFFILLILLLAPA
FT                   LNQWFFGAVYWLAELSGVPSALMSIGGQLTRFWSAWL"
FT   sig_peptide     complement(570491..570616)
FT                   /locus_tag="Mkms_0518"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.409 at
FT                   residue 42"
FT   gene            complement(570648..571376)
FT                   /locus_tag="Mkms_0519"
FT   CDS_pept        complement(570648..571376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0519"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: mmc:Mmcs_0508 GntR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89735"
FT                   /db_xref="GOA:A1UA77"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA77"
FT                   /protein_id="ABL89735.1"
FT                   /translation="MPDDFLLRPLDAPPAYAAVVERVRRAVALGVLLPGDRLPSERALA
FT                   EGLGVSRVTVREALRVLQGERLLITKRGNGGTVVAPTVARLGDDPGGVDYGRRLDEVFE
FT                   LRLAVESMAARLAARRGRPEGLRWLDSCQEALRASSDVHTFRRADSEFHLAVARLSGNS
FT                   MLSQVIEDARAAAFSRLDRQDFAVIYESSIRGHAAVIEAIRNADPDGAAAAMAAHIEEA
FT                   RDEVAAVLSTRESPEVRSAG"
FT   gene            571432..572109
FT                   /locus_tag="Mkms_0520"
FT   CDS_pept        571432..572109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0520"
FT                   /product="gamma-glutamyl-gamma-aminobutyrate hydrolase"
FT                   /note="PFAM: glutamine amidotransferase class-I; peptidase
FT                   C26; KEGG: mmc:Mmcs_0509 peptidase C26"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89736"
FT                   /db_xref="GOA:A1UA78"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA78"
FT                   /protein_id="ABL89736.1"
FT                   /translation="MNSEVTPLIGVCGLSVAARWGLWDQPAVLVAQTYLEAIHRAGGQP
FT                   LILPPSAHADTDLLLHTVDAIVLAGDGDIEAQRDDFELDIAAAALSEAVPVLGVCRGLQ
FT                   ALNVAAGGTVRRRFGHHHTAETTSHTVDVAVDSLLGEAGYAGVREVTSRHRQGLATVGD
FT                   GGKVTAASVPDGAIEAVEWPDHPFALGVHWHPEDPLMHELFRALISAATAPLFNTSTLP
FT                   VQP"
FT   gene            572150..573355
FT                   /locus_tag="Mkms_0521"
FT   CDS_pept        572150..573355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0521"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   mmc:Mmcs_0510 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89737"
FT                   /db_xref="GOA:A1UA79"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA79"
FT                   /protein_id="ABL89737.1"
FT                   /translation="MTIDNISTIAPFGNHLPVRITFGEGSAHRLPDLLRDAGAQRVLVL
FT                   TDQGIEHHNPAVAAVLTTLSTSGLTVSRLDKAPGEPTIEMVDAATARMTSESVDAIVAL
FT                   GGGSVIDTAKAARLCHQQGLTFGEFLDSARTYPAPAVPLIAVPTTAGTGSEVSGGAVVS
FT                   DPQAGRKAGIAHPNMRAQYAVVDPVLTWSMPPVMTANTGIDALAQAMAAVIAKVRTPIG
FT                   DAIALEAVRLMGHSLPAAYRDGADAAARAGMACGSMMAGLAMNISDCAAEHSLGQAIGG
FT                   LSGAPHGLTIGLVLAETLERERHHVPDRMERIADAWGLPADGTADGSRLVGAVRRLLSD
FT                   LQFPVLSDLGLGAEHLDRLTDLALSDYFITMAPQPWDRAEVHQAFARALATRDRGLVTA
FT                   AG"
FT   gene            573363..575009
FT                   /locus_tag="Mkms_0522"
FT   CDS_pept        573363..575009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0522"
FT                   /product="cyclohexanone monooxygenase"
FT                   /note="KEGG: mmc:Mmcs_0511 cyclohexanone monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89738"
FT                   /db_xref="GOA:A1UA80"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA80"
FT                   /protein_id="ABL89738.1"
FT                   /translation="MSAQQDSPDRFDVVIVGAGFAGLYMLHRVRALGLTARIVERGEDV
FT                   GGTWYWNRYPGARCDIESIDYAYSFDETLTREWRWTERYAAQPEILSYIGHVADRFDLR
FT                   DDITFGTTVRRADWDDDTAQWTLVCDTGQVLRATFCVMATGCLSVAKQPEFPGLSQFRG
FT                   RWYHTGRWPHDPVDFTGRRVAVIGTGSSGIQAIPRIAEAAEQLFVLQRTPNYSMPAQNR
FT                   PLAADEFDSAIADFATRRRICQRSDAGVPHPPPTQGTFDVTAEERERRYEEGWQRGGIN
FT                   ALSAAFTDFFTDEDANRMAQEFARNKIRSIVEDAQTAELLCPQHHIGTKRTCVDTGYFQ
FT                   TYNRDNVELVNSRAEPIDQITATGIRLVGGRHLDVDTLVFAIGFDAITGALTDIDIRGT
FT                   GGAALRDEWDDGPRTLLGLQTAGFPNLFMVTGPGSPSVLSNMLVSIEQHVDWIADCLLH
FT                   LRKLGHDRIEATRDAQDRWMEHIGELAAETLYPQANSWYLGANIPGKARTFMPYVAGCG
FT                   EYRRECDEVVASGYSGFLLGRPSPVREGTSA"
FT   gene            575006..576406
FT                   /locus_tag="Mkms_0523"
FT   CDS_pept        575006..576406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0523"
FT                   /product="Glutamate--ammonia ligase"
FT                   /EC_number="6.3.1.2"
FT                   /note="PFAM: glutamine synthetase, catalytic region; KEGG:
FT                   mmc:Mmcs_0512 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89739"
FT                   /db_xref="GOA:A1UA81"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA81"
FT                   /protein_id="ABL89739.1"
FT                   /translation="MIDARTAPTASEVLARLHAEDIATVILGGTDTHGVMRGKRVPISQ
FT                   LPRMLEHGMPMCDVFWVMHVDESDLVARPDGYRGYFPTERQGYPDILAVPDLTTLRIVP
FT                   WHNDTALLLCDWELPADHRPVPIAPRSVLRRVVERADAMGYQPLSALELEFYLLREKAG
FT                   TTHRKRADELVPLQEAPSTYGVVMGSLQEDIGALIRRHMLDYGLPVEACNPETGPGQFE
FT                   ITLRYGNSLKSADDAFLFKSAVKEVAAQNDLLATFMAKPVTDWAGNSCHVHLSLRDIAG
FT                   GGVFFDQDAPDQLSTALRHFAGGILHTMREFTALMAPTPNSYRRFVPYSWAGTTATWGV
FT                   DNRSVGLRVIREGDHGTRVEHRQPGGDANPYLATAAALAGGLHGLLNEIEPRELSTTDI
FT                   YSQPSEDLPVLPATLAEAVDLLADSAAAREWFGDDFVDHYVLMKRAEIAAQSVAVTDWE
FT                   VARYLEAM"
FT   gene            576431..577909
FT                   /locus_tag="Mkms_0524"
FT   CDS_pept        576431..577909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0524"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   mmc:Mmcs_0513 amino acid permease-associated region; TC
FT                   2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89740"
FT                   /db_xref="GOA:A1UA82"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA82"
FT                   /protein_id="ABL89740.1"
FT                   /translation="MADSSETRSYGDVGSAPHGELTPEQERGLRRGAINWRQVAVLSVA
FT                   GCGPASVIALNLQFMGQFAGAALVLAFVLVWPGILLLVNTFAEFSKRLPTSGGLYTWNS
FT                   KAWGPNVGFVYGWTFIGAYLVFSAAGFAVFGGWVQEWLQTQFGISVPWWLFTFAALAYV
FT                   CVLAYLGITQSLHAALGLLAFEIIVLLALAAWIFITGPQSGSGFGVAPFQVSSAGALAL
FT                   GGVGLAMTYGVLSHVGIEEGATLGQEVKDPKRQIPRGLWVAAVVVPVFYIVVAYAMVYG
FT                   YGIDDMTAFGEDPAPLQTIAQTYWGQVGLTVIVLATLSSILAFSQTAFLAGARVLYTLG
FT                   REGVLPTRLGAVSRRQTPAVGIAVMGVLSMLLGVPLAFLVGPFNVWGYFGFLISIAFLV
FT                   SYIFTNIGLVRYMLRIGVFHWFRHGVLGALGSLVFLYPLYKTVWPLQTGIYGALPFVYL
FT                   AWIVLGIGLLIYTLRRRPEVMSRIGTSLADDDVS"
FT   gene            complement(577902..578528)
FT                   /locus_tag="Mkms_0525"
FT   CDS_pept        complement(577902..578528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89741"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA83"
FT                   /protein_id="ABL89741.1"
FT                   /translation="MSARDRAAGGGDGMVVLRFGGHRAPRGLTGLDTVDVTGAPDVDAA
FT                   AAGARRLVVVGSDADLATVLTRLMRTERLGVELAAARGLFPARTALSGTARRVPLIRDD
FT                   AGIALVGSAQWRGTEGALFGEAVVDDTTLFSGEVAGVRIEPTAEMPGLRAAVLSGRGRP
FT                   QRWVAGRAAQLGTTGARVVRDGVEGTREVKRSTFYRHTEGWLRVS"
FT   gene            578600..579895
FT                   /locus_tag="Mkms_0526"
FT   CDS_pept        578600..579895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0526"
FT                   /product="Adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="PFAM: adenylosuccinate synthetase; KEGG:
FT                   mmc:Mmcs_0515 adenylosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89742"
FT                   /db_xref="GOA:A1UA84"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UA84"
FT                   /protein_id="ABL89742.1"
FT                   /translation="MPAIVLIGAQWGDEGKGKATDLLGGRVQWVVRYQGGNNAGHTVVL
FT                   PTGENFALHLIPSGILTPGVTNVIGNGVVVDPGVLLTELRGLEERGVDTERLLISADAH
FT                   LLMPYHVAIDKVVERYAGSKKIGTTGRGIGPCYQDKIARQGIRVADVLDPAVLAEKIEG
FT                   ALELKNQVLVKIYNRKALEPAEVVENLLEQAEGFKHRIADARLLLNQALERDEIVLLEG
FT                   SQGTLLDVDHGTYPYVTSSNPTAGGASVGSGIGPTRITTVLGILKAYTTRVGSGPFPTE
FT                   LFDEHGAYLAKTGGEVGVTTGRARRCGWFDAVIARYATRVNGITDYFLTKLDVLSSLET
FT                   VPICVGYTIDGKRTDEMPMTQSDIARAEPVYEELPGWWEDISGAREFDDLPAKARDYVL
FT                   RLEELAGAHVSCIGVGPGRDQTIVRRDVLAPS"
FT   gene            579892..580539
FT                   /locus_tag="Mkms_0527"
FT   CDS_pept        579892..580539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0527"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mmc:Mmcs_0516 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89743"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA85"
FT                   /protein_id="ABL89743.1"
FT                   /translation="MSSDYGLDPRRVDPEYDRHGGFPVFEAAEPGPGFERFLTAMRRAQ
FT                   DLAVSVNPDPDTWDEAADRVEELVKLLDPYRAGEGVGPANRVPTLPGAGSLLMPPWRVI
FT                   KFESDGVELEVAFSRYHVGGNSAVHGGVLPLMFDSMFGMVIHATGRPISRTAFLHVDYR
FT                   RVTPIDSVLTARGWLREAEGRKAFVNAELLDADGNVLAEANGLMIRLLPGQP"
FT   gene            580648..581292
FT                   /locus_tag="Mkms_0528"
FT   CDS_pept        580648..581292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89744"
FT                   /db_xref="GOA:A1UA86"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA86"
FT                   /protein_id="ABL89744.1"
FT                   /translation="MSTPRAAALAGVVFALLFGAALILIRTSLPEGAEPGSQWIDGGSD
FT                   RLQVAAVLMPFAGIAFLWFIGVIRDGFGRYEDKFFATVFLGSGLLFLAMMFVAAGVGAG
FT                   LESMSGHPAESVSGVALLGQTVLLSISKTYALRMAAVFMMSLATIWLRTGLMPRPLVYV
FT                   TYLVAVALIVAAEVSMWLVLTFPAWVLVVSALIYSREVTPRPPAAPSPDTA"
FT   sig_peptide     580648..580749
FT                   /locus_tag="Mkms_0528"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.685 at
FT                   residue 34"
FT   gene            complement(581249..581443)
FT                   /locus_tag="Mkms_0529"
FT   CDS_pept        complement(581249..581443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0529"
FT                   /product="putative ferredoxin"
FT                   /note="KEGG: fra:Francci3_1600 putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89745"
FT                   /db_xref="GOA:A1UA87"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA87"
FT                   /protein_id="ABL89745.1"
FT                   /translation="MRIEANRDVCISAGNCVMSAPEVFDQDDDGIVVLLADPVPEIEHE
FT                   HAREAVKLCPATALRVASE"
FT   gene            complement(581448..582668)
FT                   /locus_tag="Mkms_0530"
FT   CDS_pept        complement(581448..582668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0530"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: mmc:Mmcs_0518
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89746"
