(data stored in ACNUC29543 zone)

EMBL: CP000521

ID   CP000521; SV 1; circular; genomic DNA; STD; PRO; 3976747 BP.
XX
AC   CP000521;
XX
PR   Project:PRJNA17477;
XX
DT   02-MAR-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 9)
XX
DE   Acinetobacter baumannii ATCC 17978, complete genome.
XX
KW   .
XX
OS   Acinetobacter baumannii ATCC 17978
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC   Moraxellaceae; Acinetobacter;
OC   Acinetobacter calcoaceticus/baumannii complex.
XX
RN   [1]
RP   1-3976747
RX   DOI; 10.1101/gad.1510307.
RX   PUBMED; 17344419.
RA   Smith M.G., Gianoulis T.A., Pukatzki S., Mekalanos J.J., Ornston L.N.,
RA   Gerstein M., Snyder M.;
RT   "New insights into Acinetobacter baumannii pathogenesis revealed by
RT   high-density pyrosequencing and transposon mutagenesis";
RL   Genes Dev. 21(5):601-614(2007).
XX
RN   [2]
RP   1-3976747
RA   Smith M.G., Gianoulis T.A., Pukatzki S., Mekalanos J., Ornston L.N.,
RA   Gerstein M., Snyder M.;
RT   ;
RL   Submitted (27-NOV-2006) to the INSDC.
RL   Department of Molecular, Cellular, and Developmental Biology, Yale
RL   University, 266 Whitney Ave, New Haven, CT 06520, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-3976747
RA   Smith M.G., Gianoulis T.A., Pukatzki S., Mekalanos J., Ornston L.N.,
RA   Gerstein M., Snyder M.;
RT   ;
RL   Submitted (10-AUG-2007) to the INSDC.
RL   Department of Molecular, Cellular, and Developmental Biology, Yale
RL   University, 266 Whitney Ave, New Haven, CT 06520, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-3976747
RA   Smith M.G., Gianoulis T.A., Pukatzki S., Mekalanos J., Ornston L.N.,
RA   Gerstein M., Snyder M.;
RT   ;
RL   Submitted (26-JUN-2008) to the INSDC.
RL   Department of Molecular, Cellular, and Developmental Biology, Yale
RL   University, 266 Whitney Ave, New Haven, CT 06520, USA
XX
DR   MD5; 6436448dd60eadb61395223cc5e90ad9.
DR   BioSample; SAMN02604331.
DR   EnsemblGenomes-Gn; A1S_0120.
DR   EnsemblGenomes-Gn; A1S_0121.
DR   EnsemblGenomes-Gn; A1S_0174.
DR   EnsemblGenomes-Gn; A1S_0175.
DR   EnsemblGenomes-Gn; A1S_0275.
DR   EnsemblGenomes-Gn; A1S_0276.
DR   EnsemblGenomes-Gn; A1S_0277.
DR   EnsemblGenomes-Gn; A1S_0278.
DR   EnsemblGenomes-Gn; A1S_0280.
DR   EnsemblGenomes-Gn; A1S_0332.
DR   EnsemblGenomes-Gn; A1S_0333.
DR   EnsemblGenomes-Gn; A1S_0400.
DR   EnsemblGenomes-Gn; A1S_0401.
DR   EnsemblGenomes-Gn; A1S_0678.
DR   EnsemblGenomes-Gn; A1S_0679.
DR   EnsemblGenomes-Gn; A1S_0680.
DR   EnsemblGenomes-Gn; A1S_0681.
DR   EnsemblGenomes-Gn; A1S_0714.
DR   EnsemblGenomes-Gn; A1S_0715.
DR   EnsemblGenomes-Gn; A1S_0716.
DR   EnsemblGenomes-Gn; A1S_0717.
DR   EnsemblGenomes-Gn; A1S_0830.
DR   EnsemblGenomes-Gn; A1S_0831.
DR   EnsemblGenomes-Gn; A1S_0832.
DR   EnsemblGenomes-Gn; A1S_0846.
DR   EnsemblGenomes-Gn; A1S_0856.
DR   EnsemblGenomes-Gn; A1S_1064.
DR   EnsemblGenomes-Gn; A1S_1071.
DR   EnsemblGenomes-Gn; A1S_1223.
DR   EnsemblGenomes-Gn; A1S_1234.
DR   EnsemblGenomes-Gn; A1S_1500.
DR   EnsemblGenomes-Gn; A1S_2236.
DR   EnsemblGenomes-Gn; A1S_2237.
DR   EnsemblGenomes-Gn; A1S_2238.
DR   EnsemblGenomes-Gn; A1S_2239.
DR   EnsemblGenomes-Gn; A1S_2310.
DR   EnsemblGenomes-Gn; A1S_2344.
DR   EnsemblGenomes-Gn; A1S_2345.
DR   EnsemblGenomes-Gn; A1S_2346.
DR   EnsemblGenomes-Gn; A1S_2415.
DR   EnsemblGenomes-Gn; A1S_2513.
DR   EnsemblGenomes-Gn; A1S_2652.
DR   EnsemblGenomes-Gn; A1S_2675.
DR   EnsemblGenomes-Gn; A1S_2676.
DR   EnsemblGenomes-Gn; A1S_2678.
DR   EnsemblGenomes-Gn; A1S_2764.
DR   EnsemblGenomes-Gn; A1S_2800.
DR   EnsemblGenomes-Gn; A1S_2801.
DR   EnsemblGenomes-Gn; A1S_2802.
DR   EnsemblGenomes-Gn; A1S_2803.
DR   EnsemblGenomes-Gn; A1S_2804.
DR   EnsemblGenomes-Gn; A1S_2805.
DR   EnsemblGenomes-Gn; A1S_2909.
DR   EnsemblGenomes-Gn; A1S_2953.
DR   EnsemblGenomes-Gn; A1S_2954.
DR   EnsemblGenomes-Gn; A1S_2992.
DR   EnsemblGenomes-Gn; A1S_2993.
DR   EnsemblGenomes-Gn; A1S_3015.
DR   EnsemblGenomes-Gn; A1S_3018.
DR   EnsemblGenomes-Gn; A1S_3019.
DR   EnsemblGenomes-Gn; A1S_3020.
DR   EnsemblGenomes-Gn; A1S_3183.
DR   EnsemblGenomes-Gn; A1S_3184.
DR   EnsemblGenomes-Gn; A1S_3188.
DR   EnsemblGenomes-Gn; A1S_3189.
DR   EnsemblGenomes-Gn; A1S_3215.
DR   EnsemblGenomes-Gn; A1S_3216.
DR   EnsemblGenomes-Gn; A1S_3226.
DR   EnsemblGenomes-Gn; A1S_3249.
DR   EnsemblGenomes-Gn; A1S_r01.
DR   EnsemblGenomes-Gn; A1S_r02.
DR   EnsemblGenomes-Gn; A1S_r03.
DR   EnsemblGenomes-Gn; A1S_r04.
DR   EnsemblGenomes-Gn; A1S_r05.
DR   EnsemblGenomes-Gn; A1S_r06.
DR   EnsemblGenomes-Gn; A1S_r07.
DR   EnsemblGenomes-Gn; A1S_r08.
DR   EnsemblGenomes-Gn; A1S_r09.
DR   EnsemblGenomes-Gn; A1S_r10.
DR   EnsemblGenomes-Gn; A1S_r11.
DR   EnsemblGenomes-Gn; A1S_r12.
DR   EnsemblGenomes-Gn; A1S_r13.
DR   EnsemblGenomes-Gn; A1S_r14.
DR   EnsemblGenomes-Gn; A1S_r15.
DR   EnsemblGenomes-Gn; EBG00001164002.
DR   EnsemblGenomes-Gn; EBG00001164003.
DR   EnsemblGenomes-Gn; EBG00001164004.
DR   EnsemblGenomes-Gn; EBG00001164005.
DR   EnsemblGenomes-Gn; EBG00001164006.
DR   EnsemblGenomes-Gn; EBG00001164007.
DR   EnsemblGenomes-Gn; EBG00001164008.
DR   EnsemblGenomes-Gn; EBG00001164009.
DR   EnsemblGenomes-Gn; EBG00001164010.
DR   EnsemblGenomes-Gn; EBG00001164011.
DR   EnsemblGenomes-Gn; EBG00001164012.
DR   EnsemblGenomes-Gn; EBG00001164013.
DR   EnsemblGenomes-Gn; EBG00001164014.
DR   EnsemblGenomes-Gn; EBG00001164015.
DR   EnsemblGenomes-Gn; EBG00001164016.
DR   EnsemblGenomes-Gn; EBG00001164017.
DR   EnsemblGenomes-Gn; EBG00001164018.
DR   EnsemblGenomes-Gn; EBG00001164019.
DR   EnsemblGenomes-Gn; EBG00001164020.
DR   EnsemblGenomes-Gn; EBG00001164021.
DR   EnsemblGenomes-Gn; EBG00001164022.
DR   EnsemblGenomes-Gn; EBG00001164023.
DR   EnsemblGenomes-Gn; EBG00001164024.
DR   EnsemblGenomes-Gn; EBG00001164025.
DR   EnsemblGenomes-Gn; EBG00001164026.
DR   EnsemblGenomes-Gn; EBG00001164027.
DR   EnsemblGenomes-Gn; EBG00001164028.
DR   EnsemblGenomes-Gn; EBG00001164029.
DR   EnsemblGenomes-Gn; EBG00001164030.
DR   EnsemblGenomes-Gn; EBG00001164031.
DR   EnsemblGenomes-Gn; EBG00001164032.
DR   EnsemblGenomes-Gn; EBG00001164033.
DR   EnsemblGenomes-Gn; EBG00001164034.
DR   EnsemblGenomes-Gn; EBG00001164035.
DR   EnsemblGenomes-Gn; EBG00001164036.
DR   EnsemblGenomes-Gn; EBG00001164037.
DR   EnsemblGenomes-Gn; EBG00001164038.
DR   EnsemblGenomes-Gn; EBG00001164039.
DR   EnsemblGenomes-Gn; EBG00001164040.
DR   EnsemblGenomes-Gn; EBG00001164041.
DR   EnsemblGenomes-Gn; EBG00001164042.
DR   EnsemblGenomes-Gn; EBG00001164043.
DR   EnsemblGenomes-Gn; EBG00001164044.
DR   EnsemblGenomes-Gn; EBG00001164045.
DR   EnsemblGenomes-Gn; EBG00001164046.
DR   EnsemblGenomes-Gn; EBG00001164047.
DR   EnsemblGenomes-Gn; EBG00001164048.
DR   EnsemblGenomes-Gn; EBG00001164049.
DR   EnsemblGenomes-Gn; EBG00001164050.
DR   EnsemblGenomes-Gn; EBG00001164051.
DR   EnsemblGenomes-Gn; EBG00001164052.
DR   EnsemblGenomes-Gn; EBG00001164053.
DR   EnsemblGenomes-Gn; EBG00001164054.
DR   EnsemblGenomes-Gn; EBG00001164055.
DR   EnsemblGenomes-Gn; EBG00001164056.
DR   EnsemblGenomes-Gn; EBG00001164057.
DR   EnsemblGenomes-Gn; EBG00001164058.
DR   EnsemblGenomes-Gn; EBG00001164059.
DR   EnsemblGenomes-Gn; EBG00001164060.
DR   EnsemblGenomes-Gn; EBG00001164061.
DR   EnsemblGenomes-Gn; EBG00001164062.
DR   EnsemblGenomes-Gn; EBG00001164063.
DR   EnsemblGenomes-Gn; EBG00001164064.
DR   EnsemblGenomes-Gn; EBG00001164065.
DR   EnsemblGenomes-Gn; EBG00001164066.
DR   EnsemblGenomes-Gn; EBG00001164067.
DR   EnsemblGenomes-Gn; EBG00001164068.
DR   EnsemblGenomes-Gn; EBG00001164069.
DR   EnsemblGenomes-Gn; EBG00001164070.
DR   EnsemblGenomes-Gn; EBG00001164071.
DR   EnsemblGenomes-Gn; EBG00001164072.
DR   EnsemblGenomes-Gn; EBG00001164073.
DR   EnsemblGenomes-Gn; EBG00001164074.
DR   EnsemblGenomes-Gn; EBG00001164075.
DR   EnsemblGenomes-Gn; EBG00001164076.
DR   EnsemblGenomes-Gn; EBG00001164077.
DR   EnsemblGenomes-Gn; EBG00001164078.
DR   EnsemblGenomes-Gn; EBG00001164079.
DR   EnsemblGenomes-Gn; EBG00001164080.
DR   EnsemblGenomes-Gn; EBG00001164081.
DR   EnsemblGenomes-Gn; EBG00001164082.
DR   EnsemblGenomes-Gn; EBG00001164083.
DR   EnsemblGenomes-Gn; EBG00001164084.
DR   EnsemblGenomes-Gn; EBG00001164085.
DR   EnsemblGenomes-Gn; EBG00001164086.
DR   EnsemblGenomes-Gn; EBG00001164087.
DR   EnsemblGenomes-Gn; EBG00001164088.
DR   EnsemblGenomes-Gn; EBG00001164089.
DR   EnsemblGenomes-Gn; EBG00001164090.
DR   EnsemblGenomes-Gn; EBG00001164091.
DR   EnsemblGenomes-Gn; EBG00001164092.
DR   EnsemblGenomes-Gn; EBG00001164093.
DR   EnsemblGenomes-Gn; EBG00001164094.
DR   EnsemblGenomes-Gn; EBG00001164095.
DR   EnsemblGenomes-Gn; EBG00001164096.
DR   EnsemblGenomes-Gn; EBG00001164097.
DR   EnsemblGenomes-Gn; EBG00001164098.
DR   EnsemblGenomes-Gn; EBG00001164099.
DR   EnsemblGenomes-Gn; EBG00001164100.
DR   EnsemblGenomes-Gn; EBG00001164101.
DR   EnsemblGenomes-Gn; EBG00001164102.
DR   EnsemblGenomes-Gn; EBG00001164103.
DR   EnsemblGenomes-Gn; EBG00001164104.
DR   EnsemblGenomes-Gn; EBG00001164105.
DR   EnsemblGenomes-Gn; EBG00001164106.
DR   EnsemblGenomes-Gn; EBG00001164107.
DR   EnsemblGenomes-Gn; EBG00001164108.
DR   EnsemblGenomes-Gn; EBG00001164109.
DR   EnsemblGenomes-Gn; EBG00001164110.
DR   EnsemblGenomes-Gn; EBG00001164111.
DR   EnsemblGenomes-Gn; EBG00001164112.
DR   EnsemblGenomes-Gn; EBG00001164113.
DR   EnsemblGenomes-Gn; EBG00001164114.
DR   EnsemblGenomes-Gn; EBG00001164115.
DR   EnsemblGenomes-Gn; EBG00001164116.
DR   EnsemblGenomes-Gn; EBG00001164117.
DR   EnsemblGenomes-Gn; EBG00001164118.
DR   EnsemblGenomes-Gn; EBG00001164119.
DR   EnsemblGenomes-Gn; EBG00001164120.
DR   EnsemblGenomes-Gn; EBG00001164121.
DR   EnsemblGenomes-Gn; EBG00001164122.
DR   EnsemblGenomes-Gn; EBG00001164123.
DR   EnsemblGenomes-Gn; EBG00001164124.
DR   EnsemblGenomes-Tr; A1S_0120-1.
DR   EnsemblGenomes-Tr; A1S_0121-1.
DR   EnsemblGenomes-Tr; A1S_0174-1.
DR   EnsemblGenomes-Tr; A1S_0175-1.
DR   EnsemblGenomes-Tr; A1S_0275-1.
DR   EnsemblGenomes-Tr; A1S_0276-1.
DR   EnsemblGenomes-Tr; A1S_0277-1.
DR   EnsemblGenomes-Tr; A1S_0278-1.
DR   EnsemblGenomes-Tr; A1S_0280-1.
DR   EnsemblGenomes-Tr; A1S_0332-1.
DR   EnsemblGenomes-Tr; A1S_0333-1.
DR   EnsemblGenomes-Tr; A1S_0400-1.
DR   EnsemblGenomes-Tr; A1S_0401-1.
DR   EnsemblGenomes-Tr; A1S_0678-1.
DR   EnsemblGenomes-Tr; A1S_0679-1.
DR   EnsemblGenomes-Tr; A1S_0680-1.
DR   EnsemblGenomes-Tr; A1S_0681-1.
DR   EnsemblGenomes-Tr; A1S_0714-1.
DR   EnsemblGenomes-Tr; A1S_0715-1.
DR   EnsemblGenomes-Tr; A1S_0716-1.
DR   EnsemblGenomes-Tr; A1S_0717-1.
DR   EnsemblGenomes-Tr; A1S_0830-1.
DR   EnsemblGenomes-Tr; A1S_0831-1.
DR   EnsemblGenomes-Tr; A1S_0832-1.
DR   EnsemblGenomes-Tr; A1S_0846-1.
DR   EnsemblGenomes-Tr; A1S_0856-1.
DR   EnsemblGenomes-Tr; A1S_1064-1.
DR   EnsemblGenomes-Tr; A1S_1071-1.
DR   EnsemblGenomes-Tr; A1S_1223-1.
DR   EnsemblGenomes-Tr; A1S_1234-1.
DR   EnsemblGenomes-Tr; A1S_1500-1.
DR   EnsemblGenomes-Tr; A1S_2236-1.
DR   EnsemblGenomes-Tr; A1S_2237-1.
DR   EnsemblGenomes-Tr; A1S_2238-1.
DR   EnsemblGenomes-Tr; A1S_2239-1.
DR   EnsemblGenomes-Tr; A1S_2310-1.
DR   EnsemblGenomes-Tr; A1S_2344-1.
DR   EnsemblGenomes-Tr; A1S_2345-1.
DR   EnsemblGenomes-Tr; A1S_2346-1.
DR   EnsemblGenomes-Tr; A1S_2415-1.
DR   EnsemblGenomes-Tr; A1S_2513-1.
DR   EnsemblGenomes-Tr; A1S_2652-1.
DR   EnsemblGenomes-Tr; A1S_2675-1.
DR   EnsemblGenomes-Tr; A1S_2676-1.
DR   EnsemblGenomes-Tr; A1S_2678-1.
DR   EnsemblGenomes-Tr; A1S_2764-1.
DR   EnsemblGenomes-Tr; A1S_2800-1.
DR   EnsemblGenomes-Tr; A1S_2801-1.
DR   EnsemblGenomes-Tr; A1S_2802-1.
DR   EnsemblGenomes-Tr; A1S_2803-1.
DR   EnsemblGenomes-Tr; A1S_2804-1.
DR   EnsemblGenomes-Tr; A1S_2805-1.
DR   EnsemblGenomes-Tr; A1S_2909-1.
DR   EnsemblGenomes-Tr; A1S_2953-1.
DR   EnsemblGenomes-Tr; A1S_2954-1.
DR   EnsemblGenomes-Tr; A1S_2992-1.
DR   EnsemblGenomes-Tr; A1S_2993-1.
DR   EnsemblGenomes-Tr; A1S_3015-1.
DR   EnsemblGenomes-Tr; A1S_3018-1.
DR   EnsemblGenomes-Tr; A1S_3019-1.
DR   EnsemblGenomes-Tr; A1S_3020-1.
DR   EnsemblGenomes-Tr; A1S_3183-1.
DR   EnsemblGenomes-Tr; A1S_3184-1.
DR   EnsemblGenomes-Tr; A1S_3188-1.
DR   EnsemblGenomes-Tr; A1S_3189-1.
DR   EnsemblGenomes-Tr; A1S_3215-1.
DR   EnsemblGenomes-Tr; A1S_3216-1.
DR   EnsemblGenomes-Tr; A1S_3226-1.
DR   EnsemblGenomes-Tr; A1S_3249-1.
DR   EnsemblGenomes-Tr; A1S_r01-1.
DR   EnsemblGenomes-Tr; A1S_r02-1.
DR   EnsemblGenomes-Tr; A1S_r03-1.
DR   EnsemblGenomes-Tr; A1S_r04-1.
DR   EnsemblGenomes-Tr; A1S_r05-1.
DR   EnsemblGenomes-Tr; A1S_r06-1.
DR   EnsemblGenomes-Tr; A1S_r07-1.
DR   EnsemblGenomes-Tr; A1S_r08-1.
DR   EnsemblGenomes-Tr; A1S_r09-1.
DR   EnsemblGenomes-Tr; A1S_r10-1.
DR   EnsemblGenomes-Tr; A1S_r11-1.
DR   EnsemblGenomes-Tr; A1S_r12-1.
DR   EnsemblGenomes-Tr; A1S_r13-1.
DR   EnsemblGenomes-Tr; A1S_r14-1.
DR   EnsemblGenomes-Tr; A1S_r15-1.
DR   EnsemblGenomes-Tr; EBT00001731084.
DR   EnsemblGenomes-Tr; EBT00001731085.
DR   EnsemblGenomes-Tr; EBT00001731086.
DR   EnsemblGenomes-Tr; EBT00001731087.
DR   EnsemblGenomes-Tr; EBT00001731088.
DR   EnsemblGenomes-Tr; EBT00001731089.
DR   EnsemblGenomes-Tr; EBT00001731090.
DR   EnsemblGenomes-Tr; EBT00001731091.
DR   EnsemblGenomes-Tr; EBT00001731092.
DR   EnsemblGenomes-Tr; EBT00001731093.
DR   EnsemblGenomes-Tr; EBT00001731094.
DR   EnsemblGenomes-Tr; EBT00001731095.
DR   EnsemblGenomes-Tr; EBT00001731096.
DR   EnsemblGenomes-Tr; EBT00001731097.
DR   EnsemblGenomes-Tr; EBT00001731098.
DR   EnsemblGenomes-Tr; EBT00001731099.
DR   EnsemblGenomes-Tr; EBT00001731100.
DR   EnsemblGenomes-Tr; EBT00001731101.
DR   EnsemblGenomes-Tr; EBT00001731102.
DR   EnsemblGenomes-Tr; EBT00001731103.
DR   EnsemblGenomes-Tr; EBT00001731104.
DR   EnsemblGenomes-Tr; EBT00001731105.
DR   EnsemblGenomes-Tr; EBT00001731106.
DR   EnsemblGenomes-Tr; EBT00001731107.
DR   EnsemblGenomes-Tr; EBT00001731108.
DR   EnsemblGenomes-Tr; EBT00001731109.
DR   EnsemblGenomes-Tr; EBT00001731110.
DR   EnsemblGenomes-Tr; EBT00001731111.
DR   EnsemblGenomes-Tr; EBT00001731112.
DR   EnsemblGenomes-Tr; EBT00001731113.
DR   EnsemblGenomes-Tr; EBT00001731114.
DR   EnsemblGenomes-Tr; EBT00001731115.
DR   EnsemblGenomes-Tr; EBT00001731116.
DR   EnsemblGenomes-Tr; EBT00001731117.
DR   EnsemblGenomes-Tr; EBT00001731118.
DR   EnsemblGenomes-Tr; EBT00001731119.
DR   EnsemblGenomes-Tr; EBT00001731120.
DR   EnsemblGenomes-Tr; EBT00001731121.
DR   EnsemblGenomes-Tr; EBT00001731122.
DR   EnsemblGenomes-Tr; EBT00001731123.
DR   EnsemblGenomes-Tr; EBT00001731124.
DR   EnsemblGenomes-Tr; EBT00001731125.
DR   EnsemblGenomes-Tr; EBT00001731126.
DR   EnsemblGenomes-Tr; EBT00001731127.
DR   EnsemblGenomes-Tr; EBT00001731128.
DR   EnsemblGenomes-Tr; EBT00001731129.
DR   EnsemblGenomes-Tr; EBT00001731130.
DR   EnsemblGenomes-Tr; EBT00001731131.
DR   EnsemblGenomes-Tr; EBT00001731132.
DR   EnsemblGenomes-Tr; EBT00001731133.
DR   EnsemblGenomes-Tr; EBT00001731134.
DR   EnsemblGenomes-Tr; EBT00001731135.
DR   EnsemblGenomes-Tr; EBT00001731136.
DR   EnsemblGenomes-Tr; EBT00001731137.
DR   EnsemblGenomes-Tr; EBT00001731138.
DR   EnsemblGenomes-Tr; EBT00001731139.
DR   EnsemblGenomes-Tr; EBT00001731140.
DR   EnsemblGenomes-Tr; EBT00001731141.
DR   EnsemblGenomes-Tr; EBT00001731142.
DR   EnsemblGenomes-Tr; EBT00001731143.
DR   EnsemblGenomes-Tr; EBT00001731144.
DR   EnsemblGenomes-Tr; EBT00001731145.
DR   EnsemblGenomes-Tr; EBT00001731146.
DR   EnsemblGenomes-Tr; EBT00001731147.
DR   EnsemblGenomes-Tr; EBT00001731148.
DR   EnsemblGenomes-Tr; EBT00001731149.
DR   EnsemblGenomes-Tr; EBT00001731150.
DR   EnsemblGenomes-Tr; EBT00001731151.
DR   EnsemblGenomes-Tr; EBT00001731152.
DR   EnsemblGenomes-Tr; EBT00001731153.
DR   EnsemblGenomes-Tr; EBT00001731154.
DR   EnsemblGenomes-Tr; EBT00001731155.
DR   EnsemblGenomes-Tr; EBT00001731156.
DR   EnsemblGenomes-Tr; EBT00001731157.
DR   EnsemblGenomes-Tr; EBT00001731158.
DR   EnsemblGenomes-Tr; EBT00001731159.
DR   EnsemblGenomes-Tr; EBT00001731160.
DR   EnsemblGenomes-Tr; EBT00001731161.
DR   EnsemblGenomes-Tr; EBT00001731162.
DR   EnsemblGenomes-Tr; EBT00001731163.
DR   EnsemblGenomes-Tr; EBT00001731164.
DR   EnsemblGenomes-Tr; EBT00001731165.
DR   EnsemblGenomes-Tr; EBT00001731166.
DR   EnsemblGenomes-Tr; EBT00001731167.
DR   EnsemblGenomes-Tr; EBT00001731168.
DR   EnsemblGenomes-Tr; EBT00001731169.
DR   EnsemblGenomes-Tr; EBT00001731170.
DR   EnsemblGenomes-Tr; EBT00001731171.
DR   EnsemblGenomes-Tr; EBT00001731172.
DR   EnsemblGenomes-Tr; EBT00001731173.
DR   EnsemblGenomes-Tr; EBT00001731174.
DR   EnsemblGenomes-Tr; EBT00001731175.
DR   EnsemblGenomes-Tr; EBT00001731176.
DR   EnsemblGenomes-Tr; EBT00001731177.
DR   EnsemblGenomes-Tr; EBT00001731178.
DR   EnsemblGenomes-Tr; EBT00001731179.
DR   EnsemblGenomes-Tr; EBT00001731180.
DR   EnsemblGenomes-Tr; EBT00001731181.
DR   EnsemblGenomes-Tr; EBT00001731182.
DR   EnsemblGenomes-Tr; EBT00001731183.
DR   EnsemblGenomes-Tr; EBT00001731184.
DR   EnsemblGenomes-Tr; EBT00001731185.
DR   EnsemblGenomes-Tr; EBT00001731186.
DR   EnsemblGenomes-Tr; EBT00001731187.
DR   EnsemblGenomes-Tr; EBT00001731188.
DR   EnsemblGenomes-Tr; EBT00001731189.
DR   EnsemblGenomes-Tr; EBT00001731190.
DR   EnsemblGenomes-Tr; EBT00001731191.
DR   EnsemblGenomes-Tr; EBT00001731192.
DR   EnsemblGenomes-Tr; EBT00001731193.
DR   EnsemblGenomes-Tr; EBT00001731194.
DR   EnsemblGenomes-Tr; EBT00001731195.
DR   EnsemblGenomes-Tr; EBT00001731196.
DR   EnsemblGenomes-Tr; EBT00001731197.
DR   EnsemblGenomes-Tr; EBT00001731198.
DR   EnsemblGenomes-Tr; EBT00001731199.
DR   EnsemblGenomes-Tr; EBT00001731200.
DR   EnsemblGenomes-Tr; EBT00001731201.
DR   EnsemblGenomes-Tr; EBT00001731202.
DR   EnsemblGenomes-Tr; EBT00001731203.
DR   EnsemblGenomes-Tr; EBT00001731204.
DR   EnsemblGenomes-Tr; EBT00001731205.
DR   EnsemblGenomes-Tr; EBT00001731206.
DR   EuropePMC; PMC1820901; 17344419.
DR   EuropePMC; PMC2443898; 18411315.
DR   EuropePMC; PMC2747904; 19633088.
DR   EuropePMC; PMC2848557; 20368969.
DR   EuropePMC; PMC2863528; 20194587.
DR   EuropePMC; PMC2976157; 20713680.
DR   EuropePMC; PMC3043498; 21147956.
DR   EuropePMC; PMC3067174; 21282446.
DR   EuropePMC; PMC3122444; 21576434.
DR   EuropePMC; PMC3122835; 21289143.
DR   EuropePMC; PMC3187012; 21788470.
DR   EuropePMC; PMC3224125; 21985032.
DR   EuropePMC; PMC3318347; 22290963.
DR   EuropePMC; PMC3352118; 22117008.
DR   EuropePMC; PMC3416510; 22609912.
DR   EuropePMC; PMC3526259; 22904089.
DR   EuropePMC; PMC3535948; 23070160.
DR   EuropePMC; PMC3627594; 23482393.
DR   EuropePMC; PMC3691203; 23826102.
DR   EuropePMC; PMC3697591; 23649094.
DR   EuropePMC; PMC3699609; 23843955.
DR   EuropePMC; PMC3978071; 24709747.
DR   EuropePMC; PMC4049102; 24895306.
DR   EuropePMC; PMC4136133; 24899031.
DR   EuropePMC; PMC4136169; 24899022.
DR   EuropePMC; PMC4172580; 25247305.
DR   EuropePMC; PMC4202317; 25164683.
DR   EuropePMC; PMC4244539; 25505462.
DR   EuropePMC; PMC4328036; 25648327.
DR   EuropePMC; PMC4334535; 25679516.
DR   EuropePMC; PMC4367897; 25534766.
DR   EuropePMC; PMC4407223; 25746991.
DR   EuropePMC; PMC4457973; 26047954.
DR   EuropePMC; PMC4567131; 26360766.
DR   EuropePMC; PMC4675053; 26653099.
DR   EuropePMC; PMC4767972; 26699703.
DR   EuropePMC; PMC4863628; 27303682.
DR   EuropePMC; PMC4886253; 27240484.
DR   EuropePMC; PMC5005500; 27358465.
DR   EuropePMC; PMC5094136; 27806702.
DR   EuropePMC; PMC5110958; 27849050.