FT                   /db_xref="GOA:A1UA88"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA88"
FT                   /protein_id="ABL89746.1"
FT                   /translation="MTGTTGASTAPPLPPLHMRRTGFDPTDELRDIRESAGVRLTQNAF
FT                   GMDVYLVTRHDDVKAVLADHTRFSNTRPPGFAGAGSPISDAEQARAQAGNLLANDPPEH
FT                   QRLRRMLTPEFTLRRINRLEPRIVAIVDEHLDAMQQSGPPADLVAGFALPIPSLVICEL
FT                   LGVPYADREDFQRRSARQLDLSLPIPERLDLARQAREYMHTLVGRARRTPGDDILGMLV
FT                   REHGDELTDDELVGIAGLLLLAGHETTSNMLGLGVLALLRHPEQLAAVRDDPDAVGPAV
FT                   EELLRWLSIVHSGIPRITTTDVEVAGVLIPKGQLVFVSLPSANRDPSFLDAPETFDIRR
FT                   GAPGHLAFGHGVHHCLGAPLARMEMRIAFPALLRRFPTLTLAEPFEDVEFRSFHFIYGL
FT                   RSLLVGW"
FT   gene            complement(582705..584729)
FT                   /locus_tag="Mkms_0531"
FT   CDS_pept        complement(582705..584729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0531"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: mmc:Mmcs_0519 MmpL"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89747"
FT                   /db_xref="GOA:A1UA89"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA89"
FT                   /protein_id="ABL89747.1"
FT                   /translation="MAGRFSWVVALLVVLVSGGLMGVLSGGESSSQSPVSVPTDAESAK
FT                   VNALRSEFPGGDQAPAILVVTRTDGAALSPADIAATEAARGRMLDAAQSAPAGPPVIVS
FT                   EDDKAAIATVPLATDLSGFGLNDAVKGLREAAADGLPGDLRAEVTGGPAFGADIANSFS
FT                   GANVTLLAVTAAVVALLLIVTYRSPVLFLVPLLVIGFADRVAAVVGTAIAEAVGMSPDG
FT                   STSGITSVLVFGAGTNYALLLISRYREELGRNGDHREALAVAVRAAGPAILASNATVVL
FT                   ALLTLVFASAPSTRALGVQAAAGLVVAAVFVLLVLPALLRLFGKKLFWPLIPKEGAAPL
FT                   TDSGLWHRIAAGVSRRPAVVAVASIGALAVLCTGLLFTPIGLTQTEQFRVQAESVTGYE
FT                   TLADHFPSGLTDPTRVIGPSDKTAELQRAISETPGVVSADPAGTSPTGLTQWSVVLSAE
FT                   PASDEAFSTVDALRENVRGVDSSALVGGSDAQARDISSAASRDRMVVIPTILAVVLVVL
FT                   YVLLRSALAPLILVAVTVLSALAALGLGGWASVHLFGFPALDDTTPLFAFLFLVALGVD
FT                   YTIFLVTRAREETPDHGTRQGIVRAVSATGAVITSAGIVLAAVFCVLGVLPLIVLTQLG
FT                   IIVGLGILLDTFLVRTVIIPALFTLIGPKIWWPALRASP"
FT   sig_peptide     complement(584634..584729)
FT                   /locus_tag="Mkms_0531"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.471 at
FT                   residue 32"
FT   gene            584788..585261
FT                   /locus_tag="Mkms_0532"
FT   CDS_pept        584788..585261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0532"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: mmc:Mmcs_0520
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89748"
FT                   /db_xref="GOA:A1UA90"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA90"
FT                   /protein_id="ABL89748.1"
FT                   /translation="MADADRAALEALIAADVRALSAESEHIGRVFAARHSLSANDFRAL
FT                   LHIMVAETAGRPLTAGDLRRQMGMSGAAITYLVERMITSGHLRRDSDPADRRKVILRVA
FT                   EHGMGVAGQFFAPLAEHTTRAMVDMPDDDIAVAHRTLTALIDAMAAFRRDLGD"
FT   gene            complement(585273..586874)
FT                   /locus_tag="Mkms_0533"
FT   CDS_pept        complement(585273..586874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0533"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="TIGRFAM: Na+/H+ antiporter; PFAM: sodium/hydrogen
FT                   exchanger; KEGG: mmc:Mmcs_0521 Na+/H+ antiporter; TC
FT                   2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89749"
FT                   /db_xref="GOA:A1UA91"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA91"
FT                   /protein_id="ABL89749.1"
FT                   /translation="MSASLLAVLVVAVLLAAVARRADVSAPLALVVAGLAVGLIPGVPD
FT                   IQLDPDLVLYVVLPPLLWSAGLESSYVALRRNVRSIGMLAVGLPLATTFAVGVVAYWAV
FT                   PELTIAAALTLGAIVAPPDAVSATAVGRRLGLPRRLMTLLGGESLLNDATALTAYKVAL
FT                   GLAIGGSASWTGGLWTFALAAVGGVVGGGALGAVIVYVRSRLRDPLVESALGLVAPFGI
FT                   YLLAEEVHGSGVLAVVVAALILGQHSTNASYATRLQDSAVWKAVQLLLESFAFLLIGLQ
FT                   LPKVIEELAGISAAVLVVSSLAVLATVIAVRIVWVYLFAYLPRLVSPALRYREPSPRPA
FT                   QVFVVAWAGMRGVVSLAAAFAVPATTLSGAEFPGRPQLVFLTFVVVVGTLLLHGLTLPW
FT                   LIRRLGVQGDEAHTDAVAAAAAQDRAARAAAERLDELLEQQRTDGTVDDVHERAAEVLR
FT                   GWNTRRRNSAWEQLGRDEADIGESPAAAFRRLRLEMLAAERATLIAERDSGHIDDEVLR
FT                   SVLHGLDLEEATLNRR"
FT   sig_peptide     complement(586806..586874)
FT                   /locus_tag="Mkms_0533"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.725 at
FT                   residue 23"
FT   gene            586940..587269
FT                   /locus_tag="Mkms_0534"
FT   CDS_pept        586940..587269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0534"
FT                   /product="zinc finger, UBP-type protein"
FT                   /note="SMART: zinc finger, UBP-type protein; KEGG:
FT                   mmc:Mmcs_0522 zinc finger, UBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89750"
FT                   /db_xref="GOA:A1UA92"
FT                   /db_xref="InterPro:IPR001607"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA92"
FT                   /protein_id="ABL89750.1"
FT                   /translation="MRSRARRATGRTQDTAAPRTCEHLASTSPEAVNADPRPNTPGRCE
FT                   DCAELGEATWAHLRMCLTCGHVGCCDSSPHQHATEHFHQTGHPVMRSAEPGESWRWCYI
FT                   DLRVG"
FT   gene            587292..588578
FT                   /locus_tag="Mkms_0535"
FT   CDS_pept        587292..588578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0535"
FT                   /product="formate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="6.3.4.-"
FT                   /note="PFAM: ATP-dependent carboxylate-amine ligase domain
FT                   protein, ATP-grasp; KEGG: mmc:Mmcs_0523 ATP-dependent
FT                   carboxylate-amine ligase-like, ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89751"
FT                   /db_xref="GOA:A1UA93"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA93"
FT                   /protein_id="ABL89751.1"
FT                   /translation="MTEPTDADTPVTDPEVAVPQVAPAAPDAPAEPAAPRNTVLLLGAG
FT                   ELSRELALAFQRLGAFVVAVDRYADAPAHGVADRSAVVRLTDTEAVTALIEREKPRYVV
FT                   AQSGAIAADALIAVAERGGVDVFPTPRSTRLGQDREGLRRLASDELGLPTAPFWFAGSA
FT                   EELGTVAQHAGFPLVVKPISGAPGEGQSVLLRAEDVEPAWHRAVAAGRITHNRVMAETV
FT                   VEVDYEVTLLTVRSTGATGPTLTFCEPIGHRPGDGDALESWQPQQMTPAALDAAKSIAA
FT                   RMVNSLGGRGVFAVELLVRGDEVYFSDVRTRLQDTGLVTVRSQRLSQFELHARAILGLA
FT                   VDTIMISPGAAEVRYAGTETSVSEPSGADIAAVVADALATQESDVRLFGRPDETDGRRR
FT                   LGVALATAPDVIIARDRARRVGAALRRLW"
FT   gene            588582..589040
FT                   /locus_tag="Mkms_0536"
FT   CDS_pept        588582..589040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0536"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0524 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89752"
FT                   /db_xref="GOA:A1UA94"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA94"
FT                   /protein_id="ABL89752.1"
FT                   /translation="MSAESDPDTGRPSDRPTAAPFMIALVIIVLVVIGIWLVNLFEGDE
FT                   PTPEQLIGRVAAAQNDALQREDYRAFQAYTCRAEHATESEVLERQRNSSAEQGARFIDG
FT                   VSDVVVDGDRATATVTYHFDRSEDDKFGVPTTFVQEDGAWKVCSTGSG"
FT   gene            589060..589473
FT                   /locus_tag="Mkms_0537"
FT   CDS_pept        589060..589473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0537"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: mmc:Mmcs_0525
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89753"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA95"
FT                   /protein_id="ABL89753.1"
FT                   /translation="MSYAGDITPEQAWQLLDDDPNAVLVDVRTDAEWRFVGVPDLSPLS
FT                   RDAVFIEWNRTDGTRNDGFVDDLKAAGITPGERPVVFLCRSGNRSIGAAEAATEAGIGP
FT                   SYNILDGFEGDLDEQKHRGRTGWKAVGLPWKQS"
FT   gene            589470..590708
FT                   /locus_tag="Mkms_0538"
FT   CDS_pept        589470..590708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0538"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: mmc:Mmcs_0526 O-succinylhomoserine
FT                   sulfhydrylase; TIGRFAM: O-succinylhomoserine sulfhydrylase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89754"
FT                   /db_xref="GOA:A1UA96"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA96"
FT                   /protein_id="ABL89754.1"
FT                   /translation="MSSEVPSRTQGADKPSVRRPAELPEGVGQATIGVRGGLLRSGFEE
FT                   TAEALYLTSGYVYASAAEAEKAFTGEIDRYVYSRYGNPTISMFEERLRLIEGAPACFAT
FT                   ATGMAAVFTSLGALLGAGDRLVAARSLFGSCFVVCSEILPRWGVETVFVDGDDLSQWEE
FT                   ALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNVFATPLLQQGFPLGVDV
FT                   VVYSGTKHIDGQGRVLGGAILGSQEYIDGPVQKLMRHTGPAISAFNAWTLLKGLETLAV
FT                   RVDYSNRSAERIAEFLEGHSSVSWVKYPFLESHPQYDLAKRQMRGGGTVVTFELAGGKE
FT                   RAFEVLDKLQIIDISNNLGDAKSLITHPATTTHRAMGPEGRAAIGLGDGVVRVSVGLED
FT                   TDDLIRDLDRALG"
FT   gene            590709..591119
FT                   /locus_tag="Mkms_0539"
FT   CDS_pept        590709..591119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0527 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89755"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA97"
FT                   /protein_id="ABL89755.1"
FT                   /translation="MSRRSEAKKARRRKRQAAQNVAWVPEAVVEQLSTIEDAIVADLAA
FT                   FDERITERGWTFDEQESDDDYAIWFYEPSGAEVSDGLPVTSLWLDAAEDGEVVRVVLVG
FT                   TTEQHGFTHDELDQHLDAIESYRNGDPVPDFD"
FT   gene            complement(591207..592070)
FT                   /locus_tag="Mkms_0540"
FT   CDS_pept        complement(591207..592070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0540"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: mmc:Mmcs_0528 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89756"
FT                   /db_xref="GOA:A1UA98"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA98"
FT                   /protein_id="ABL89756.1"
FT                   /translation="MDNIRGKTIAITGAARGIGYATAKALLARGARVVIGDRDVALQES
FT                   AVAQLTKLGPVSGYPLDVTDRESFATFLDKARTDGGGHIDVLINNAGVMPIGPFLEQSE
FT                   QAIRSSIEVNLYGVIAGCQLALPDMVARGRGHIINIASLSGVIPVPGQVVYVGAKFGVV
FT                   GLSAALADEVAPHGVHVSVVMPPFTRTELISGTKESGAIKPVEPEDIAAAIVKTLDKPK
FT                   THVSVPPALRFTAQAAQLLGPRGRRWLNKKLGLDNVFLDFDTAKRKSYEDRAQTALGVV
FT                   ESGDRT"
FT   gene            592129..592623
FT                   /locus_tag="Mkms_0541"
FT   CDS_pept        592129..592623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0541"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0529 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89757"
FT                   /db_xref="GOA:A1UA99"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1UA99"
FT                   /protein_id="ABL89757.1"
FT                   /translation="MIDDLRFVAVDQTDPLAEPLLGELAVEYADRYEGRAGAVLAWLRR
FT                   YPAAEFTPPDGAMLIGLLGDTPVTGGAFRRFGVVDGVPTAELKRIWTDSAHRRRGFGRA
FT                   LLAVLEQEIAARGYRRIYLTTGDRQPEAEALYLATGYQRLAEPLLAEGEVYPVAFAKLL
FT                   Q"
FT   gene            592644..592952
FT                   /locus_tag="Mkms_0542"
FT   CDS_pept        592644..592952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89758"
FT                   /db_xref="GOA:A1UAA0"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA0"
FT                   /protein_id="ABL89758.1"
FT                   /translation="MPLAAGVSQAAVGWLILLAAAAIAAGGVMLRAFIGRRADRHLLGR
FT                   LTRRMRGTALARVLFGPVQHDALDPDELDQMILMPTIVVACGLCLTAVFLLGYRILT"
FT   sig_peptide     592644..592718
FT                   /locus_tag="Mkms_0542"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.742 at
FT                   residue 25"
FT   gene            complement(592949..593677)
FT                   /locus_tag="Mkms_0543"
FT   CDS_pept        complement(592949..593677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0543"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   mmc:Mmcs_0531 beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89759"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA1"
FT                   /protein_id="ABL89759.1"
FT                   /translation="MAAALTAVTDRVHLARTDLVNWTLVTDGDGVLLIDAGYPGHRDDV
FT                   VDSVRRLGFGIDDIRAILLTHAHIDHFGSAIWFAETHGVPVYTHADEVGHARRDYLEQV
FT                   SPLAVARHAWRPRWLKWSLTISGKGGTHRGGIPTAQALTDEIAATLPGTPAAVPTPGHT
FT                   GGHCSYVVDGVLVSGDALVTGHPLLSDTRPQLLPDLFNHDQARCVASLAALAALDTEVL
FT                   LPGHGPLWRGPIREAAQAAR"
FT   gene            593741..594751
FT                   /locus_tag="Mkms_0544"
FT   CDS_pept        593741..594751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0544"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: mmc:Mmcs_0532
FT                   luciferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89760"
FT                   /db_xref="GOA:A1UAA2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019944"
FT                   /db_xref="InterPro:IPR019945"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA2"
FT                   /protein_id="ABL89760.1"
FT                   /translation="MAELKLGYKASAEQFAPRELVELAVAAEEHGMDSATVSDHFQPWR
FT                   HEGGHAPFSLAWMTAVGERTKRLQLGTSVLTPTFRYNPAVIAQAFATMACLYPDRIFLG
FT                   VGTGEALNEIATGYEGDWPDFKERFARLRESVRLMRELWLGDRVDFDGEYYRTKGASIY
FT                   DVPEGGVPVYIAAGGPVVAKYAGRAGDGFICTSGKGEELYKDKLLPAVAEGADAAGKNV
FT                   DDVDKMIEIKISYDTDPELALENTRFWAPLSLTAEQKHSIDDPIEMEKAADELPIEQVA
FT                   KRWIVASDPDEAVEKVKDYVGWGLNHLVFHAPGHDQRRFLELFKRDLEPRLRKLG"
FT   gene            complement(594755..596407)
FT                   /locus_tag="Mkms_0545"
FT   CDS_pept        complement(594755..596407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0533 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89761"
FT                   /db_xref="GOA:A1UAA3"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA3"
FT                   /protein_id="ABL89761.1"
FT                   /translation="MTGCAPRRSWGVALFAVLSALYFTVGAVLVLRFNMFDPDSPSRVA
FT                   NAGYVLMSRQPHLSAIGFVWNPLPSLVEIPVLTLADWWPALKTHGLAGVVQSALFMAGA
FT                   AVMVRRIALDRGVGTVWRWLAVGCFALHPMIVTYGASGMSEAAETFALVWCVRHLMQWA
FT                   HSHRVGDLAWAGIALGVGYLSRYEAVPAACGAALLVAVVAFHRAQRGQRVNSVILNVLI
FT                   VMFPLISSFAIWALTGWVVSGELFATLSSQYGNDSQVAAAMDRASPLAGAASDDWVVIA
FT                   ARLLGMQPFVLIATAGAVAFAVLRRNATALVPVATLGPVLAFAAWGQFTSTTFGWFRFY
FT                   LLAIPLVICVALAFWQPGARRAVTVARSDVRAGRVGAGLLCASLVIGIPVTVTAMSDER
FT                   IGNQQLQFGLKSLTDPQRYPPTEQWYRRLMVNDRALAAYFDRKRLPEGAVLMDTFNTWG
FT                   VWLGSQRPKQFVITSDYDFTATLNRPWDFGVQYLVASNPGISNADALNIRYPTLWHDGA
FT                   GLGTLVHSVYGATGDERFRVYRVTGRPAPPTAG"
FT   gene            complement(596404..598326)
FT                   /locus_tag="Mkms_0546"
FT   CDS_pept        complement(596404..598326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0534 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89762"
FT                   /db_xref="GOA:A1UAA4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA4"
FT                   /protein_id="ABL89762.1"
FT                   /translation="MKVLTRAVTAVAVAGLALGVSGPPVALADPANTVVAGLGAAGQIR
FT                   WESLGVSERLDLIGENQPVDVSIPVPAGVRPGRLTGQVGSVVNVADGRIEVMDGRDSIL
FT                   GSFPVPREAESKPFSVNVSGAEIVDGTATLRFVLRDRGPVADSCSQPPSLSLTQLGNSF
FT                   TGPTPNPRTVSDFLPGYLDEIVIRVGPSPTPAEQQAALTLVAELTRLYRPMPVRIDLDT
FT                   SGAPSAKGAPGRRVIEISEGGKAAMAVKNPGTQAAVLAIGGTGEELTRQVDLFADRRFT
FT                   LAQTDSAATLYATPNRAESTDIKTFAQLGMTGEASVLGTTTLYAGFDVARFAVGPITGA
FT                   RVHLKARYTPVVGGEASILVRSGSTVLATRRLDESGVLDLTGDIPAESVTSNVGMALEL
FT                   RYVPDQECAPMNDRMTFALDPQSTVTVIPGVHNRGGFPVLPMAFTPDFDVAVDSPGHLR
FT                   YAAQAINLMGQQSSETLRPRITTFDAAVGSGTGLLAVGGGTELADAAMPAPVLPGAPNT
FT                   FGISGSPETDVDLSGPLGVVQVFTHNARTVLSITGTGDWALVDDTFNHIRGLPNRWASL
FT                   TGDVVATGAAHQTVNLTVREGGALINEYPGDPWKWWAVLSSAVGVAVAIAAVVIVLMRR
FT                   RRRAR"
FT   sig_peptide     complement(598240..598326)
FT                   /locus_tag="Mkms_0546"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(598352..599746)
FT                   /locus_tag="Mkms_0547"
FT   CDS_pept        complement(598352..599746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0547"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89763"
FT                   /db_xref="GOA:A1UAA5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA5"
FT                   /protein_id="ABL89763.1"
FT                   /translation="MHDPAGTLLPAHMSARGLLGPRALAVVTAVLAALAAVVWAWPSVL
FT                   APVITGVVAFTYLVSTVDRNYLLFKGLRMSSLVTVSAEEARAVPDDDLPVYTVLLPVYD
FT                   EPTIVTNLINGVGRLDYPPDKLEILLLIEEDDIATQEALLGADLQSARIVIVPHSLPKT
FT                   KPKACNYGMSLPDLRGEYLTIYDAEDIPDPLQLRRAVAAFRRLPVEIGCLQARLGYFNE
FT                   RQNLLTRFFSLEYDQWFGVVLPAVENAGCVVPLGGTSNHMSVRVWRQIGGWDEFNVTED
FT                   ADLGVRLARHGYRTLILDSITLEEANSDVVNWIRQRSRWYKGYLQTMLVHLRAPVRLRR
FT                   ELGTKGFLRLINMTGGVPMTSALNVIFWFTLFVWVLGRPDAIGPLFPPVTYYVCLLLLL
FT                   ICAPLSVFAGLIVTAALGKPQLWWAALLAPLYWMLQSVAAVKAIYQLFARPSFWEKTVH
FT                   GLSPSA"
FT   sig_peptide     complement(599624..599746)
FT                   /locus_tag="Mkms_0547"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.755 at
FT                   residue 41"
FT   gene            complement(599739..601226)
FT                   /locus_tag="Mkms_0548"
FT   CDS_pept        complement(599739..601226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH02708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89764"
FT                   /db_xref="GOA:A1UAA6"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA6"
FT                   /protein_id="ABL89764.1"
FT                   /translation="MPSEHGVTEVAGAKPLGPLLGISDESLETQPHQGWIARRLAVAVV
FT                   VTAVAYGAGYAAAVAESAAGSRTPHLVALPVLIVLIATGYRTPPRGVGDTESNWIIALM
FT                   VAVPALAGIELLGNRLPTLAALWHLRDFGAIVWFAALLAVLFGVRHVVRMWPLWIFAAS
FT                   FVSPLPWILVTAAAGGSDAAAAAPAAVAGAAAVFLACPEVPRFRRMLAASACLVVATAF
FT                   IVTAGPHLPLPATALFVGAALPVAVTLLYRHRAARSGPTAWAAPHRISARSVTALAAMA
FT                   GVLAVSNPATARPAPLPTAAADWINAAGLTSSSSYGFISRYAGPAATFVRYRPSAPSGS
FT                   SAPAVDVITAPDRAALAAIDDLTWYPTSQPVNYRPAPTGSGLPAGARIAHTNADAARDG
FT                   RNTDWVAIAWEWQAGNVFQRVTIVADQSPTGGRRLPEPSPVSVLDVSLRPALWVARQQP
FT                   DAAGDVDDIVLRDAVALGAELNAAATGHPADGLTTDA"
FT   gene            601421..603535
FT                   /locus_tag="Mkms_0549"
FT   CDS_pept        601421..603535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0549"
FT                   /product="phosphotransacetylase"
FT                   /EC_number="2.3.1.8"
FT                   /note="KEGG: mmc:Mmcs_0537 phosphate acetyltransferase;
FT                   TIGRFAM: phosphate acetyltransferase; PFAM: phosphate
FT                   acetyl/butaryl transferase; DRTGG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89765"
FT                   /db_xref="GOA:A1UAA7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR016475"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA7"
FT                   /protein_id="ABL89765.1"
FT                   /translation="MSLMRQAVRVPDQTDSRVSAIYVASPEGDTGKSTIALGLLDRLTA
FT                   TAPRVGVFRPITRSGPARDYILELLLAHSTAGLTYEDSVGVTYHQLHEDPDSALADIVD
FT                   RFHRVADRCDVVLIVGSDYTDVASPSELSMNARIAANLGAPVVLAVKARGRTPDDVVQV
FT                   VEVCLDEIAAQHAYTAAVVANRCDPDQLTEVREALKRDGAPQVYVLPEEPLLVAPSVAE
FT                   LRDAVDGSMVSGDESLLDREALDVLVAGMTAEHVLERLTEGVTVVTPGDRSDVVLAVVS
FT                   AHAAEGFPSLSSIILNGGLELHPSIAKLVAGLGLRLPIVATGYGTFETASRVAGTRGRV
FT                   TAASVRKIDTALTLMETHVDTAELLSRLAIPIPTVVTPQMFTYQLLDQARSDRKRIVLP
FT                   EGDDDRILKAAGRLLQRGVADLTILGEEGPVRARAAELGVDLAAATVLDPRTSELCDQF
FT                   AEQYAELRRHKGVTVEQAREIIHDVSYFGTMLVHNDMVDGMVSGAAHTTAHTVRPAFEI
FT                   IKTLPDVSTVSSIFLMCLADRVLAYGDCAIVPDPTAEQLADIAISSARTAAQFGIEPRV
FT                   AMLSYSTGTSGTGADVEKVREATDLVHKREPDLLVEGPIQYDAAVEPSVAKTKMPDSPV
FT                   AGRATVLIFPDLNTGNNTYKAVQRSAGAIAIGPVLQGLNKPVNDLSRGALVEDIVNTVA
FT                   ITAIQAQGDR"
FT   gene            603532..604731
FT                   /locus_tag="Mkms_0550"
FT   CDS_pept        603532..604731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0550"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: mmc:Mmcs_0538 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89766"
FT                   /db_xref="GOA:A1UAA8"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UAA8"
FT                   /protein_id="ABL89766.1"
FT                   /translation="MTRTVLVLNSGSSSLKFQLLEPDSGASLADGIVERIGEDSSSASL
FT                   VCGEREVTHSERVPDHEAALRTAYGLFDEAGAELGSVGLVAVGHRVVHGGPDLYQPTLI
FT                   DDALVDTLESLAPLAPLHNPPAVLGIRGARKAFPDLPHVAVFDTAYFHDLPVAAATYAI
FT                   DRDLSEQWHIRRYGFHGTSHQYVSEQAALFLDVPLSSLSQIVLHLGNGASASAILGGRP
FT                   IDTSMGLTPMEGLVMGTRSGDVDPGVLVYLWRTAGMSVDEIETMLNKRSGVRGLGGEID
FT                   FRVLHQRIESGDESDRENAQLAYDVYIHRLRKYIGAYLALLGSTDVIVFTAGVGENDAA
FT                   VRRDALSGMGRLGIELDEHLNESPSHTARRISAETSPTTVLVIPTNEELAIARACVEVI
FT                   "
FT   gene            604838..605512
FT                   /locus_tag="Mkms_0551"
FT   CDS_pept        604838..605512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0551"
FT                   /product="asparagine synthase (glutamine-hydrolyzing),
FT                   putative"
FT                   /note="KEGG: mmc:Mmcs_0539 asparagine synthase
FT                   (glutamine-hydrolyzing), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89767"
FT                   /db_xref="InterPro:IPR008884"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAA9"
FT                   /protein_id="ABL89767.1"
FT                   /translation="MQVLQAVAANPLQRRIRRDKLTYLGYQKLRSLSRAAEAVREVPGC