DR   EuropePMC; PMC5119006; 27671072.
DR   EuropePMC; PMC5313234; 28152054.
DR   EuropePMC; PMC5382811; 28663824.
DR   EuropePMC; PMC5472653; 28670571.
DR   EuropePMC; PMC5561291; 28667108.
DR   EuropePMC; PMC5571315; 28674047.
DR   EuropePMC; PMC5693900; 29150608.
DR   EuropePMC; PMC6070778; 30037042.
DR   EuropePMC; PMC6105664; 30135466.
DR   EuropePMC; PMC6186949; 30349524.
DR   EuropePMC; PMC6304438; 30619184.
DR   EuropePMC; PMC6330354; 30666237.
DR   EuropePMC; PMC6363711; 30761101.
DR   EuropePMC; PMC6365058; 30638443.
DR   EuropePMC; PMC6371490; 30792853.
DR   EuropePMC; PMC6434125; 30745327.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000521.
DR   SILVA-SSU; CP000521.
DR   StrainInfo; 51504; 0.
XX
CC   Source DNA and bacteria available from Michael Snyder
CC   (michael.snyder@yale.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3976747
FT                   /organism="Acinetobacter baumannii ATCC 17978"
FT                   /strain="ATCC 17978"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:400667"
FT                   /culture_collection="ATCC:17978"
FT   gene            95..1492
FT                   /locus_tag="A1S_0001"
FT   CDS_pept        95..1492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0001"
FT                   /product="DNA replication initiator protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10498"
FT                   /db_xref="GOA:A3M0Q4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0Q4"
FT                   /protein_id="ABO10498.2"
FT                   /translation="MLWTDCLTRLRQELSDNVFAMWIRPLVAEEVEGILRLYAPNPYWT
FT                   RYIQENHLELISILAEQLSEGRVRQVEILVDSRPGSILSSSEQPATTTAALQTAPIPQP
FT                   AKVKREPEPVANTAVSSKSSKKKLLNPQFTFSLFVEGRSNQMAAETCRKVLTQLGASQH
FT                   NPLFLYGPTGLGKTHLMQAVGNALLQAKPNARVMYMTSESFVQDFVSSLQKGKVEEFKK
FT                   NCRSLDLLLVDDIHLLAGKEASLVEFFYTFNALLDESKQIILTSDRYPKELTELDPRLV
FT                   SRFSWGLSVGVEPPDIETRIEILLKKAENSGVDLPRNCALFIAQQVVANVRELEGALNK
FT                   VVAISRFKGAPIDLDVVRESLKDVLAIRARTISVENIQRVVSEYFRIPLKELIGPKRTR
FT                   IYARPRQLAMGLARELTGDSFPEIGMAFGGRDHSTVMHACEKVVSLREEDPIFDEDYKN
FT                   LLRLLQS"
FT   gene            1590..2738
FT                   /locus_tag="A1S_0002"
FT   CDS_pept        1590..2738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0002"
FT                   /product="DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10499"
FT                   /protein_id="ABO10499.2"
FT                   /translation="MRLKIAKESLLNVLSHVVGAVERRHTLNILSNVKIQTNAQALTIT
FT                   GSDLEVELVASTALSEGACLEAGETTVPARKLMEICKSLPTAALIDLQITEDQRCILKS
FT                   GNSRFVLGTLPAEDYPLLTTENSQGTQVQVTQRELKRLFEKTAFAMAVQDVRFYLTGTL
FT                   LEIDENQLRAVTTDGHRLALCEILASSTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLL
FT                   IGRELLNVTINTPSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQ
FT                   SLQRVAILSNEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLAIQYQSAPLEMSFNAQYL
FT                   LDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMRV"
FT   gene            2753..3835
FT                   /locus_tag="A1S_0003"
FT   CDS_pept        2753..3835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0003"
FT                   /product="DNA replication recombination and repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10500"
FT                   /db_xref="GOA:A3M0Q6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0Q6"
FT                   /protein_id="ABO10500.2"
FT                   /translation="MHLTRLNIERVRNLKTVALHGLQPFNVFYGANGSGKTSILEAIHL
FT                   LATGRSFRTHIPKNYIQYEADDAIVFAQSATEKIGMQKLASGEQLMKVNGDTVATQGQL
FT                   AKLLPLQHIDPQSTDIIDHGAKPRRQLLDWLMFHVEPEFYFAWQYYSRALKQRNTLLKT
FT                   RRNLSLADLEPWNKMLSDYGEILHSQRLSIVEQWNVYFQNDLSQLLPDLEIELEYSPGF
FT                   HTEQGLMQDLLNQHQKDIERRYTEYGPHRADLRLKTPFGHADDVLSRGQKKLLIIALKL
FT                   SQIAMLHASNKETVVLLDDLTAELDLTAQQRLIERLSQLGSQVFMTTLDHASVKKHLHD
FT                   LSISYQLFSVESGQVSLAAS"
FT   gene            3888..6356
FT                   /locus_tag="A1S_0004"
FT   CDS_pept        3888..6356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0004"
FT                   /product="DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10501"
FT                   /protein_id="ABO10501.2"
FT                   /translation="MSSESQSASQTEQTNEKAYDSSSIKVLRGLDAVRKRPGMYIGDTD
FT                   DGTGLHHMVFEVVDNAIDEALAGHCDEIIVTIHEDESVSVSDNGRGIPTDIHPEEGVSA
FT                   AEVILTILHAGGKFDDNSYKVSGGLHGVGVSVVNALSSKLHLTIYRAGQIHEQEYHHGD
FT                   PQYPLRVIGETDNTGTTVRFWPSAETFSQTIFNVEILARRLRELSFLNAGVRIVLRDER
FT                   INLEHVYDYEGGLSEFVKYINEGKNHLNEIFHFTADADNGIAVEVALQWNDSYQENVRC
FT                   FTNNIPQKDGGTHLAGFRAALTRGLNQYLENENILKKEKVNVTGDDAREGLTAIISVKV
FT                   PDPKFSSQTKEKLVSSEVKPAVEQAMNKEFSAYLLENPQAAKSIAGKIIDAARARDAAR
FT                   KAREMTRRKSALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKMQAILP
FT                   LKGKILNVERARFDKMISSQEVGTLITALGCGIGREEYNPDKLRYHKIIIMTDADVDGS
FT                   HIRTLLLTFFFRQMPELVERGHIYIAQPPLYKLKKGKQEQYIKDNDALETYLISNAIDE
FT                   LALHISADAPAITGEALAKVIQDYQVSQKSLQRLTLRYPASLLDALLEVDAFKADQNHD
FT                   QAYVQQWADQVREAVQRLQPSLRPEITLETFERENAQGEKSAHYWPRVTVYIHNLPHAY
FT                   LLDAGLLNSAEYARLLKNSKSWFKLIEDGAYLQKGDRRIQVANFHQVWQHILQDSRRGM
FT                   MIQRYKGLGEMNAEQLWETTMDPENRNMLQVTIDDAIEADRMFSCLMGDDVEPRRAFIE
FT                   ENALNADIDA"
FT   gene            6397..6786
FT                   /locus_tag="A1S_0005"
FT   CDS_pept        6397..6786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0005"
FT                   /product="putative Cytochrome b precursor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10502"
FT                   /protein_id="ABO10502.2"
FT                   /translation="MSQKILASVLISCAALVSHSAFAADLEADMKTLAKSTKAFAEAKD
FT                   IDNAKQQLVIMRQAALSSKLSLPHKLEGLPPENVQVKEYQAGLDQLVAEIDRVTVFVDK
FT                   GQLDQAKTEAINLVNIRNENHKKFR"
FT   gene            complement(6872..7429)
FT                   /locus_tag="A1S_0006"
FT   CDS_pept        complement(6872..7429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0006"
FT                   /product="putative DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10503"
FT                   /protein_id="ABO10503.2"
FT                   /translation="MNFIDFITNFEQFLPILIQEYGAWVYAILFLIIFSETAFVFMFFL
FT                   PGDSLLLTVGALCSVVELMHLGYMITLLTVAATLGYIVNYSIGRHFGNRIFEAKSRFIK
FT                   KEYLNKTNRYFLQHGGKTILLARFIPFARSFAPLAAGSSNMSYGKFLIYNVAGAILWIC
FT                   ILLTAGYLFGHALIQVTDFVEN"
FT   gene            complement(7680..9611)
FT                   /locus_tag="A1S_0007"
FT   CDS_pept        complement(7680..9611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0007"
FT                   /product="putative transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10504"
FT                   /protein_id="ABO10504.2"
FT                   /translation="MIQFDQVSLRRGGRVLFQKASMQLHPGWKIGLTGVNGAGKSTLFA
FT                   ALLGSLGADEGSLTRPSVWTVAHMAQEVKALDMPAIDFVLSGDEEYWDIQNKLAQPEQL
FT                   TDSDLAKLHGRFDEIHGYSAPSKAAQLMAGLGFLEHQLRLNVASFSGGWRMRLNLARTL
FT                   MSRSDLLLLDEPTNHLDLDAILWLEDWLKAYEGTLILISHDRDFLDAITDHILHIENQE
FT                   LTLYTGNYSTFETTRSERLAQQQQAFEKQQEARAHLQKFIDRFKAKATKARQAQSRIKQ
FT                   LERMQQLAPAHVDTPFTFSFREPTKMSSPLLTLENASIGYGDKKIAEKIKLQITPNSRI
FT                   GLLGMNGAGKSTLIKSLVGDLPLLAGERKASELLNIGYFAQHQMDALDGHASPMLQLAR
FT                   IADKQISEATLRSFLGSFGFSGERMDTPCESFSGGERARLALALIVWQRPNVLILDEPT
FT                   NHLDLDMRHALSMALQDFEGAVVLVSHERQLIASVCDELLLVHGGKCTEFEGDLQDYAK
FT                   WLREARQQQINAQTAVAQNNSSSAAPAPAKVDKEAQRKEAARRREQTRPIRKNIEKVES
FT                   QIEKLQPRLAQIEEALADPSLYEANRKEDLLKLMNEQTELKAKLEQYEEQLLELMMELE
FT                   EMEASFEN"
FT   gene            9868..10872
FT                   /locus_tag="A1S_0008"
FT   CDS_pept        9868..10872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0008"
FT                   /product="putative RND type efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10505"
FT                   /protein_id="ABO10505.2"
FT                   /translation="MKKRLGIVSAVICYAMGTTHAGQNVCVFDLLGKSGESYKMMEEWA
FT                   LAAKSWQADITLIPFQDEALVDRRLREGKCDAAYMTSMRARNYNKFAGSIDAIGGVTSN
FT                   AIAQKAISYVLDQRNKHRMLTTQNGTNYEVVGIVQIGLAYLFVRDRNLNSIEKVRGTKF
FT                   AILQYDAAQKIMVESVGAQPIPSEITDFVKKFNSGQVEAIAAPAYAYKPLEIGKGIGAN
FT                   GAMFTFPVVNVTGDLIARSDKFPANFGMKSREWFIKQLPQNFAMVKRLETGIPPKIKLN
FT                   FSAEDKLKYQKILREGRLGLTKQGVYDATMMSVLKRARCTIERTNFECTLTGE"
FT   gene            11128..12135
FT                   /locus_tag="A1S_0009"
FT   CDS_pept        11128..12135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0009"
FT                   /product="putative RND type efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10506"
FT                   /protein_id="ABO10506.2"
FT                   /translation="MKKIVLAMAAASVVGFSASAQAASTVCVFDLLGKAGDSYKMMEEW
FT                   ALAAKGWGTEINLVPRQDEAVADNDFKAGKCDAVAMTAMRARQYNKFAGSIDSLGGVPN
FT                   NQIAQRAITYVLDARNAAKMTTNLGGKKYEVAGISPLGSAFIFVRDKNINSVEKAAGKK
FT                   FAVLGYDDAQKIMVQRVGAQAVLSDISNFAAKFNNGQVDMVGAPAYAYKPLELNKGLGA
FT                   NGVMWNFPVLHVTADLVLRADKFPAGFGQKSRDWFVKQLPKSFAMINRLEAQIPGKYKM
FT                   NLSAEDKLKYQKMLRDGRMDLTKRGIYDAGMMSVLKKARCSVDKANFECSMPGE"
FT   gene            12478..13482
FT                   /locus_tag="A1S_0010"
FT   CDS_pept        12478..13482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0010"
FT                   /product="RND type efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10507"
FT                   /protein_id="ABO10507.2"
FT                   /translation="MRFSKTLLLAMGLTTISFAAEAKQTICVFDFVGKNGDVYALMKDY
FT                   QLAAKNWGADIELKVNQNEAVIAEDFKAGKCDGISVSGMRGRQFNSFTGSLDAIGAIPD
FT                   LKLAVKVMQGLASQTFSKYMVNGRYEVVGVIPVGDAYLLVNDRSINTVAKAAGKKIAVL
FT                   DYDEAQKIMVQQVGAQAVSADVTNFGAKFNNHQVDIIGAPAAAFKPLELQKGLGTKGAI
FT                   VNYPILQVTGNIIIRPDKFPAGFGQKSREWVAGQLPRAFTILGKMKADIPQKYWMEVPA
FT                   ADKPGYQKLMRESRINLTQRGVYDKRMMKLLWQFRCKQDAKNFECGLQDENYK"
FT   gene            13607..13942
FT                   /locus_tag="A1S_0011"
FT   CDS_pept        13607..13942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10508"
FT                   /db_xref="GOA:A3M0R4"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0R4"
FT                   /protein_id="ABO10508.2"
FT                   /translation="MNAQALVLTDNAANKVRQLRDSEGNDDLMLRVYVTGGGCSGFSYG
FT                   FNFAESVNEDDAEFVNGDVKMLVDSLSYQYLVGSVVDYVEGLEGSRFIVQNPNATTTCG
FT                   CGSSFSI"
FT   gene            complement(13998..14843)
FT                   /locus_tag="A1S_0012"
FT   CDS_pept        complement(13998..14843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0012"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10509"
FT                   /protein_id="ABO10509.2"
FT                   /translation="MDLTKRIHQYTRGAWAFNVIDSGPIDGPLVVLLHGFPETAHSWEQ
FT                   TSELLHQHQFRTFAIHQRGYSLNARPQSRFHYALSELTEDVAVFIKGLGQPVYLIGHDW
FT                   GSVVASSVAMKYPQYIQHLTLVSVPHQAAFLKACLSSNQLLKSYYFAVFQLPILPELLF
FT                   KKMPKVARKFLKSSGMTEQQIKIFETEFIKENRLATALNWYRGFFWEKPENPFKAIDVP
FT                   TLFIWGKHDIAVTEKSAKLNSGYFKNNYKAIFMDASHWIPYQNAPELVQCFLESIHDQA
FT                   "
FT   gene            complement(14971..16098)
FT                   /locus_tag="A1S_0013"
FT   CDS_pept        complement(14971..16098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10510"
FT                   /protein_id="ABO10510.2"
FT                   /translation="MSAIYIGVMTGTSMDGVDIVAASFEPLQLHATLTVPFEPELRDEL
FT                   MALTLPDDNEIDRMGKADVALAKMIGHGINSLIEKHQLDRNQIKAIGSHGQTIRHRPEH
FT                   GFTLQIGDPNIITEITQIPVVSDFRRRDMAAGGQGAPLVPAFHQALFQHPSIHRVILNL
FT                   GGIANVSMLPANNPDGVFGFDTGPANILMDAWCHRHTGHPYDENGDWAAYGHPIRSLLD
FT                   RLYAHEYFSKEPPKSTGREDFNIDWLDDQLIDWRNDLTYDELEDTPENIQATLLKLTVR
FT                   AIQKAIYRSNMETGEVYVCGGGAYNSYLLEQLRWRLRKHNWSVQTTDVLGLSPTWVEAT
FT                   AFAWLAMRFVDGLSGNLPAVTGASDFRILGTITAV"
FT   gene            16178..17392
FT                   /locus_tag="A1S_0014"
FT   CDS_pept        16178..17392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0014"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10511"
FT                   /protein_id="ABO10511.2"
FT                   /translation="MSNFLPAEEQLALIQRGTHEIISEEDLLKKLKENRPLKIKAGFDP
FT                   TAPDLHLGHTVLINKLKTFQDLGHEVTFLIGDYTAMIGDPTGKSATRPPLSREQVEANA
FT                   KTYQEQVFKILDPNKTKVRFNSEWFNQKSAADLIQLASQQTVSRMLERDDFTKRYNNHQ
FT                   PIAIHEFLYPLVQGYDSIALEADVELGGTDQTFNLLMGRTLQSRYGQESQVCITVPILE
FT                   GLDGVNKMSKSLGNYIGVFDAPGAMYQKVLSMPDSLIERYFDLLSFKSLDEIKALLDEI
FT                   AAGRNPQEVKRILALELVERFHDAEAAANAHKSAGNRITEGEVPADTPEVTISRGEFGG
FT                   EIFIATILRVAGLNPNAAAAKDAVARGAVKVDWNVVDASFSVKENGTFIIQSGKKAIAR
FT                   VTFTD"
FT   gene            complement(19143..20306)
FT                   /locus_tag="A1S_3477"
FT                   /old_locus_tag="AS1_3477"
FT   CDS_pept        complement(19143..20306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3477"
FT                   /old_locus_tag="AS1_3477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89902"
FT                   /protein_id="ABS89902.2"
FT                   /translation="MASLNSEFQIPLKVVTTRLNHMKINLPQLVKKIEKRAIENLKRRK
FT                   DKKEQIDLLITWDDWIYAALDADHERIHGSADPHPLPPTFKNNMVSGVYEKALKNVMGH
FT                   FGVKATVPAWAANIKVGEHIPKELLDRLPVTTGELVTLGNWMLTKNIYRFEDIVINELI
FT                   KTGFNGVIPNHILNLPDLCVYIQTDNAKGLTFENRQVVGVLFCVTELCGDRLLVSTMYL
FT                   DDGMPRTIAIMLNEDQDIEASLTNFVDQFQQDYDPETMASDLKERLKIQKKLINLVLWF
FT                   SQSKPEVTPLTPDTNKPVQFVEIKKEKRLFEAGKYKTFKIGSETARKLTKLYEEIEVAK
FT                   AEGKASGREPHLRKSHWHLYWYGKKGRYERYDFLLIPVTIVGGVSKD"
FT   gene            complement(20391..21893)
FT                   /locus_tag="A1S_0015"
FT   CDS_pept        complement(20391..21893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10512"
FT                   /protein_id="ABO10512.2"
FT                   /translation="MTQKNELDTKYAVIVAGGNGAGKSTLIDNVIIPKFNSLNLDINFI
FT                   NADVWQLQHFGHFDNTNPTHAREAQKWAEAERQKHLDEGRSFIAETVFSHPSKVDLIKE
FT                   AKSKGFYVVLYHIHLENSDIALDRIKDRVRKGGHDVDEDKVKARYERVLPLVAEATQYA
FT                   DLTFVLDNSVRDRPHQQVFKLEYGKITAIDNNVPDWAIKAYEKQLTDYLGLDQATKISN
FT                   TNEDLTMSNTKEKLGFEYNARLLANDIQPQHRETVVANYRKNFVEHVANSAAVAGNSHK
FT                   LDDVASLINGTTVGGHSVKDQRQVLNLIDASNELVNMVRNGNFALNKSTYLKVNGIVAD
FT                   RESIEAGVLRGEGVEQSFTPDVGIRHFRTHRPMKTEEDAPALNKFMQEGFDHINSLKNP
FT                   LEKGIATFLYGSLNQFTFEGEKRTAHLMMNGVLMSAGLDAISIPADKAIDFRQKMVRFY
FT                   ESKNADEVMEFLADLHPALNNTKKLDAEKEKKSENDFGRSFQ"
FT   gene            complement(21894..22121)
FT                   /locus_tag="A1S_3478"
FT                   /old_locus_tag="AS1_3478"
FT   CDS_pept        complement(21894..22121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3478"
FT                   /old_locus_tag="AS1_3478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3478"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89903"
FT                   /protein_id="ABS89903.1"
FT                   /translation="MNSKFSVDQSNKISLKAVLEDLGDQMFEANKCPDTHPVYDQLRER
FT                   LRKDRQLLDALDAQDENANTEERSRSLDIN"
FT   gene            22222..23154
FT                   /locus_tag="A1S_0016"
FT   CDS_pept        22222..23154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0016"
FT                   /product="site-specific tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10513"
FT                   /protein_id="ABO10513.1"
FT                   /translation="MLDREILLKKWLDEYLLANKSNETIYTLKNSLNLFFEYTNLALEE
FT                   IEASDIRTFIAYRAQNGVGVSTLKKNISAIRTFFHYLTKEKLINFNPAEDIKIKKSSKV
FT                   LPKFHEVTVINEVLDSNKNLEFERPSSTVIFKRDLALIEIAYSCGLRLEEIHSLQIENV
FT                   EVKRKQVRVTGKGNKTRIIPLGSKAIEAYLEWLPLREEIMNKDTNQKHNYVFVTTTGAQ
FT                   LSRVQINKRIKNAFKLAGYPIQSNPHMLRHSFATHLINNSVGIREIQEMLGHSNLNTTQ
FT                   IYTDLDHTSMTNVYMDTHPRAVKNTEGEN"
FT   gene            complement(25014..25556)
FT                   /locus_tag="A1S_0017"
FT   CDS_pept        complement(25014..25556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0017"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10514"
FT                   /protein_id="ABO10514.1"
FT                   /translation="MLVYIIVGSVREGRTAIKIANWLETTIPSFNLKDFQTEVIDLKEW
FT                   NLPLFSGSHPPATGIYDQPKQQEWADKIAQADAFIFISPEYNHGYSPALKNALDYVGKE
FT                   WSGKPAAFIGYGSTNGSRSISQIRQVTSSLSIVDPNAVIEIRDIFKRNKDEKFEANEFE
FT                   VKGLQSIVEKLQKYHLS"
FT   gene            complement(25674..26183)
FT                   /locus_tag="A1S_0018"
FT   CDS_pept        complement(25674..26183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0018"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10515"
FT                   /protein_id="ABO10515.1"
FT                   /translation="MHNMTEIIQPNEEIRITDGSKVDLHFSVAIENGVEIDNTRSREEP
FT                   VSLTIGDGNLLPGFEKALLGLRAGDRRTVHLPPEDAFGPWNPENIQTFDTVKFEQRPIP
FT                   GHMIEFEDKAKATLFGVVKSVNDDITEIDFNHPLAGKNITFEVEIFKVTPAGQQGIKII
FT                   VKKALD"
FT   gene            complement(26176..26706)
FT                   /locus_tag="A1S_0019"
FT   CDS_pept        complement(26176..26706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0019"
FT                   /product="Signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10516"
FT                   /db_xref="GOA:A3M0S2"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0S2"
FT                   /protein_id="ABO10516.2"
FT                   /translation="MPNSQAKKGLFQFYPHNLIWLGLSVLAIVLDQWTKWIASTHLNYA
FT                   DPVPVLPFLNWTLLHNYGAAFSFLSDAGGWQRYFFTSLAGLVSILFVFWLLRMPKKMVV
FT                   LPVAIALILGGALGNLIDRITLGYVVDFIHVYYQNHHFPAFNIADSAITLGTILLLIDT
FT                   FFLEKQRPKNSDA"
FT   gene            complement(26699..29536)
FT                   /locus_tag="A1S_0020"
FT   CDS_pept        complement(26699..29536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0020"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10517"
FT                   /protein_id="ABO10517.2"
FT                   /translation="MSDKQTTENAVDYKATLNLPDTQFAMKANLAVREVKWLEEWYTDN
FT                   IYQQIRASRIGKKKYILHDGPPYANGTIHLGHAVNKVLKDIIVKSRTLAGFDAPYVPGW
FT                   DCHGLPIELKVEEKVGKVGEKVDAATFRKHCREYALKQIDLQRTDFKRLGILGDWDNPY
FT                   LTMNYKQEADIVRALGLIQKNGHIQPGLKPVNWCMDCGSALAEAEVEYEDKKSDAIDVG
FT                   FGVVDLKDLSARVNVDVQDPTDIVIWTTTPWTLPANQAVALHAEIEYQLVQVTTERGKQ
FT                   NFILAKDLVASAIERYKLENPVVLADFTGSALENLTLQHPLLTDRQVPVILGEHVIATS
FT                   GTGAVHTAPGHGADDYKVGLQYNLKVENPVGGNGVYLSTAPIFAGEHIYKANPKIIEAL
FT                   GAVGRLWAHQPIKHSYPHCWRHKTPIIFRATPQWFISMDQKGLRDGALNAIENDIEFVP
FT                   NWGKNRIESMIEGRPDWCISRQRTWGVPIPFFVHKDTNELHPRTPELIEEVAKLIEKEG
FT                   IDAWFNRDAKDFIGEDAEQYNAVRDTLDVWFDSGTTHYAVLEQRDELESPADLYLEGSD
FT                   QHRGWFQSSLLTSMAIHNRAPYKALLTHGFTVDENGRKLSKSLGNYIPLEEIIKQLGAD
FT                   GLRLYVASSDYRYEIAASKEIFSRVSDSYRRIRNTLRFLLANLNGFKPSTDALAVDNLI
FT                   ALDQYILQRANEVQQTIIAAYEEMNFHVVCSALTSFCINDLGGFYLDIIKDRQYTTKAD
FT                   SQARRSAQTALYHIVQAFVRWMSPILSFTAQEAWRLIPEQTDKYVFTAEWYDLPVSSKA
FT                   NLLSEADWQTLISVKSAVNKQIESARNAKLVGSNLSAKVELWANESLQTVLNQLADELR
FT                   FVLITSQVVVHPFAEQGEATEMEGLRVQVSAAEGEKCARCWHVLPDVNTHADHPGLCGR
FT                   CIVNVTGRGEVRKYA"
FT   gene            30101..30356
FT                   /locus_tag="A1S_0021"
FT                   /note="contains frameshift; similar to hypothetical
FT                   protein"
FT   gene            30807..31940
FT                   /locus_tag="A1S_0023"
FT   CDS_pept        30807..31940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0023"
FT                   /product="putative malic acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10518"
FT                   /protein_id="ABO10518.2"
FT                   /translation="MKRPFYQLNQSKDVIRHFTPNWFTATMGTGVVSMILIQLPFAKSF
FT                   LFMLATLLWQFNIVLFSVFSVLYLLRWLLFPHEAKQIFNHPNMSLFLGAIPMGLATILN
FT                   GFLSFGIGLYGEVAVHIAQALWYIDVFLALAIAWIVPFCMFSRQNHQLHTMTAIWLLPV
FT                   VACEVAASSAGMLVAHLPTDVHSFHLLLAGYVLWGISVLPAFAILTILMLRMALHQLPE
FT                   KEVAISSWLSLGPIGTGALGLLLLGEQAQRVFVNVGFPELAHVFQALGVVGSLVLLGFG
FT                   LWWLGLAILTTLRHAKTGIPFNLGWWGLTFPFGVFILALFNLGHQIEVVFLQYVAVAFS
FT                   ILLLVMWSGVMKKTLAGAYSGKLFFSPCLVALQQRMQ"
FT   gene            32021..32587
FT                   /locus_tag="A1S_0024"
FT   CDS_pept        32021..32587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0024"
FT                   /product="putative MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10519"
FT                   /protein_id="ABO10519.1"
FT                   /translation="MNTDTALIMALPNESKGLFEQAGIEVHYSGIGKINAAFKAFEVIQ
FT                   KTGCKTLINLGTAGSSSFNRHDLVEIKTFVQRDMDVSPLGFEVGVTPLDDHLAAEIHLQ
FT                   THFADLPKGICGTGDSFETGQPKVACDVVDMEGYALAKVCHKLGVRLISVKYITDGADD
FT                   TAHLDWEENLLLGAQKLLALYQNHF"
FT   gene            complement(32622..33242)
FT                   /locus_tag="A1S_0025"
FT   CDS_pept        complement(32622..33242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0025"
FT                   /product="putative transcriptional repressor"
FT                   /note="TetR/AcrR family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10520"
FT                   /protein_id="ABO10520.2"
FT                   /translation="MQQMEQKKSTQKRNQLLAAALDVFSLYGFSGASLDEIAQLADMHK
FT                   SNIFYYYENKESLYVEVLTTVLQKWLAPLQTLEAELEPAEALSHYLIQKIELSRSQPKA
FT                   SRLFALEIIQGAPHILPILKGPLKKLFKRKAKVIQTWQEQGKISPDIDPELLILNIWGL
FT                   TQNYADFATQMEMVTGKTLRNRSMFQRSIEHTVHMMLYGVLPR"
FT   gene            complement(33503..34303)
FT                   /locus_tag="A1S_0026"
FT   CDS_pept        complement(33503..34303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0026"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10521"
FT                   /protein_id="ABO10521.2"
FT                   /translation="MTNLNLNINQNDVELIPENHPESQEPVVGAEILIEQLYKFYGEVK
FT                   VLEDLNLHIQPGEFLAIVGRSGCGKSTLLRLIAQLEKASFGEIKFKSARHLREGITNDD
FT                   IRVMFQDPRLLPWRNILQNVQLGLPKSQHALAEELLEKVGLKEKAGQWPSQLSGGQRQR
FT                   TALARALSHTPRILLLDEPLGALDALTRLEMQSLIERLWKEQGFTAILVTHDVSEAVQL
FT                   ADRIILLDKGQIAQSFQVNLPRPRKKSITFAQLEQQVLDAVLAT"
FT   gene            complement(34317..35114)
FT                   /locus_tag="A1S_0027"
FT   CDS_pept        complement(34317..35114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0027"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily membrane"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10522"
FT                   /protein_id="ABO10522.2"
FT                   /translation="MSKDINIVSRGTKQVGQRLLPWIFPIVLLVVWQIASSSGLLENRI
FT                   LPAPTAVVSAFWHLLISGELWQHVKVSAGRALLGLFIGGGLGLLLGLLNGSSRFASTLL
FT                   DTTLQMIRNIPALALIPLVILWFGIDETAKLFLVAVGVFFPIYINTYHGIRSVDPQLIE
FT                   MGKSYGLSRWQLYKEIILPGAMPSILVGLRFALGLVWVLLIVAETISAQAGIGYMTMNA
FT                   REFLQTDVVLVGILLYALLGKLADVLAQLLERYLLRWHAGYQK"
FT   gene            complement(35111..36286)
FT                   /locus_tag="A1S_0028"
FT   CDS_pept        complement(35111..36286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0028"
FT                   /product="FMNH(2)-dependent alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10523"
FT                   /protein_id="ABO10523.2"
FT                   /translation="MKIFWFIPTHGDSRYLGTSKGARQVDHAYMKQIAVAVDNLGYEGV
FT                   LIPTGRSCEDPWITAASLIDATQHLKFLVALRPGVTTPALAARMAATFDRLSNGRVLLN
FT                   LVTGGDEAELRGDGLYEDHSTRYQTANEYVKIWREILTRSHTGEAFTFHGERLQVDDAK