FT                   VIECGLALGGSGIMLATELPDRPFHGYDVFAMIPPPGPNDPAKAHDRYEVIASGRSEGL
FT                   GGETYYGYVDDLFDRVSDSFARYGVPTGDRIHLHKGLFEDTLDPQWPVALAHIDCDWYD
FT                   PVKLCLERLTPWLSPGARVILDDYSDYGGAKKATDEHVAAHSGFSVERDAGHRVLVYKP
FT                   RA"
FT   gene            complement(605509..607788)
FT                   /locus_tag="Mkms_0552"
FT   CDS_pept        complement(605509..607788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0552"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: tyrosine protein
FT                   kinase; serine/threonine protein kinase; KEGG:
FT                   mmc:Mmcs_0540 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89768"
FT                   /db_xref="GOA:A1UAB0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR031634"
FT                   /db_xref="InterPro:IPR031636"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB0"
FT                   /protein_id="ABL89768.1"
FT                   /translation="MAASDHDLDPAVDDEPGTQPASLDDLDLDSASTVRPMATQAVFRP
FT                   DFDDSDSISVHTGDTEPQDHATTAIRTLSPVRRLGGGLVEIPRVPAKDPLEALMTNPVV
FT                   AENKRFCWNCGRPVGRSTSDGKALSEGWCPHCGSQYSFLPQLNPGDMVADQYEIKGCIA
FT                   HGGLGWVYLAFDHNVNERPVVLKGLVHSGDAEAQAIAMAERQFLAEVTHPGIVKIYNFV
FT                   EHEDKHGNPVGYIVMEYVGGTSLKQARGQRLPVAQAIGYMLEILPALGYLHSLGLTYND
FT                   LKPENIMLTEDQVKLIDLGAVSTINSFGYLYGTPGYQAPEIVRTGPTVQSDIYTVGRTL
FT                   AALTLELRTRKGRYVEGLPEDDPVLAQYDSFGRLLRRAIDPDPRRRFASSEEMSSQLLG
FT                   VLREVVARDTGVPRSGLSTVFSPTRSTFGIDLLVAHTDVYVDGQVHSEKLTAQEIVRAL
FT                   PVPLVDPTDVGAAVLSASVLSEPVQTLDQLRAARHGSLDSEGIDLSESVELPLMEARAL
FT                   LDLGDVAKATRKLDDLATRVGWRWRLVWFRAVAELLSADYESATKHFTEVLDTVPGELA
FT                   PKLALAATAELAGSDLDHAPSRKFYETVWGTDHGIISAGFGLARALSAEGDRNGAVRTL
FT                   DEVPATSRHFTTARLTSAVTLLSGRSSNEITEQQIRDAARRVEALPDTEPRVLQIRALV
FT                   LGTAMDWLVDNSANTNHILGFPFTEYGLQLGVEASLRALARVAPTQAHRYALIDLANSV
FT                   RPMSTF"
FT   gene            complement(607788..608783)
FT                   /locus_tag="Mkms_0553"
FT   CDS_pept        complement(607788..608783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0553"
FT                   /product="amino acid ABC transporter substrate-binding
FT                   protein, PAAT family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; KEGG: mmc:Mmcs_0541 extracellular solute-binding
FT                   protein, family 3; TC 3.A.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89769"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB1"
FT                   /protein_id="ABL89769.1"
FT                   /translation="MSARAKNRQRVMKRLLALLSATVLVLAGCGQAASVVPTPGVTLAP
FT                   PTPAGMEELPPEQARLPIPETDDCNRRASLRPFPTRAEADAAVAYIRERGRLIVGLDIG
FT                   SNLFSFRDPITGDITGFDVDIAGEIARDIFGSPAQVDYRILSSADRIVALQNNQVDVVV
FT                   KSMTITCERKKKVGFSTVYLNADQRILAPRDSAITRAADLSGRRVCVVKGTTSLRRVQQ
FT                   ISPPPIIVSTVTWADCLVALQQRQVDAVSTDDAILAGLVAQDPYLHIVGPSMNQEPYGI
FT                   GVNLENTGLVRFVNGTLQRIRNDGTWYALYRKWLTVLGPAPAPPVARYVD"
FT   sig_peptide     complement(608649..608783)
FT                   /locus_tag="Mkms_0553"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.484 at
FT                   residue 45"
FT   gene            complement(608783..610102)
FT                   /locus_tag="Mkms_0554"
FT   CDS_pept        complement(608783..610102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0554"
FT                   /product="putative conserved membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0542 putative conserved membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89770"
FT                   /db_xref="GOA:A1UAB2"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB2"
FT                   /protein_id="ABL89770.1"
FT                   /translation="MTVELAHPSTEPLASRSPTTPAHPRWFFLWTTPGRILTIGIVLAA
FT                   LAIASAFATSTTINDRQRALTTVLNHTEPLSFAAGELYSRLSVADAAAATAFIAGTEPR
FT                   DVRQRYEQAITDAAVALTRASSGLTDEELVQLLGRINAELAVYTGLVETARTNNRAGNP
FT                   VGSSYLSEASSLMQTKILPDAERLYERTSAQVDQETGASTRIPAPVILVVLATLLFGLF
FT                   ANRWLARRTRRRVNIGFVAGGLAVLIMVLWVGTALTISTTDSRSARGAGAESLKTITTL
FT                   AITAQQARADETLALIRRGDEEVRKQSYYQRIDGMQKKLADYLAREDAIDSTDLVAAED
FT                   LLARWRAADDRINAYIAVGNYQAATQVALGTGEDDSTPAFDKLNDALTKAIEQSRSQLR
FT                   NDILNARRVLSGATAGAAALSVIAAVAVALGLWPRLSEYR"
FT   gene            610211..610735
FT                   /locus_tag="Mkms_0555"
FT   CDS_pept        610211..610735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0555"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mmc:Mmcs_0543 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89771"
FT                   /db_xref="GOA:A1UAB3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB3"
FT                   /protein_id="ABL89771.1"
FT                   /translation="MGAPYPVRVRGDGDGWVFSEGGGRYWGRHGAAGLLLRAPQSDGSA
FT                   AVLLQHRAPWSHQGGTWGLPGGARDSHETPEQAAVREAHEEAGLSVEQLTVRTTVVTAE
FT                   VVGSGGASWTYTTVIADAPALLHTVPNRESAELRWVAEEDVDSLPLHPGFAASWDRLRT
FT                   VTAAFPLLVSD"
FT   gene            complement(610725..611405)
FT                   /locus_tag="Mkms_0556"
FT   CDS_pept        complement(610725..611405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0556"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: mmc:Mmcs_0544 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89772"
FT                   /db_xref="GOA:A1UAB4"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UAB4"
FT                   /protein_id="ABL89772.1"
FT                   /translation="MREPLDPLGPALAQASLYLCTDARRERGDLAEFADAALAGGVDLI
FT                   QLRDKGSAGERRFGPLEAREELAALEILAEAARRHGALLAVNDRADIALAAGADVLHLG
FT                   QDDLPLPVARRIIGPSPLIGRSTHDSAQVAAAVAEEVDYFCVGPCWPTPTKPGREAPGL
FT                   GLVREVASRATEKPWFAIGGIDEARLPEVLDAGARRIVVVRAITAADDPKAAARRLKDA
FT                   LVSR"
FT   misc_binding    611441..611557
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 66.40"
FT   gene            611545..612561
FT                   /locus_tag="Mkms_0557"
FT   CDS_pept        611545..612561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0557"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: mmc:Mmcs_0545 glycine oxidase ThiO"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89773"
FT                   /db_xref="GOA:A1UAB5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB5"
FT                   /protein_id="ABL89773.1"
FT                   /translation="MPPDSTLAVIGGGVIGLSVARRAALDGWSVRVHRSPAKGASWVAG
FT                   GMLAPHSEGWPGEHELLRIGLDSLRLWHGGFLEGLPDEVVTARESLVVAVDRADAADLK
FT                   TVGEWLAVQGHPVTFTTAARDIEPLLAQGIRHGFVADTELAVDNRAVVDALEAHCTRLG
FT                   VRWAPPVDDLAAVDDVDLRVLANGVDAPTLWPGLPIRPVKGEVLRLRWRRGCMPAPRRV
FT                   VRARVHGRQVYLVPRADGVVVGATQYEHGRDTAPAVTGVRDLLDDACTVMPALGEYEFA
FT                   ECAAGLRPMTPDGLPLVEWLDERTLVAAGHGRNGFLLAPWTAERVSAELQTTQGART"
FT   gene            612572..612769
FT                   /locus_tag="Mkms_0558"
FT   CDS_pept        612572..612769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0558"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: mmc:Mmcs_0546 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89774"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB6"
FT                   /protein_id="ABL89774.1"
FT                   /translation="MRIVVNNEDVHLDEQTTVAQLVARMGFPEKGIAVAVDWSVLPRTE
FT                   WETPLRDGARVEVVTAVQGG"
FT   gene            612762..613523
FT                   /locus_tag="Mkms_0559"
FT   CDS_pept        612762..613523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0559"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   mmc:Mmcs_0547 thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89775"
FT                   /db_xref="GOA:A1UAB7"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB7"
FT                   /protein_id="ABL89775.1"
FT                   /translation="MAEAAKLTIAGREFGSRLILGTGGAANLAVLEQALMASGTELTTV
FT                   AMRRVDAETGTGVLELLNRLGISPLPNTAGCRGAAEAVLTAQLGREALGTDWVKLEVIA
FT                   DERTLLPDAVELVRAAEQLVDDGFTVLPYTNDDPVLARRLEDIGCAAVMPLGSPIGTGL
FT                   GIANPHHIEMIVDAANVPVILDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAA
FT                   AMAAAVTAGHLARHAGRIPKRFWAQASSPAL"
FT   gene            613532..614281
FT                   /locus_tag="Mkms_0560"
FT   CDS_pept        613532..614281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89776"
FT                   /db_xref="GOA:A1UAB8"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR037460"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB8"
FT                   /protein_id="ABL89776.1"
FT                   /translation="MALGSSMAAGPGIRPSADGAPFRAGRSARNYAHLVAERLGLDLTD
FT                   VTYSGATTANILDEPQHGTPPQFLALDGTETLVTVTIGGNDVGYVPMLMAAGLPRVVRW
FT                   LPPVSTLFDPTARDRALVEVGESLHRVARTVRARAPRARVLFVDYLTLLPPPGEPVAPL
FT                   SDADAALGRRIADTLERLTGRAAADTGCGWIRAAQASRAHHAWSSEPWTTGPGLPWPGR
FT                   PAPLHPNAAGMRAVADLIVDAVESRDD"
FT   gene            614274..615176
FT                   /locus_tag="Mkms_0561"
FT   CDS_pept        614274..615176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0561"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmc:Mmcs_0549 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89777"
FT                   /db_xref="GOA:A1UAB9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAB9"
FT                   /protein_id="ABL89777.1"
FT                   /translation="MIELTGLTKRFGRVRAVDDLTCTVEPGVVTGFLGPNGAGKSTTMR
FT                   MILGLDRPSAGTATVMGRPYREHRHPLRTVGALLDARQVHPNRTARSHLRWIAASNRLP
FT                   DKRVDEVLGMVGLADVAGKPAGAFSLGMSQRLGIAAALLGDPQVLLFDEPVNGLDPEGI
FT                   RWIRTLMRDLAGEGRTVFVSSHLLAEMAQTADRLLVIGRGRLIAATTVGDFVNRAGLDT
FT                   VRVRTPDRDRLCDALTAAGLSTTVEDSAVLVHGASTEQVGELAARTGATLHELSIQRAS
FT                   LEEAYMALTDEAVDFRARR"
FT   gene            615176..615916
FT                   /locus_tag="Mkms_0562"
FT   CDS_pept        615176..615916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0562"
FT                   /product="putative ABC transporter membrane protein"
FT                   /note="KEGG: mmc:Mmcs_0550 putative ABC transporter
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89778"
FT                   /db_xref="GOA:A1UAC0"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC0"
FT                   /protein_id="ABL89778.1"
FT                   /translation="MLRAEQIKLRTTRSPLWTLFAVVVVSLGFAVIQASVGSTAVPLAP
FT                   ERAAIGVAGFAVPVLMVLSALTVTGEYRTGMIRTTFLAMPGRTRVLAAKAVVTAVFSGI
FT                   CAVIMVLASALAVRLVGTPAQGAELSFTEFAVWRTAGAIGLYAVLGAVLAVGLGTLIRH
FT                   SAGVIAILLLLPFVIEPLLGSIPRVGARVGPLMPFANVNTFTEVEWVQTFSMWWGPLGA
FT                   LLYFTGVVAVVFVAAAVDINRRDP"
FT   sig_peptide     615176..615280
FT                   /locus_tag="Mkms_0562"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.191 at
FT                   residue 35"
FT   gene            complement(616691..618442)
FT                   /locus_tag="Mkms_0563"
FT   CDS_pept        complement(616691..618442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89779"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC1"
FT                   /protein_id="ABL89779.1"
FT                   /translation="MGLIFWSNSNLRTVFGSPSPGRGSVSVCTTIRTRTARSPGSVTSR
FT                   TTYLASPGRNLLCRITSSFSLRHRYPGSERSASRRHTRSSPSLMMTWTSTSVSFRGGFG
FT                   ENTPQLWSRPVARVRGWSIGASVSLIAESGSDPTTATTTSSATMTLMAMSPARLVLEAD
FT                   SPSCVDIGAYSSHQPSRPTGPPPKRTSTNRETRSSKKCTTRQKRSERNLKKRAIGLGVG
FT                   RSDGFVASTASVESEPSLKSSVESTASSVESTASPRPSAVVSRMSVRSDPSTTSVRSRL
FT                   SAAPSTVSSTPSTAVSRTSLTPSESTASSVESTVSPRPSTVTSTVSVRSVPSTTSVRSR
FT                   LSAAPSTVSSTPSTAESTTSLTPSASEAASSVESTVSPRPSTVTSTVSVRSVPSTTSVR
FT                   SRLSAAPSTVSSTPSTAVSRTSLTPSASEAVSLTSSVESTASNVESTASPSPSAAASTT
FT                   SVRSVRSAASVRSSASSRPSTVVSRVSVTPSTVSSTVSSTPSTRSLISRLPRSSPPPPP
FT                   RSSNPLVPIRDPASGSSADGDSPSDVADEPPSEPGEPSDPSSPSFSPASPPTGASGTIP
FT                   APGVESN"
FT   gene            618488..619486
FT                   /locus_tag="Mkms_0564"
FT   CDS_pept        618488..619486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0564"
FT                   /product="HTTM domain protein"
FT                   /note="SMART: HTTM domain protein; KEGG: mmc:Mmcs_0552
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89780"
FT                   /db_xref="GOA:A1UAC2"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC2"
FT                   /protein_id="ABL89780.1"
FT                   /translation="MTADLWSRLRQTGGDSARAWRRFWFSYDSAYPLGFIRIAFGVLMM
FT                   VWTVSLYPGLHDRFGTDGVVPRPPTADFTWSVFRVFPDDDAVFAGWVLLLVASIALTVG
FT                   WHSRLAAVLVFVMVVSFERRNPFVMNAGDVLLRVEALFIALAASGAALSLDQRRRTGSF
FT                   WTAEQRRIWPVRLMQIQVSVIYVSTVVAKLHGETWQDGTAVSYSLRQNDLLFFTTPRWI
FT                   TDNLLVSNVLSWSTLLIELSIGLLVWNRRCRPWVLAAGVVLHLSIFVSMSIGLFSLAMF
FT                   VLYLAFLPSGRAEALGNRLAQRSAARCGRHSGRHSRQRSADMTRDLARSGG"
FT   gene            619523..621028
FT                   /locus_tag="Mkms_0565"
FT   CDS_pept        619523..621028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0565"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mmc:Mmcs_0553 lysyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89781"
FT                   /db_xref="GOA:A1UAC3"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC3"
FT                   /protein_id="ABL89781.1"
FT                   /translation="MVREMLAVLSIVAVTAGLTGCGDDEKGNPVPAPSTQETAPEAKEF
FT                   GAALKDKVTVDAMMGHLDELQKIADAHGGNRALSTPGYDASVDYVANTLRDKGFDVQTP
FT                   DFEVRLPFAEKPQLTVGGRAVEAKALEYTIGTAPQGVEGPLVPARVEDSPGCTASDYDG
FT                   LPVQGAVVLVDRGECPFGVKQAVAAQRGAVALVVVNNVDGEVVSGTLGDDTDVKIPAVS
FT                   VTKAVGGELRDAPGQTTLRLEAGVRTDRTRNVIAQTKTGSTSDVVMVGAHLDSVPEGPG
FT                   INDNGSGVAAILETALQLGVDPDVRNTVRFGFWGAEEQGLLGSMDYVQSLNEEQLKDIS
FT                   LYLNFDMLGSPNPGYFTYDGDQSAPPNPEAGSPRVPEGSAGIERTLMQYLDDAGKPGED
FT                   TSFDGRSDYDGFTLAGIPAGGLFSGAEEEKTPEQAERWGGEADRPFDPNYHKKEDDLTH
FT                   IDRTAMEINGGGVAYAVGLYAQDQRGRNGIPIRDDRTRHPVES"
FT   sig_peptide     619523..619606
FT                   /locus_tag="Mkms_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.681 at
FT                   residue 28"
FT   gene            621028..622467
FT                   /locus_tag="Mkms_0566"
FT   CDS_pept        621028..622467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0566"
FT                   /product="aminopeptidase Y, Metallo peptidase, MEROPS
FT                   family M28A"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M20; protease-associated PA domain
FT                   protein; peptidase M28; KEGG: mmc:Mmcs_0554 lysyl
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89782"
FT                   /db_xref="GOA:A1UAC4"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC4"
FT                   /protein_id="ABL89782.1"
FT                   /translation="MHISRAVTALVAALVAACSSPAPPPDVTGGDLAGKVTVDALYTHL
FT                   EALQDIAERHGGNRAQGTAGFDASVDYVANLLRDSGFDVQTPEFDRYGGTRGGAPRLTV
FT                   NGRAHAVEKASLLVDTGPEGLDAVTLRPGRPAGCSAGDYGAVDVRRSIVVVDDTGCSVV
FT                   VKQDVAVARGAVGVLVVTGSGGGSPPGLFTPGYYRELTVPVGIINSDANAALRRTTAPV
FT                   RLRLDGQPVLVKSRNVLAQTKTGDTRNVVMAGAHLDSVSSGPGINDNATGVAAVLETAL
FT                   QLGSSPRVANAVRFAFWGSEEIGLEGSRAYLRDLDGEQLDDIALYLNFDMLGSTNAGYF
FT                   TYDGDQSAATEPVSVPEGSAGVERLLAGYLNEAGVRPADMPLSDRTDYHSFLAAGVPFG
FT                   GTTTGAAQQKTEVQARLWGGRAGAAFDPNYHTRRDTIDNVDRHALGIMGPAVAFAVGTY
FT                   AHSIKGANGVPPRDRRDRDRP"
FT   sig_peptide     621028..621117
FT                   /locus_tag="Mkms_0566"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.856 at
FT                   residue 30"
FT   gene            622957..624261
FT                   /locus_tag="Mkms_0567"
FT   CDS_pept        622957..624261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0567"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89783"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC5"
FT                   /protein_id="ABL89783.1"
FT                   /translation="MQTAVRSYVSAGVALAGVGAIAFSPVVPIPDVEVPAISSSAVELN
FT                   ALVNPIELFVPIFEKAFADTGALGQRVFANPAPILEQILANQVASAQTLGEIAGVFGES
FT                   FQTAFAAAPGLLETAFDQFAAGEITLALNTLFDLALSPVIGPLLDSIFMGDGVLQDLVG
FT                   VLQKPLVNAQNVIGLLGDPDFLLTIGLLPLQTAYALNTAVGGAAEALLAAAEAGDPEGF
FT                   VNAITTGSANVTAAVLDLLLNPGTPPYNYDQGLVAALLSARDMIAQAIGAPAPSPALLA
FT                   TVSSEVTDPALTTITLDVAPASDAIEAPKPAAETDVSAVSLSADAVDATEPATAVAEET
FT                   AAVEAGVDEVVAESEVVTPKKSDPLNELRKGVEGAVNDIRNGFKHAAASLTGKASKPAK
FT                   SESSPASDSGSASESDSGSDSGSGSGSDSTSGDAE"
FT   sig_peptide     622957..623067
FT                   /locus_tag="Mkms_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.378 at
FT                   residue 37"
FT   gene            complement(624279..625580)
FT                   /locus_tag="Mkms_0568"
FT   CDS_pept        complement(624279..625580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0568"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: mmc:Mmcs_0556
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89784"
FT                   /db_xref="GOA:A1UAC6"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC6"
FT                   /protein_id="ABL89784.1"
FT                   /translation="MIPAKTGRSANWKWKPVEARADADFVVAPDERLSWPRTIGLGAQH
FT                   VVAMFGATFLVPVLTGFPPATTLLFSGVGTILFLIITGNRLPSYLGSSFSVIAPVTAAV
FT                   ASEGTGSALGGIVALGLVLIVIGGVVHLVGTRWLDVTLPPVVTGAIVALIGFNLAPAAK
FT                   TNFEAGPVVATVTLVLLVATLAFFRGMIGRLAIFLAVLIGYLLALAMGDVDTSAIAAAP
FT                   WVGLPDFEAPSFSLAVLPMFLPAVVALIAENIGHVKSVGQMTRTDMDPLIGRALAADGV
FT                   ATTLAGFGGGSATTTYAENIGVMAATRVYSTAAYWVAAVVAIALSLCPKIGAAISATPA
FT                   GVLGGATVVLYGLVGVLGVRIWLTNHVDFSLPVNQMTAAIPLIIGIADFTWQAGELTFT
FT                   GIALGSIAALLVYHGMRLLGLRTSRSAEPSTSTV"
FT   gene            complement(625587..626834)
FT                   /locus_tag="Mkms_0569"
FT   CDS_pept        complement(625587..626834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0569"
FT                   /product="amino acid/polyamine/organocation transporter,
FT                   APC superfamily"
FT                   /note="PFAM: amino acid permease-associated region; Amino
FT                   acid transporter, transmembrane; KEGG: mmc:Mmcs_0557 amino
FT                   acid permease-associated region; TC 2.A.3"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89785"
FT                   /db_xref="GOA:A1UAC7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC7"
FT                   /protein_id="ABL89785.1"
FT                   /translation="MNPPGGPALSRRLGLVDAIVIGLGAMIGAGIFTALAPAAAAAGGG
FT                   LLVGLAVAAVVAYCNATSSARLAARYPESGGTYVYGRERLGPFWGYLAGWGFVAGKTAS
FT                   CAAMALTVGVYVWPGGARLIAVAAVVALTAVNYAGIRKSALLTRLIVAVVLAVLAVVVV
FT                   IVLGFGDPVGDRLDFGADVTVGGALQSAGLLFFAFAGYARIATLGEEVCDPARTIPRAI
FT                   PIALGLTLAVYAVVAVTVLAQLGPAALAGSTAPLADAVRAAGFPGWVPVVGAGAAVAAL
FT                   GSLLALILGVSRTALAMARDRHLPSGLAAVHARHGTPHRAEVAVGVLVAALAATVDLRD
FT                   AIGFSSFAVLMYYAIANASAWTLGARVVPAVGLAGCLLLAFALPWTSVLAGVAVLAVGA
FT                   LAYAVRRARSTGNGAR"
FT   sig_peptide     complement(626709..626834)
FT                   /locus_tag="Mkms_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.853 at
FT                   residue 42"
FT   gene            complement(626844..627182)
FT                   /locus_tag="Mkms_0570"
FT   CDS_pept        complement(626844..627182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0570"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89786"
FT                   /db_xref="GOA:A1UAC8"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC8"
FT                   /protein_id="ABL89786.1"
FT                   /translation="MSARAWYIGIGGAILMAIGLFALRFPVLIDGYDQWGWQVECGSGF
FT                   VANLTQAENAAVDGTDFVASCQNALLTRRLWTIPLIAAGVVAMVAVLLTATVAHEDEDT
FT                   LAGDRETS"
FT   gene            627278..628564
FT                   /locus_tag="Mkms_0571"
FT   CDS_pept        627278..628564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0571"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: mmc:Mmcs_0559
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89787"
FT                   /db_xref="GOA:A1UAC9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAC9"
FT                   /protein_id="ABL89787.1"
FT                   /translation="MCGISVFGMAPTPPGRGDGVRRRPKDRKAQIARASAEAFSSLGYH
FT                   GVSMDAIASRVGISAAALYRHYTGKYELFRDAVLALGQQLVDATAFVDGEISDDGFGAH
FT                   ITEDPERTLVHLATAVCDAALANRESGGLYRWEARFLRGDDQATLDSQIRTVHRRFQQP
FT                   LRMLRPELDSRQRWTLSTAMISVLGSIVDHRAKLPAGQIRPLLAELVVALVPAEFPDLP
FT                   DDPEPPAPIAAAHRSKYEALLVESMRLFNLKGYRDTSMEDIAAATGMPASGIYRYFSGK
FT                   SDILAGAFRRSADRWSAEMSAILDTTADREEALAKLIDGHVARSFSEPELDYVYYTERL
FT                   NMSPADQQILRNLQRSTVETWADLVVTLRPEWTAGQARFAVYAALAVTIDLGRLVHYRN
FT                   SPYTRALVAGLMDLTLLGRYRLRTVLPAK"
FT   gene            complement(628531..628797)
FT                   /locus_tag="Mkms_0572"
FT   CDS_pept        complement(628531..628797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0572"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89788"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD0"
FT                   /protein_id="ABL89788.1"
FT                   /translation="MPQQDNRAAKLTGLAIAGTGLAHFVRPQVFEPITVAAFPQNTRRH
FT                   IYTNGSLETAIGLALAGRKTRKFGLAGLLGYAVYLAGNTVRKR"
FT   gene            complement(628811..630301)
FT                   /locus_tag="Mkms_0573"
FT   CDS_pept        complement(628811..630301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0573"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mmc:Mmcs_0561 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89789"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD1"