FT                   LLYPPVQKPYPPLWFGGSSDVAVELAAEQVDTYLTWGEPPAAVKEKIEHVRAKAEAKGR
FT                   KLTYGIRLHVIVRETNEQAWAAANELIQYLDDATIAAAQKKFAQMDSVGQQRMAALHGG
FT                   NRDKLEVSPNLWAGIGLVRGGAGTALVGDPETVAARIQEYADLGIDTFIFSGYPHLEES
FT                   IRFAELVFPLLPIETRAKLAQPNLTGPFGEIIANNYVPDEKKQNSSVKEPA"
FT   gene            complement(36313..37296)
FT                   /locus_tag="A1S_0029"
FT   CDS_pept        complement(36313..37296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0029"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10524"
FT                   /protein_id="ABO10524.2"
FT                   /translation="MQHQPLFNKSQWTQLVKRFSAVAVLGLTIAAPAWAIDPTVKELRI
FT                   GFQKSSINFAIAKQQKLFEQEFPNAKITWNEFPAGPQILEALAVGSLDVGVTGDTPPVY
FT                   AQAAGKPLYYIAYEAAKPLASAILVPKNSQLKQLKDLKGKRIALQKGSSSHYLLVQAVR
FT                   KAGLKWSDITPIWLTPADARAAFQKGAVDAWAIWDPYYASAQLEDQARVLASGKGLSPN
FT                   YTFYLAAPNFVKQYPKAVPGLIKQINQADKWVQSHQAETASAIGQSTGLKPATSDLFIK
FT                   RRPRPSSAAPLNSKVIAEQQQLADIFTQQGIIPKPISIKQAVWGAK"
FT   gene            complement(37368..38336)
FT                   /locus_tag="A1S_0030"
FT   CDS_pept        complement(37368..38336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0030"
FT                   /product="alkanesulfonate transport protein"
FT                   /note="ABC superfamily peri_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10525"
FT                   /protein_id="ABO10525.2"
FT                   /translation="MALFNSTSWAKYSVIAASLAGVMMLGGCAKKEEHTTTTLNIGYQK
FT                   YGILPILKARGDLEKALKDQGVQVKWVEFPAGPQLLEGLNVGSVSLGEAGEAPPIFAQA
FT                   ANPNLVYVANQPAAPKAEALLVQKDSPIQSIKDLKGKRVALNKGSNVHYLLLKVLEANH
FT                   LSLSDIQPVYLPPSDARAAFEKGAVDAWVIWDPFFAAAEHQIQARVLATGENLVSNHQF
FT                   YLADRKFAENNPKVLNTVVQTLNQTTEWVSTHQDEAAKLLEKPTALEFDVLKTSISRMG
FT                   FGVQPISDKVAQEQQYVADAFYAQKLIPNKLTIQEAILKLK"
FT   gene            complement(38670..40025)
FT                   /locus_tag="A1S_0031"
FT   CDS_pept        complement(38670..40025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0031"
FT                   /product="N-alpha-acetylglutamate synthase"
FT                   /note="amino-acid acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10526"
FT                   /protein_id="ABO10526.2"
FT                   /translation="MPTKSLEKSHNNTQHYVHWFRHSAPYINAHRDKTFVLMFGGEAVR
FT                   DPNFEHIIHDIALLHSLGIRLILVHGARPQINHNLKEKGIETPFYDNCRITTRESLSCV
FT                   MSAVGSIRLEIEALLSMGLANSPMYGARIDVVSGNFVTAKPYGIREGMDFQLTGEVRSI
FT                   DTDAIERHLDNNNIVLLGPTGYSTTGEVFNLRAEEVATKTATYLKADKLIFLGEQQGLP
FT                   NEDGQLLRELSPHQLDYYIQQYQTTHPTLTLHLQEAKKASLSGVHRVHLISYSYDGALI
FT                   EELFTRDGVGTMITDAHYEEVRMAHIQDVGGLMNLLRPLEEEGILVYRSRERLEQEINQ
FT                   FAVIERDGMILACAALYPIPTEFNETRSAEIACVAVHPSYRKSNRGSQILQFLEEKAKQ
FT                   QGIRQLFVLTTRTAHWFLEHGFHQVSVDDLPNARQALYNYQRNSLVFKKLLP"
FT   gene            complement(40146..40466)
FT                   /locus_tag="A1S_0032"
FT   CDS_pept        complement(40146..40466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0032"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10527"
FT                   /protein_id="ABO10527.2"
FT                   /translation="MKKITTAIILSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDD
FT                   HANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEQSHKIIKV
FT                   IR"
FT   gene            complement(40689..41099)
FT                   /locus_tag="A1S_0033"
FT   CDS_pept        complement(40689..41099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0033"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10528"
FT                   /protein_id="ABO10528.2"
FT                   /translation="MKKLFTILALCITVLTTSMASFADPPFDRGHGPKGPKGGPRGEWN
FT                   DRGHKFDRDDNGDRVRDERRMREERGFERLKQHRWQPGYVMPQHYRGNGYKVDYKDNNL
FT                   PKPDRNQQWYKINNDYILVDTDSNSIVSIRGF"
FT   gene            complement(41317..42063)
FT                   /locus_tag="A1S_0034"
FT   CDS_pept        complement(41317..42063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0034"
FT                   /product="putative oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10529"
FT                   /protein_id="ABO10529.2"
FT                   /translation="MKYSEYQPRPDLLKDRIILITGAGDGIGRAAALSYALHGATVVLH
FT                   GRTLNKLEVIYDEIEGLGAPQPAILPLQLSSASDRDYDFLVSTLEKQFGRLDGILHNAG
FT                   ILGERVELAHYPAEVWDDVMAVNLRAPFALTQALLPLLQKSENASVVFTSSGVGREARA
FT                   LWGAYSVSKVAIEAVSKIFAAEHTYPNIRFNCINPGATRTAMRAKAYPEEDPKTLPTPE
FT                   SIMPAYLYLMGEDSLTLNGQSIDAQD"
FT   gene            complement(42129..42830)
FT                   /locus_tag="A1S_0035"
FT   CDS_pept        complement(42129..42830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0035"
FT                   /product="putative phosphoglycolate phosphatase 2 (PGP 2)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10530"
FT                   /protein_id="ABO10530.2"
FT                   /translation="MMKAVLFDLDGTLIDTAADFIRIIQQMCRDARRPVVEADLIRTQV
FT                   SEGARAMVKLVYPELDVTNPIFLAHRQNFLDLYGNNIVVDTDLFEGMYPLLEELEAQRI
FT                   PWGIVTNKPRGLSESLLEKLNLTERCAVLVCPEDVSKTKPDPEPMYLAAKQLNIPANEI
FT                   IYVGDHPRDIDAGRNADMYTILAAYGYLPIEHRDDLNAWQADSIVNTVTELHELLRQKL
FT                   PALQENQRMIS"
FT   gene            complement(42827..43426)
FT                   /locus_tag="A1S_0036"
FT   CDS_pept        complement(42827..43426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0036"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase and
FT                   2-octaprenyl-6-hydroxy phenol methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10531"
FT                   /protein_id="ABO10531.2"
FT                   /translation="MNWIDERAGGLAGKKVLDVGCGGGILAESMARRGADVLGIDMGEA
FT                   PLAVGRLHAQQENVQNIEYRQIPVEELAQEQAGQYDVVTCMEMMEHVPDPASIVKACQT
FT                   LVKPGGHVFFSTINRNPKSYLFAIIGAEYVLRMLPKGTHDYHKFIRPSEMAHDIRNAGL
FT                   TLKEMTGLHYNPITKRYWLAPNVDVNYMVHTIKTGA"
FT   gene            43719..44336
FT                   /locus_tag="A1S_0037"
FT   CDS_pept        43719..44336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0037"
FT                   /product="alkali-inducible disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10532"
FT                   /protein_id="ABO10532.2"
FT                   /translation="MKKLVLGGLSAAIMAVSGSAMAADFVAGKDYTVIANPGKVEVPGK
FT                   IEVREFFWYGCPHCFKLEPHMQTWLKQIPSDVRFVRTPAAMNKVWEQGARTYYTSEALG
FT                   VRKRTHLPLFHAIQVNGQQIFDQASAAKFFTRYGVPEQKFNSTYNSFAVTAKVAESNKL
FT                   AQQYQLTGVPAVVVNGKYVVQGEDGKVTQVLNYLIEKERKAK"
FT   gene            complement(44414..45061)
FT                   /locus_tag="A1S_0038"
FT   CDS_pept        complement(44414..45061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0038"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10533"
FT                   /protein_id="ABO10533.2"
FT                   /translation="MNLDRHTQFLMRKEKILSVAEKLLLENNQEITLDELVAELDIAKG
FT                   TLYKHFRSKNELLLELIIQNEKQILEISQKYNTDFKEYAPRYMLHHLLTPGKTILLHQL
FT                   EENLTMTESKLKHLFEELYEVRQQRILAIKDITESYLKSLNYDMSIRDYLSYIWSLTYG
FT                   ASLLLNSTYYQRSIGSRQKLINLYINQALSLPTQTTNFDALNFQIEDENSQN"
FT   gene            complement(45198..45836)
FT                   /locus_tag="A1S_0039"
FT   CDS_pept        complement(45198..45836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0039"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10534"
FT                   /protein_id="ABO10534.2"
FT                   /translation="MSIRDERKQQSRQALLDAALHLSTSGRSFSSISLREVAREVGLVP
FT                   TAFYRHFQDMDELGKELVDQVALHLKSVLHQLGQSYLQHKSAKTQTSIELFVQAVNHSP
FT                   KQWQFMIAERWGGSETVRAAIAREIEFLIEDLTTDLTKLENFKHIQNPQDLNVLSTILT
FT                   NMSFTWAMTWLNLAKQYQGEQLKQQQTAFIENASTQVRLLFRGIANWER"
FT   gene            46010..47035
FT                   /locus_tag="A1S_0040"
FT   CDS_pept        46010..47035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0040"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10535"
FT                   /protein_id="ABO10535.2"
FT                   /translation="MNATLNYQPHWVREDFVDFVLQKINATWAWKRVLAEVTAVQPLHT
FT                   DMVLIKLKPNRNFNFEQVCAGQSILLTLLIDGVYQQRSYSIIEVTTQGEIALGIKVQGL
FT                   VSRAAQLLHVGECVEISQPQGDFTLHQGQQPAILIASGSGITAIYSLLQQALKQQLEQI
FT                   HVIYFNRAEIFHAELKALAEQYPQLQYHFFNTTEQKQHLTESLLQKLVPDFAQTATYIC
FT                   GHHGMMQQANEIYAQKGAQSRLHQEYFQPLQVTGTHAAQPVIFRRAQHEFLAETNLLSS
FT                   AEQAGLRPQHGCRMGVCNKCSCTKVSGVTQNLLTGEIEDQPNRPIKLCVSQALSPVTID
FT                   L"
FT   gene            47060..48235
FT                   /locus_tag="A1S_0041"
FT   CDS_pept        47060..48235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0041"
FT                   /product="putative linoleoyl-CoA desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10536"
FT                   /protein_id="ABO10536.2"
FT                   /translation="MNMALKVSMASKSAHLTPEQIEEFGRRVEQIRQDVMQSLGEQDAK
FT                   YIYKVRNFVRYTEIASRGMLMFGGWIPPVWLLGTGLLGISKIVENMELGHNVMHGQFDW
FT                   LNEPSLNGNTYDWDTIASGDDWRETHNYVHHTYTNIVGKDHDVGYGILRVSDQQKWEPR
FT                   HLFNIPLALQLMFFFEWYVGVQNLHLEDALVYKTKSWKQVWKDAAKVRKKATRQILKDY
FT                   VFFPVISGPMFLPVFAGNVVANIIRNLWSSAVIFNGHFTEDAETFEPDNTDTETKAEWY
FT                   LRQIRGSSNFSGTEWLHFMSGNLSHQIEHHLFPDMPANRYKEVAPKIKALCAEYGINYN
FT                   EANFMRQFWSVWVRLAKCSLPNHTTAKVMQTLEKLKAKFKFCLIDRPINSS"
FT   gene            48368..49084
FT                   /locus_tag="A1S_0042"
FT   CDS_pept        48368..49084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0042"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10537"
FT                   /db_xref="GOA:A3M0U3"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0U3"
FT                   /protein_id="ABO10537.2"
FT                   /translation="MRIDQRALDQLREVKITRNYTRYAEGSVLVEFGHTKVLCTASIDN
FT                   SVPRFLKGQGQGWVTAEYGMLPRSTHSRCDREAARGKQTGRTQEIQRLIGRSLRAMVDL
FT                   KKLGENTITIDCDVIQADGGTRTASITGAAVALVDAMNVLLAQKKIKQDPLKGLVAAIS
FT                   VGMYQDEVLLDLCYEEDSNCQTDLNVVMTQAGEFIEIQGTAEDKPFTRAQSNAMLEMAE
FT                   KGIAELIKKQQEALGW"
FT   gene            complement(49196..49333)
FT                   /locus_tag="A1S_3479"
FT                   /old_locus_tag="AS1_3479"
FT   CDS_pept        complement(49196..49333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3479"
FT                   /old_locus_tag="AS1_3479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3479"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89904"
FT                   /protein_id="ABS89904.1"
FT                   /translation="MQLLVGGVVGDELSELLSSLQALSMSAKDVINKIESFRIGFFQTV
FT                   "
FT   gene            49374..51542
FT                   /locus_tag="A1S_0043"
FT   CDS_pept        49374..51542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10538"
FT                   /protein_id="ABO10538.2"
FT                   /translation="MNRREFLLNSTKTMFGTAAIASFPLSIQKALAIDAKVESGTIQDV
FT                   KHIVILTQENRSFDNYFGTLKGVRGFGDRFTIPMTEGRKVWEQYDANKKKVLPYHLDSR
FT                   LGNAQRVSGTPHSWSDGQAAWDNGRMSDWVAYKKPQSMGYYKKQEVEYQFALANAFTIC
FT                   DAYHCAMHAGTNPNRKFIWTGTNGPTGAGVASVVNEFDGIGPSTEGYEWTTYPERLLQA
FT                   GVKWKVYQNMPDNFTDNPLAGFKQYRRANEQSGQPVSNDTLTCPAYDEKIDATQPLYKG
FT                   IANTMPDGGFLGTFKADIAQGKLPQVSWLVAPATYSEHPGPSSPVQGAWYIQEVLNALT
FT                   ENPQVWSQTVLLVNFDENDGFFDHVPSPSAPSKDINGVVYGKTTLTDQQVSYEYFNHPA
FT                   VATSKSQPKPDGRVYGPGVRVPMYVISPWSRGGWVNSQVFDHTSILQFLEKRFGVQEPN
FT                   ISPYRRAVCGDLTTAFNFKTPNLLPVAELDGKKTKAEADAIRVAQALLPQVPVPSQQQF
FT                   PQQEMGIRPSRALPYILHTSAKVDAAQKTVKLMFSNTGKQAAVFHVYNRLDLTVIPRRY
FT                   MVEAGKQLDDVWNTTNGQYDLWVLGPNGFHRAFKGNLSQANQTQALPEIRVCVEECDAN
FT                   LYLKVRHDGNKSVKLNVKANAYLPNKTWMIETNSSEKELVWDMSEFGGWYDFTVTLADD
FT                   ATFSRRFAGRIETQEDSISDPYMGYLES"
FT   gene            51947..52114
FT                   /locus_tag="A1S_3480"
FT                   /old_locus_tag="AS1_3480"
FT   CDS_pept        51947..52114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3480"
FT                   /old_locus_tag="AS1_3480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3480"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89905"
FT                   /protein_id="ABS89905.1"
FT                   /translation="MLQGFIVLLAVVTFVLMAADPRDSGAQATQSAWQKTQAADMTKSQ
FT                   KNTNNDADFI"
FT   gene            complement(52111..52956)
FT                   /locus_tag="A1S_0044"
FT   CDS_pept        complement(52111..52956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0044"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /note="quinolinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10539"
FT                   /protein_id="ABO10539.2"
FT                   /translation="MSIPQSLLEQSIQINIQQALQEDIGDGDITAMLTPEDEQATATII
FT                   SREDMVLAGQPWVNALISAYDNTVQVTWLKQEGDRVAANEAFLKLAGSARSLLTVERPA
FT                   LNFIQTLSAVATKTAEYVQHLEGLNTKLLDTRKTLPGLRIAQKYAVTVGGGQNHRLGLF
FT                   DAFLIKENHIMAAGGIAQAIAKAHQIAPGKPVEVEVETWDELNQALEAGADIVMLDNFS
FT                   QQQMIDAVKHVAGRCKLEASGNITIENLREVATTGVDYISMGVLTKDVKAVDLSMRFNA
FT                   "
FT   gene            53128..53697
FT                   /locus_tag="A1S_0045"
FT   CDS_pept        53128..53697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0045"
FT                   /product="regulating N-acetyl-anhydromuramyl-L-alanine
FT                   amidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10540"
FT                   /protein_id="ABO10540.2"
FT                   /translation="MKQITPYEVIDGQLKGARQVPSPNFNQRPAGTEIQMIVVHNISLP
FT                   PSQFGGGYIEQFFQNKLDWSVHPYFQTIEGMQVSTHLLILRTGEVLQFVNFNDRAWHAG
FT                   RSSYLAKVECNDYSIGIELEGSDDLPFEDVQYEVLTDVVTAIRQAYPEIKNHIAGHSDI
FT                   APGRKTDPGPYFKWQHFRQLLAQKKT"
FT   gene            53779..55320
FT                   /locus_tag="A1S_0046"
FT   CDS_pept        53779..55320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0046"
FT                   /product="putative virulence factor MviN family"
FT                   /note="multidrug/oligosaccharidyl-lipid/polysaccharide
FT                   exporter superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10541"
FT                   /protein_id="ABO10541.2"
FT                   /translation="MALWRSTFIVSAMTMLSRVLGLVRDVVLLNVFGAGKDFDTFVVAF
FT                   RIPNFFRRLFAEGAFSQAFIPVLTEYKTGRAHAEVQILISRVFGCLLTVMTLLTFVAMV
FT                   LAPAIIYMYAPGFHNDPEKFDLAVSMFRLTIPYLMFMSLTAFASSILNSYGSFASPAFS
FT                   PVLLNVAMIAGAWWLTPYMAEPIKALGWSVVAAGILQLAIQIPELWRKNLLIPPKVDFK
FT                   HEGVERILKLMLPALFGVSVTQINLLLNTIWASFMQDGSVSWLYSAERMTELPLGLIGV
FT                   AIGTVILPSLSARHAEQDQAKFRSMIDWAAKVIVLVGLPASIALFMLSTPIIQALFQRG
FT                   EFDLRDTQMTALALQCMSAGVISFMLIKVFAPGFYAQQDTKTPVRVGLMSVAANAILNV
FT                   VFIGFFKLINWHAEHMALALASSGSALVNAGLLYFYLHKRNIFRFGAHWKKLALQYGLA
FT                   NLAMIAALWFGLNWYNGELSQWIRVAEVVGLCVVGVIAYLIGLLLTGFRPRDLKH"
FT   gene            complement(55366..56061)
FT                   /locus_tag="A1S_0047"
FT   CDS_pept        complement(55366..56061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0047"
FT                   /product="FKBP-type 22KD peptidyl-prolyl cis-trans
FT                   isomerase (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10542"
FT                   /protein_id="ABO10542.2"
FT                   /translation="MKKISLVIAASTMSLSVFAAAPITNKSPAKDQFSYSYGYLMGRNN
FT                   TDALTDLNLDIFYQGLQEGAQNKTARLTDEEMAKAINDYKKTLEAKQLVEFQKQGQQNA
FT                   QAGAAFLAENAKKSGVITTKSGLQYQVLKEGTGKTPKATSRVKVNYEGRLLDGTVFDSS
FT                   IARNHPVDFQLNQVIAGWTEGLQTMKEGGKTRFFIPAKLAYGEVGAGDSIGPNSTLIFD
FT                   IELLQVLPK"
FT   gene            complement(56112..56834)
FT                   /locus_tag="A1S_0048"
FT   CDS_pept        complement(56112..56834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0048"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10543"
FT                   /protein_id="ABO10543.2"
FT                   /translation="MSKALPIAVAVVLGGAALVPVYYATQHPTTEVGRKADKNASPIQK
FT                   ISYVLGYEVAQQTPPELDTKAFVQGIHDARNKQPSAYTQEDLKAAVAAYEKELQQKMQH
FT                   QDKPEQAGTAADSADAQFLAENKTKAGVKTTASGLQYIITKEGTGKQPTAQSIVKVHYE
FT                   GRLINGQVFDSSYKRGQPVEFPLNQVIPGWTEGLQLMKEGGKATFFIPSNLAYGPQELP
FT                   GIPANSTLIFDVELISVK"
FT   gene            complement(57027..59213)
FT                   /locus_tag="A1S_0049"
FT   CDS_pept        complement(57027..59213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0049"
FT                   /product="protein tyrosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10544"
FT                   /protein_id="ABO10544.2"
FT                   /translation="MNQQNTNTEDTIDLKELFFSLIAQWKLIALCVILSVVCALLYLRV
FT                   TPDTYSVDALVQVEDSKGASAALLGDLSQMIEQKSPAQAEIEILKSRLVLGTVIKDLHL
FT                   NIQVSSTENTLTHRLLSDADYKTEYTTKSVIFKDGLKSFDIRQFEIPAYYLDKNLLLDF
FT                   DKQSLRLTDPVTEEVILTVPLNQVNHVAGPHGLWKVAIFTKDQFDATYNIKSLSLPIAV
FT                   NAISANYAVAERGKLTGVLGLNYQGQDKEHITKVLNAILATYSAQNIERRSAESAQTLK
FT                   FLDEQLPDLKKQLDDAERQFNKFRQQYNTVDVTKESELYLTQSITLETKKAELEQKQAE
FT                   MAAKYTAEHPAMREINGQLAAINKQIGELNSTLKQLPDVQRQYLQLYREVEVKTQLYTA
FT                   LLNSYQQLRIAKAGEIGNVRIVDTAVEPVEPIKPKKLLVLILSVFVGGFIGALIALLRN
FT                   MLRTGIKDSGQIENEMDLPVYATVPRSPIQESRIKILKKKKSIPILAVKNSDDIAIESL
FT                   RSIRTAIHFALANAKNNIIMIAGPSPEVGKSFISTNLATIFAQGNKRVLLIDADMRRGY
FT                   MHKYFDVDVKPGLSELLSGQADLQKVLHKTQVANLDVITRGKSPTNPSEILSSNQFKEL
FT                   LEQLQSQYDHIIIDTPPVLAVTDGIIISQYTGVNLIVARYAKSQMKELELTVNRFEQAG
FT                   VKVNGFILNDIQRASAGYGYGYNYAYAYKAQKED"
FT   gene            complement(59233..59661)
FT                   /locus_tag="A1S_0050"
FT   CDS_pept        complement(59233..59661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0050"
FT                   /product="putative protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10545"
FT                   /protein_id="ABO10545.2"
FT                   /translation="MQIKNILVVCIGNICRSPMAEYFLKQQYPQLNIESAGISGLIGHQ
FT                   ADEKAQLCMQRLGIDMQPHIARKLNAELIKKADLILVMSSNQQKHIEQTWPFAKGKTFR
FT                   LGHWQNKNVPDPYQHEQAVFDETCQLIQQCVADWKPYI"
FT   gene            complement(59666..60766)
FT                   /locus_tag="A1S_0051"
FT   CDS_pept        complement(59666..60766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0051"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10546"
FT                   /protein_id="ABO10546.1"
FT                   /translation="MKYCQFFSVLALSLSAASCAVTSGLQTYDIPSEGVYKTDLGTTVN
FT                   VVKISQETLPAIQPAQIDYQRDYASLFKNQQSIYRLSPGDVLSIQLWAYPEITPPVNNI
FT                   SNEQSIQANGYPIDQSGYIQFPLVGRYKAAGKTLAQVNRELHSQLARFLKNPDVVVRVV
FT                   SYEGQRFSVQGSVTKGGQFYLSDQPVSIYTALGMAGGVTTTGDNTYIQLIRNGRTYNLN
FT                   TIDLEKAGYSLHKLLVQPNDTIYVSTRENQKIYVMGESGKNQALPMRDQGMTLSDALGE
FT                   SLGINPNSASASRIYVVRTNPNDRTTEIYHLNLMSLGDFGLANQFRLRSNDIVYIDATG
FT                   LTRWQRVVNQIIPFSNALYNIDRLGQ"
FT   gene            61127..62422
FT                   /locus_tag="A1S_0052"
FT   CDS_pept        61127..62422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0052"
FT                   /product="WecC protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10547"
FT                   /protein_id="ABO10547.2"
FT                   /translation="MQLADLRIAIIGLGYVGLPLAVEFGKKGPVVGFDINQNRIDELKS
FT                   GKDHTLEVSPEELQKAEQLSFSANLDDLKTSNFFIVTVPTPVDQVNRPDLTPLKKASET
FT                   VGQALKKGDIVVYESTVYPGATEEVCIPILEKVSGLKFNQDFFAGYSPERINPGDKVNT
FT                   LTKIKKITSGSTPEVANTVDAVYASIITAGTHKASSIKVAEAAKVIENTQRDLNIALVN
FT                   ELSVIFDRIGIDTLDVLEAAGSKWNFLPFRPGLVGGHCIGVDPYYLTHKAEEVGYHPQV
FT                   ILAGRRINDNMARYVARNTIKLMLQNGIDVPRSKVGVLGVTFKENCPDIRNSKVADLIK
FT                   ELEFWGAQVVVADPWADAEEVKHEYGVELGTVNAQNPVDSLIVAVGHSEFRSLSASELR
FT                   SYVKAEKPVLADVKSLFDRTQMSDVGFTVFRL"
FT   gene            62453..63403
FT                   /locus_tag="A1S_0053"
FT   CDS_pept        62453..63403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0053"
FT                   /product="MviM protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10548"
FT                   /protein_id="ABO10548.2"
FT                   /translation="MKKFALIGAAGYIAPRHLKAIKETGNTLAVAMDVNDSVGIMDSHF
FT                   PEAEFFTEFEEFEAYVEDQKLKGEKLDYVAICSPNYLHAPHMKYALKNGIDVICEKPLV
FT                   LNSEDLNMLAEYEKQYGAKVNSILQLRLHPSIIALRDKVQAAPADKVFDVDLTYLTSRG
FT                   KWYLKSWKGVDNKSGGVATNIGVHFYDMLHFIFGKIVKNEVHYRDEKTASGYLEYERAR
FT                   VRWFLSIDANNLPENAVQGEKLTYRSITIENEELEFSGGFTDLHTQSYQRVLEGKGYGV
FT                   EENRAAIETVEVIRVSPIIENPENPHPLLAKVKKA"
FT   gene            63400..63978
FT                   /locus_tag="A1S_0054"
FT   CDS_pept        63400..63978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0054"
FT                   /product="WbbJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10549"
FT                   /protein_id="ABO10549.1"
FT                   /translation="MSFYQHETAIVDNGAQIGEGSRVWHFVHVCGGAKIGKGVSLGQNV
FT                   FVGNRVVIGDHCKVQNNVSVYDNVTLEEGVFCGPSMVFTNVYNPRSLIERKDQYRDTLV
FT                   KKGATLGANCTIVCGVTIGAYAFIGAGAVVNKDVPAYALMVGVPAKQIGWMSEFGEQLD
FT                   LPLQGQAQAICSHTGAVYQLDGTTLTKQG"
FT   gene            63980..65059
FT                   /locus_tag="A1S_0055"
FT   CDS_pept        63980..65059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0055"
FT                   /product="WecE protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10550"
FT                   /protein_id="ABO10550.2"
FT                   /translation="MIDFIDLKAQQNRIKDKIDAGIQNVLTHGQYILGPEVIELEEKLA
FT                   SYVGAKHCITCANGTDALQIAQMAFGIGPDDEVITPGFTYIATAETVALLGAKPVYVDV
FT                   NPKTYNLDSEKLEAAITPRTKAIIPVSLYGQCADFDVINAIAKKYSIPVIEDAAQSFGA
FT                   TYKSRKSCNLSTVACTSFFPSKPLGCYGDGGAIFTNDDELAKVIRQIARHGQDKRYHHI
FT                   RVGVNSRLDTLQAAILLPKLEILDDEMQARQRVAEVYNRLFNEVGIHTTPYIEAHNTSA
FT                   WAQYTIQVDNRAEVQEKLKAQGIPTAVHYPIPLNKQPAVADSDIHLPIGDAIAEKVMSL
FT                   PMHPYLAIDDQLKIVKAFG"
FT   gene            65094..66446
FT                   /locus_tag="A1S_0056"
FT   CDS_pept        65094..66446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0056"
FT                   /product="O-antigen translocase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10551"
FT                   /protein_id="ABO10551.2"
FT                   /translation="MRLNAQGGFLKAVSVLVGGTAFAQGLAIIALPFITRLYSPSDFSI
FT                   FAVYASILGILTVASCLRFEIAIPIPSEDEEAAILVILALISNLAISILTGLLIWVFHV
FT                   EIISLLKKPNFNHIIWLIPLGVFFSGIYTALQYWATRKKNFTVIARTRVVQSISGVATQ
FT                   IILGFWGTAALGLALGQIIKVSFGIGKLAKNFWKESEVFIRNITIIKLYNVFKKNDQFP
FT                   KYSTLDSLANSAGAQLPINYYCYTCFRSEAGYLMIAMQVLAVPIQLIGGAVSQVYLAHA
FT                   PAAVQEKTIAHYTTNILENLFKYGVSSLIFIGLVSPILAKYIFGYEWEKVGLIISWMIP
FT                   WFAFQLIASPISMIMHIVGRQKQMLLLTLTGFILRIGILYGQFYLNPTYLLEAYAISGG
FT                   IFYGICYIVFSNSAGLEVKDHILLVKKVGFLLIFITSLGVMVNITLRVLGL"
FT   gene            66443..67009
FT                   /locus_tag="A1S_0057"
FT   CDS_pept        66443..67009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0057"
FT                   /product="capsular polysaccharide synthesis enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10552"
FT                   /protein_id="ABO10552.2"
FT                   /translation="MKKKLRKLIYFILPCIRLFLNLFFKRKYLEGRFFSKSLSGYVWAV
FT                   RSIWVKNILRLSKPTPFPTALTCSISNPYNIHFHPDDLNNFQSPGTYFQNFSAHIYIGK
FT                   GSYIAPNVGIITSNHDLADLESHTEGKDVVIGDKCWIGMNSVILPGVVLGNGTIVAAGA
FT                   VVTKSFKQGNIVIAGVPAKIIKEIK"
FT   gene            67186..68349
FT                   /locus_tag="A1S_0058"
FT   CDS_pept        67186..68349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0058"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10553"
FT                   /protein_id="ABO10553.2"
FT                   /translation="MKIGLTKFNYPEIRCVTTSQENDYINLKKYNIYYYFNNIPVIKNY
FT                   FHRFLFKPISVKNVDVIHSFNDICLTNNKWVVTFETMLPRFLDILSNHKNLNPEYIYND
FT                   EINKYLEVVARDNCLGVIALSKSAKKIQSDILKAYPKVRDKIEKKMFVLYPPQKIYTTQ
FT                   HEIEEKVLKPLKLIFVGNDFYLKGGAECILAINELLEEGIISENEIMLTVVGILNRTHN
FT                   YSFGIYQDDSDFSKNINTIIMNRKNIKIYSNVDNNKVIEMIREHHIGLLPTWADTFGYS
FT                   VLEFQACGCPVISTDVRALSEINNNDIGWLINVDKNKYGEIVVDSYSKKDLCRRTIIDQ
FT                   LKKHILSAYENPNVVINKGVESLNRIKKEHSIDYYNDKIKSVYTIGI"
FT   gene            complement(67415..67528)
FT                   /locus_tag="A1S_3481"
FT                   /old_locus_tag="AS1_3481"
FT   CDS_pept        complement(67415..67528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3481"
FT                   /old_locus_tag="AS1_3481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3481"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89906"
FT                   /protein_id="ABS89906.1"
FT                   /translation="MQQLPNIYLFHHYKYIQDSNSYDYSKYPKTVVTLSRK"
FT   gene            68441..69532
FT                   /locus_tag="A1S_3482"
FT                   /old_locus_tag="AS1_3482"
FT   CDS_pept        68441..69532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3482"
FT                   /old_locus_tag="AS1_3482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3482"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89907"
FT                   /protein_id="ABS89907.2"
FT                   /translation="MKILHAAYMKDASSGIVNQMYWEQEAAKELGISWKSILFVQNPNG
FT                   FQNNEIVTVCNDIMGGELKKWFKAKKSYYSWLEGIMQEYDVLIIRHSLCDPFEPFFIRK
FT                   MIKPVYIMHHTFEIDELYSYNYGVKTKIKSLMEIYFGKKSISYSKGIVAVTKEIFLYEN
FT                   SRVNGKFKKEIVYPNGIISQHDIILDDRNDDIPEIVFIASYFNGWHGLDLLLHNLSSIN
FT                   DDFILHIVGDVSVEDELLAKKDSRVILHGHLNNIEISQLMSKMWIGLASFGLFRKGMKE
FT                   ACTLKVREYLNYGLPIYSGHKDIFPEEFEYYKFGEPKFVDILSFAHLMRKVSKSDVKQA
FT                   AIKFIDKKILLKELYEQLLEEKS"
FT   gene            69615..70655
FT                   /locus_tag="A1S_3483"
FT                   /old_locus_tag="AS1_3483"
FT   CDS_pept        69615..70655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3483"
FT                   /old_locus_tag="AS1_3483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3483"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89908"
FT                   /protein_id="ABS89908.2"
FT                   /translation="MSLKIRKELLIFLILSSFLSLLVGFRGNTNDTITYYMIFKNIGSY
FT                   DLTNFSLFYNETGVEIGWGLYSKIISLFSDSPVVLFTIFSFFTFFTFYRISRLVEIKFL
FT                   YVMLYYLPTGFFMMQQFMQIRQGFAIPLVIYGSVLYLSGKKYISLVFFILAILFHQSSL
FT                   AFILIFISYLFFNNFLKINTSVFKFFIINILILVFGFIVARFILLDAAMDYFQRLEAYS
FT                   TTDYAESVGFFSLSNIKFYIEFFLIFLLLNNRLLLNKFIVFFVFIFTVGLSLRVAFYDF
FT                   GILSGRLSNTFLLIEVFLMPMLLSSRLNKIYLYIYFLLYFLVIFYVTWTFQASEFIKNN
FT                   YFLPLS"
FT   gene            70659..71693
FT                   /locus_tag="A1S_0059"
FT   CDS_pept        70659..71693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0059"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10554"
FT                   /protein_id="ABO10554.2"
FT                   /translation="MKILFLINSLKSKSGSERVAVELANKMAAIGSYNITLLNRESIKE
FT                   NAAYPIADNVEVIALSGSLFEFYKKLKKQISSNNYDVVVVHNMGKLSLLCAFVPNIKKL
FT                   VVLEHVSFISRPKKIQILSKFLYRNIDQVVTLTQNDKEQFDKFHSNVIVIPNFSPFSIA
FT                   SQPQNNGKQIVTIGRLTDQKNYIHLLQAWKKIYQSIPDWQLNIYGEGEQEEMLQDYIKQ
FT                   QSLKNVSLKGSTSNVKEVYEQSSFFVMSSKYEGLPMVLIEAQSFGLPIVSYNCPYGPSD
FT                   VIRDSKNGFLVEDQNVDELAAAVLKVALSPQLLEQFSQSSLLNAKKYQPEQILKIWIEK
FT                   VLEG"
FT   gene            71700..72527
FT                   /locus_tag="A1S_0060"
FT   CDS_pept        71700..72527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10555"
FT                   /protein_id="ABO10555.2"
FT                   /translation="MFSVLSSIYHKEQPEHFNTCMESIWDNQTLKPTEIVLIEDGPLTP
FT                   ELDQVIAHWQKKLGNVLRVTKLEKNVGTGKAKNIGLQECNYDIVSIVDTDDIYVPERFE
FT                   KQIKFLQQNPEISIVGGQIFEFIEDIGNPVGMRKVPLSNEELRNYAKKQSPFNNMTITY
FT                   RKSHILEVGGYQHHLWMEDYNLFLRVIAKGYKIENLPDVLVYARIDNGMHGRRKGLQYI
FT                   KSEKQLLDLKKQLKLQNPLYANMLFLVRSAFRLLPANLLGTIYNTFLRKDIKK"
FT   gene            72528..73160
FT                   /locus_tag="A1S_0061"
FT   CDS_pept        72528..73160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0061"
FT                   /product="putative UDP-galactose phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10556"
FT                   /protein_id="ABO10556.2"
FT                   /translation="MNENMKRLVDIVISLIALTVLSPIFLIVAYKVRKNLGSPIFFYQE
FT                   RPGKDGKLFKMIKFRSMKDAFDAQGNPLPDEARITPFGQKLRSTSLDEMPQLINVLKGD
FT                   MSVVGPRPMLKDFVALYSPEQARRLEVRPGMTGLAQVSGRNELDYEERFKCDVWYVDNH
FT                   NIWVDFKIMFKTVKVMLKREGINAPGHVGPSLFKGNDTQENIDSSVK"
FT   gene            73185..74060
FT                   /locus_tag="A1S_0062"
FT   CDS_pept        73185..74060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0062"
FT                   /product="putative UTP-glucose-1-phosphate
FT                   uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10557"
FT                   /protein_id="ABO10557.2"
FT                   /translation="MIKKAVLPVAGLGTRFLPASKSIPKEMVTVVDRPAIEYVVREAVE
FT                   AGIEQIILVTHSSKASIENYFDRNFELETTLEQKKKFDLLAEITQIVPEHVSVVSVRQP
FT                   QPLGLGHAVLCAKSVVGQDDFAVLLPDVLVKDSSGKNDLSRMIARYNSSQAAQIMVEAV
FT                   PDHLVDQYGIVDVKHSPNEGESIAMQGIVEKPAVGSAPSNLSVVGRYVLPAKIMQLLEN
FT                   TPKGAGNEIQLTDAIAMLQETDTVEAYRMQGQTFDCGSKIGYLKAVLHYGVEHPKLGND
FT                   FKQLIQELKL"
FT   gene            74176..74379
FT                   /locus_tag="A1S_3484"
FT                   /old_locus_tag="AS1_3484"
FT   CDS_pept        74176..74379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3484"
FT                   /old_locus_tag="AS1_3484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3484"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89909"
FT                   /protein_id="ABS89909.1"
FT                   /translation="MKIAVFGTTLHAGVMAALLAEYGNQIYWCTSVTCEENISILSYQD
FT                   QEVNHYLNKQRKARFFKRKSFF"
FT   gene            74761..75438
FT                   /locus_tag="A1S_0063"
FT   CDS_pept        74761..75438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0063"
FT                   /product="putative UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10558"
FT                   /protein_id="ABO10558.1"
FT                   /translation="MLATRISYMNDLAMVAEKLGIDIANVKHGIAADTRIGAAYLSAGV
FT                   GFGGENFSHDILTLSSTVSGTGAKSRLLEQVWAINEQQKEILFRKLWNYYHCDLSGKTV
FT                   AIWGASFKENTSSTHNSPIHILLAALWAQGVKVRLHDPQALDEIATTYGDREDLVLCAD
FT                   QYEAAQGAHALCLVTAWKQYWSPDFKQLQQVMQHPLILDGRNIYDPAYVKAKGFAYEGV
FT                   GRL"
FT   gene            75435..77105
FT                   /locus_tag="A1S_0064"
FT   CDS_pept        75435..77105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0064"
FT                   /product="putative phosphoglucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10559"
FT                   /db_xref="GOA:A3M0W5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0W5"
FT                   /protein_id="ABO10559.2"
FT                   /translation="MSKSIEKFPKELVSPIAQLHSLVEKNSKLHIKELFAAEQDRFQNY
FT                   SVKFDQLVFDYSKHRITKSVLEQLFALAKTKQLTHWIERLFSQDKVNCTEQRAAMHWAL
FT                   RLPSEYSKFPELTKQVHTQLQRMYALVEKIHAGQYRGATGEVIQDVVNIGVGGSDLGPQ
FT                   MVTHALCDFKVKTAKPLNVHFVSTMDGSQLSDLLHQLRPETTLFIISSKSFGTIDTLSN
FT                   AQTVRQWLEKALGKHDRVVKSHFIGVSTKAEKMTEWGIAPENQLLLWDWVGGRYSLWSC
FT                   IGFPIALTIGIDGFQQLLAGAHAVDEHFQNTSFEQNIPVLMALLGIWNNNFLNIQTHAV
FT                   LPYDGRLKYFAAYLQQLEMESNGKSVQRDGQKVELDTCPIVWGEVGPNAQHAFYQLLHQ
FT                   GTQAVSCDFIAPIQRYNADHFTYVENAEALIEQHHLALSNCLAQSRLLAFGNEALDSAE
FT                   LKNLPIYKQYEGNQPSSTLLLKELNPYSLGMLIALYEHKVFVQSVIWNINPFDQWGVEK
FT                   GKQIADQLLPILNGAQNDLSALDASTRGLIKILLGKVDG"
FT   gene            77098..78114
FT                   /locus_tag="A1S_0065"
FT   CDS_pept        77098..78114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0065"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10560"
FT                   /protein_id="ABO10560.2"
FT                   /translation="MAKILVTGGAGYIGSHTCVELLEAGHEVIVFDNLSNSSKESLNRV
FT                   QEITQKSLTFVEGDIRNSGELDQVFQEHAIDAVIHFAGLKAVGESQEKPLIYFDNNIAG
FT                   SIQLVKSMEKAGVYTLVFSSSATVYDEANTSPLNEEMPTGMPSNNYGYTKLIVEQLLQK
FT                   LSVADSKWSIALLRYFNPVGAHKSGRIGEDPQGIPNNLMPYVTQVAVGRREKLSIYGND
FT                   YDTIDGTGVRDYIHVVDLANAHLCALNNRLQAQGCRAWNIGTGNGSSVLQVKNTFEQVN
FT                   GVPVAFEFAPRRAGDVATSFADNARAVAELGWKPQYGLEDMLKDSWNWQKQNPNGYN"
FT   gene            complement(78158..79528)
FT                   /locus_tag="A1S_0066"
FT   CDS_pept        complement(78158..79528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10561"
FT                   /protein_id="ABO10561.2"
FT                   /translation="MTTLTCFKAYDIRGKLGTELNEEIAYKIGRAYGQIYKPKTVVVGC
FT                   DIRLSSEALKQATIRGLNDAGVNVLDLGMTGTEEVYFAAFHLDVQGGIEVTASHNPMDY
FT                   NGMKLVRENARPISADTGLKEIQALAETNNFEEVSQKGTTQSYNILPEFVDHLLTYIEP
FT                   AKIRPLKLVVNAGNGAAGHVIDAIEEKFKALNVPVEFIKIHHEADGTFPNGIPNPILIE
FT                   NRDSTRNAVLEHKADMGIAWDGDFDRCFLFDEKGQFIEGYYIVGLLAQAFLIKQSGEKI
FT                   VHDPRLVWNTFDIVDEYKGVAVQSKSGHAFIKDVMREHNAVYGGEMSAHHYFRDFAYCD
FT                   SGMIPWLLTIALLSETGQSLSTLVENMIAKFPCSGEINFKVADTQTTIQKIFDFYADQN
FT                   PQIDRTDGVSLDFGAWRFNVRASNTEPLLRLNIESRADRQAQPMQYYVDELTGLIQN"
FT   gene            79909..81570
FT                   /locus_tag="A1S_0067"
FT   CDS_pept        79909..81570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0067"
FT                   /product="L-lactate permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10562"
FT                   /protein_id="ABO10562.2"
FT                   /translation="MLNMWQQLYDPLNNIWLSSAVALIPIIFFFLALAVFRLKGSIAGT
FT                   GTVIIALLIALFFYQMPGQMAFASIIYGFFYGLWPISWIIIGAVFLYKISVKTGQFEVI
FT                   RSSILSITEDQRLQMLLVGFAFGTFLEGAAGFGAPVAITAALLVGLGFKPLYAAGLCLI
FT                   VNTAPVAFGAMGIPIIVAGQVSGVDTMEISQMVGRQLPFLTIIVLFWIMAIMDGWRGVK
FT                   ETWPAVLVGGGAFAIAQYLTSNFIGPELPDITAAIASLVSLTLLFRVWKPKHIFRFEPE
FT                   AGQTLTQQPTTVQRYSIGKIAKAWSPFAILTVMVTIWSVKPFKALFAKDGALEHWIFKL
FT                   EVPYLHKLVEKMPPIVSEMKPYEAIYKFDWFSATGTAIFIAAIITVIFLKMKASEAVTT
FT                   FGETLNELKTPIYSIGMVLAFAFIANYSGLSATLALALSHTGHAFTFFSPFLGWLGVFL
FT                   TGSDTSSNALFSALQATTAQQIGIPEVLLVAANTSGGVTGKMISPQSIAIACAAVGLVG
FT                   KESDLFRFTVKHSIIFTVFVGIIITVQAYLVPWMIP"
FT   gene            81590..82342
FT                   /locus_tag="A1S_0068"
FT   CDS_pept        81590..82342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0068"
FT                   /product="L-lactate utilization transcriptional repressor
FT                   (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10563"
FT                   /protein_id="ABO10563.2"
FT                   /translation="MRISDQVVMKLQALIEERHMKKGDRLPAERQLATSLGVSRPSLRE
FT                   AIQQLNSQGVLISRRGDGTYIQQLPEQWPQQLIVNPISNLIEEDPLYRFDVQEARLVLE
FT                   GGTAWYAALRSTPEDRAKIHHYFNEISRHQNAGDSAQAAVADAEFHLAIAEASHNVVLI
FT                   QMMRSLFDLLQYNVLLGRKKVYNDPVNGDLLSEQHFQVMDAIDRKDPEAARQAVCGHIE
FT                   FVINHVRSLDEDEARQKRANRLNRVDSK"
FT   gene            82339..83490
FT                   /locus_tag="A1S_0069"
FT   CDS_pept        82339..83490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0069"
FT                   /product="L-lactate dehydrogenase FMN linked"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10564"
FT                   /db_xref="GOA:A3M0X0"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0X0"
FT                   /protein_id="ABO10564.2"
FT                   /translation="MIISSGNDYRAAAQRRLPPFLFHYIDGGAYAEYTLKRNVQDLSEI
FT                   ALRQRVLNDMSALSLETKLFNETLSMPVALAPVGLTGMYARRGEVQAAMAADKKGIPFT
FT                   LSTVSVCPIEEVAPAINRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPVPGA
FT                   RYRDAHSGMSGPNAAMRRYMQSVFHPHWSWNVGLMGRPHDLGNISKYLGKPTGLEDYIG
FT                   WLGSNFDPSISWKDLEWIREFWDGPMVIKGILDPEDAKDAVRFGADGIVVSNHGGRQLD
FT                   GVMSSARALPAIADAVKGDLAILADSGIRNGLDVVRMLALGADTVLLGRAFVYALAAAG
FT                   GQGVSNLLDLIDKEMRVAMTLTGAKSISDINADCLVQAIKQGL"
FT   gene            83782..85488
FT                   /locus_tag="A1S_0070"
FT   CDS_pept        83782..85488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0070"
FT                   /product="D-lactate dehydrogenase NADH independent,
FT                   FAD-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10565"
FT                   /protein_id="ABO10565.2"
FT                   /translation="MQTFSPQAVIEHLQNIVGRSYVLTDDQSTRQYRQGRRFGEGKVLA
FT                   VVVPGTLLEQWQVLQAAIEADCIVIMQAANTGLTGGSTPYGDDYDRPVLVMSTRRLKGI
FT                   QVIHDGKQVICLPGATLDNLEQILKGYNREPHSVIGSSCIGASVLGGVCNNSGGALVRR
FT                   GPAYTELALYAQVNAAGQLELVNHLGVNLGSTPEEILTRLEKQQYQAVDILDDNEKQAS
FT                   DHRYAHDVTQVDEDTPARFNADPSRLFEASGSAGKVCVFAVRLDTYEKVESSVFYIGSN
FT                   DADDLTAIRRYLLTSLPSLPIAGEYIHRDAYLIGEKYGKDTFLFIEKFGTANVPKAFAM
FT                   KDKVDGFLEKFKIKGLTDQILQAITFFLPSHLPKRMTEYRDRYEHHLVLRVENNSKAQT
FT                   EQFLKEYFAVHQSGNYFVCSEEEGRKAFLHRFAIAGAAIRYRDTHRSEVEDIVALDIAL
FT                   RRNDREWVEQLPAEMEKKIIHKLYYGHFFCHVFHQDYILKKGNDPLEMEHQMWKLLDAR
FT                   RAEYPAEHNVGHLYIAKPALANFYQKLDPTNSFNVGIGHTSKLKYWGKAKS"
FT   gene            complement(85537..86751)
FT                   /locus_tag="A1S_0071"
FT   CDS_pept        complement(85537..86751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0071"
FT                   /product="tyrosine aminotransferase tyrosine repressible,
FT                   PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10566"
FT                   /protein_id="ABO10566.1"
FT                   /translation="MFQHIPPYAGDPILSLMEQFNADTRSEKVNLSIGLYYNEDSIVPQ
FT                   LETIIEAQKRIEPKNGKTKLYLPMEGFKPYREAIQALLFGANSPAVKAGRAVTIQTLGG
FT                   SGALKVGADFLKTYFPNSDVWVSQPTWDNHVAIFNGAGIKTHFYPYFDAETRGVDFDGM
FT                   LSTLKTLPEQSIVLLHPCCHNPTGADLNPAQWDQVIAVLKDRNLIPFLDIAYQGFGDGM
FT                   EEDAYAIRALDQAGLNFIVSNSFSKIFSLYGERVGGLTFVCDDAEAAQCTFGQLKATVR
FT                   RIYSSPPTTGAWLVDEVLNDAELNQQWQGEVKEMRERIIKMRSILKDELTKALPDRDFS
FT                   YLVNQKGMFSYTGLTAEQVDILREEYAIYLVRSGRICVAGLNMNNVYTVAKAMAEVLAK
FT                   SVEAA"
FT   gene            87267..87977
FT                   /locus_tag="A1S_0072"
FT   CDS_pept        87267..87977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0072"
FT                   /product="putative transcriptional regulator (GntR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10567"
FT                   /protein_id="ABO10567.2"
FT                   /translation="MQDLTFAPEPLQSQGRTLTEHVFKQIQTAIVLGQIPAGSKISEPE
FT                   LARTYGISRGPLREAIHRLEGQRLVERTAHVGARVVSLSLQQFKELYQIRASLEGLACK
FT                   LAAQHIDKKQILALRDVLRMHAEDENFKAGKGYYLQEGQDDFHYCIIKSSGNKTLEKML
FT                   CDELYHLIRMYRIQFSNTPDRPSKAWDEHIRILDAIAEGDGELAELLMHRHINASYKII
FT                   EQTLLQAQGEHNNG"
FT   gene            87970..88854
FT                   /locus_tag="A1S_0073"
FT   CDS_pept        87970..88854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0073"
FT                   /product="putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase or putative methylisocitrate lyase (PrpB)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10568"
FT                   /protein_id="ABO10568.2"
FT                   /translation="MAKQSAGQLFRDAVAQEKPLQVVGTINANHALLAKRAGYKAIYLS
FT                   GGGVAAGSLGLPDLGISNLDDVLTDVRRITDVCDLPLLVDADTGFGASAFNIARTTKSL
FT                   IKFGAAAMHIEDQVGAKRCGHRPNKAIVTQEEMVDRIKAAVDARGDDSFVIMARTDALA
FT                   VEGLQAAIDRAGAYIEAGADMLFPEAITELDMYKQFAQKTGVPILANITEFGSTPLFTT
FT                   EELASADVSLALYPLSAFRAMNKAAETVYETLRKEGTQKNVVDIMQTRKELYERINYYA
FT                   FEDYLDNAFAKKK"
FT   gene            89235..90280
FT                   /locus_tag="A1S_0074"
FT                   /note="contains frameshift; similar to methylcitrate
FT                   synthase"
FT   gene            90283..92889
FT                   /locus_tag="A1S_0076"
FT   CDS_pept        90283..92889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0076"
FT                   /product="aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10569"
FT                   /protein_id="ABO10569.2"
FT                   /translation="MNTKYRKPLAGTQLEYYDVRQAVEDIQPGAYEKLPYTSKVLAEQL
FT                   VRRADAENLTAYLTQLIERRQDLDFPWYPARVVCHDILGQTALVDLAGLRDAIAEKGGD
FT                   PSKVNPVVPTQLIVDHSLAVEYGGADPDAFAKNRAVEDRRNEDRFHFIEWTKTAFKNVD
FT                   VIPAGNGIMHQINLEKMSPVIQARDGVAFPDTCVGTDSHTPHTDALGVISVGVGGLEAE
FT                   NVMLGRASWMRLPDIIGVELVGQRQAGITATDIVLALTEFLRKERVVGAYLEFFGEGAD
FT                   SMSVGDRATISNMTPEYGATAAMFYIDQNTIDYLRLTGREDAQVALVEQYAKEIGLWAS
FT                   EMTKAEYPRVLRFDLSTVTRNIAGPSNPHARVSTSDLKEKGIAGVVENRSDGLMPDGAI
FT                   IIAAITSCTNTSNPRNTVAAGLLARKANELGLVRKPWVKSSFAPGSKAAALYLEEAGVL
FT                   KDLEKLGFGIVAYACTTCNGMSGALDPAIQQEIIDRDLYATAVLSGNRNFDGRIHPYAK
FT                   QAFLASPPLVVAYAIAGTIRFDIEKDALGHDKEGNPIYLKDIWPSDAEIDALVKQAVKP
FT                   EQFRKVYIPMFDLGEVEQAKSPLYDWRPQSTYIRRPPYWEGALAAPRTLANMRPLAILG
FT                   DNITTDHLSPSNAILMDSAAGEYLHKMGVPEEDFNSYATHRGDHLTAQRATFANPKLYN
FT                   EMVRRSDGTIKQGSKARVEPEGEVMRMWEAIETYMNRKQPLIIIAGADYGQGSSRDWAA
FT                   KGVRLAGVEAIVAEGFERIHRTNLVGMGVLPLEFKPGVNRKTLKLDGTELYSVIGNIAP
FT                   RSTLTLVIERATADGKEEILEVPVTCRLDTEEEVSVYEAGGVLQRFAQDFLEGQIA"
FT   gene            92999..95467
FT                   /locus_tag="A1S_0077"
FT   CDS_pept        92999..95467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10570"
FT                   /protein_id="ABO10570.1"
FT                   /translation="MEKNDTFLSDLLTTYKKLKLSDANEAETRKKLIDVVIENVLGWTT
FT                   DDISYEERVSEDGETTYADYIIRTADVSILIEAKRLGSTFYTVPEKKKVKLSTFSEDDL
FT                   TGKAIKQAREYCRKKSIPFAAVTNGSQWIIFPAVRTDSVSFSDSTALVFDSIERILGEE
FT                   SSHFRGLLSRDGVIEGNLALELIGRKTDQFDERRLNKFFKGISIKKENPIYPLIEGAVV
FT                   SAFSDSIVDNDNSILEKCYVKNADRKKFDNRIEMHLQKREPLFNSQPKRPMRKRESSSL
FT                   VDSINKASHNKKPLAILILGTVGTGKTTFLQYTRRISSASFFEQKEKQPYPHWIEIDFR
FT                   TFSKNENPLDFIYDKLFDYIKTDKFFCDYDRSIKFAYEKEINSLKSGPLFLLANSDEEL
FT                   KKRITDLLIADYQAIKPYVDKLIGYASKLSPIFLIIDNVDQFEDDFIQSEIFSDSIAIA
FT                   SRLGINLIIAMRESTFINHRSSPTFDAFDFDPLHIEPPEIPAVLSRRFFLTGKLLEGKS
FT                   GEFIALNGANFKVEDLSVFIDIVKGSVLGTEVGEKIDVLSNHDVRLALRMTREFLARGY
FT                   TDPAKALITHKPEKRYTLPKQEAFRSILLGNQSVYSEEYSVIGNPFDSRLNRSNTELLR
FT                   IFVLSALVRKGSSNGQGYIEGQIIRDSLKTIGFSETDTLAILKDLCTLRFAHTKSHGKA
FT                   DINSSYFASRLGGHIIKSLIGDFTFIENILMDTFISEKDQWEQLKSISSSIQEERDIVR
FT                   KINQRIDRIKIFYELMISQYSILLSEATKRGLDPIWLSNPLIEMKDTLWSNCDKAYASA
FT                   NRIYGENAQK"
FT   gene            96053..96277
FT                   /locus_tag="A1S_0078"
FT   CDS_pept        96053..96277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0078"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10571"
FT                   /protein_id="ABO10571.1"
FT                   /translation="METILGLCIGVGLSAACGFRVFVPLLVMSIATMMGWFEPSKGFEW
FT                   LALPSVCLALGVATVCEVAAYYIPWAIMP"
FT   gene            96301..96627
FT                   /locus_tag="A1S_3485"
FT                   /old_locus_tag="AS1_3485"
FT   CDS_pept        96301..96627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3485"
FT                   /old_locus_tag="AS1_3485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3485"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89910"
FT                   /protein_id="ABS89910.1"
FT                   /translation="MIAGTLATMAVSSGEMSQFASWAAAIIVGGGTAGVVQMSTVAARG
FT                   VSTATTGGLGNFIVATGEWIGAILLSVSAMLVPALVAIVVLIAVIWVVRWIRHKKQEQA
FT                   HTPL"
FT   gene            97027..97536
FT                   /locus_tag="A1S_0079"
FT   CDS_pept        97027..97536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10572"
FT                   /protein_id="ABO10572.2"
FT                   /translation="MTVILVKPHLRFKDSYNDYINELADEDRHPLTTEFDHTDFESFLN
FT                   KLRDYEKGESLEEGHVPNITYWLVEDNEVIGASNLRLKLNEQIEYCGGHIGLGIRPSKR
FT                   GQNFGSKLLELTIQEAWKLGLSELHIHCYKYNLASAKTIQANNGRLHSEITLNQVVQRY
FT                   VVYKTL"
FT   gene            complement(97896..98132)
FT                   /locus_tag="A1S_3486"
FT                   /old_locus_tag="AS1_3486"
FT   CDS_pept        complement(97896..98132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3486"
FT                   /old_locus_tag="AS1_3486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3486"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89911"
FT                   /protein_id="ABS89911.2"
FT                   /translation="MGISGCNLHTQQEFEKICLSGGHSKTSCECIYQRLEQTYSPKLMQ
FT                   RLEHVSLQSPVLPQDFAPTFLSTMQRCDKSSLG"
FT   gene            98856..100082
FT                   /locus_tag="A1S_0080"
FT   CDS_pept        98856..100082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0080"
FT                   /product="beta-ketoacyl-ACP synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10573"
FT                   /protein_id="ABO10573.2"
FT                   /translation="MERVVITGMGINSCIGNTLEKVTESLKAGRSGIRYNEVYAKLNFR
FT                   SHVSATAEMNFENIDPELKKHMGVCAMYAYNSALDALQHAKLDVTDIANNSKYGVIGGT
FT                   GGTSTASIIDMLHTLKEKGTSEVSPDLAPRYLTSTISSNLSRAFNLKGVSQSIASACAT
FT                   SADAIGYAYHLIAAGKQDLMLAGGGEEDHWSQTAIFDAMGALCSKYNDAPETASRPYSV
FT                   DNDGFVIAGGGGMVVLESLSHAQKRGAKILAEVVGYAANSDGVDMVAPSGEGATRCIKL
FT                   ALAEAKQNGSDTIDYINTHGTSTPAGDIPELLAIERAFGGEKVPPLSSTKSMTGHCLGA
FT                   AGVHEAIYSILMLQNNFIAPSINITELREEAKKFDIVQTSRETELKTVMSNSFGFGGVN
FT                   TCLVFRKWE"
FT   gene            complement(100092..100784)
FT                   /locus_tag="A1S_0081"
FT   CDS_pept        complement(100092..100784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0081"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10574"
FT                   /protein_id="ABO10574.2"
FT                   /translation="MKIKKSAFYIFTMIFSLHSSAFAEPSVADVQYRAQQGQPIAQYHL
FT                   GIMLLTGEQGVVKNYEQAFKWLTAADQNGSVGAKYSLGMMYFTGTGVEKDMKRAFEYFA
FT                   KAADKGHAKAQYNLGVLYDRGEGTAQNYEQAFEWYSRAAEQGYPPAEYNLAHLYKKGHG
FT                   VAQSDEQALKWYTKAAEHNESDAQYNLAQMYLNGEGTPKNLQLAKKWFQQAADAGDSDA
FT                   KEMLKSLD"
FT   gene            101204..103814
FT                   /locus_tag="A1S_0082"
FT                   /note="contains frameshift; similar to putative VGR-related
FT                   protein"
FT   gene            103819..104649
FT                   /locus_tag="A1S_0086"
FT   CDS_pept        103819..104649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0086"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10575"
FT                   /protein_id="ABO10575.2"
FT                   /translation="MDNVIDANKDIKKQATELLKKAHGKVSNVPPVIPVKLTTYTHSLT
FT                   IFIGGAADKYVFTPGDVPVGWGDFRPIGPTYFVGNYVNNYFATIKGGSKNAFVKYYGYE
FT                   EAYVSDTRELTVNTNKDKKLNAFNDVKNFLKTYPQTQVNIVGHSLGGWNAAGLAEILHK
FT                   NNICKVNVLITIDPVGEILSKIGLGSRTSIYYSRPKPVFNLWISISCDPKSYEWNNDLI
FT                   ADLGGQWSSYPSSNSSYYYVTRYSHADFRLMMQEKIVNNLSVQDILSKELSRIK"
FT   gene            complement(106539..107240)
FT                   /locus_tag="A1S_0087"