FT                   /protein_id="ABL89789.1"
FT                   /translation="MTSEQYDAVIVGAGFAGIGAAIQLKRMGYANFVILDREDDLGGTW
FT                   YVNHYPGLAVDVPTTTYSYFFEPNPKWSRLFSTGAEIKQYADEVADKYDVRRHIRFNTA
FT                   VEGARWDEEAKLWRVALDGGETLSTRYLITATGFLSQPRTPDIPGITSFEGKVIHTTDW
FT                   DDSFDPSGRRIAIIGTGATAVQLIPELARNAADLTVYQRTPIWVAPKVDIRFSERTKRL
FT                   FARVPLLQRTVRLITDTIYEAMINIGVVHYKVPLFRRLNMSAMDLCKINQFVAIRDKEL
FT                   RRKLTPDYDIGCKRPTFSNSYFRTFTKPHVHLQADGIDHVEADGIVNADGTKTVIDTLV
FT                   LATGFDLWEANFPAIEIIGRGGRNLGKWWRETRFQAYQGVSMPYFPNYLSLASPYAFLG
FT                   LNFFNTMEYQMRLMDRLFSEVHRRGATTFEVTEEANTRYLDRMTEALGSSLWTLGNCAS
FT                   SRSYYFNPSGEPSLLRPMSTRDAIKEASEFPLSDYQIA"
FT   gene            complement(630357..630974)
FT                   /locus_tag="Mkms_0574"
FT   CDS_pept        complement(630357..630974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89790"
FT                   /db_xref="GOA:A1UAD2"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD2"
FT                   /protein_id="ABL89790.1"
FT                   /translation="MSMPPGPPPPPPGQPPYGQQPYGQPAYGQPAYGQPYFPPPPPQPY
FT                   AEMRPAGPPPPPKKSKLWLILGLVALTVVVIAIAVVLFVVLVVREGTVTATQVKLGDCL
FT                   SEIPDGSEVRTLKTVDCAEPHAGEVFAVLQMPDGDFPGQDAMVEYANRCAPELASYSPS
FT                   AVTDDTVRLFVLFPTDETWSDGDRAVTCVATLNPPRAGSLKG"
FT   gene            complement(630985..631608)
FT                   /locus_tag="Mkms_0575"
FT   CDS_pept        complement(630985..631608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0575"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89791"
FT                   /db_xref="InterPro:IPR026555"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD3"
FT                   /protein_id="ABL89791.1"
FT                   /translation="MNLDDIAGVAHEPAGTPRGVVLLTHGAGGNRDAPLLVRFCDEWAG
FT                   RGWLAVRYNLPYRRRRPKGPPSGSATADRAGVADAVAAARELTDGPVIAGGHSYGGRMT
FT                   SMAVADDGVALDVMTLSSYPLHPPGKPDRARTEHLPRIGVPTVFVHGTADPFGSIDELT
FT                   AAAALVAGPTELVEITGARHDLGSKALDVPKLAVDAALRLLATG"
FT   gene            complement(631595..632443)
FT                   /locus_tag="Mkms_0576"
FT   CDS_pept        complement(631595..632443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0576"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: mmc:Mmcs_0564 phosphomethylpyrimidine kinase
FT                   type-2; TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89792"
FT                   /db_xref="GOA:A1UAD4"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD4"
FT                   /protein_id="ABL89792.1"
FT                   /translation="MTDTRYLPLAPPGQTPARVMTIAGTDSGGGAGIQADSRTFAMLGV
FT                   HGCVAVVAVTVQNSVGVKGFHEIPIDVITGQIEAVVSDIGIQAAKTGMLASSEIITAVA
FT                   ETWRRLRPAPLVVDPVCASMHGDPLLHPSALDALRSELFPLATLVTPNLDEVRLITGID
FT                   VTDAASQRDAARALHALGPQWALVKGGHLRSSAYSPDLLFDGSEFHEFGADRIDTGHDH
FT                   GAGDTLAAATASALAHGYSVPDAVAFAKQWVTECLRAAYPLGHGHGPVSALFRLSADEP
FT                   R"
FT   misc_binding    complement(632434..632542)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 69.91"
FT   gene            632619..634382
FT                   /locus_tag="Mkms_0577"
FT   CDS_pept        632619..634382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0577"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mmc:Mmcs_0565 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89793"
FT                   /db_xref="GOA:A1UAD5"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD5"
FT                   /protein_id="ABL89793.1"
FT                   /translation="MCSAASARRCAPSDTKRTRLQMTTELTGRRRIATDRDHPLYKWVV
FT                   LSNTTLGMLLATVNSSIVLISLPAIFRGIGLNPLQPANVTYLLWLLMGYMVVTAVLVVL
FT                   FGRLGDMFGRVRIYNLGFVIFTLCALALSFQPFDLDAGAWWLIGWRVVQGVGGAMLIAS
FT                   SAAILTDAFPAHQRGMALGVNMVAAVAGSFLGLVIGGALSEWHWQAIFWVGVPIGVLGT
FT                   VWAMRSLREVGERSPGRLDWAGAVTLGLGLTVLLTGITYSIQPYGGSPTGWGNPWVLGA
FT                   IAFGVLALVAFCVIELRVDQPLVDILLFRITAFGMGNLAGLMSSVGRGGLQFMLIIWLQ
FT                   GIWLPLRGYDFEATPLWAAIYMLPLTFGFLVAGPLSGWLSDRYGARPFTVGGMLLMCAT
FT                   FVALVLIPVDFDYWLFATLIFLNGVGGGVFTSPNSAAIMSSVPASARGAASGVRATFFN
FT                   AGGSLSIGIFFSLMIVGLANTLPGAMSAGLQAQGVSAAVADEVAGTPPVGSLFAAFLGY
FT                   NPIGELLEPSHALQQPGVNAEVLTGQTFFPHLIIEPFHTGLVVVFVAAAVMMLIGAVAS
FT                   LFNAGRYAEQT"
FT   gene            634427..637186
FT                   /locus_tag="Mkms_0578"
FT   CDS_pept        634427..637186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0578"
FT                   /product="regulatory protein, LuxR"
FT                   /note="PFAM: regulatory protein, LuxR; KEGG: mmc:Mmcs_0566
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89794"
FT                   /db_xref="GOA:A1UAD6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD6"
FT                   /protein_id="ABL89794.1"
FT                   /translation="MPLQLISRDAELSAVDDLLSAVPTGTCVLVLEGDVGIGKSTVWRA
FT                   GIERARTRGFRVLAAHPVSSESVAAYSSLAELLADVDTEVLDHLPAPQRVAIDRVLSRA
FT                   DDTGPGTDQRAVAAAVRSVLERLAHDSPVLVAIDDLQWLDPPTAAVLASVARRSAGAIG
FT                   FLVTVRSGAGDHTETLLEPSRPERLHRARVHPMTVGGLHAMISHQLGRSLTRPRMDWVY
FT                   EVSAGNPLYALELARALDRDATGVGPLPATLADLVRTRISGLPDHTREVLLATACIASP
FT                   TVDLVARAVGDNVEWTVAALEEAERHGVVEITGYKVTFSHPLLARGVYAEASADERRWM
FT                   HRRLADIVESPESRARHRALSSDGADEQTVKALDEAAESVHLRGAPATAAELLDMARAR
FT                   GGDTPERTLRAAACHFEAGDAARARVLLEHALSEIPPGELRARALQLLGLVRLYANSSS
FT                   EAVPMLEQAIAEPGVNPDRRVHMLVMLAFIEFNAGRADRAVQRAEEAVTQAMTLHRPDL
FT                   ITQAKPIRALLRFLLGEGFDEAELDGVFDFDEPEGLPLAAQPRTLHALLMLWTDRLDEA
FT                   ADQFNAIAQRCIERGDESERAFVDFHLGQVNVWRADLAAAERVAEDSVERALQSHGDLP
FT                   LFVALIVRVMVSAHFGREDQTRRFAAQARTVGERCESSRLGVWLTTSLGFLELSLGDHR
FT                   AAVDVLSPAVEGWSSAATGIPAPTELVTAPFLPDAAEALIGIGRLDEAERLVEALEANG
FT                   TRLDRPWMLALGARCRALLLAARGDLTAAVRAGERALTEHGRLSMPFELARTQLVVGRL
FT                   QHRRRQYDAATATVSTALAAFERIGAELWARQARAELDALTGRQTAAGLAESERRFADL
FT                   AVQGMTNREIAATLYVSEKTVEANLSRVYRRLGIRSRGELARVLNAES"
FT   gene            complement(637196..637999)
FT                   /locus_tag="Mkms_0579"
FT   CDS_pept        complement(637196..637999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0579"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="TIGRFAM: exodeoxyribonuclease III;
FT                   exodeoxyribonuclease III Xth; PFAM:
FT                   Endonuclease/exonuclease/phosphatase; KEGG: mmc:Mmcs_0567
FT                   exodeoxyribonuclease III (xth)"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89795"
FT                   /db_xref="GOA:A1UAD7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD7"
FT                   /protein_id="ABL89795.1"
FT                   /translation="MRLATWNVNSIRARVDRVTDWLERADVDVLAMQETKCNDEQFPTM
FT                   PFAALGYDVVHCGFNQWNGVAIASRVGLDDVAVGFDGQPTWGDKPDIEAAAEARALGAT
FT                   CAGVRVWSLYVPNGRFVGSPHYAYKLEWLAALRKTAHGWLTENPALPIAMVGDWNIAPT
FT                   DDDVWSVEAYQDSTHVTPPERQAFTEIVDAGYADVVRPFTPGPGVYTYWDYTRLAFQKR
FT                   RGMRIDFILGSPAFADRVTHAEIVREERKGKGASDHAPVLVDLRD"
FT   gene            complement(638003..638893)
FT                   /locus_tag="Mkms_0580"
FT   CDS_pept        complement(638003..638893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0580"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   mmc:Mmcs_0568 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89796"
FT                   /db_xref="GOA:A1UAD8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAD8"
FT                   /protein_id="ABL89796.1"
FT                   /translation="MPELPRAGTRVSLRYRLPAGSVPPLNDVVGHLLERDPVVRVRTKT
FT                   GESVTISPADVVTVRVLTDVPVKSSQIRAVEHAAALAWPGLHREWVDGWLLRASDGYTH
FT                   RGNSAVPLDINANAATVPAIRDWYARRGLTPWLAVPDRLVQLPLRDVHLESIVMVRALP
FT                   AEAAAEVTVTPQPDPAWLAVYEREVPIEVLTAVVDGQVAFGRIDDAAVGRAAVTPARDG
FT                   TRWVGLSAVRVAEDRRRRGHARALCAALLQWGARGGATHAYVQVLADNHGAIALYESMG
FT                   FTAQHRERYVDASKL"
FT   gene            complement(638902..639495)
FT                   /locus_tag="Mkms_0581"
FT   CDS_pept        complement(638902..639495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0581"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: mmc:Mmcs_0569 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89797"
FT                   /db_xref="GOA:A1UAD9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UAD9"
FT                   /protein_id="ABL89797.1"
FT                   /translation="MAVVPIRIVGDPVLRTETTPIPVGDDGSLPAEVADLIRDLYETMD
FT                   AANGVGLAANQIGVSQRVFVYDCPDSRGRAGRRRGVVINPVLETSDIPETMPDPDDDEE
FT                   GCLSVPGEQFPTGRADWARVTGLDADGSPITVEGTGLFARMLQHETGHLDGFLYLDRLI
FT                   GRHARAAKRAVKHNGWGVPGLSWTPGEDPDPFGH"
FT   gene            639633..639941
FT                   /locus_tag="Mkms_0582"
FT   CDS_pept        639633..639941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0582"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="KEGG: mmc:Mmcs_0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89798"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE0"
FT                   /protein_id="ABL89798.1"
FT                   /translation="MDGAMAQTEQSGDDSDLPAGLTRREFDILAFERQWWKYAGSKEDA
FT                   IKELFSMSATRYYQVLNALVDRPEALAADPMLVKRLRRLRASRQKARAARRLGFEVT"
FT   gene            639967..640428
FT                   /locus_tag="Mkms_0583"
FT   CDS_pept        639967..640428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0583"
FT                   /product="putative tuberculin related peptide"
FT                   /note="KEGG: mmc:Mmcs_0571 putative tuberculin related
FT                   peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89799"
FT                   /db_xref="GOA:A1UAE1"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE1"
FT                   /protein_id="ABL89799.1"
FT                   /translation="MMNQRESSGLPLRAIVMVLLFLGIVFLLVGFQALRSDDSSADETT
FT                   VATTTSSTPSPKPAPEADARPEVRVFNISDVAGAAEGVATRLRDEGWNVTETGNLTLEG
FT                   VTATTVYFGEAPGEREAADEVGRLLEAPVEPRVPPLAEQPPGVVVAVTG"
FT   sig_peptide     639967..640092
FT                   /locus_tag="Mkms_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 42"
FT   gene            640478..641164
FT                   /locus_tag="Mkms_0584"
FT   CDS_pept        640478..641164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0584"
FT                   /product="superoxide dismutase, copper/zinc binding
FT                   protein"
FT                   /note="PFAM: superoxide dismutase, copper/zinc binding;
FT                   KEGG: mmc:Mmcs_0572 superoxide dismutase, copper/zinc
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89800"
FT                   /db_xref="GOA:A1UAE2"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE2"