FT   CDS_pept        complement(106539..107240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0087"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10576"
FT                   /protein_id="ABO10576.2"
FT                   /translation="MNNNIIIFGYGTGISKAVAHKFGKEGYKIGLVARNAQKLEKAILE
FT                   LKAQGIEAYAFACDLAVLEDIPNLIKRIKDQLGEIKNIHWNAFHDIEGNILETPPLELT
FT                   KSFHIRVSSYIATVQACLGDLEKNHGSILSTNGIFAFDAVGIDLVAKEYSSLATTAAAQ
FT                   YKTTNLLAHSLADSNVYVSQVIVNGFVDGTSGAQDKTYTVHPETIAGQFWYLHQHKQET
FT                   VSFCGEAIQAA"
FT   gene            108043..108744
FT                   /locus_tag="A1S_0088"
FT   CDS_pept        108043..108744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0088"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10577"
FT                   /protein_id="ABO10577.1"
FT                   /translation="MENKNQCRQCAVCGKSFPLKDLVSGEVIRNVISDEILKDHPDWSY
FT                   SSFICRADLADYRIKYVQSLLRSEKGELSNLENEVIGSMQRHELISRNTESDFDQNWTF
FT                   GEKLADKIASFGGSWAFLICFALFLTGWIVLNTVVIVVRPVDPYPFILLNLVLSCLAAI
FT                   QAPIIMMSQNRQEAKDRLRSQHDYQINLKAELEIRHLHEKMDHLLSHQWERLAHIQEIQ
FT                   LDLLAEMNKKR"
FT   gene            108855..109520
FT                   /locus_tag="A1S_0089"
FT   CDS_pept        108855..109520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0089"
FT                   /product="dual specificity pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10578"
FT                   /protein_id="ABO10578.2"
FT                   /translation="MPLNDNFVYAPPQDPLSILFEDDDLIVVDKPAGLLSVMGRLPEHH
FT                   DSAYLRVLEKFPLAKVTHRLDMATSGLLMFAKHRDAEVAVSKMFQARTVKKHYIALVQG
FT                   QVKQEGSVEVPLITDWENRPRQIVHFELGKHAKTLFQPLVYDATTDQSRVLLEPVTGRS
FT                   HQLRVHMMHIGHPIMGDKLYHPEPKRFHLNRMALHAAYLAFQHPLKGTDVVIESQVPF"
FT   gene            109631..110005
FT                   /locus_tag="A1S_0090"
FT   CDS_pept        109631..110005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10579"
FT                   /protein_id="ABO10579.2"
FT                   /translation="MNRDYEQFPDDDNGNVLWQMVEDGDDLTELHEIEFSIAFQDQQNA
FT                   EQCAMHLLYQEQKISLFQDDSVEPNEWIITIFVTMEPEYSDIVDLEQWFSTIAEQFNGE
FT                   YDGWGCMAYVFDEEEDDILQ"
FT   gene            110034..110414
FT                   /locus_tag="A1S_0091"
FT   CDS_pept        110034..110414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10580"
FT                   /protein_id="ABO10580.1"
FT                   /translation="MSLSQKEIAVRFLELAAAGEVDEAYGNYTAPNFKHHNPYYAGDKT
FT                   SLKEGMRESAVETPNKVLEVQHVIEDGALVAVHSKLEMQMNNKLTILAVVHICRFENGK
FT                   IAEFWDIGQIQPDPLVNENGMF"
FT   gene            complement(110459..112432)
FT                   /locus_tag="A1S_0092"
FT   CDS_pept        complement(110459..112432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0092"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10581"
FT                   /protein_id="ABO10581.2"
FT                   /translation="MSQNSSATKFTHDVLDVPFNRAYLSKQIMEQQDVQRIDDALTLVS
FT                   GVFHQNSFGGGFWDNYSFRGFSTDPNLGAAMIRNGLSVNRGINAPKDVVNIESLEFLKG
FT                   PMAALYGRGETGGLLNLNSKKPQWESESELNLRANTQEQYRISLEHTAPINDELAYRLA
FT                   VAHEDNQSFRDHVSSERWFFSPQLTWKISDQTQLDFDSEFTEHKGTFDRGVSTVNHQFV
FT                   MDPKTFTGEPDDGDLKIKDYFYQLRLSHEFNPDWKLNSAVSYKDAKMVGFATEPRRMQA
FT                   DGRTLERQRRYRDYTSEDVLAQTELLGKIDTSWARHEILLSTELGQLDYKQNQLRRNHD
FT                   SNSPTTVNTIDIYQPEYGKYLPNLTPFTDTKERQRYFAFNVQDQIFFNDQWSVLFGNRF
FT                   DQVEQDFKNHIKQTEDNQTLHQNSPRFGVNFKASEQWAFYTNYGRSFAMNSGMNRNGQT
FT                   FAPEKGKSYEVGTKYKINDQSVLSLALFKMKKQNVLTTDPIDKDFQTAAGELSSKGVEF
FT                   DLNSQINDRWFVNANYSYTDAQIEKDQDLAKGARLSNVPKHQGSVSTNYEFLQDGARKA
FT                   GVGANLTYVGERSGHNLDNGFNLPSYTLVNLNGYYAPSDRLRYQLNINNLFDKTYYVSS
FT                   YSDLWVQPGEPLNASISAQWKF"
FT   gene            112634..113779
FT                   /locus_tag="A1S_0093"
FT   CDS_pept        112634..113779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0093"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10582"
FT                   /protein_id="ABO10582.2"
FT                   /translation="MSLEKNIERLQSIDALRGLVIIIMLLDHVRETFYLHKQVTDPMDV
FT                   TVTEPALFGSRLLAHICAPVFVLLTGISAFLFQSKKQDLQQTRAFLLKRGLFLIVLELT
FT                   LVNFAWTATFPPEVIYLQVIWAIGISMVVLACCVSLPLPVLAGVALVIIFGHNLLDSVH
FT                   FSQGILQNIWFVLHERGWLEFAGIKLRTSYPVLPWIGVILLGYVLGQFFNSKYTAKQRS
FT                   RTLLSLGLASIGLFVLLRFINVYGDQPWQHFESLQLSLMSFFNLTKYPPSLLFILLNVG
FT                   IGLLVLVAFERMQQYSFLKPLVVFGSVPMFFYLLHLYVLKLMYVFALSVWGANYGNYLS
FT                   VNHVWMLWLITIVLSFALYPAVKWFSKFKHQNKHISILKYF"
FT   gene            complement(113820..114287)
FT                   /locus_tag="A1S_0094"
FT   CDS_pept        complement(113820..114287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0094"
FT                   /product="lrp regulon transcriptional regulator (AsnC
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10583"
FT                   /protein_id="ABO10583.2"
FT                   /translation="MRPLDRIDRMILDILQREGRIAISELASRVNLSTTPCSERVKRLE
FT                   RDGIIMGYYARLNPAYVDRNLLVFLEIKLSAKSGDVFDQVARDLVEIPEVLECHLISGE
FT                   FDYLVKARLKEMSAYRRLLGDLLKKLPASASSHSYVVMEEVKETLYLDVSK"
FT   gene            114424..115689
FT                   /locus_tag="A1S_0095"
FT   CDS_pept        114424..115689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0095"
FT                   /product="D-amino acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10584"
FT                   /db_xref="GOA:A3M0Z0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023080"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M0Z0"
FT                   /protein_id="ABO10584.2"
FT                   /translation="MRVIVLGSGVIGVASAYYLARQGAEVTVLDRQSGPAEETSFGNAG
FT                   QISPGYSTPWAAPGIPFKAVKWMFQHHAPLAINLDGSMWQLQWMAQMLKNCNPQSYAVN
FT                   KERMMRVAEYSRDCLRELRKDTGIHYENRAKGTLQLFRKEAQMEAVQRDISVLEECGVS
FT                   YELLNANELGRVEPALANAQDKLVGGLHLPNDETGDCYLFTNALAQIAKELGVNFQFNQ
FT                   NVEKLIVEGDQIKGVQVNGKILTADRYVLAFGSYSRDFLKPLDLQLPVYPVKGYSLTIP
FT                   IVDPAFAPQSTVLDETYKIAITRFDQRIRVGGMAELSGFNLGLNEDRRATLQMVTQDLF
FT                   PGGDMEQASFWTGLRPMTPDSTPIIGATRFKNLFLNTGHGTLGWTMACGSGKLISDIVL
FT                   NHKTDISTDGLSIQRYSHAHAA"
FT   gene            115710..116813
FT                   /locus_tag="A1S_0096"
FT   CDS_pept        115710..116813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0096"
FT                   /product="alanine racemase 2 PLP-binding, catabolic"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10585"
FT                   /protein_id="ABO10585.2"
FT                   /translation="MPRPITAVIHRQALQNNLAVVRKAMPNSKVFAVVKANAYGHGIER
FT                   VYEAFKAADGFALLDLDEAKRIRALGWTGPILLLEGIFSPQDLFDCVQYQLSFTIHSEA
FT                   QIEWVEQHPYPAQFDVFLKMNSGMNRLGFKPQHYVQAWERLNNLANVAKITHMMHFSDA
FT                   DGDRFGQQGIDYQITAFEEIVKDLPGERSVSNSAAILRYQDQLKSDYVRSGIMLYGSSP
FT                   DYPTHSIADWGLQPTMSLRSEIISVQHLEPNESVGYGSNFVAEQPMTIGIVACGYADGY
FT                   QRISPTGTPVLVDSVRTRTVGRVSMDMLAVDLTGIESAKVGSEVVLWGQSSTGVVLPID
FT                   DVAVSSGTVGYELMCAVTARVQFINQV"
FT   gene            116824..117183
FT                   /locus_tag="A1S_0097"
FT   CDS_pept        116824..117183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10586"
FT                   /protein_id="ABO10586.1"
FT                   /translation="MSNSDIQKINTNEVMSAVTVFNKVVYLSGQVPKNTEQDVAGQTRE
FT                   ILATIDELLALANTDKSRLLSAQLYLKNLSDFSTVNAIWVDWLKGCVAPSRATIQADLV
FT                   NPNWLIEIAVTAAQK"
FT   gene            117345..118784
FT                   /locus_tag="A1S_0098"
FT   CDS_pept        117345..118784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0098"
FT                   /product="D-serine/D-alanine/glycine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10587"
FT                   /protein_id="ABO10587.2"
FT                   /translation="MTTARHSDMENSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILFIYMIIGGMFFFLMRAMGELLLANLHYKSFVDMAHDLIGPWAGYYLGWTY
FT                   WLGWVLVGIADLSAVINYLSFWLPDGASFSPIQQAMISAGCVLFVMGLNLLTVRLFGEI
FT                   EFWFALIKILAIIGLIGVGGYMIFSHFQAPQGAVASISNVWSHGGLFPKGTEGFLAGFQ
FT                   IAVFAFVGVELVGTTAAETKDPQKNLPKAINAIPVRIILFYVLALFIVMSVTPWDHIRA
FT                   DKSPFVELFLNAGIPVSAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPGAFGR
FT                   LSKRAVPSNGLIFSCTFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWSLIMVCYLR
FT                   YRKLRPELHEKSTFKMPGGIWMSYVVLAFMLFTLVILALEPDTLKALYVSPVWLIILGV
FT                   TYHVLYKPRMKRLGRELVNDH"
FT   gene            119155..120585
FT                   /locus_tag="A1S_0099"
FT   CDS_pept        119155..120585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0099"
FT                   /product="D-serine/D-alanine/glycine transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10588"
FT                   /protein_id="ABO10588.2"
FT                   /translation="MTMVHHSDEASSPDHLQRKLSNRHLQLIAIGGAIGTGLFMGSGKT
FT                   ISLAGPSILVIYMLIGGMFFFLMRALGELLLANLHYKSFVDMAYDLIGPWAGYYIGWTY
FT                   WLGWVLVGIADLSAVINYLSFWLPEGASFSPMQQAMISAGCVLFVLGLNLLTVKLFGEV
FT                   EFWFALIKILAIIGLIGVGGYMILTHFQAPHGDVVSISNVWSHGGLFPKGVSGFLAGFQ
FT                   IAVFAFIGVELIGTTAAETKDPQTNLPKAINAIPVRIILFYVLALFVVMSVTPWNHIRA
FT                   DKSPFVELFLNAGIPISAIIMNLVVLSSVMSSMNSGVFSTSRMLFGLSKDGQAPSVLGR
FT                   LSKRAVPSNGLIFSCIFIMGGAVLQYFVPNTMEAFTLASSLCVILFISVWILIMACYLR
FT                   YRKIRPELHAASTFKMPGGVLMAYAVIAFFLFTLVILALEPDTLKALYVSPVWLVVLSV
FT                   TYYVFYKPRMRKLGQEIF"
FT   gene            complement(120643..121524)
FT                   /locus_tag="A1S_0100"
FT   CDS_pept        complement(120643..121524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0100"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10589"
FT                   /protein_id="ABO10589.1"
FT                   /translation="MKVDWDHLQFFLVLARTKTLTNAARIIGVEHSTVARRIQALELAL
FT                   GTTLFKREATGYELTLEGMALVPRVEQMEQAFLQIEKPHQPLQGRVRIGTPEGFGTAFL
FT                   ARLLAEFSIQYPLLTIDLIPVPKMIKLSHREADIVVSIERPTSGPYIITRLSDYCLKIY
FT                   GSQNYLAQNPPIRRLEDLTQHRFVNYIDDLVYSPELYCLERLPLKLNANFRSSSILAQQ
FT                   IAVSAGAGLAILPKFLADDKPELEEVLEQQVRFTHTFWMLTFVDLQHEPRIKLVWDYLR
FT                   KQADKYQHLLVD"
FT   gene            121909..123203
FT                   /locus_tag="A1S_0101"
FT                   /note="contains frameshift; similar to
FT                   methylmalonate-semialdehyde dehydrogenase oxidoreductase"
FT   gene            123218..124108
FT                   /locus_tag="A1S_0103"
FT   CDS_pept        123218..124108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0103"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10590"
FT                   /protein_id="ABO10590.2"
FT                   /translation="MNIAFIGLGNMGGRMAQNLLKAGLKVYGYDLSEIAIQHFAEAGGV
FT                   VCDSPQDAAKQADVVITMLPAAKHVKEVYLGENGVLEVLKAGSLCIDSSTIDPQTIKDI
FT                   AAVAHSKNIKICDAPVSGGTIGAQAGTLTFMVGADEQTFNEVKPVLSHMGKNIVHCGDV
FT                   GAGQIAKICNNLILGISMAAVAEGMALGVKLGIDPQALAGVINTSSGRCWSSDVCNPWP
FT                   HINENAPASRGYQDGFATQLMLKDLGLAVEAAGQVKQPVLLGGMVQQLYQQMCMRGNAH
FT                   LDFSSIIQQYLPQEA"
FT   gene            124193..125839
FT                   /locus_tag="A1S_0104"
FT   CDS_pept        124193..125839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0104"
FT                   /product="putative acetyl-coA synthetase/AMP-(fatty) acid
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10591"
FT                   /protein_id="ABO10591.2"
FT                   /translation="MDYQNAVQAFDLESTAKQMLSGSLDALNACYECCDRHADGDKIAL
FT                   YWQGKDGRKEQYTFRELKEWSSQFANFLKAQGVKTGDRISGLLPRTPELIVTILAAWRI
FT                   GAVYQPLFTAFGPKAIEHRIQLAQSKLVVTDMGNRSKLEEIEKCPAIVTVADAQGTPLK
FT                   AGDFNFWNEVKQQSDQCDLVMRSIQDPFLLMFTSGTTGPAKPLEVPLKALIAFGRYMQD
FT                   AIGLTEEDSFWNIADPGWAYGLYYAITGPLFLGHATLFYEGGFSTDSLCQIVKDYKVNN
FT                   LAGAPTAYRMMMAADPAQMAPLKGQFRVVSSAGEPLNPEVIRWFKQVLDAPIYDHYGQT
FT                   EVGMVVCNHHGLKHEIHAGSAGFPSPGYRVAIVNEQGEELPPDTPGILAVDISQSPMMW
FT                   FGGYKESRKSPFVGHYYLTGDTAELHADGSMSFVGRSDDVITTSGYRIGPFDVESALLE
FT                   HDAVIEAAVIGVPDPDRTEVVKAFVILATGVQPTEALAEELSQFVKRRLSAHAYPRLVE
FT                   FVSELPKTPSGKIQRFLLRNQEIAKQQAKAG"
FT   gene            125851..126978
FT                   /locus_tag="A1S_0105"
FT   CDS_pept        125851..126978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0105"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10592"
FT                   /protein_id="ABO10592.2"
FT                   /translation="MQFTEEQLLIRDMAKSFAQEQIKPNASDWDRDGTFPKDTLAQMGQ
FT                   LGFMGMLVSEQWGGSDTGNLAYVLALEEVAAADGATSTIMSVHNSVGCVPILKFGTDEQ
FT                   KERFLKPLAQGEMIGAFALTEPHTGSDAAAIKTRAVKDGDYYILNGAKQFITSGNNAGV
FT                   IIVFAVTDPSAGKKGISAFLVPRETPGYEVIRVEEKLGLHASDTCQIALTDVRIHKSLM
FT                   LGKEGEGLKIALANLEGGRIGIAAQAVGLARAALEEATRYAKERITFGKPIFEHQTIAF
FT                   RLASMATEIEAARQLVHYAARLKEAGQPCLNEASMAKLFASEMTERVCSSALQVFGGYG
FT                   YLRDFPIERIYRDARICQIYEGTSDIQRLVIARSL"
FT   gene            127000..127773
FT                   /locus_tag="A1S_0106"
FT   CDS_pept        127000..127773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0106"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10593"
FT                   /protein_id="ABO10593.2"
FT                   /translation="MQWQSILLEKRNGVGLITLNRPQALNALNSELISEINQALDQLEK
FT                   DRGIGCIVLAGSEKAFAAGADIKEMADLAFPDIYLDDFFHLADRIAQRRKPLIAAVSGY
FT                   ALGGGCELALMCDFIYCADNAKFGLPEVTLGVIPGIGGTQRLTHAIGKAKAMEMCLTAR
FT                   QMGAVEAEQSGLVARVFAKEELLEQTLQAAEKIAARSLTANIMLKETINRAFEVNLTEG
FT                   LRFERRMFHSIFATFDQKEGMQAFVEKRKANFKNQ"
FT   gene            127786..128811
FT                   /locus_tag="A1S_0107"
FT   CDS_pept        127786..128811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0107"
FT                   /product="putative enoyl-CoA hydratase/isomerase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10594"
FT                   /protein_id="ABO10594.2"
FT                   /translation="MNTENHLMIEQQGKLGIITLDRVTHLNALSLDMIKSIGAQLELWR
FT                   NDAAVQAVLIKSNSPKAFCAGGDIRYLYDSYKNGTADYKGYFSAEYKMLDILREYAKPV
FT                   IVMLDGYVLGGGFGLAQACHIVVSSEKSRFAMPETAIGFFPDVGATHFLSRLDDIGVYM
FT                   AITGEQISSSDALYLDLIDYHVPSEQLQALQDALVEAPSLTKEGIEHIITRFITHPAES
FT                   ELKQLAEGIRKHFGYQHLDEIEQSLENEQDESLKTWASKMLSILQQRSFIAKQTSLKLQ
FT                   HLGRGLSLQQCMQLERDLQDIWFEHGDFIEGVRALIVDKDKQPRWQERNPELEQILEKL
FT                   S"
FT   gene            128931..130283
FT                   /locus_tag="A1S_0108"
FT   CDS_pept        128931..130283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0108"
FT                   /product="major facilitator superfamily (MFS) metabolite/H+
FT                   symporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10595"
FT                   /protein_id="ABO10595.2"
FT                   /translation="MQTIHGNGSYPKKSSHRLAGISSMVGTTIEWYDFFVYGAAAALIF
FT                   NKLFFPNLDPLTGVLAAFATYAVGFIGRPLGGLVFGHFGDKIGRKSMLLLTLMLMGIPT
FT                   VLIGLLPTYESIGYWAAIGLVILRFIQGMAMGGEWGGAVLMAVEHAPEGGKGFWGSLPQ
FT                   ASTGGGLMLASIALGLVSLLPEQALFSWGWRLPFLASIILLAVGWYIRVKVPESPDFEK
FT                   VKQQSEEVKVPAFQVFKNHPKQLITIILARAAENAWFYIASTFTLAYTTTQLGIPRQDI
FT                   LFATICGAAVILFMTPLCGHLSDKVGQRNMFMFGLCVLALYSYPFFSMLNTKDPVLVWT
FT                   AIVLAIGVVFPIMYAPQAQLFARQFPAEIRYSGISISVQLAGVLGGGLAPMIATKLLSI
FT                   GQGNPYLIMFYIGSMAVVAIISTSFMPRDWSYKKDETYYKKANLNLKTKID"
FT   gene            complement(130376..130927)
FT                   /locus_tag="A1S_0109"
FT   CDS_pept        complement(130376..130927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0109"
FT                   /product="homoserine lactone synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10596"
FT                   /protein_id="ABO10596.2"
FT                   /translation="MNIIAGFQNNFSEGLYTKFKSYRYRVFVEYLGWELNCPNNEELDQ
FT                   FDKVDTAYVVAQDRESNIIGCARLLPTTQPYLLGEIFPQLLNGMPIPCSPEIWELSRFS
FT                   AVDFSNPPSSSSQAVSSPVSIAILQEAINFAREQGAKQLITTSPLGVERLLRAAGFRAH
FT                   RAGPPMTIDGYSMFACLIDI"
FT   gene            complement(131006..131371)
FT                   /locus_tag="A1S_0110"
FT   CDS_pept        complement(131006..131371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10597"
FT                   /protein_id="ABO10597.1"
FT                   /translation="MNENQLMSYPLQHIISIVESRHTEASQIFYYGFTEWATSQTPALS
FT                   TGWDWELIENNGITTVKRVGLPRSNIMIVDVSGMDIGFDINETLLEKKIDTLFWEPFIY
FT                   AQINTSLTKSSLSQTFS"
FT   gene            132182..132898
FT                   /locus_tag="A1S_0111"
FT   CDS_pept        132182..132898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0111"
FT                   /product="eR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10598"
FT                   /protein_id="ABO10598.2"
FT                   /translation="MESWQEDLLSAFLVVKNEYQLFEIVKSTASRLGFDYCAYGMQSPL
FT                   SIAEPKTIMLNNYPEAWQKRYVERQYVKIDPTVQHCMVSLQPLVWSSQSAKTQAEKDFW
FT                   EEARSYGLNVGWAQSSRDFIGTRGMLTLARSNDQLSEKEQKAQYTNMYWLTQTVHSSIA
FT                   KIVNDVEFAKFNLYLTNREKEALRWTAEGKTSAEIAQILGVTERTVNFHLSNSMQKLNV
FT                   NNKISAAIRAVMLGLL"
FT   gene            133515..135404
FT                   /locus_tag="A1S_0112"
FT   CDS_pept        133515..135404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0112"
FT                   /product="Acyl-CoA synthetase/AMP-acid ligases II"
FT                   /note="AMP-forming"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10599"
FT                   /protein_id="ABO10599.2"
FT                   /translation="MAVMCTDNIIATLESRAKLNGNKIAFEYLGRQSGGIQSLTYADLN
FT                   ERVQHQAQILMSIVDSGDRAVLLFEPGLDFIVSFFACLKAKIIAVPVSLPFNRNGFSNI
FT                   LNIMNDCEPKIVLTTKKILELAGLITLKAQNENLILHVVDAELQRDLVEKDFPLITEKD
FT                   ICFLQYTSGSTGWPKGVIVTHKNIMANEVMIAEAFGTQPEDVGLTWLPVYHDMGLIGSV
FT                   LQTVYVGLTCYVMSPLDFIRKPLKWLQFISEKGVTISGGPNFAYELCLHRITDEQAAAL
FT                   DLSRVRVLFNGAEPIKAHVMQRFMEKFNTQSRLRLDTFLPCYGLAEVTLLVSGVTGPLN
FT                   AISLDRDKLNAHLVQTSQDQTAVQVVSCGKISKHIDCRIVNPHTRKEVAAHEVGEIWLA
FT                   GESVTAGYWQKPEVNQETFEATILNEAGQPSQVHYLRTGDMGFIKNGDLYITGRLKDVI
FT                   IIRGKNYYPQDIECSVEMAHPAVRKGCVAAVNFADSEGVTVVLEIKKKSLDKTLNFETI
FT                   RTQVKEQVAADIGLPVDGVYLLHQGRINKTTSGKIRRRKIKEQIERGQLVCLTHPNRRT
FT                   VIARNYVKNGLDVIRDREQRGQLIRYSSNLLNSMIKEREVRTLIFNRLKSALF"
FT   gene            135437..137230
FT                   /locus_tag="A1S_0113"
FT   CDS_pept        135437..137230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0113"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10600"
FT                   /protein_id="ABO10600.2"
FT                   /translation="MSLTSNLRQFQSAARLEQILGSVHDTNNDFSWSAAIERDEKEQYP
FT                   QRAVDFLNAVGMNRFYVPSELGGRMEIGEELLYLHRVLARRDLTINSTYSTNAWSVIVW
FT                   IGGNANQCQNIANRILSGAAPALAYSEKAHGADLLSSEVTAQPSDSKYVLNGEKWSINR
FT                   ATLGDSLSLIAKTSNDRGPRSLSAFWLDKRHMASKGTYSLNRLPTVGMRGLDISGIGFN
FT                   NAEIHKDALIGEEGQGLELGLKTLQVTRAYCSSFSLGAGDTMLRIATEFAIERELYNKK
FT                   VISIPLVREQLATAYAYLLAAEVLSLVGARGLHVCINQFSTWSPIVKVLVPEYVESLAK
FT                   ITSSVLGSRFFLRNAYADGMFQKAFRDHLIVSVFDGSSTVCLDSLSFQLKSANKGRSKK
FT                   ADHLNQAEAKARYRQLYDLQVETGAIDFRELEIFNRDGDLVMESLETIIEMLNDSNVTV
FT                   GLSAETLATLHERANQLLVEQRSLDQKIQDYFSNSEQSKEFETMRFSLARDYAELFARI
FT                   AVLGFWVFNRHGLRPALQNGAWLIIFLNAAEGQTAPPMTSLRESTLADLLDRISTNHML
FT                   SVIDFALAPRDAKPVKKEITP"
FT   gene            137227..137487
FT                   /locus_tag="A1S_0114"
FT   CDS_pept        137227..137487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0114"
FT                   /product="Acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10601"
FT                   /protein_id="ABO10601.1"
FT                   /translation="MNKDKAYWSAIIRTLVAKEMRVEPETIDPDQKFTSYGLDSIVALS
FT                   VSGDLEDLTKLELEPTLLWDYPTINALAEYLVSELQQGVAS"
FT   gene            137484..141443
FT                   /locus_tag="A1S_0115"
FT   CDS_pept        137484..141443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0115"
FT                   /product="Amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10602"
FT                   /protein_id="ABO10602.2"
FT                   /translation="MNNLARLEPEVLSRHAISAEQLGIWYIQRFEPTCSAYNMVVAFDV
FT                   KVNQSLGNKPIEILEAVMHDYPLLRVSMPANDQGIEQLIWDRVYPNIIFSDARHIEASD
FT                   LTQLVEQDTKQPFDLTQPPLWRIHCYERGQNHYVIAFVIHHALMDFWSIGLLLRDVSKR
FT                   FGLVAESDAVNGIEFAQYADKQQSNVIDDTDESLLFWKNALKHAPHVHSIPLDYPRPAV
FT                   QQHKGSSLAFRVPESVSSGLINLAKDYEITLFGLVLSGFYILLHKLSNENNLVIATPVA
FT                   GRLERSLRNALGQFVNTIAIHIDIDADQTLRQFTQQVQEQLRQSLKHQKVAFSRVVEAV
FT                   APKRDGSINPLAQIGMFWERLGGMDEFKELLLPIQTPATLVGQDLTLGSFPVRQQEGQL
FT                   DITLEMGGEYQGELVGVLKYNTDLFSAQSAENMVQLLQAVLAEMVAHPERKIVELDIAP
FT                   DYKDGIQFEALRGKVTDYAQHDLLGMILKQIVERGENHALTSNDHTVSYRELGQHIAGI
FT                   AEYLRAHGITQGDRVGLMLDRTALLPAAILGIWAAGAAYVPLDPNFPTERLQNIIEDAE
FT                   PKVILTQTELMDGLNVSVPRLDINQAGVVALEQVRETLAFGDIAYVMYTSGSTGKPKGV
FT                   RIGHPSIINFLLSMNDRLQVTTETQLLAITTYAFDISILELLIPLMYGGVVHVCPREVS
FT                   QDGNQLVDYLNAKSINILQATPASWKMLLDSEWSGNAGLTALCGGEALDTILAEKLLGK
FT                   VGCLWNVYGPTETTVWSSAARITDAKCIDLGEPLANTQLYVLDEQQRLVPPGVMGELWI
FT                   GGDGLAVDYWHRPELTDAQFRTLPSLPNAGRLYRTGDKVCLRTDGRLTHHGRLDFQVKI
FT                   RGFRIELGEIENVLKQIDGITDAVVLVKTTAGNDQKLVAYVTGQELDIAGLKKTMQIHL
FT                   PAYMVPSAFIRLDEFPMTANNKLDRKAFPEPIFEQSNDYVAPRDPIEIELCTTFEQILS
FT                   VKRVGIHDDFFELGGHSLLAVKLVNHLKKAFGTELSVALLAQYSTVERLGEIIRENKEI
FT                   KPSIVIELRRGTSEQPLWLFHPIGGSTFCYMELSRHLNPNRTLRAIQSPGLIEADAAEV
FT                   AIEEMATLYIAEMRKMQPQGPYFLGGWCFGGAIAYEISRQLRQMGQQVTGIVMIDTRAP
FT                   IPENVPEDADDAMLLSWFARDLAAPYGKKLTIPAQYLRELSPDQMFDHVLKEAKAINVL
FT                   PLDADPSDFRLYFDTYLANGIALQTYFPEPEDFPILLVKAKDEQEDFGESLGWDQLVKD
FT                   TLTQVDLPGDHSSIMYAENVVAVAQTIDQMYPIPA"
FT   gene            141468..145118
FT                   /locus_tag="A1S_0116"
FT   CDS_pept        141468..145118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0116"
FT                   /product="RND superfamily-like exporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10603"
FT                   /protein_id="ABO10603.2"
FT                   /translation="MVTIEHAFLIPAKIDKVFNYLANPANDAGWQLSCKHSELLDSTPR
FT                   VGSKYEIGFSFIGREMSFKGEITHLVPNELYAFKVVEGPFHYTGTYRFKPHPEGTWIEW
FT                   VFEAEPGSFFGVLPPALLKKMVLAQFKKDVDNLQALAQKGEAYESVGNENKPTLETNKP
FT                   PHKTQQMMERYARWILSHRRIVLTVVMLLTLALAYLASGVKIIIDPDALAPKGHPYITS
FT                   TKLIEKKFGSKYMVVIGITPKKGDIYQPQVLEKVKRITEEVDNAPGVVRSTMMSLAARQ
FT                   AKGIEANAEGFDAKKLLPSSSVTQEDIDHLKKLLALNPTYMNSVVSKDQRTAAILLELE
FT                   ESPEGFQKMMGPINKIVESEQSKDMTISVGGNPVYLDKAEDYSKRINILFPIAVLVIGL
FT                   LHFEAFRSKQGLILPLVTALLAVAWGMGMMGLFKQPMDIFNSPTPILILAIAAGHAVQL
FT                   LKRYYEDFDRLIAQGMEPKAANSEAVVQSLVRVGPVMVLAGGIAAAGFFSLLTFNIPTI
FT                   RSFGIFTGIGIISTLVIEMTFIPALRSMLPPPSVVKVKRKGLPIWDWIPNRIGDVILSV
FT                   RPRMMLMTAIAAMGIFLAIGTSRIVVDNDSRNFFSRDLPMQQDDRFLNQSLGGTNSLYI
FT                   MVDTKVRDGIENPEILKAIDNTEKFANSIPEVGKTISIVDYIKRMNQAMNADQPQAFQV
FT                   PATKDIVAQYLLLYSMSGEPTDFESYIDTTQRYAKITILLKTGSNHRIKEILESLKTYM
FT                   AGQLGDKAVVSFGGDVTQTIALTETMVHGKLMNILQISFAVFFISALVFRSISAGLIVL
FT                   TPLLFSILAIFGVMGWLDIPLNIPNSLISAMAVGIGADYAIYFLYRLREILREEGGDIK
FT                   DAIRKTLSTAGKASLFVATAVAGGYGVLSLSQGFHVHQWLAMFIVIAMLFSVFATLIMV
FT                   PTMILILKPRFIFSSKKKSIPVAQTVVTSLLLGTALTMSMPKTSHADEVQDIVNRSDDA