FT                   /protein_id="ABL89800.1"
FT                   /translation="MFAVPALALSACSPNEPVSSEPGTTPSVWTGSPSPSAAPGQGEEG
FT                   GSGSEGQGEGGQKLTAELKSPDGTTVANAEFDFSGGYATVTVQTVASGQLEPGFHGMHV
FT                   HQVGKCEPNSVAPSGGAPGNFNSAGGHFQTEGKTGHPASGDLTSLQVREDGSAMVVTTT
FT                   DAFTAEDLTGGEGTAIIIHEKADNFANIPPEKYNQVNGTPGPDQATMATGDAGGRVACG
FT                   VIRSGQ"
FT   gene            641142..642272
FT                   /locus_tag="Mkms_0585"
FT   CDS_pept        641142..642272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0585"
FT                   /product="uncharacterized enzyme"
FT                   /note="TIGRFAM: uncharacterized enzyme; PFAM:
FT                   glutamate--cysteine ligase, GCS2; KEGG: mmc:Mmcs_0573
FT                   enzymatic protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89801"
FT                   /db_xref="GOA:A1UAE3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UAE3"
FT                   /protein_id="ABL89801.1"
FT                   /translation="MLSVPASSRIDFAGSPRPTVGVEWEFALVDAHTRDLSNEAATVIA
FT                   EIGETPHVHKELLRNTVEVVTGICENTGEAMADLHDTLKVVRRIVRDRGMELFCAGTHP
FT                   FANWSTQQLTDAPRYAELIKRTQWWGRQMLIWGVHVHVGISSAHKVMPIISSLLNQYPH
FT                   LLALSASSPYWDGSDTGYASNRAMMFQQLPTAGLPFQFQSWPEFERFVHDQKKTGIIDH
FT                   MNEIRWDIRPSPHLGTVEIRVFDGVSNIAELGSLVALTHCLVVDLDRRLDAGEQLPVMP
FT                   PWHVQENKWRAARYGLDAEIILDADSNERLVTEDLDDLLTRLQPVARSLDCADELAGVA
FT                   EIYRHGASYQRQRRVAEEHDGDLLAVVDALVAELEL"
FT   gene            642369..642707
FT                   /locus_tag="Mkms_0586"
FT   CDS_pept        642369..642707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0586"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89802"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE4"
FT                   /protein_id="ABL89802.1"
FT                   /translation="MADPDQVAMNTTAPSTTTTSPSPTTRARVPDPTPSAPRSPGVPAP
FT                   GGLAATTCGEYVDMDEATQRQVIEAIGEQNELVALNPELWITMASAMCTFADPATLVSD
FT                   AVVGGGFN"
FT   gene            642726..643337
FT                   /locus_tag="Mkms_0587"
FT   CDS_pept        642726..643337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0587"
FT                   /product="peptidase S16, lon domain protein"
FT                   /note="PFAM: peptidase S16, lon domain protein; KEGG:
FT                   mmc:Mmcs_0575 peptidase S16, lon-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89803"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE5"
FT                   /protein_id="ABL89803.1"
FT                   /translation="MFPLEVTMLPGEELPLRIFEPRYVALVQDCLAMTDPAFGVVLIEA
FT                   GREVGGGDRRSTVGALARIVDYADLGVGRFRLRCLMGERIRVRQWLDDAPYPRADIEVW
FT                   EDEPGAVDSAAVFDVEDRVVALYERIAAARGSEFGGRSAVLGPEESDVVKRLYGLAARV
FT                   PMGQADKYAVLSAPTVSARLSALSEAVDTVTAMVEFQLSE"
FT   gene            complement(643391..644395)
FT                   /locus_tag="Mkms_0588"
FT   CDS_pept        complement(643391..644395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0588"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0576 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89804"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE6"
FT                   /protein_id="ABL89804.1"
FT                   /translation="MTTARTYNQEHVPRRRDGRRRISIYWTWSYPWEAQRNPAEVYNRF
FT                   STMTEVRNALWPSYETTEYDDAHFLQGIAGTLELFHRSTLAFQELAGEVTGHPVAVFQR
FT                   IDQAGYLLPIDERILADTDTLMVFGLDHILSEQEATADEIAAIKQWLQREGTCLLLAPH
FT                   HDVGFTDDFDQRAAEFAHHGDPLVPRQQRFGQYTRSLMKALDVPVHNTWGLRPAVVERT
FT                   REIAPLNGFRDLDTARLLDNVTTFNFHPHLPHYELTAPESDTLRVLGRQRVDPHRPHPF
FT                   TDGGNTEFNALIWMPPTGHRSGDVVLIDSTHFTTLFGGTDSLRNLWHNLATMR"
FT   gene            complement(644392..645735)
FT                   /locus_tag="Mkms_0589"
FT   CDS_pept        complement(644392..645735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0589"
FT                   /product="Dyp-type peroxidase family"
FT                   /note="TIGRFAM: Dyp-type peroxidase family; KEGG:
FT                   mmc:Mmcs_0577 Dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89805"
FT                   /db_xref="GOA:A1UAE7"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE7"
FT                   /protein_id="ABL89805.1"
FT                   /translation="MTFTLTELELDDIQHILLTRTPAITGRYEFLTFDTPAGGRAWVTA
FT                   LLDKVQSAADVRAAMDTSDRWVTLAFTWQGLRALGVPDTSLATFPDAFREGMAARARIL
FT                   GDTGAAAPEHWLGGLAGDDLHAIAILFSRTDEQYRASVANHDALLDSLAGVRSLSHLDL
FT                   NATPPFNYAHDHFGFRDRLSQPVIKGSGEEPTPGSGAPLAPGEFILGYPDENGPVADSL
FT                   QPEALARNGSYMAYRRLEEHVGLFRDYLRANSKDAGEEELLAAKFMGRWRSGAPLVLAP
FT                   DQDDPELGADPMRNNDFNYKKMDPFGYACPLGSHARRLNPRDTAHYMNRRRMIRRGATY
FT                   GPALPEGAPDDGVERGIAAFIICADLVRQFEFAQNVWINDKTFHELDNEHDPIAGTQDN
FT                   TLDFTVPKRPIRRVHKGIPAFTTLRGGAYFFLPGLRGLRYLATLGDTS"
FT   gene            complement(645732..646136)
FT                   /locus_tag="Mkms_0590"
FT   CDS_pept        complement(645732..646136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89806"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE8"
FT                   /protein_id="ABL89806.1"
FT                   /translation="MGTSDPLVTVTRYIEAFNRGDAAVMALMFDTEGVILDGMAPHVWL
FT                   GPSAVQDWYRDVLVEGEHHGASDYAVTLGEPLHHNVTGDRAYLAIPARMTFRVRGTPVT
FT                   QTGAFFTVALRQVAEGWRITAWAWTKGTQQ"
FT   gene            complement(646142..646702)
FT                   /locus_tag="Mkms_0591"
FT   CDS_pept        complement(646142..646702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmc:Mmcs_0579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89807"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAE9"
FT                   /protein_id="ABL89807.1"
FT                   /translation="MSADNQHWSKPAAMAIPREGYFELEQGRYGPVYPRTPACYGFSII
FT                   AKVKEGREEAVRAYGKTIEETIAASPDALAPLRLHYLRWQLFDVGSGLHFQYQGIFDTD
FT                   FDKYTEDAVQLFSATGITTVFTNLEGFPEDWKENPESFVNFVREHQVPSFLEYGEYPYV
FT                   TADEIKKALRLKAAFSDMLDQMQ"
FT   gene            complement(647000..647749)
FT                   /locus_tag="Mkms_0592"
FT   CDS_pept        complement(647000..647749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0592"
FT                   /product="putative methyltransferase"
FT                   /note="TIGRFAM: putative methyltransferase; PFAM:
FT                   O-methyltransferase domain protein; KEGG: mmc:Mmcs_0580
FT                   protein of unknown function Mtu_121"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89808"
FT                   /db_xref="GOA:A1UAF0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UAF0"
FT                   /protein_id="ABL89808.1"
FT                   /translation="MTTPDGIVSALAVALARQSESHADCPLFNDPYAQVFIDAALSRGC
FT                   QLPSDETSERINGIANYASSRTKWFDEYFIAAGAHGLEQMVIVAAGLDARAWRLPWVAG
FT                   TTLFEIDHPGVLKFKNEALHEHGESPSVSRYVPVPADLSDGWSERLRDAGFDVSEPTAW
FT                   AVEGLLPYVADGPHLLFDRIHEISPAGSRLAVEAVGTGVADWLSTQGWQVTMIGAQELM
FT                   TRYGRCGDHSDTDAGMDTVFVNATRTR"
FT   gene            complement(647736..648098)
FT                   /locus_tag="Mkms_0593"
FT   CDS_pept        complement(647736..648098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0593"
FT                   /product="multisubunit sodium/proton antiporter, MrpG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; KEGG: mmc:Mmcs_0581 Na+/H+ antiporter
FT                   subunit; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89809"
FT                   /db_xref="GOA:A1UAF1"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF1"
FT                   /protein_id="ABL89809.1"
FT                   /translation="MNAFDIVASVLVLGGSTLALTAAIGVVRFPDTLSRMHAATKPQVL
FT                   GLLLVLAGAAIRLRGNIDVGMLILAGLFTIITAPVIANRVGQLAYHEQNIRDDLLTRDE
FT                   MLEVAAEGEHRGHDDS"
FT   sig_peptide     complement(648027..648098)
FT                   /locus_tag="Mkms_0593"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.397 at
FT                   residue 24"
FT   gene            complement(648095..648382)
FT                   /locus_tag="Mkms_0594"
FT   CDS_pept        complement(648095..648382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0594"
FT                   /product="multisubunit sodium/proton antiporter, MrpF
FT                   subunit"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: mmc:Mmcs_0582 multiple resistance and pH
FT                   regulation protein F; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89810"
FT                   /db_xref="GOA:A1UAF2"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF2"
FT                   /protein_id="ABL89810.1"
FT                   /translation="MNTVWIIAGVMLSTAAAATMFRLLAGPSTLDRLVALDTLVAVTMC
FT                   AIGTWAAFSLNTTVTYSLTALALISFVGSVSVARFRVPDVHRPDRTRRIS"
FT   sig_peptide     complement(648305..648382)
FT                   /locus_tag="Mkms_0594"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.638 at
FT                   residue 26"
FT   gene            complement(648414..648983)
FT                   /locus_tag="Mkms_0595"
FT   CDS_pept        complement(648414..648983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0595"
FT                   /product="multisubunit sodium/proton antiporter, MrpE
FT                   subunit"
FT                   /note="PFAM: cation antiporter; KEGG: mmc:Mmcs_0583 cation
FT                   antiporter; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89811"
FT                   /db_xref="GOA:A1UAF3"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF3"
FT                   /protein_id="ABL89811.1"
FT                   /translation="MKVIEGTRWSPRRLALRAWVLCWLTLVWVLLWGTLSAANVVSGLA
FT                   VALMITLLLPLPPVPVEGRVHLLSLLRLVATVAYYLVVSSVQVAWLAVKPGPPPLTAVL
FT                   RAHFAVKSDLVLALAVNIVNLTPGTIALEIDQTRRVVYVHVIDVGSDRALSRFYRQIGQ
FT                   FERLLIAAFERESDWRPSTEKEADPE"
FT   sig_peptide     complement(648870..648983)
FT                   /locus_tag="Mkms_0595"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.883) with cleavage site probability 0.362 at
FT                   residue 38"
FT   gene            complement(648980..650587)
FT                   /locus_tag="Mkms_0596"
FT   CDS_pept        complement(648980..650587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0596"
FT                   /product="multisubunit sodium/proton antiporter, MrpD
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: mmc:Mmcs_0584 NADH dehydrogenase (quinone); TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89812"
FT                   /db_xref="GOA:A1UAF4"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF4"
FT                   /protein_id="ABL89812.1"
FT                   /translation="MSLSSVLTPLPVLIPTIAAALTLFAGRRPVLQRVIAQLALVAVVV
FT                   VCAALVYLTDRDGTLALHVGGWGQSVPGMGPLGITLVVDRLSALMLMVSSIVLLAVVAY
FT                   AIGQGIRDGDGRQPVSIFLPTYLVLSAGVCTAFLAGDLFNLYVGFEVLLSASFVLLTIG