FT                   SKFLSSTASAKFILTSKNGEQRVRLTKNMTKLAGNTQNNMRLTEFISPADVQGTTTLLI
FT                   ENAKGSDSMFVYLPALKKVRRLASANKGDAFIGTDFSYGDVLGYKLSDWKYTKLADGKF
FT                   NGKDCYMIEATPINNTVKSDFGYSKRRMCILKDNFVTATIDIWDTAGKPLKHIEFTDIR
FT                   PYGKVKPRWQAMKSMAKNLQTQHMTQVIVNDFAAEKTLSDKLFSPQSLEK"
FT   gene            145115..146389
FT                   /locus_tag="A1S_0117"
FT   CDS_pept        145115..146389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10604"
FT                   /protein_id="ABO10604.2"
FT                   /translation="MTQGAYWVFVCCSSFMLLQHTYADDSEMSFVSQNSARLDVWSSDR
FT                   DLSSLKNIGQASFWSNGTLKFNPAFKLHYDIVVSDETDHTVNPDQVSKVNRNLRELYAS
FT                   YNWDQTFYLDLGRQIVVWGRADGINPTDNLSPRDYTRLVPDETDQRLGNDALKLTYIPE
FT                   SGTNKWTALWYPRSRSDVIPLRQIAGVQYDIDRKSRPAFAMRWDYSVDGLDVGASYFSG
FT                   LDHMPDLSVLSASPTGEATLQLKNNPMSVYGFDFSYNHNDLVWRGEAAYTKTDSNGSED
FT                   LIHKKNNLTVVMGPEWSLKNSTLSLVGVYKHTEDFKSADNLTNLLVREVYRYQQTISDQ
FT                   YEQDQYGAMLRYALNLLNDNLKLEFTGFYFAPEPNELLRVRINYNLNDHWQLNAGGDRF
FT                   WGRNDTVLGQFRDNSLVYAQVRYNF"
FT   gene            146443..148308
FT                   /locus_tag="A1S_0118"
FT   CDS_pept        146443..148308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10605"
FT                   /protein_id="ABO10605.2"
FT                   /translation="MDNLNNAKKDNFSRKTILVTGAAGFIGSRLIVELLREGHQVIAAL
FT                   RNAATKKDKLLGFIATQGLADPSISFVEYDLSRDFKLDSLLSDAQTKIHVIYHLAASFN
FT                   WGISKAEAERTNIKSGLALIEWAATLKQLERFIWIGGYRVAAPPQESADELYCKHGGYE
FT                   ASKILGHQAFIEACKRLNVPWTAINPATVIDGFYNYGDMQCIGIADMIDKLYQGRLLAL
FT                   PGGRDTFLPLCNMQYIVSFLIRTMSYPETIAQEYMLLDPATPKFHRLVYLAAEHLGVSS
FT                   PHLQIPKVLLEKLPEVLLDGSKEQLSFISTEHYHVAGAEAMAAKMGITDLISIMPYFSR
FT                   WIDRLVFTRFGRMQVPTPNSFSYQNRYWTEIYTKQPVGSEKASALFLHGIPFDSACWSP
FT                   IINKITYDQVAMMDLPGLGRSGSYEMMEDNNHQFIDTAAELLAPNSVVIAHSLGCLFAL
FT                   NLAKKYPDKVARLILISPYFVQAQAAKMFQIQAISKLIFRFVPKDVIAKDLHPEGQQNL
FT                   SVRYAMDSLRRMSVSKHISEYMHHINLPQQRAAQTALLSELRSKIEIIVGEKDPIVTPI
FT                   SPEIPVHIIAGAGHNPHVTHVEAVYDYLTPVLTKYISTTAQLSDV"
FT   gene            148301..149065
FT                   /locus_tag="A1S_0119"
FT   CDS_pept        148301..149065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0119"
FT                   /product="Phosphopantethiene-protein transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10606"
FT                   /protein_id="ABO10606.2"
FT                   /translation="MSDIAQVQVYVCPVSRVPDNHLILSHYLSFLNAAEKLRYDQYHSH
FT                   AARLFLISRVLMKSVLSDKLGILPHEVIIQLQPNGKPFVRGNKAIYFNLSHSADLIVFA
FT                   VTEKREIGVDVERMNHEFEWRRVDSVLAPSEIEWIQQNEWTNPTSVYQRFFQIWTLKES
FT                   YIKCTGEGMSRHLKKLNFHVSPEHIQFCDLTNNDVQRTEQYHFKSYIYNYSFIFSLCLQ
FT                   QSHCLESFNIDCFQLLPYISTHRITLEPCEHN"
FT   gene            complement(149160..149235)
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0120"
FT   tRNA            complement(149160..149235)
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0120"
FT                   /product="tRNA-Gly"
FT   gene            complement(149281..149356)
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0121"
FT   tRNA            complement(149281..149356)
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0121"
FT                   /product="tRNA-Gly"
FT   gene            149587..149895
FT                   /locus_tag="A1S_0122"
FT   CDS_pept        149587..149895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0122"
FT                   /product="putative morphogenic pathway activator (BolA)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10607"
FT                   /protein_id="ABO10607.1"
FT                   /translation="MSLEQQLIERLQTLAPSHLEVINESAGHGGYFPGKESHFKVIVVS
FT                   EEFNGLRLVQRHQKVYALASDLMNPGQIHALAIHAYLPSEWQGQAPASPECAHAPKS"
FT   gene            149907..150299
FT                   /locus_tag="A1S_0123"
FT   CDS_pept        149907..150299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0123"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10608"
FT                   /protein_id="ABO10608.2"
FT                   /translation="MDAHLLTKLIHMTAVAAALMVFVLRASTLFIGVQGEQPNPAGRKV
FT                   LVALQHLSFTVVFITGAILLVMKNFQVQPWFYAKIILFLVLLSSLMKAFKKDDTILLAQ
FT                   RRAGLVISAIAFVAIIILVIVKPVFA"
FT   gene            150376..151218
FT                   /locus_tag="A1S_0124"
FT   CDS_pept        150376..151218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0124"
FT                   /product="putative chromatin partitioning ATPase (ParA
FT                   family ATPase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10609"
FT                   /protein_id="ABO10609.2"
FT                   /translation="MLTRVVFNQKGGVGKSSITVNLAAISAKHGLRTLVIDLDPQANSS
FT                   QYLLGEEATYAADKAVLEPNIENFFEDVLGNNQQKGLIGNALGSILKAPRNKDLDSFVH
FT                   STSFAKLDVLPASPTLGALEHALESKHKIYKLRDSIQSLIGRYDRIYIDTPPAFNFFTL
FT                   SALIAADKVLIPFDCDVFSKRALQTLIENVLETQDDHNDRLEIEGIVVNQFQSQAKLPR
FT                   EVVQQLKDEGLPVLNSMLPPSILMKESHQKNLPLAHLAPEHKLTQSYEALFSEIEPKR"
FT   gene            151229..151615
FT                   /locus_tag="A1S_0125"
FT   CDS_pept        151229..151615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10610"
FT                   /protein_id="ABO10610.2"
FT                   /translation="MKGLYIVPLAAATLLLGACATTVKPTYVSPTQYQSLSCQQLQSEY
FT                   NRIQQYIDNGVQTPKSTGMGVGLGLGGGWGRGGWGFGPSISVNMGQSSSTKNTELSRVL
FT                   GQQEAIVQAAQFKNCPIIVRKKTN"
FT   gene            151831..152421
FT                   /locus_tag="A1S_0126"
FT   CDS_pept        151831..152421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0126"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10611"
FT                   /protein_id="ABO10611.2"
FT                   /translation="MIESWFFVLAMLAVLLIPGPTNALLATAAHSQGLSKTFWLIPMEW
FT                   LGYAYGISFWAVFIHLADPVWPALLLILHITSVLYVFWMAFRLWKTTHLQQFSQNHRNI
FT                   RPRQLFFSTLKNPKSLLFAAGIFPAETWNSPENFLMVLAAFTLILIPAASFWMFFGRAL
FT                   LTGSMKKIKADHLYKGSAMLLILCMLPVVFRFF"
FT   gene            complement(152429..153070)
FT                   /locus_tag="A1S_0127"
FT   CDS_pept        complement(152429..153070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0127"
FT                   /product="putative integral membrane protein (DedA)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10612"
FT                   /protein_id="ABO10612.2"
FT                   /translation="MELLDFILHVDQHLAEFITNYGTWIYGILFLIIFVETGLVVMPFL
FT                   PGDSLLFAAGALAASTGTMDPWLLGILLFIAAVLGDTVNYHIGRFIGPRVFEMNSRFIN
FT                   KQHLIKTHEFFARHGGKTIIFARFIPFARTFAPFVAGAGSMNYKFFLTYNIIGAFCWVA
FT                   SFVTLGYLFGGHPLVKDNFTHLIFGIIIISILPGVIGFIRQKLKNRKANV"
FT   gene            153264..153701
FT                   /locus_tag="A1S_0128"
FT   CDS_pept        153264..153701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0128"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10613"
FT                   /protein_id="ABO10613.2"
FT                   /translation="MFNPNVVVKNIVTQPGADSFISLVARLLIAYIFLAAGWGKITGYA
FT                   ATAGYMEAMGVPGGLLPLVILVEFGGGLALLFGFQARFAAFGLGIFSILTAFLFHQGGA
FT                   DAAAQYNNGIHFMKNLAMAGGLFFLMLHGAGRISLDHAIEK"
FT   gene            complement(153760..154989)
FT                   /locus_tag="A1S_0129"
FT   CDS_pept        complement(153760..154989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10614"
FT                   /protein_id="ABO10614.2"
FT                   /translation="MLQTMIADFQQHFWLYVSIPFMSGLIGYVTKVIAIQMMFSPLEFK
FT                   GIKPFFGWQGIVPRKAEKMATTAVELMTAKLIKPEEIFARLDPKRIAKEIEKPLMAAAE
FT                   DITREVAQEYQPGLWEGMPEFARQRLIRRVQSKAPEIVEHIMSEVQRDVNRYFDIKHLV
FT                   ISNLLKDKRLLNNIFKRVGKQEFKFFSNVGFVFGFGIGVIQMLCWIATQGKYPWMLPLF
FT                   GGFVGFFSDWIALQMMFRPLYPKKILGYTWQGLFIKRQNEVAADYAALISKQLLTSRHM
FT                   MEELFSGTHSARVIELVNRHVKQEIDMQAGVIRPLVVYAIGGEKYQNMKTQVAERIMQQ
FT                   LPETMKYVESYAEDAMNIRNTLIERMQKLTPSEFEGMLRPAFKEDEWALIAVGAVLGFV
FT                   VGELQIQFML"
FT   gene            155365..156933
FT                   /locus_tag="A1S_0130"
FT   CDS_pept        155365..156933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0130"
FT                   /product="GMP synthetase"
FT                   /note="glutamine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10615"
FT                   /protein_id="ABO10615.2"
FT                   /translation="MTTNTQITEDRILILDFGSQYSQLIARRVREAGVYSEMYAFDMSE
FT                   EDIRAFKPNGIILSGGPESVHEEGSPRAPQVVFELGVPVLGICYGLQTMSEQLGGKVEP
FT                   GTVHEFGYAEVDIVKRDQLIGNLQDRENQLHVWMSHGDKVSQIPEGFTITASTPSCPVA
FT                   AVSDETRRFYGVQFHPEVTHTAKGEELLSNFVHKICGCGGLWTPEHIIDLRVEQLREQI
FT                   GNEKVLLGLSGGVDSSVVAALLHKAIGDQLTCVFVDNGLLRLNEGDQVMQMFAENMGIR
FT                   VIRADAEARFLNALAGVTDPEAKRKIIGREFIEVFAEEARKLDGVKFLAQGTIYPDVIE
FT                   SAASKQGKAHVIKSHHNVGGLPDDLAFELVEPLRDLFKDEVRKLGTTLGLPHSMIYRHP
FT                   FPGPGLGVRILGEVKKEYADILRLADDIFMQELRDSGWYDKTAQAFAVFQPVKSVGVVG
FT                   DGRRYAWVIALRAVETVDFMTARFAHLPYELVDKISTRIMNEIKDVSRVVYDVSSKPPA
FT                   TIEWE"
FT   gene            156999..157787
FT                   /locus_tag="A1S_0131"
FT   CDS_pept        156999..157787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0131"
FT                   /product="putative adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10616"
FT                   /protein_id="ABO10616.2"
FT                   /translation="MSDFIQLEYLQEKLQQLLAKSLFAIYLYGSAVDGGLGPESDLDVM
FT                   VVVTQPLTSALREQLAQELLKISQPVGELQRPLEVTILLKDEIQSGNYPLSYEMQFGEW
FT                   LREELKEGGTLNSQKDPDISILLRKARFHHTVLFGPALDQWAPEISDQELWQAMSDTYP
FT                   EIVAHWDEDADERNQILALCRIYFSLVMKDIASKDNAARWVMSQLPPEQKFVLQRLIQE
FT                   YRGEISKQNWQEEHYALQPIVNFLSSKIEEQFEQKRNLIT"
FT   gene            158006..158533
FT                   /locus_tag="A1S_0132"
FT   CDS_pept        158006..158533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0132"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10617"
FT                   /protein_id="ABO10617.2"
FT                   /translation="MRQQSEHHHAEHNDHHHGHHRSGRRGRLFEAGRMKLLVLHLIQQS
FT                   PKHGYEIIKEISDLVGDGYTPSAGTIYPTLTSLEEMNLINLLDVERKQYQITEFGEAYL
FT                   NEHQDKLSGLLEKLRLRREIHSNDQLIEIHRAMENLKTALRLKLNTTELKQEQIYQIAE
FT                   KIDQAAVAIGRL"
FT   gene            158594..158899
FT                   /locus_tag="A1S_0133"
FT   CDS_pept        158594..158899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10618"
FT                   /protein_id="ABO10618.1"
FT                   /translation="MKQHQYHVTVQHLKDAKGEVSTYTERLEFYTGNHDDIFEIVEKLK
FT                   NAEFFDDQTTKSFAVGLKLFSEVMLENRDHPLFQEFLPQFGQFMKNLKQQVKTQSP"
FT   gene            159056..160003
FT                   /locus_tag="A1S_0134"
FT   CDS_pept        159056..160003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0134"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10619"
FT                   /protein_id="ABO10619.2"
FT                   /translation="MSNNNDYDISDSKDCEKFANQFIQEFPIRSAEIGQGTVIKRALPS
FT                   RQKRMIGAWCFLDHAGPVTFPAGNGLDVGPHPHIGLQTFTWMIEGTMMHTDSLGSKQLI
FT                   RPKQVNLMTAGHGISHTEVAPDTETQMHAAQLWIALPDHKRNMDPKFEHYPDLPVVEKD
FT                   GLEFTVLVGEYLETTSPVVVHTPLVGVDLIATQDTKTRIPLNPEFEYGFMALDGVAHVN
FT                   GHELTADNMVVLDTGLNEIEIEVKKGNRVLLIGGEPFETPILLWWNFVARTMDDLKEAR
FT                   EQWVNHDVRFGEIPDYVGARLEAPVLPDQMRASK"
FT   gene            160000..160407
FT                   /locus_tag="A1S_0135"
FT   CDS_pept        160000..160407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10620"
FT                   /protein_id="ABO10620.2"
FT                   /translation="MTAVIASSKAKPLAEQWKGEITSGRHQYFCDEPEKLEGHDQGPAP
FT                   YDLLTGSLAACTLITLRMYAKHKGYDFGEYSVEIDFHTNREHEEHIERRIVFKELPNEE
FT                   LQQKILTICSKTPVTKTLLRSLDIHTVLVTA"
FT   gene            160519..161187
FT                   /locus_tag="A1S_0136"
FT   CDS_pept        160519..161187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0136"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10621"
FT                   /protein_id="ABO10621.1"
FT                   /translation="MISVHHLECSRSFRILWALEELGLDYDIHFYQRLPNYSAPETLKC
FT                   IHPLGKAPILTDDEQVIAESAVILEYLQQRYDQKQQFKPKQAQDLQQYIYWMHYAEGSL
FT                   MPLLVMTLVMNNVNKHVPWLIQPVAKKITEGVKANFVRPRMKDHISFLENYLAEHEYFA
FT                   GDFSFADIQMSFPLEALQSRLQGKYPHIQAFLHRIQQRPAFQKARQKGLGSNERNCADI
FT                   "
FT   gene            complement(161231..161857)
FT                   /locus_tag="A1S_0137"
FT   CDS_pept        complement(161231..161857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10622"
FT                   /protein_id="ABO10622.2"
FT                   /translation="MFGKTQRGVSERPNKPKKPLIPKWLGTLVAILAVLCIAVMLMLWK
FT                   PWQPVSSKNQITSEHYKEEETNKDYRFYDLLPQQQVTPIPEQAIPESKNQGTAMIVEAP
FT                   STAQPAASEPASVSTDDTTDSTAAIPQQPNYILQVRSYTDPDQADARRAEIILNGLSAD
FT                   VIKSSENGKTWYRVISGPYDTQEAALAAQQTLQHSGIDSIVIKRK"
FT   gene            complement(162014..163365)
FT                   /locus_tag="A1S_0138"
FT                   /note="contains frameshift; similar to arginyl-tRNA
FT                   synthetase"
FT   gene            164294..165991
FT                   /locus_tag="A1S_0140"
FT   CDS_pept        164294..165991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0140"
FT                   /product="NAD-linked malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10623"
FT                   /protein_id="ABO10623.2"
FT                   /translation="MISGHPSKHPLYIPYAGYTLLELPLLNKGSAFTQEERSNFNLHGL
FT                   LPHIIETIEEQSQRSYQQYCAFNDDINKHIYLRNIQDTNETLFYHLIENHLEEMMPIIY
FT                   TPTVGEACQRFSDIYRRHRGVFISYPDRDVIDDILQNVNKNNVKVIVITDGERILGLGD
FT                   QGIGGMGIPIGKLSLYTACGGISPAYTLPITIDVGTNNPQLLNDPIYMGWRQPRISGDE
FT                   YYDFVDMVIEAVKRRWPKALIQFEDFAQKNAMPLLEKYRDKICCFNDDIQGTAAVSVGS
FT                   LIAASRAAGKQLKDQTIAFLGAGSAGCGIAEQIVAQMVSEGLTDAEARARVYMVDRFGL
FT                   ITENQPNLLDFQRKLAQKAEVVDQWGNIEEVISLLDVVKNAKPTVLIGVSGQPGLFTEE
FT                   IIKTMAANCERPIVMPLSNPTSRVEAVPADIVEWTEGKALIATGSPFAPVNHHGKLYNI
FT                   SQCNNSYIFPGIGLGVVASGAKRVTENMLMASSSALADCSPLLKDPQADLLPPLGEIQQ
FT                   VSKVIAFEVAKAAMADGVAVTISDDLLNQKIDQSFWKPEYRKYKRIPF"
FT   gene            complement(166037..166957)
FT                   /locus_tag="A1S_0141"
FT   CDS_pept        complement(166037..166957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0141"
FT                   /product="putative dyp-type peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10624"
FT                   /protein_id="ABO10624.2"
FT                   /translation="MTAQSVILPLPSDHARFIVLRLKDLTIAELKEQLEALFETRDRLI
FT                   TQHSDAQIKTAVAFGPELWKQLYSQSPAGFKQLEPENGAFNMPVVPADVLIHIASMRSD
FT                   ICFALSQAFFEGIKDKVEVLDERVCFRYFDGRDITGFIDGTENPQFPDDRAETALLPES
FT                   AGVFADGSFIFAQRYAHDLEKWKKLKVDAQENVMGRTKLESIELDDDVKPENAHVARTV
FT                   VEDEEGEEMEILRHSLPYGDGRGDQGLFFIAYTKDLSIIDAMLKRMFGTSGDGIHDRLL
FT                   HFVTPLDGAYYFAPSEELLEEILEA"
FT   gene            167143..167742
FT                   /locus_tag="A1S_0142"
FT   CDS_pept        167143..167742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0142"
FT                   /product="homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10625"
FT                   /protein_id="ABO10625.2"
FT                   /translation="MLACWVISISPGAGAIASMSSGLNYGFRHGYWNAIGLQIALLIQI
FT                   MIVAAGVGVLFATTPLAFQAVKWFGVAYLLYLAYLQWRAPVKDIEIQHEKKDKSVSALL
FT                   FNGFVVNISNPKAIVFLLAVLPQFLDLSKPQWIQYLIMAATMVTIDLIVMAGYTGLASK
FT                   VLRLLRSPKQQKYLNRGFAVMFSCAALLLSTVHQAA"
FT   gene            complement(167744..168550)
FT                   /locus_tag="A1S_0143"
FT   CDS_pept        complement(167744..168550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0143"
FT                   /product="high affinity Zn transport protein"
FT                   /note="ABC superfamily membrane"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10626"
FT                   /protein_id="ABO10626.2"
FT                   /translation="MEWLQLLLPAWIMGTLLVFLTAPLGCLMLWRRMSFFADTMAHGTL
FT                   LGVAIAGALSLPLWLGVAGTAILLVAILWALHDNRLPNDALLALCSATLLCSGLLFIQH
FT                   VPSLRPELLSYLFGDLLSIDWPDLPIFTLIIAVSLAILYRYWQPQIQIAIDPDIAISEG
FT                   VNAKWQRLIFMLLLALFTVLALRAVGSLLMGALLVIPALSARLLAHSPKQMVIWAFVLA
FT                   QLGVSVGLWSSAALNISTGLSIVLCMALSFALIFMVQKIKNQTQAA"
FT   gene            complement(168557..169336)
FT                   /locus_tag="A1S_0144"
FT   CDS_pept        complement(168557..169336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0144"
FT                   /product="high affinity Zn transport protein"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10627"
FT                   /protein_id="ABO10627.2"
FT                   /translation="MPHSSLNPVLIQLEQVSVHRDQRDILKKVDFALHENEIVTLIGPN
FT                   GAGKSTLIKVLLGILKPSSGRVISNKKLKMAYVPQKFNPSHSLPLRVQDLLDLEKCSPA
FT                   LRQEIIQDTGIAKLQQSKVQQLSGGERQRVLLARALLRKPDILVLDEPMQGLDIQSEAE
FT                   LYEYVRSLPERYGCAILIVSHDLQWVMQGTQRVVCLNKHICCSGLPESIQQHPEYQAIF
FT                   GTQRVFYQHHHDHCAHGDAAHPCPHNSRPHIHPEPEA"
FT   gene            complement(169318..169803)
FT                   /locus_tag="A1S_0145"
FT   CDS_pept        complement(169318..169803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0145"
FT                   /product="transcriptional repressor of Zn transport system
FT                   (Fur family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10628"
FT                   /protein_id="ABO10628.2"
FT                   /translation="MHEHHDSLHGVHDHHNVASRLAEAETLCTAVGARLTPLRKEVLEL
FT                   ILNASGPMGAYDLLARIKSQTDRPAAPPTVYRTLDFLLEKGLIHRLTSINAYIPCCHPR
FT                   EGHQAAFLICTECHTVKEASSQGLTQQLDQLAALDDFAAQHSIIEISGKCQQCRTAR"
FT   gene            169979..170782
FT                   /locus_tag="A1S_0146"
FT   CDS_pept        169979..170782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0146"
FT                   /product="high affinity Zn transport protein"
FT                   /note="ABC superfamily peri_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10629"
FT                   /protein_id="ABO10629.2"
FT                   /translation="MSTLGWSQGLVVSTHPIYLIAKEITKGVEEPQLLLQGQSGHDVQL
FT                   TPAHRKAINDATLVIWLGKAHEAPLNKLLSNNKKAIALLDSGILSILPQRNTRGAALPN
FT                   TVDTHVWLEPNNAVRIGFFIAALRSQQHPENKAKYWNNANTFARNMLQAAQAYDSSSNG
FT                   KPYWSYHDAYQYLERSLNLKFAGALTDDPHVAPTAAQIKYLNDSRPKAQMCLLAESFTT
FT                   KGQYQKLGSITFQPVDESMNNEDNFVTAWKKLAIKTDKCVLNTQK"
FT   gene            170952..171350
FT                   /locus_tag="A1S_0147"
FT   CDS_pept        170952..171350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0147"
FT                   /product="ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10630"
FT                   /protein_id="ABO10630.2"
FT                   /translation="MSQTSRLIDRRLAKALVFLQACMIPVSALVAWSIKDMTAALSAAL
FT                   GALVCWLATSYFAWQSFRTAGARASKQVLSNMYRGMLGKFAIMIVGFILILSNVKPLSP
FT                   LALLFGFILVQAMSWVAPFWVSRLQKRV"
FT   gene            171455..172330
FT                   /locus_tag="A1S_0148"
FT   CDS_pept        171455..172330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0148"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10631"
FT                   /db_xref="GOA:A3M137"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M137"
FT                   /protein_id="ABO10631.2"
FT                   /translation="MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGF
FT                   TAIHLDSMGWSIGLGVIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGK
FT                   SRLIAPLALTIFVWIFLMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPSTDPN
FT                   ITLGMSLSVFVLILFYSIREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFL
FT                   ARPISLALRLFGNMYAGELIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTI
FT                   VYLSMASEKH"
FT   gene            complement(171598..171723)
FT                   /locus_tag="A1S_0149"
FT   CDS_pept        complement(171598..171723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0149"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10632"
FT                   /protein_id="ABO10632.1"
FT                   /translation="MIISIADWNFVGTPAFAALATIQNNKQKITPRPIDQPIESK"
FT   gene            172216..172389
FT                   /locus_tag="A1S_3487"
FT                   /old_locus_tag="AS1_3487"
FT   CDS_pept        172216..172389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3487"
FT                   /old_locus_tag="AS1_3487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3487"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89912"
FT                   /protein_id="ABS89912.2"
FT                   /translation="MGVICALGDLPHSCNHVAGIHLYDAYHRLLEHGKRKTLMVLPNCQ
FT                   TMVGLNFFNLIW"
FT   gene            172415..172660
FT                   /locus_tag="A1S_0150"
FT   CDS_pept        172415..172660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0150"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit c"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10633"
FT                   /db_xref="GOA:A3M139"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M139"
FT                   /protein_id="ABO10633.2"
FT                   /translation="MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELA
FT                   PQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG"
FT   gene            172699..173169
FT                   /locus_tag="A1S_0151"
FT   CDS_pept        172699..173169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0151"
FT                   /product="membrane-bound ATP synthase F0 sector, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10634"
FT                   /db_xref="GOA:A3M140"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M140"
FT                   /protein_id="ABO10634.2"
FT                   /translation="MNINLTLIGQAIAFAFFVAFCMKFVWPPLINAISERQRKIADGLN
FT                   AAEKAKADLADAQAQVKQELDAAKAQAAQLIEQANRRAAQLIEEARTQAAAEGERIRQQ
FT                   AKEAVDQEINSAREELRQQVAALAVTGAEKILNQQVDAEAHNAMLSQLAAKL"
FT   gene            173182..173718
FT                   /locus_tag="A1S_0152"
FT   CDS_pept        173182..173718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0152"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   delta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10635"
FT                   /db_xref="GOA:A3M141"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M141"
FT                   /protein_id="ABO10635.2"
FT                   /translation="MAELLTLARPYAKAAFAYASEQGATDNWSNALQVLSAAVQDEAFS
FT                   AYLNRPELTPAEQVKLFAKVLGEDQSQAVSNFLTLLADNDRLVLLPEIAAEYEQLKSQN
FT                   NNNVDVVIESAFPLTAEQEQLLKSALEKRFNSTVTVSVEVKPELIAGVVIRAGDQVIDD
FT                   SALNKLEKMRTRLLA"
FT   gene            173765..175309
FT                   /locus_tag="A1S_0153"
FT   CDS_pept        173765..175309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0153"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10636"
FT                   /db_xref="GOA:A3M142"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M142"
FT                   /protein_id="ABO10636.2"
FT                   /translation="MQQLNPSEISALIKQRIGDLDTSATAKNEGTIVMVSDGIVRIHGL
FT                   ADAMYGEMIEFDGGLFGMALNLEQDSVGAVVLGNYLSLQEGQKARCTGRVLEVPVGPEL
FT                   LGRVVDALGNPIDGKGPIDAKLTDAVEKVAPGVIWRQSVDQPVQTGYKSVDTMIPVGRG
FT                   QRELIIGDRQTGKTAMAIDAIIAQKNSGIKCVYVAIGQKQSTIANVVRKLEETGAMAYT
FT                   TVVAAAAADPAAMQYLAPYSGCTMGEYFRDRGEDALIIYDDLSKQAVAYRQISLLLRRP
FT                   PGREAYPGDVFYLHSRLLERASRVSAEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSA
FT                   FVPTNVISITDGQIFLETSLFNAGIRPAVNAGISVSRVGGSAQTKIIKKLSGGIRTALA
FT                   QYRELAAFAQFASDLDEATRKQLEHGQRVTELMKQKQYAPYSIADQAVSVYASNEGYMA
FT                   DVEVKKIVDFDAALIAYFRSEYAPLMKQIDETGDYNKDIEAAIKAGIESFKATQTY"
FT   gene            175387..176256
FT                   /locus_tag="A1S_0154"
FT   CDS_pept        175387..176256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0154"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   gamma-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10637"
FT                   /db_xref="GOA:A3M143"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M143"
FT                   /protein_id="ABO10637.2"
FT                   /translation="MANLKEIRAKVASIKSTQKITRAMQMVAASKMRRAQERMAQGRPY
FT                   ADNMRRVIAHLVQANPEYKHRYMVDRPVKRVGYIIVSSDRGLAGGLNINLFKKVVQHVK
FT                   AQQEQSIEVQFALIGQKAVSFFKNYGGKVLGATTQIGDAPSLEQLTGSVQVMLDAFDKG
FT                   ELDRIYLVSNGFVNAMTQKPKVEQLVPLAPAEEGDDLNRTYGWDYIYEPEAEELLNGLL
FT                   VRYIESMVYQGVIENVACEQSARMVAMKAATDNAGQLIKDLQLIYNKLRQAAITQEISE
FT                   IVGGAAAV"
FT   gene            176287..177681
FT                   /locus_tag="A1S_0155"
FT   CDS_pept        176287..177681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0155"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10638"
FT                   /db_xref="GOA:A3M144"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M144"
FT                   /protein_id="ABO10638.2"
FT                   /translation="MSSGRIIQIIGAVIDVEFERTSVPKIYDALQVDGTETTLEVQQQL
FT                   GDGVVRTIAMGSTEGLKRGLTVTSTNAPISVPVGTATLGRIMDVLGRPIDEAGPVATEE
FT                   RLPIHRQAPSYAEQAASTDLLETGIKVIDLLCPFAKGGKVGLFGGAGVGKTVNMMELIN
FT                   NIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVYGQMNEPPGNRLRVALTG
FT                   LTMAEYFRDEKDENGKGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMG
FT                   VLQERITSTKSGSITSIQAVYVPADDLTDPSPATTFAHLDATVVLSRDIASSGIYPAID
FT                   PLDSTSRQLDPLVVGQEHYEIARAVQNVLQRYKELKDIIAILGMDELAEEDKLVVYRAR
FT                   KIQRFFSQPFHVAEVFTGAPGKLVPLKETIRGFKGLLAGEYDHIPEQAFYMVGGIDEVI
FT                   AKAEKL"
FT   gene            177699..178118
FT                   /locus_tag="A1S_0156"
FT   CDS_pept        177699..178118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0156"
FT                   /product="membrane-bound ATP synthase F1 sector,
FT                   epsilon-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10639"
FT                   /db_xref="GOA:A3M145"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M145"
FT                   /protein_id="ABO10639.2"
FT                   /translation="MATMQCDVVSVKESIYSGAVTMLIAKGAGGELGILPGHAPLVTLL
FT                   QPGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQL
FT                   LANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ"
FT   gene            178267..178749
FT                   /locus_tag="A1S_0157"
FT   CDS_pept        178267..178749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10640"
FT                   /protein_id="ABO10640.2"
FT                   /translation="MKFKYWLPILVSTAFVGCASVPQANPQLAQQAKQLTAPTNGNAVI
FT                   YVYRSNNIVGSALKKDVWVDGECLGETARGIFFYKEVAGNQEHTVSTESEFSPNHLKFK
FT                   TEAGKKYFVQQYIKPGVFVGGANLKLVDDAQGQKAINEYRLAEAGKCSKATIALVN"
FT   gene            complement(178790..179389)
FT                   /locus_tag="A1S_0158"
FT   CDS_pept        complement(178790..179389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10641"
FT                   /protein_id="ABO10641.2"
FT                   /translation="MKKVLQGAFFPFVIFASGMLLLGCDQAQDHSKEQESVQTNDQISE
FT                   QADDSQQEITATQNKTELKNGNVFYIVRDAANLQLKAGDYIEKLKDTQLDVEQAIQDKD
FT                   QHELKTTVTTLKAQLEGLNQALLGLDIRSQEVENIRQSLLQANQQALSMPLLNGKLEQI
FT                   NFDQIEKQLNTIQMDMVKLAAMIMAGDEKSDSKTDS"
FT   gene            complement(179535..180080)
FT                   /locus_tag="A1S_0159"
FT   CDS_pept        complement(179535..180080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0159"
FT                   /product="glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10642"
FT                   /protein_id="ABO10642.1"
FT                   /translation="MTQSVYHIPVKAISGETVDLDQYKGKVLLIVNTASKCGLTPQYEG
FT                   LEKLYQAKKDQGLEILGFPANNFKEQEPGSDEEIQQFCSLNYDVHFPLFSKISVAGEDK
FT                   HPLYQALTTAQPERIGEGPFRERLEGLGIPTNPAPEVLWNFEKFLVNKNGEVVARFAPN
FT                   LTADDEQIVKAVEAELAK"
FT   gene            complement(180203..180967)
FT                   /locus_tag="A1S_0160"
FT   CDS_pept        complement(180203..180967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0160"
FT                   /product="putative transcriptional regulator (AraC family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10643"
FT                   /protein_id="ABO10643.2"
FT                   /translation="MKNEDQQFSLLESIEVHEFLYEKEDIVRPHASLWGDFNFSLNGIL
FT                   EIQVEEQIYLSPPSYGLWIPPQTVHQSTHIDHEIHYICIRLHPRLCSILGDICRCFSIQ
FT                   PFFRTLVLQILEQQKQTEKPEYLEHLLQVLFDQLQQASAYSHYLPQTRHPVLLPILEKL
FT                   SDPLLFNLSLQQLLQNFSVSDRHLLRLSQQELQLSLSEWRNRAKIVYAIHQIRQGTPIK
FT                   RLAYDLGYQHSSSFIEFFKRYTGQTPVQIRNN"
FT   gene            complement(180989..182203)
FT                   /locus_tag="A1S_0161"
FT   CDS_pept        complement(180989..182203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0161"
FT                   /product="putative transporter (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10644"
FT                   /protein_id="ABO10644.2"
FT                   /translation="MDQSTTSKARPMTSTQGSWFAILAVAIAAFALVTSEFLPVGVLNS
FT                   VAADLHISVGTAGLIITVPGIMAAIAAPLLPVSVKQLDRRYVLILLTAIMVIANTITAF
FT                   AENFHVLLLSRLILGISIGGFWATAIALSGKLAPANLPIAKATAVVMAGVTFATVLGVP
FT                   IGTWLSEFYGWRSAFGITAAIGLVVLVLQLIFLPKLLPESAIHIRDLPALLRTPKARSG
FT                   MLIVLLIGLAHFCAYSYLAPFFKNVAGFNGTTISSLLLLYGIAGIFGNAFAGYSGNLNV
FT                   RYTLAFVGTCFAIVFFGFPIFAIHEFGAIVLTALWGFAFGAFPTSANIWMFVHAPHAVE
FT                   KGMPLFVGMFQVMIATGSLLGGYVVDHFNENTLIYGVLSFVALALISTFTLAKGLNNPK
FT                   ATCEN"
FT   gene            182349..182990
FT                   /locus_tag="A1S_0162"
FT   CDS_pept        182349..182990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0162"
FT                   /product="putative regulator (TetR/AcrR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10645"
FT                   /protein_id="ABO10645.2"
FT                   /translation="MTNRHETDLVNEDTLKKKRGRPKCFDEQQVLEKAMLLFWEHGYEA
FT                   TSISDLTHALEITAPSLYSAFGDKAGLFYKSIDYYLAHEACPIETIFLEAKTAKIAFEL
FT                   YLYDNVKRLVQPNKPAGCMLVVAAMNCSDATQEVQQNLLDKRIKTKEKLLKRLEQGVEH
FT                   GDLPINAPLQEMTDFYATVIQGLTIQARDGASTEQLHKVVEHAMKTWTLF"
FT   gene            183252..183554
FT                   /locus_tag="A1S_0163"
FT   CDS_pept        183252..183554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0163"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10646"
FT                   /protein_id="ABO10646.1"
FT                   /translation="MTPFMFLSVWRQRRLVIPYLPKLAVLSAFGMVLYQGLAYTAAHYT
FT                   SATNMGIVNAFIPIFTIFVSLAILKDVPNRFAVFGSILSFAGLLYVMSQGILISF"
FT   gene            183656..184015
FT                   /locus_tag="A1S_0164"
FT   CDS_pept        183656..184015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0164"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10647"
FT                   /protein_id="ABO10647.1"
FT                   /translation="MTSLYVQIGFSVLFHLPLIFWFGLDALNAQNAPSAIYAGVFASLI
FT                   APLVWMLAVQQLGPNRTSIFMNLVPVFTAIIASIWLSEQWTIYHTFGGIMILVGIIMAQ
FT                   KKVNSKKSDLLPEQN"
FT   gene            complement(184407..184976)
FT                   /locus_tag="A1S_0165"
FT   CDS_pept        complement(184407..184976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0165"
FT                   /product="putative Sua5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10648"
FT                   /db_xref="GOA:A3M154"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M154"
FT                   /protein_id="ABO10648.2"
FT                   /translation="MITTSVTEAAECLQQGQVLAYPTEAVWGLGCDPFNEQAFQKILEL
FT                   KQRPIEKGVILLAGHISQVEHLLTSLPQTTQQEIIDCWTNHQPSERATTWLLPADQHIP
FT                   SWIKGEHPLVAVRVTTHPLCVALCNAFHGFIVSTSANPSGQEPAHSLQDACQYFGSQLN
FT                   YLNGDLGQSQQPSRIINALTGEVIRP"
FT   gene            complement(185027..186178)
FT                   /locus_tag="A1S_0166"
FT   CDS_pept        complement(185027..186178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0166"
FT                   /product="putative Rossmann-fold nucleotide-binding DNA
FT                   uptake protein (Smf)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10649"
FT                   /protein_id="ABO10649.2"
FT                   /translation="MLDVPFTMLTQLSSHHYHTLKVWYLVQHSLVSFKKIIDYFGNCEK
FT                   ATQPDGLAKWSSLGLHANHLKRVSEFQTPQGQTQFEQLVQQVVQHTDFILTPDDSGYPT
FT                   QLLPYTDHPPIIFGKGQAQALLQPQIAIVGSRKPSPHGRQVAYDFAYYLSEKGFFISSG
FT                   LAYGIDEAAHQGASAHQRTIAVTGTGLDTTYPAQNKKLAEHILAQNGAIITEFLPGTPP
FT                   LQQHFPRRNRIVSGLSLGVLVVEATLKSGSLITANKAAEQGKTVFAIPGHIYSEFHQGC
FT                   HQLIREGAILIDHPEQIIEDLALPTQWQSQQQNQTEEANTNTPEIPEHLIDLYQSLDWV
FT                   GQNIDQLVIHHNIPVSELTSSLMELELLGLCMQQSGLYLRCRS"
FT   gene            complement(186178..187332)
FT                   /locus_tag="A1S_0167"
FT   CDS_pept        complement(186178..187332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10650"
FT                   /protein_id="ABO10650.2"
FT                   /translation="MKKVFNGMVNFHALGIKKHLLALALCTGVAIGTIAEVHATSPNHN
FT                   PPSLKSNAPNVYVVKRGDTLWDISGHFLNKPWRWPEIWASNQHVKNPHWIYPGDRLLLC
FT                   SLDGRPLVGKDEGDGCVGIIRRYTGQTTNLQPQVRVEALNNSVPVIPLEHIKQWLENST
FT                   ILPADSITNTPYIVGTADQRVLAGKGQTIYARGQGLINGQRYAVYREGEPYYFTDNKGK
FT                   KHSLGIELLQVASGVAVSSEKDITTLELTDSYNAEVRRGDRVMPEEQATLPTLFYPVDA
FT                   KQVTDGGKIIRVMGSIGRAAKNSVVTLDRGTTQGVQVGQVFDITQQGESIRDPKTKEVI
FT                   QLPGQQIGSLMVFRTFDQLSYAYVLESDLPIKVGSSIQPPQFND"
FT   gene            187455..187985
FT                   /locus_tag="A1S_0168"
FT   CDS_pept        187455..187985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0168"
FT                   /product="Zinc(II) binding peptide deformylase 1"
FT                   /note="N-formylmethionylaminoacyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10651"
FT                   /protein_id="ABO10651.2"
FT                   /translation="MALLPILSFPDPRLRTIAKPVEEVTDEIRQLAADMFETMYAAPGI
FT                   GLAASQVDRHIQLIVMDLSESKDEPMVFINPKVTPLTEETQPYEEGCLSVPQIYDKVDR
FT                   PSRVKIEAINLEGQAFEIEADGLLAVCIQHEMDHLNGKLFVDYLSPLKRQRAREKVEKI
FT                   VRQREREKVAVKR"
FT   gene            188148..188450
FT                   /locus_tag="A1S_0169"
FT   CDS_pept        188148..188450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10652"
FT                   /protein_id="ABO10652.1"
FT                   /translation="MLKPKAQTEAMSHAMHHSHHQHHIEQAQVPDHHDHHDANHQCQYC
FT                   TVYANLVLPPEFGVKEVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA"
FT   gene            188523..190598
FT                   /locus_tag="A1S_0170"
FT   CDS_pept        188523..190598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0170"
FT                   /product="putative outer membrane copper receptor (OprC)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10653"
FT                   /protein_id="ABO10653.2"
FT                   /translation="MPHSKFLLQPLWVAMLAVSHSGLVFAESEKNDADTNTLHSLAPIV
FT                   VTAQQGNDANGLIVHADPKQPIQPVPATDGADYLQSIMGFNSIQSGGTNGDVTFRGMFG
FT                   SRIKILTDGTENLGACPNRMDAPTSYISPESYDRISVIKGPQTVQYANTGSAATVLFER
FT                   QPEKLTSEKPYRGQASVLLGSYGRIDHNIEAAVGDEKKYIRLNANRSESNSYQDGDGNT
FT                   VPSAWKKWNADVALGFTPDENTWVEITGGKSDGESLYAGRSMDGSQFARESLGLRFEKK
FT                   NITDVIKKIEGQVNYSYNDHVMDNFRLRIPPMTHDMMTHQMVVNPSEMQVTRRTLNTRF
FT                   AMTSEWGKLNVITGIDSQQNHHAESMKSLMMDMPLTTNMKFQSYGAFGELGYQLSENSK
FT                   LVTGARLDQVKIDALKLNDDRSETLPSGFIRLETQLPEHNAKSYIGLGYVERVPDYWEL
FT                   FSTAHGNSGMPKPTFNDLDTEKTLQLDMGYQHQHGAFNSWASAYVGLINDYILMSYHNH
FT                   PTSGGHGHGSSFSAGAKNVDATIAGAEAGIGYQFTDRIQADLSAMYAWGKNTTDDKPLP
FT                   QISPLEGRLNIRYVADKYNLGLLWRAVAEQNRVSLHQGNIVGYDLKPSKGFSTLSLNGS
FT                   YNLRKDIDVSVGIDNVLDKTYTEHLNKAGSAGFGFASEEQFNNIGRNYWVRMSMKF"
FT   gene            190652..190858
FT                   /locus_tag="A1S_0171"
FT   CDS_pept        190652..190858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10654"
FT                   /protein_id="ABO10654.1"
FT                   /translation="MTNKLSPEQSWWGWKLLIVASILSVLFMIIFYLAINNEPDYMPSQ
FT                   KKMQMMESHEQMNHAEMHSSSAQ"
FT   gene            complement(190755..190847)
FT                   /locus_tag="A1S_3488"
FT                   /old_locus_tag="AS1_3488"
FT   CDS_pept        complement(190755..190847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3488"
FT                   /old_locus_tag="AS1_3488"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3488"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89913"
FT                   /protein_id="ABS89913.1"
FT                   /translation="MNYAFQRDSFARVTPSSASFFDLACSQAHC"
FT   gene            complement(190928..192142)
FT                   /locus_tag="A1S_0172"
FT   CDS_pept        complement(190928..192142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10655"
FT                   /protein_id="ABO10655.2"
FT                   /translation="MQMISPTRLASFNDMQDSNFFTQFLNICCEKPVQPGYTEYVSLQH
FT                   ALYEGDIEMDKVIDWVMQNPKDHRIIFEKILFQGRDELSELIPTELENFFNYIEQKPEW
FT                   LDQRQIDEAVKFTHRLGINNGFILRDLSLMAGYLYPGFNQPLILTGALKKEAGTRLAET
FT                   TKWWVDITEPQGLSRLSAGFTSTIYVRFIHALVRRQLKKSDRWDSEVWGVPLNQFDLAM
FT                   TNLAFSSVVLLGIRALGIWPTKQEAKSFLHFWRYVGWLMGIDEKWLIQSEPEGWRLLYW
FT                   MQFAHPRSDHSSVELGSSLSKEPFERKYLHLRSLQQKLAYRQHLELTQFFIGKKRMKLL
FT                   GLPQQSASWFAYYLIVRNLLLYNGAKLSPKVEKFLSKSGRNIQKLGLTLYQNQGKAKTL
FT                   ASMHQ"
FT   gene            192230..192826
FT                   /locus_tag="A1S_0173"
FT   CDS_pept        192230..192826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0173"
FT                   /product="putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10656"
FT                   /protein_id="ABO10656.2"
FT                   /translation="MRKAPQQQRSKIIVDHILEATQQCIAQYGLLHTTTPKIAEKSGVS
FT                   VGSIYQYFENKNQIIEELLRRKSELLGQQLKELVIQQGNIPLELLIPLAIELGFNALKA
FT                   DHGFFIEVLKHWHDYSHSQAAQILEKHFFEVGLYTFSRNPHQWDFEQVKHKSFVIINST
FT                   LFTMMRYVSQNNFLISEQQLKRELSSMILAYLSQK"
FT   gene            193327..194855
FT                   /locus_tag="A1S_r01"
FT   rRNA            193327..194855
FT                   /locus_tag="A1S_r01"
FT                   /product="16S ribosomal RNA"
FT   gene            194916..194992
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0174"
FT   tRNA            194916..194992
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0174"
FT                   /product="tRNA-Ile"
FT   gene            195048..195123
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0175"
FT   tRNA            195048..195123
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0175"
FT                   /product="tRNA-Ala"
FT   gene            195464..198366
FT                   /locus_tag="A1S_r02"
FT   rRNA            195464..198366
FT                   /locus_tag="A1S_r02"
FT                   /product="23S ribosomal RNA"
FT   gene            198530..198663
FT                   /locus_tag="A1S_r03"
FT   rRNA            198530..198663
FT                   /locus_tag="A1S_r03"
FT                   /product="5S ribosomal RNA"
FT   gene            198805..199347
FT                   /locus_tag="A1S_0176"
FT   CDS_pept        198805..199347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0176"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10657"
FT                   /protein_id="ABO10657.2"
FT                   /translation="MQFKIIAAQDLDRNQRHQIAELCFSAFDEDPWTQYAFMQKAIHVV
FT                   GILNNQIVSHALWTDRVFTINGSSDVKTAYVEYVTTDYTMRGKGLATQLLKYLVEILTH
FT                   LEYELAALQPEDEAFYEKLGWTVWKGNLSIKQDTCSYLTDEYEIMLYPLNIQMKDQLSN
FT                   SSEEDTICADWREGELW"
FT   gene            199554..200552
FT                   /locus_tag="A1S_0177"
FT   CDS_pept        199554..200552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0177"
FT                   /product="cysteine synthase A/O-acetylserine sulfhydrolase
FT                   A subunit PLP-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10658"
FT                   /protein_id="ABO10658.2"
FT                   /translation="MSTDPQFPTPNNLGIAVYSNNAEAIGNTPLVRINRLIKTGATVLA
FT                   KVESRNPAFSVKCRIGAALIADAEKRGVLKEGMHIVEPTSGNTGIALAFVAAAKGYSIT
FT                   LTMPASMSLERRKVLKALGANLVLTEPAKGMKGAVDEAVRLATEQPEIYFLPQQFENPA
FT                   NPQIHVDTTGPEIWQATGGQVDILIAGVGTGGTITGISRYFEQVQNKPLYSVAVEPAES
FT                   PIITQTKKGENITPAPHKIQGIGANFIPKNLDLDLVDEVIPVSSEEAIQWARNCATQEG
FT                   ILVGISSGAALAAAAKIAERPENAGKTIVVILPDSGERYLSSVLFEGLFDE"
FT   gene            complement(200608..201189)
FT                   /locus_tag="A1S_0178"
FT   CDS_pept        complement(200608..201189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10659"
FT                   /protein_id="ABO10659.2"
FT                   /translation="MLTSSLAQDHFAPSQLQRLSLKFFIIALMTIMTGCTSLGPNSGSF
FT                   SWRSSKLSSGLQKAYSVPPSTANRLSPMIIQSADRYNVPPLLLAAVIRQESSYNSNARS
FT                   PTGAIGLTQIIPSYWQQTCAGNLYDESTNIQCGAYILNHYYQTADSWFKATAYYNVGPT
FT                   GYERSFWTRHKAKKYARSVKRHQKTLKSAL"
FT   gene            complement(201522..202088)
FT                   /locus_tag="A1S_0179"
FT   CDS_pept        complement(201522..202088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0179"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10660"
FT                   /protein_id="ABO10660.2"
FT                   /translation="MKTVAIIYHSRQGHTQFIAKQIQIGVLSHHNIKADLLNAEDLIER
FT                   PGILIQYDGLIWGSPTYLGGVSSKLKQLMDATGPLWKKQSFKGKLAAGFTVSSLPAGDK
FT                   QSTLISIFTFCMQHGMLWVGNPILPEQHQGVAYTQAANRLGSWSGLMAQAEQASNADGF
FT                   DEGDIKTAQQFGENFALTLNAYQGT"
FT   gene            complement(202105..202590)
FT                   /locus_tag="A1S_0180"
FT   CDS_pept        complement(202105..202590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0180"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10661"
FT                   /protein_id="ABO10661.2"
FT                   /translation="MNTSTLFFQALCLGIGATIVMDIWLLILKIFKVPTLNFAFLGRWV
FT                   GWIFQGKLVHQSIAKSTPIKGEYLLGWIAHYSVGIIFALSFLLIVGSTWLDHPQFYSAL
FT                   LFGLVTVLIPFFIMQPAMGSGFASSKTPHPFLNCLKSLLNHSVFGCGLYLTAKLFQI"
FT   gene            202672..203076
FT                   /locus_tag="A1S_0181"
FT   CDS_pept        202672..203076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0181"
FT                   /product="transcriptional regulator SoxR-family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10662"
FT                   /protein_id="ABO10662.1"
FT                   /translation="MDIGEVAKKAKVTTATLRFYEEKGLIKSIGRQGLRRQYGKQVIDQ
FT                   LALIALGRAAGFSLNEIATMFGQDGKPDLDRQKLKDKAEQLEQMAKRLHFISQGLEHAA
FT                   VCPAENHMECPTFQKFLKAAIAGEYQPTKL"
FT   gene            203224..204483
FT                   /locus_tag="A1S_0182"
FT   CDS_pept        203224..204483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10663"
FT                   /protein_id="ABO10663.2"
FT                   /translation="MSKKTLIALLCCASLGLTACNDDNDQDQTSPTENVTEPTLISFAK
FT                   LPVETYAAGPDSGAYVKGANGIYPPFKGQPVQGFSAALKNEDGSYMAMADNGFGTQDNS
FT                   SDFLLRIYKIKPDFKTKTKGTGQVTVQSFIQLRDPNKLIPFNIINGNTPERLLTGADFD
FT                   PESMQRTSDGTYWIGDEFGPYLLHFSADGVLLDAPIPLPNPLNPTQELRSPQNQFNKAQ
FT                   INFVEPLVQQSGGFEGMAISPDGQYLYPLIEKPIKSIRETERQLLISQFDIKKKAYTGK
FT                   YYWFQLDSKATNIGDFQLFNDKEGIIIERDATQNNLGGYKKLIRIKLNESGQLVSREDL
FT                   VDLIKIANPNMLYGTARAGDIGMGQVFAFPFETIEDVIIENGTTLTVFNDNNFPGSTGR
FT                   NAKLADDNEIIQIRLPKALF"
FT   gene            204698..207076
FT                   /locus_tag="A1S_0183"
FT   CDS_pept        204698..207076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0183"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10664"
FT                   /protein_id="ABO10664.2"
FT                   /translation="MSTAYTMQTAPKALFDYDKYWASCFEPAPFLPMSREEMDQLGWDA
FT                   CDFILVCGDAYIDHPSFVSGVIGRVLEAQGFRVGIIAQPDWTNVESFRVLGKPTIAWGV
FT                   TAGNMDSMINRYTADRKIRSDDAYSPNNEPNKRPDRAATVYCQRCREAFPDVPVLLGGI
FT                   EGSLRRIAHYDYWSDKVRRSILMDSKADMLMYGNGERAIIDVMHRLAKGEKIHEITDVR
FT                   GTAFIINKHNKAAKAKFVEIASNDVDTIGRVDPIINPYVMTEDIDGCEIEKDKGNTLAQ
FT                   YQGFQKEIVANPIVREGDQLDENTQIVQLKPAQSKAIKHKLPPRELAVIRLPSFEEVAN
FT                   DQVLYAHANRILHLETNPGNARALVQRHGERDVWINPPPIPLTTEEMDYVFDLPYARLP
FT                   HPAYGDARFPAFDMIKFSVNIMRGCFGGCTFCSITEHEGRIIQNRSEDSILREIEKIRD
FT                   TAPNFTGIISDLGGPTANMYRLHCKDPEIEKNCRKPSCVYPGVCQNLHTDHAPLVQLYR
FT                   KARAIKGVKKILIGSGLRYDLAVLNPEYVKELVQHHVGGYLKIAPEHTEQGPLSKMMKP
FT                   GIGTYDRFKQMFDRFSKEAGKEQYLIPYFIAAHPGTSDYDMMHLAIWLKKNGFRADQVQ
FT                   TFYPSPMATATTMYYSGKNPLAKVARYTENVDIVKGEKRRRLHKAFLRYHDPNNWPLLR
FT                   EALKEMGRADLIGNSKQHLIPTYQPKGAEGEYKSARKKNSTVAGDSVKRSGQTVQNKNQ
FT                   HKRPQKGQVLTQHTGLPPRETGEKRPFGGKSKPKSKARG"
FT   gene            207390..207890
FT                   /locus_tag="A1S_0184"
FT   CDS_pept        207390..207890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10665"
FT                   /protein_id="ABO10665.2"
FT                   /translation="MYYLITILLLFLTVVMAAKSLSRKHQQDSALKRRAVLSSHEQMTL
FT                   TRLQTVLPKFTVLAHVSFDALLTTKYAHTRLKYQNMTADFVVLDQNYQVVVVVMLEESG
FT                   LRRAHQQYERRLLQLAGYRVLSYSTVPDYHELRRDLLTPESEMATLLATPQLERISNAF
FT                   VKS"
FT   gene            complement(208036..208389)
FT                   /locus_tag="A1S_0185"
FT   CDS_pept        complement(208036..208389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10666"
FT                   /protein_id="ABO10666.2"
FT                   /translation="MTVKRLHVTSRYCEVAISGNLVHLAGQLADDTSVDITAQTQQTLD
FT                   NIDRLLAEAGTDKSHILSVMIFLKDIDKDYAAMNTVWDAWISKEHPPARTCVESKLYAP
FT                   DVLVEMTVVAVLP"
FT   gene            complement(208493..208600)
FT                   /locus_tag="A1S_3489"
FT                   /old_locus_tag="AS1_3489"
FT   CDS_pept        complement(208493..208600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3489"
FT                   /old_locus_tag="AS1_3489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3489"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89914"
FT                   /protein_id="ABS89914.1"
FT                   /translation="MPKQPLLSAYRPVIGVTTKSEYYRALKVHGACPFL"
FT   gene            complement(208710..209765)
FT                   /locus_tag="A1S_0186"
FT   CDS_pept        complement(208710..209765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0186"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10667"
FT                   /protein_id="ABO10667.2"
FT                   /translation="MRKIIHIDMDAFYASVELRERPDLRHLPVVISSHHPRAVIAAASY
FT                   PAREFGLRSAMSMSQARKLCPQVVIIEPNFEKYRAISAQIHSIFQQYTTLIEPLSLDEA
FT                   YLDVTENLKQIASATEVAMHIREDIFRQTGLTASAGVAPNKFLAKVASDWNKPNGLFVI
FT                   KPSQVASFIQDLPLKKIPGVGKVTQEKLQQLELHTLGDLQKIEEAVLVHHFGKYGQQLY
FT                   LYAQGIDNRPVQAERARQQISKETTFDSDFTLAQCQPYWHGLAEKVWQSLEKKQLNARG
FT                   VNIKLKLKNFQTLQHSKSFKNPIHSQQDLIQVLFLLLNEMHIPENFQFRLIGIGVYQLQ
FT                   TKADDFQLSLW"
FT   gene            complement(209767..210525)
FT                   /locus_tag="A1S_0187"
FT   CDS_pept        complement(209767..210525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0187"