FT                   ASAERVRAGISYVMVSMVSSLIFLLGIGLVYAATGTLNMAELAVRLDDVSEGTRMALFA
FT                   VLMVAFGIKAAVFPLSTWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRAHSLLFPGGGL
FT                   DQVLLWAALLTMVVGILGAIAQSDIKRLLSFTLVSHIGYMVFGIALSNDIGMAGAIYYV
FT                   AHHIVVQTTLFLVVGLIERQAGASTMTRLGGLAAASPLLAFVFVVPALNLGGIPPFSGF
FT                   IGKVALLEAGAANGTPLAWALVAGGVVTSLLTLYVVARVWTKAFWRSREDAPEGHLSST
FT                   APAALLDDTAESDDIQFVDRDHVGRMPAGMLVPTGLLIAVGLALTVAAGPIFAYSGRAA
FT                   DEVIQRDHYITAVVGERP"
FT   sig_peptide     complement(650441..650587)
FT                   /locus_tag="Mkms_0596"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.474 at
FT                   residue 49"
FT   gene            complement(650584..651057)
FT                   /locus_tag="Mkms_0597"
FT   CDS_pept        complement(650584..651057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0597"
FT                   /product="multisubunit sodium/proton antiporter, MrpC
FT                   subunit"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase, chain 4L;
FT                   KEGG: mmc:Mmcs_0585 NADH-ubiquinone oxidoreductase, chain
FT                   4L; TC 2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89813"
FT                   /db_xref="GOA:A1UAF5"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF5"
FT                   /protein_id="ABL89813.1"
FT                   /translation="MTTFLVPLILIGGLTSVGVYLLLERNLTRMLLGLLLIGNAINLLI
FT                   LTVAGPSGNPPVRGRTKAGETTTADPLAQGMILTAIVISMGIAAFVLALTYRSYRLTTA
FT                   EDVGNDPEDTRVSSMAAKEAAALDEDRPPEPDLAIDTDLPDELDALPGREGSR"
FT   gene            complement(651054..653954)
FT                   /locus_tag="Mkms_0598"
FT   CDS_pept        complement(651054..653954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0598"
FT                   /product="multisubunit sodium/proton antiporter, MrpB
FT                   subunit / multisubunit sodium/proton antiporter, MrpA
FT                   subunit"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   Na+/H+ antiporter MnhB subunit-related protein; KEGG:
FT                   mmc:Mmcs_0586 NADH dehydrogenase (quinone); TC 2.A.63.1; TC
FT                   2.A.63.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89814"
FT                   /db_xref="GOA:A1UAF6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF6"
FT                   /protein_id="ABL89814.1"
FT                   /translation="MLAILCAHAIATALAPLMVARWGRIAFYPLAVVPLVSLVWVALNW
FT                   PEPGGAQTVNLVWLPELSMDITLRFDTLAAIMSVLILGIGALVLFYCGTYFHHRDGHIE
FT                   KRLPSFAAEMVAFAGSMFGLVISDNMLILYVFWETTTVLSFLLVGHYAERATSRRAATQ
FT                   ALLVTTFGGLAMLVGIIILGNLAGTYLLSELVAAPPGGVAAGVGVALILVGALSKSAIV
FT                   PLHFWLPGAMAAPTPVSAYLHAAAMVKAGVFLVARMTPGFADSPVWRPMIIILGLATML
FT                   LAGWRAVREYDLKLILAFGTVSQLGLITIMVGTGGRDMMLAGLAMLVAHAMFKASLFMV
FT                   VGVIDHSTGTRDIRRLAWLGDRSRPMLIIAVGATASMAALPPFLGFVAKEADFETVLHS
FT                   AALGPAAPWVLAGIALGSVFTTIYSLRFLWGAFSRKGLHEPSLRVREMHRPSAAFLAAP
FT                   AVLAAAGLVSGLWPAPLDAVLGDYADTVPGGSDYHLALWHGLNLPLLLSAVVIATGVTA
FT                   FFERSKLRRARVAYLPLGNADHVYDALIRGLDMVSVRLTATTQRGSIPATQSVILCTLV
FT                   VVPAAALALGARDRPDFALWDSPWQVVVGLLMLAAAVGAAVMRNRLAAVLLIGVTGYGC
FT                   GAIFALHGAPDLALTQFLVETLVLVIFVLVLRTLPAEAEKAHIRHKRLPRALLSLAVGA
FT                   TVTSLAVYAMAARTGVGIAELIPDAAYYRGQGANAVNVLLVDIRAWDTMGEISVLLVAA
FT                   TGVASLVFRNRRFGTAPRVSDAGQPDIGRIGNFATSPAVGEITWLRGSELRDPRHRSLV
FT                   LEVATRVIFPLIMVLSAYFFFAGHNTPGGGFAGGLTAGLALVLRYLAGGRYELGETLPL
FT                   DAGKILGVGLALSAGTAVTSLFLGAPVLSSAVIEFDLPVLGTVKLVTALFFDLGVYLIV
FT                   VGLVLDVLRSLGAQVDVEMSQPNPGSGGSAAKVGAR"
FT   gene            complement(654065..655378)
FT                   /locus_tag="Mkms_0599"
FT   CDS_pept        complement(654065..655378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0599"
FT                   /product="possible tyrosine transporter P-protein"
FT                   /note="PFAM: Arsenical pump membrane protein; Citrate
FT                   transporter; KEGG: mmc:Mmcs_0587 citrate transporter; TC
FT                   2.A.45.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89815"
FT                   /db_xref="GOA:A1UAF7"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF7"
FT                   /protein_id="ABL89815.1"
FT                   /translation="MSAAPAVSFSPAPVLALAIFVVAFWFIATERADKVKTVLVAAGLM
FT                   ALLGLIPGEQVFYSEHAGIDWNVIFLLLGMMVIVGVVKQTGLFDFLAIWAAKRSQGKPF
FT                   RLMVMLMLITAFASPVLDNVTIILLIAPVTLVICDRLRIAPQPYLIAEVLASNIGGAAT
FT                   LIGDPPNIIIGSRAGLTFNDFLVHMAPIVLVIFALFVASTRVLFRKDLRANDIRMDEVM
FT                   ALQERRAIRDPRLLVRSLVVLNLVIVGFALHSVLHVAPSVVALLGAGVMLLVTDIDVGE
FT                   VLPEVEWPTLVFFMGLFVMVAGLTHTGVIDALGSVAESAFGDNWFGAATALLFGSSIVG
FT                   AFVDNIPYTATMTPVVESMVTQTPDVATGQALWWAFALGACFSGNGTAIAASANVVAIG
FT                   IAARAGHPISFWRFTRYGIVVTLLSTTLAWGYVWLRYF"
FT   sig_peptide     complement(655280..655378)
FT                   /locus_tag="Mkms_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.731) with cleavage site probability 0.728 at
FT                   residue 33"
FT   gene            complement(655397..655855)
FT                   /locus_tag="Mkms_0600"
FT   CDS_pept        complement(655397..655855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0600"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; KEGG:
FT                   mmc:Mmcs_0588 putative signal transduction protein with CBS
FT                   domains"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89816"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF8"
FT                   /protein_id="ABL89816.1"
FT                   /translation="MQAHEIAVSPPTVRMDDPVSKAVQLMVVNRLPGLVVVDDADHPIA
FT                   VLPGTQVLRLTIPETYRDDPALVRTVDEIHADLFWHGPGRLTVGDCLPSPVAKPATVAP
FT                   DATLLEVATVMATKRSPLIAIVDGAGRLTGAVTLERLLTSLAVAGPGD"
FT   gene            complement(655903..656175)
FT                   /locus_tag="Mkms_0601"
FT   CDS_pept        complement(655903..656175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nfa:nfa7830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89817"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAF9"
FT                   /protein_id="ABL89817.1"
FT                   /translation="MRIDRTTVPGGGMLHHIVTRAGGRLCVLVTRDGERQVFVYDDDSD
FT                   EPAKELVLAPDEADGVAEILHSRPIADRVRSLERRVDALIGERAS"
FT   gene            656305..657285
FT                   /locus_tag="Mkms_0602"
FT   CDS_pept        656305..657285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0602"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase, dimerisation and phosphoacceptor
FT                   region; KEGG: mmc:Mmcs_0589 putative signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89818"
FT                   /db_xref="GOA:A1UAG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAG0"
FT                   /protein_id="ABL89818.1"
FT                   /translation="MNRARTPAAALFRRVFLINGLIFTLGTLVLAVSPASVSSRIRLTE
FT                   IPVLVVGLAVILSANALLLRSSLAPLDRLTASMRRVDPPRRSDRVDDRGSGDLHHLIES
FT                   FNAMLDRLETERTTASASALAAQENERQRIARELHDEIGQTLTVALLTLKRAVDRAPAE
FT                   IRGELEETQETVRASLDEVRGIARRLRPDALEDLGLQSALNALCNEFAQATGLPVVKHI
FT                   ALPAARLAPDVELVCYRIAQESLTNVARHADARKVWVDLHVADDQVTLRIADDGAGGAG
FT                   DAGEGAGISGMRERALLVNATLTIASPPGEGTEVRLTIPYRDGSR"
FT   sig_peptide     656305..656424
FT                   /locus_tag="Mkms_0602"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.668 at
FT                   residue 40"
FT   gene            657285..657932
FT                   /locus_tag="Mkms_0603"
FT   CDS_pept        657285..657932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0603"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; Sigma-70, region 4 type 2; KEGG: mmc:Mmcs_0590
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89819"
FT                   /db_xref="GOA:A1UAG1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAG1"
FT                   /protein_id="ABL89819.1"
FT                   /translation="MPARILLADDHALVRSGLRLIIDAEPDLQVVAEAADGHEALEALE
FT                   RTPTDLAILDIAMPRMTGLQAAREISRMHPHVRILILSMHDNEQYFFEALKAGASGYVL
FT                   KSVADRDLLAACRATLRGEPFLYAGAVTALIRDYLHRARSGDELPDTILTPREEEVLKL
FT                   VAEGYSTREIAATLSISAKTVDRHRANILAKLGLRDRLALTRYAIRAGLIEP"
FT   gene            complement(657892..658359)
FT                   /locus_tag="Mkms_0604"
FT   CDS_pept        complement(657892..658359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0604"
FT                   /product="protein of unknown function DUF1707"
FT                   /note="PFAM: protein of unknown function DUF1707; KEGG:
FT                   mmc:Mmcs_0591 protein of unknown function DUF1707"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89820"
FT                   /db_xref="GOA:A1UAG2"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="InterPro:IPR025698"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAG2"
FT                   /protein_id="ABL89820.1"
FT                   /translation="MTVPTTVRVGDDDRTRTANLLGLALAQGYLDMPDYEQRLQAAFAA
FT                   QTNTELHSLTADLPVATLRRNDPARRAERRRAARRGVRWHLAGYLAMVVIVLTVWLAVG
FT                   LAAGAWYFWPIWPILGAGIGVLGHALPVRYVGGSPCGRLTARSVPPGWRIG"
FT   gene            complement(658453..660678)
FT                   /locus_tag="Mkms_0605"
FT   CDS_pept        complement(658453..660678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mkms_0605"
FT                   /product="Vesicle-fusing ATPase"
FT                   /EC_number="3.6.4.6"
FT                   /note="KEGG: mmc:Mmcs_0592 vesicle-fusing ATPase; PFAM: AAA
FT                   ATPase, central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mkms_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABL89821"
FT                   /db_xref="GOA:A1UAG3"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1UAG3"
FT                   /protein_id="ABL89821.1"
FT                   /translation="MTEAGLSEREPNLSHLRLTARLNTAALDSRRGVVRLHPEVIAALG
FT                   IREWDAVSLTGARTTAAVVGIAPPGTPTGTALLDDVTLSNAGLPENSSVIVAPVTVYGA
FT                   RSVTVSGSRLATNSISPATLRQALLGKVMTVGDTVSLLPRDLGPGTSTSSATTALASSV
FT                   GITWTSELLTVTSVDPPGTVSIQPNSSVTWGDGPAPKAASAGPTDGAAVGEATVTTPSV
FT                   DRPAVSFDDLKGSHAQAGRLTEWLKLSLDEPSLLETLGATAHLGVLVSGPAGVGKATLV
FT                   RTVCAQRRLVELDGPEVGALHAEDRLNRVSSAVSTVRDGGGVLLISDIDALLPATPEPV
FT                   GTLILTELRTAVATPGVAFVATSARPDGVDARLRDPDLCDRELGLSLPDAATRKELLEV
FT                   LLRSVPAQELHLDEIAGRTPGFVIADLCALVREAALRAAARASADGAPPQLTQADLTGA
FT                   LTVIRPLSRSATEEVSVGSVTLADVGDMTETKQALTEAVLWPLQHPDTFERLGIEPPRG
FT                   VLLYGPPGCGKTFVVRALASSGRLSVHAVKGAELMDKWVGASEKAVRELFRRARDSAPS
FT                   LVFLDEIDALAPRRGQSFDSGVTDRVVASLLTELDGIEPMCNVVVLGATNRPDLIDPAL
FT                   LRPGRLERLVFVEPPDAEARREILRTAGKSVPLADDVDLDTLAAGLDGYSAADCVALL