FT                   /product="putative lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10668"
FT                   /protein_id="ABO10668.2"
FT                   /translation="MTKLAKTFSAPRYNTLIGIVLACVMGVLTYFGLFYQQKAIAQDYP
FT                   VQGFDVSHHQENINWKKISPQKFQFVYLKATEGGDYKDPKFQENWLKAREHGFHVGAYH
FT                   FYRLCRDGKTQAENFIATVPNKVDALPPVIDLEYDSNCINSHTKEQLLKEIGIMHDSLK
FT                   HHYGKQPIFYISKTFYHIVLIGSFPNTPLWVRDYEGKPELKDKRKWLFWQHSNQGKIEG
FT                   MTKPVDLNVYEGSVKEWHQFLQQQGIVKAQ"
FT   gene            complement(210603..211994)
FT                   /locus_tag="A1S_0188"
FT   CDS_pept        complement(210603..211994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0188"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10669"
FT                   /protein_id="ABO10669.2"
FT                   /translation="MNATPTHQALQPEYRLLVLLVSIGFFMQALDTTIVNTAIPAMAHH
FT                   LNEDPLRMHSVVVAYVLSVAACIPLSGWLADRFGVRNTFLSAIIIFTLASLGCGLSQSL
FT                   NELLFFRVIQGVGGALLLPVGRLSLLKIIPRTQFLAAMSLMSLAGLLGPLAGPTLGGWL
FT                   VEVATWHWIFLINIPMGVLGILMTLKVMPNVKEPTVKTFDLIGFVLLVVAMIGWSLGIE
FT                   HLASPEYSKWFSISLLVVGVIATLWYAYHSHTHQNALFRSRLFRNKIYAIGILGNFFAR
FT                   FGGNALPFVLPLMLQVAFGFEPFIAGLMMIPLVLGSLFSKPIVRPIIQKMGYRRFLLIN
FT                   TTLVGLCIASFAIMTVDTPTWFRALHFFLFGTLNSLQFVGMNTLTLKDLPQQDASSGNS
FT                   FLSMIMMLSMSIGVALAGTLINIFTDYYGTAHVTTAFHVTLICLGCINIITALIFWQIP
FT                   KNTPV"
FT   gene            complement(212192..212815)
FT                   /locus_tag="A1S_0189"
FT   CDS_pept        complement(212192..212815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10670"
FT                   /protein_id="ABO10670.2"
FT                   /translation="MNSVLTMAVNDSPITSVKTTQPLIALYCGSRAGNNPIYREKAIEL
FT                   ASGIAEQGFGLVYGGASIGLMGQVAESVLAHGGEAVGVIPEFMLDYEVAHAGLTELHVV
FT                   ETMHERKAMMAERASAFIALPGGLGTFEEILEIATWGQLNQHQKPMILYNVNGFYNALI
FT                   AQLDHAVQEGFLPLQHRAKLIVCEEIDQIYNVIKNLKMPKRFVV"
FT   gene            213142..214734
FT                   /locus_tag="A1S_0190"
FT   CDS_pept        213142..214734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0190"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10671"
FT                   /protein_id="ABO10671.2"
FT                   /translation="MIFEWMSDPSAWVGLATLIVLEIVLGIDNLVFIAILAEKLPPEQR
FT                   TKARIVGLILALGMRLILLASIAWVVTLTQPLFHIFSHPFSGRDLILLFGGVFLLFKGT
FT                   MELHERMEGKQLHKEDNPVHAAFWMVIVQIVVLDAVFSLDSVITAVGMVKELSVMMVAV
FT                   VIAVGIMLWASRPLMDFVNKHPTVVILCLGFLMMIGFSLVVEGFGFHIPKGYLYAAIGF
FT                   SILVEMINQTMRRNQEKLVTTTDLRYRTASAVLRMLGSKNSGSTSDAQTADKEDVLATQ
FT                   AFADEVFDEENGAYHSVLVQGVLGLSERPVKSVMTPRPELEWIDLDEEPEVLKERLMSM
FT                   THSRLIVARGELDNIEGIALTHKVLNGFIETGVIDFQKHLREPVIVHENAQVLMVMEQL
FT                   RQAPLQMAIVLNEYGSIEGIATPIDILEAIAGEFPDEDELDAAAESLEDGSLILEGSTD
FT                   IRHVSLLLGRDLVDESEQYSTLSGYLLFHLGRLPENGETVEADGYRFEVVTMEGHKIEK
FT                   VHIVSIEQDESKD"
FT   gene            214806..215273
FT                   /locus_tag="A1S_0191"
FT   CDS_pept        214806..215273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10672"
FT                   /protein_id="ABO10672.2"
FT                   /translation="MTQQTCPCGKGSYAECCEPLHLGTTKALTAEQLMRSRYSAFALQQ
FT                   IDYIVQTTALGQQTALDKEAIAEWSKQNQWLGLEVVNANKKLDKTHAQVEFKAHYHDGK
FT                   SAQIHHEVSHFVFHQQQWFFLDPTVDMQVTMKQPCICGSGKKIKQCCAQFL"
FT   gene            215319..215963
FT                   /locus_tag="A1S_0192"
FT   CDS_pept        215319..215963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0192"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10673"
FT                   /protein_id="ABO10673.2"
FT                   /translation="MLLTVIYIIAITAEAMTGALSAGRRSMDWFGVVLIACVTALGGGS
FT                   VRDVLLGHYPLTWVKHPEYLVLTCCAAFVTIVIAKWMRHLHNIFLVLDALGLIGFTIIG
FT                   CQIALQMGHGFVVSAVAGVLTGVSGGILRDILCNDVPFVFRRELYASISFVAVICYWVC
FT                   LDLGLSLELTVISTLVFGFTLRLIAIYFGLEMPKFIYKDDDAESASSTDEH"
FT   gene            216046..217365
FT                   /locus_tag="A1S_0193"
FT   CDS_pept        216046..217365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0193"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10674"
FT                   /protein_id="ABO10674.2"
FT                   /translation="MDLVSRIQNLPIGKFHYTLLWVVGLGWMFDAMDTGIIAFIMTTLV
FT                   KDWSLTPAESGWIVSIGFVGMAIGAVCSGALADRFGRKTVFAMTMAIYSIATALCAFAP
FT                   DLKWLLIFRFIVGLGLGGQLPVAVTLVSEYVPAHVRGRFIVLLESFWGLGWLVAALISY
FT                   FIIPKFGWHIAFLIGGLPLIYILVIWKKVPESIPYLINRGRIEEAHALVQKLEAEACVQ
FT                   IVHHIEVVPVAMRQKVSFKQLWSGQFARRSLMLWLIWFGIVYSYYGIFTWLPSLLVKQG
FT                   YDIVKSFEYVLLMILAQLPGYLAAAWFVERLGRKITLAAFIGFCALSAYFFGQADSVNS
FT                   IMFWGCLMSFFNLGAWGVLYTYTPEQYPANIRAFGSGWASAMGRIGGIVAPMVVTHMMV
FT                   AKNGFNHVFMMFTVVLLAVALVILILGEETQGKRLESIGL"
FT   gene            217597..219737
FT                   /locus_tag="A1S_0194"
FT                   /note="contains frameshift; similar to DNA gyrase"
FT   gene            220176..221716
FT                   /locus_tag="A1S_0196"
FT                   /note="contains frameshift; similar to acyl-CoA synthetase"
FT   gene            complement(221758..222141)
FT                   /locus_tag="A1S_0198"
FT   CDS_pept        complement(221758..222141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0198"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10675"
FT                   /protein_id="ABO10675.1"
FT                   /translation="MQQPDQKELFEVLEKQKNNQLQVDRIFKIVLPIVAFLLSVICANF
FT                   NWQSTLGTFVILTVTFMAVGVKRLPLWHWLIVITIYCLVDNYLSYGQLDVTHLRLQLGT
FT                   MLVFVGMVGIGRPYVDRWFMKNH"
FT   gene            222248..222646
FT                   /locus_tag="A1S_0199"
FT   CDS_pept        222248..222646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0199"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10676"
FT                   /protein_id="ABO10676.2"
FT                   /translation="MHGISSIIYIILVACLLPYAFTVIAKFTGGFQPVDNQNPRDFLAN
FT                   TKGIAARANAVQQNSFESLPLFLTAILMAEYMVVPEYFILRLGWAYIILRVIYGICYLS
FT                   NWATLRSIVWFLSLLCPIFLLIVTIKLT"
FT   gene            222774..223301
FT                   /locus_tag="A1S_0200"
FT   CDS_pept        222774..223301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0200"
FT                   /product="inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10677"
FT                   /protein_id="ABO10677.2"
FT                   /translation="MSYSNIPAGKDAPNDIYVIIEIPANAAPIKYEIDKDSDALFVDRF
FT                   MGTAMFYPANYGYVPNTLSEDGDPLDVLVVTPHPVAAGSVIRCRPVGKLNMEDDGGIDA
FT                   KLIAVPHEKLSPLYKDVQEYTDLPPLLISQVEHFFSHYKDLEPGKWVKISGWEGADVAK
FT                   AEVLKAIEAAKK"
FT   gene            complement(223408..224682)
FT                   /locus_tag="A1S_0201"
FT   CDS_pept        complement(223408..224682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0201"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10678"
FT                   /protein_id="ABO10678.1"
FT                   /translation="MLKAQKLTLAVLISAAIISSAQASEQSEAKGFVEDANGSILFRTG
FT                   YISRDKKDGRADNSSFAQTAIVNIDSGFTPGIVGFGVGVVGDGSFKIGENKNAGNNMIP
FT                   QHNDGSAYDHWARGGANVKARFSNTTVRYGTQVLDLPVLASNTARLVPEYFTGTLLTSH
FT                   EIKDLEVVAGKFTKNQYSDQIATDQNGLDRAVVWGAKYKFDDQISGSYYGVDVKDKLDR
FT                   HYVNVNYKQPLANDSSLTYDFSGYHTKFDKGANLSYATGPADEDKTNNIWAISGTYATG
FT                   PHSVMLAYQQNSGNIGYNYGVNQDGGQSVYLPNSYLSDFIGNDEKSAQIQYSLDFGKLG
FT                   VLPGLNWTTAYVYGWDIKTSNGADDSNESEFFNQVKYTVQSGFAKGSSLRLRNSIYRAD
FT                   NAYTTDYMPDTNEWRIFLDIPVTLF"
FT   gene            225607..226428
FT                   /locus_tag="A1S_0202"
FT   CDS_pept        225607..226428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0202"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10679"
FT                   /protein_id="ABO10679.2"
FT                   /translation="MMKFALKAVTFGVLTAGSTMVMAEDAPSFYGITATGSVAATTDYR
FT                   FRGVTQSSNNPAIQGGFTFSHKSGAYLSLWGSSVDFGVTGNSTETDVALGYTNTLKLSD
FT                   TLAPTYDVGIIHYGYIGAGHSFDRNGIGYDGKNGLDFNEVYGKLTFANSLLKGDAISVG
FT                   VNYSDDYWANSKQFWYFNIGYSAPIADTGFTGLASVGYNKFKNKDALAVVAGGPGKDDS
FT                   YIDYKVGVNYNILGIVAELDVVGTDISTSGMTDAQKKPYDTGLVFSLTKTF"
FT   gene            complement(226471..227355)
FT                   /locus_tag="A1S_0203"
FT   CDS_pept        complement(226471..227355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10680"
FT                   /protein_id="ABO10680.2"
FT                   /translation="MKLNGIIGYPVTPFSDDNTTQSSCSKTNAGFRLIENRSATRLQPL
FT                   GSTGESAYLEWDEWCLVAKTSIESINKRVPVIIGISELTTNQAIKKAQIAQSYGADALM
FT                   VIPVSYWKLTDQEIFEYYQAIAQATTLPIMIYNNPATSGVDMSPELMVRMFNNIANIMM
FT                   VKESSGDIQRMHKIYELSKGELPFYNGCNPLALEALCAGASGWCTAAPNLLGQRPQQLI
FT                   EYVKNGELEQAQKSFYQQLPLLRFIVSGGLPKTIKAGLQLKGVAAGAPRKPLTKATDIE
FT                   LNQLKQLLSEIEN"
FT   gene            complement(227371..228147)
FT                   /locus_tag="A1S_0204"
FT   CDS_pept        complement(227371..228147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10681"
FT                   /protein_id="ABO10681.2"
FT                   /translation="MKTASVNKHDLMQHAQQDMQKWISDLDLTDRQKLALTCRILFDHG
FT                   HDAGLAGQITCRSENKETFITQRFGLGFDEITASNLLEVNQDLEPINQEGMANPANRFH
FT                   TWIYKEHPEVNCIIHTHPTYVAALSMLQIPLMISQMDVCALYEDCSFIGHWPGVPVGNE
FT                   EGILISSALDKNRAVLLSHHGQLVTGKTIEEACNLALLIERAAQLQLLAMSAGQIQPIP
FT                   HALAAEAHDWVSTDKRNKVNFAYYARKALKKHSDCI"
FT   gene            228259..229671
FT                   /locus_tag="A1S_0205"
FT   CDS_pept        228259..229671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0205"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10682"
FT                   /protein_id="ABO10682.2"
FT                   /translation="MLRPWQIHFRIDEREEKTVFLKLTNLISQEILSGRLVQGTMLPGS
FT                   RSLSKELGINRKTVQAVYEELEAQGWLVTRPRKGTFVADVLPEKKPHIEPRADRKVSNK
FT                   PIIQQVAQRPHNDGVPDPRLIPYELFSRAYRHALIKITQNQYMGYGDPRGMAELRQALK
FT                   QMLSMERFMNVAEDEICVVRGSQMGIFLASRALPNRQGVIVVEELYYPSAVKAFQSNGF
FT                   QVVSVKLDDQGIVIEDLERILKEHSVAAIYTTPHHQYPTTVTMTMSRRLQLLELSKKWG
FT                   FYIIEDDYDHEFHYDSRPMPPLASLPHSELVIHVGSLSKVFAPGIRLGYIVAAPTIIQT
FT                   ITEDILLIDRQGNNITELALADLMQRGEIKRHIRKMKKIYQLRRDHALAEFQRVFAESI
FT                   EIQPPAGGMALWVKFQKSFTQDQLIKLKELNIDTEQKFKQKECANHCIRFGFAALSEKE
FT                   ITSLIETLNEAL"
FT   gene            complement(229711..230172)
FT                   /pseudo
FT                   /locus_tag="A1S_0206"
FT                   /note="nonfunctional ATPase due to insertion"
FT   gene            230516..230968
FT                   /locus_tag="A1S_0207"
FT   CDS_pept        230516..230968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10683"
FT                   /protein_id="ABO10683.1"
FT                   /translation="MKKLSDEYLPVRKAQTVYGSISGNYAFRGEKTIWFESTLERDFIL
FT                   KQEFNNNVIDVIGQPVVIPYITELGNQSTYTPDFLVQFSSSNCDDFEDFPVPMLIEIKP
FT                   KKKLVEDWDKLKPKFRAAHRFAADKGWKFKIISETRLYVGLTHYHL"
FT   gene            complement(230959..231921)
FT                   /locus_tag="A1S_0208"
FT   CDS_pept        complement(230959..231921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10684"
FT                   /protein_id="ABO10684.1"
FT                   /translation="MTEPNSISCTQLAETYNISHDSVNRFLEREDYTPHDLYQEAIQHI
FT                   DNNKLIVSIDDTVLDKPYSQHMDLVSYFWSGKHHRSVKGINLITLYATDQNGQNIPINF
FT                   RIYDKSESKTKNDYFMDMLSEVLSWGAKIQFITGDSWYSSTGNLKTIRKYGIRFMFGID
FT                   CNRKVSPEKGQLFQLRLLPDFHQGQVVWLKDFGFVQLFKTQLKEQQRFYIVHQDEDDLL
FT                   SFEGFHELHSSHWKIEQYHRVIKQVCHIEKFQVRRSKLILNHIFSALMAYVEIQKNQFE
FT                   GIFENVYRWQKKLFRPIIKDFIDDFILDKNHLLPQRIYK"
FT   gene            232390..233127
FT                   /locus_tag="A1S_0209"
FT   CDS_pept        232390..233127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0209"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10685"
FT                   /protein_id="ABO10685.1"
FT                   /translation="MVVGYEGNPYKIVNVLNANDIVISSLDSVRSLQVNSKSLTVFEGE
FT                   NTLTENLNKGDKDISNEAWQIALQRYEIIKPLIEYSTTELVENRANEYDVNRSTLWKWL
FT                   RDYRENNSLMTLIPKKRGWTTEKSRLSPQVSNIIKQAINDEYLNAKKPSISKTIEIVKA
FT                   ECSRLQLEAPHENSIRRRIEALNNYQVTKARLGSKAAIDKFKAAAGSFPNADYPLAYVQ
FT                   IDHTPLDIESWMTSLEKRLENLI"
FT   gene            233154..234242
FT                   /locus_tag="A1S_0210"
FT   CDS_pept        233154..234242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0210"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10686"
FT                   /protein_id="ABO10686.1"
FT                   /translation="MIVGYYLSLEAPSTTSVAMCIASCILSKKRKLIELDIDAEWQVEG
FT                   IMDSVHTDNGPDFRTNHISKACLKYGIHWEYRPIGGARFGGHIERMLGIVNLEMHVLDG
FT                   TTFSNVQQRGTYDSAKQACMTLKELEYYIVYWITKVYHQKKHSALGTSPIVKWEEGVWG
FT                   TKTTAGTGLKERVSDEDTLFIDFLPEFEATIQRTGVQKDNLFYFADCLRQWVNSIDPED
FT                   NNRKRKRKFLFKRDPRDISQIWFYEPYSNTYFKVPTAKREIPPISLFEYKQVQNYLKSE
FT                   RQDVQNQDEIYKAILHLRDQLNQARSLTRKQRRSNQRKKENAKAITQLSEQNQSKKAVV
FT                   SESLQTSDDLWSTPLTAFDDLR"
FT   gene            234247..235167
FT                   /locus_tag="A1S_0211"
FT   CDS_pept        234247..235167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0211"
FT                   /product="Transposition Helper"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10687"
FT                   /protein_id="ABO10687.2"
FT                   /translation="MEKYEHLAEHVLEIMQLSDSERIETLFTDRWIGYKKAITIMNTLT
FT                   DILNRPRKLRPECLLIVGDSNMGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLPILA
FT                   PAKANVKELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCLTGSA
FT                   KLLPEVMNTLKNLSNELSLNIVGVGTREAITILHTDPQYASRFDVVNLPKWELNQDFLR
FT                   LLVSYVRLLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGDEEITYD
FT                   IVHKFKWLKPTEGLRNIRNINLSLS"
FT   gene            235197..236312
FT                   /locus_tag="A1S_0212"
FT   CDS_pept        235197..236312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10688"
FT                   /protein_id="ABO10688.2"
FT                   /translation="MSQPEQCWYIRTPIQQGEIFSSWLIRSALDVGCSPMVLIEALWGK
FT                   WRALTIDLDKGVDAERFDALLSHSMESKQKIQQSMLSSVVSQIQPNYDSNQNIPWVLSL
FT                   GTRNRSNTSGRQVCVECLKSHENPPYLRLMWRIGWHCSCVEHQLSLIDHCPECGVTIQP
FT                   FKADMEHGCLAICTTCGFDLRRCEESKNINLNALNFQNKAEQVLKQKIGFYNQSPVTTQ
FT                   VWFEIARSWLSEIRFLVNTPNKNVIQLFESFDVNLHLSHPVTPLAFEYLSTQERIVLLS
FT                   MLDQIMDIPCDLLVQRSKEYGVSRANFWDKRKKLPVQLQQMKDLMIKPTRRYPVSRAAI
FT                   TVTKPKSKATVQRQWLNLLRRSNNSGAMHID"
FT   gene            236821..237735
FT                   /locus_tag="A1S_0213"
FT   CDS_pept        236821..237735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10689"
FT                   /protein_id="ABO10689.2"
FT                   /translation="MIAAGCADLCDDCYWHQNLWNKFDQNQKVFESSDLKQQYENYIGW
FT                   LEKKVGSHKAALYINKHTHFFIKTEIDWNQSVPTPKQLLVRLRSSGLRKFELVMQWLEE
FT                   VHDIRIDMDNKKSCSERDQMEKLVQRILQPSLAYDVVLEYKNKLEEKIKRGETSIRSAR
FT                   LAVKPAVALMLSMEGESAQLPNLEHVKAYLAEYSGQAAALTGFINFLNENYGASIDYLK
FT                   LKKSDFLKTKQKKKLEMELIALTQTDLNDSELILSWVRNGLRYFHQLPYIDALKIKTEM
FT                   ITEIEDGFTVVLNGQYYWLPKTQ"
FT   gene            complement(238110..238481)
FT                   /locus_tag="A1S_3490"
FT                   /old_locus_tag="AS1_3490"
FT   CDS_pept        complement(238110..238481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3490"
FT                   /old_locus_tag="AS1_3490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3490"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89915"
FT                   /protein_id="ABS89915.1"
FT                   /translation="MGQAKQRGTLEQRVKQAQEQKDDFYGTERSVAEVLAELGLPKEST
FT                   VKGYVIHLPEKDEFVAAINDNNISFSVAYARTPELAMIYDEPQKAISDAKKISKHKLLV
FT                   CVLFETSNQYMINDIWANY"
FT   gene            complement(238921..239772)
FT                   /locus_tag="A1S_0214"
FT   CDS_pept        complement(238921..239772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0214"
FT                   /product="Universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10690"
FT                   /protein_id="ABO10690.2"
FT                   /translation="MSKIIACIDGSLVTNTVCDYAAWFSDKLNSPIKLLHVIDKPKAKA
FT                   PQDLSGAIGLGSRETLLKELVELEERKGKIELEHGQILLREAKNYLLEKFSIDAQSFQR
FT                   HGSVLETIMGMEDDIRVLVMGKHGNETEHDSSKIGTHIENVVRALHKPVLITSAPFSPP
FT                   KSFLIAFDGSQTARKCVERIASSPLLKGLAVHLVYVGNPNSEMQNQLSWAKEQLESQGF
FT                   NITSNTLDGEVDKAIINYAEQHQIDLIVVGAYGHSKIRQFFIGSTTTKVITSANKPVLL
FT                   LR"
FT   gene            complement(239785..241272)
FT                   /locus_tag="A1S_0215"
FT   CDS_pept        complement(239785..241272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0215"
FT                   /product="sul1delta fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10691"
FT                   /protein_id="ABO10691.2"
FT                   /translation="MLSTIREQWFSNIRGDVLAGIVVALALIPEAIAFSIIAGVDPKVG
FT                   LYASFCIAVVIAFVGGRPGMISAATGAMALLMVTLVKEHGLQYLLAATILTGFIQILAG
FT                   YLKLGALMRFVSKSVVIGFVNALAILIFMAQLPELTNVTWHVYAMTIGGLAVIYLFPYI
FT                   PVIGKLLPSPLICIVLLTLFALFIGLDVRTVGDMGQLPDTLPIFLLPDIPLNLETLAII
FT                   LPYSLGLAAVGLLESMMTATIVDDLTDTTSDKNRECKGQGVANVASGFLGGMAGCAMIG
FT                   QSIINVKSGGRTRLSSFSAGVFLLIMVVFISDWLKAIPMAALVAVMIMVSIGTFNWDSL
FT                   RNIRQYPLSSNIVMIVTVVVVVATHNLAYGVLVGVLLSALFFANKIERYMAIQSVFDES
FT                   ESTRTYTVTGQVFFSSADKFTSAFDFKEALSKVVIDVSQAHFWDVSAVAAVDKVVIKFR
FT                   REGTEVELIGMNEASKTLVDKFGIHDKPDALDRLNSH"
FT   gene            complement(241567..243363)
FT                   /locus_tag="A1S_3491"
FT                   /old_locus_tag="AS1_3491"
FT   CDS_pept        complement(241567..243363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3491"
FT                   /old_locus_tag="AS1_3491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3491"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89916"
FT                   /protein_id="ABS89916.2"
FT                   /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEVL
FT                   LIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTDQSYRFSGKLITKRFSFD
FT                   FTNNKPKNIKLTDRIPNTSDYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNHCLM
FT                   HSNDGTQVITSSIHVLHSLFVNRKDIRGLLLGTSSQSIINRFLESYTTEIVDDNVEYKI
FT                   KIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEITEFNHLQQGTGKRYPIVFPP
FT                   HPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTISKPDEKNPRPRE
FT                   KSQNKNEHINTQKPPSRTSGEYRKRSEVETGNTQGILKYSFNEPTDDPIEVGASNQPYS
FT                   DKSEEVETSSDEPYGNQNTKIKKSETTDTPPSRDERFDIQYIIQSLQELASEMGSPLEH
FT                   LSAINEHGEMIASINLLQIKKLVPEPKHPSWIDYDKGRKLLFLKLDLKDQNGFSYLIDI
FT                   HKNKNHEAFCAFLIFTQNKLTSEQIKKICIELENAKGIKKWALYCDSFIHKMIAIKHLY
FT                   ATPDEWKNRFKNLFISLQKDKS"
FT   gene            complement(243449..244237)
FT                   /pseudo
FT                   /locus_tag="A1S_0216"
FT                   /note="nonfunctional ATPase due to insertion"
FT   gene            complement(244369..244596)
FT                   /locus_tag="A1S_0217"
FT   CDS_pept        complement(244369..244596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10692"
FT                   /protein_id="ABO10692.2"
FT                   /translation="MLETLLQAILEQIDEPKKDLEKNLRALLNETVEKLDLVSKQEIER
FT                   QKTALHLANQRLEALQKQVSLLEEALKNKK"
FT   gene            244876..245214
FT                   /locus_tag="A1S_0218"
FT   CDS_pept        244876..245214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0218"
FT                   /product="nitrogen assimilation regulatory protein P-II 2"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10693"
FT                   /protein_id="ABO10693.2"
FT                   /translation="MKLVTAIVKPFKLDDVREALSDIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEIAISDEMVDAVIESITRVASTGKIGDGKIFVTNLEQVIRIRT
FT                   GETGPDAV"
FT   gene            245280..246668
FT                   /locus_tag="A1S_0219"
FT   CDS_pept        245280..246668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0219"
FT                   /product="ammonium transport protein (Amt family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10694"
FT                   /protein_id="ABO10694.2"
FT                   /translation="MLMALSLTGALLGGTAAWAEETVTTPTSEVTATSTSEAPATIAAA
FT                   PAAEETPAAPTPTAKLDTGDTSWILISTALVLLMTIPGLALFYGGMVRKKNVLSTMMFS
FT                   LSAAILVSLLWVIAGYSIAFSGTGAYFGDLSKAMLNGVAFDALSGTIPESLFVIFQMTF
FT                   AIITVAILSGSIADRMKYSAFMAFIAIWVLVVYAPITHWVWAADGWLFKAGALDFAGGT
FT                   VVHINSGVAGLVAAYMLGKRIGLGRESMAPHNLTLTVIGASLLWVGWFGFNGGSALGAG
FT                   ARASMAILVTQVAAAAAAFSWLVVERMIRGKASVLGGASGAVAGLVVITPAAGFVGVGG
FT                   ALVMGLIGGVVCFWGITALKRLLKADDALDAFGLHAVGGIVGAILTGVFYSDEIIKATN
FT                   VALAPTFAGQLWVQVEGVLATMVYSGIATFIILKVIDLIIGLRVNSDDERMGLDLSQHG
FT                   ERIE"
FT   gene            246827..247285
FT                   /locus_tag="A1S_0220"
FT   CDS_pept        246827..247285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0220"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10695"
FT                   /db_xref="GOA:A3M1A1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1A1"
FT                   /protein_id="ABO10695.2"
FT                   /translation="MHCPFCNAADSKVIDSRLAAEGCQIRRRRECVSCGERFTTFESYE
FT                   VVMPRVIKSNGKNEPFDEAKLRRSLMHALQKRPVTQEQIETVLSDIQLQIRRLGERDVK
FT                   SRTIGEIVMQSLFALDHVAYVRFASVYQDFQDVEAFRRQIEQMQQREH"
FT   gene            247301..248386
FT                   /locus_tag="A1S_0221"
FT   CDS_pept        247301..248386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0221"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10696"
FT                   /protein_id="ABO10696.2"
FT                   /translation="MSELKQDQYWMQQAIELAKRGLYSTKPNPNVGCVIVKDNQLIGEG
FT                   FHPKAGQPHAEVFALREAGEHAQGATAYVTLEPCAHYGRTPPCAEALVKAQVKKVVVAC
FT                   PDPNPLVAGKGVQILKNAGIEVEIGICEDLAAQLNQGFLKAMSTGMPYVRLKVASSLDG
FT                   RTAMASGESKWITGSAARQDVQHWRAISGAVITGIDTVIVDDCQLNVRSLHNIDIETVA
FT                   QPKRVILDRRGRLPLTAKILENPETVMVMGPYRQELADLGVIQLEIQPLKTLLQTLSKQ
FT                   YQIYDVLVEAGATLSTAFLQEGLVDEMISYVAPTLLGQSARAMFNADFEYMAQQLRFKL
FT                   LDVTQLDQDIRLRLIPTQEKV"
FT   gene            248383..249675
FT                   /locus_tag="A1S_0222"
FT   CDS_pept        248383..249675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0222"
FT                   /product="putative DNA modification methylase"
FT                   /note="Adenine-specific methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10697"
FT                   /protein_id="ABO10697.2"
FT                   /translation="MNSEPSVYHKRRHAARTTDEYLFHQLVPYLGNKRRLLHLILEALE
FT                   ITGTLNSKKKNPPIFADFFAGSGVVSRLARQNGYRVIANDWEPYSHALNHAILACVDAP
FT                   AFKELGGYQKAIDYLNRLPEVKGWVTHNLCPRNDDVYDPSRDRLFFKRRNGMRIDAIRQ
FT                   QIATWQAQGAINDVEMSALLAPLLYSASFVSNTSGVFKSFHQGWGGRTQTALERIESLL
FT                   WLTPSRFCEIGDRKRPAAEMWCVDAQHLANQMSGFEVDVAYLDPPYNQHAYSSNYHVLN
FT                   ALTLWDQVDLPPPDTKGYKSGIDRAWRKERPSPYNSSKHAKDAYEKLLSTINARYILTS
FT                   YSTDGNIEPKDLLMANLERGKVTLLTQDVPRYRVSKQRQSERARVLEFIVITDTHAKPG
FT                   PPLRQLLGQLYHFAELGGVDTSGNSTQLALW"
FT   gene            249718..250377
FT                   /locus_tag="A1S_0223"
FT   CDS_pept        249718..250377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0223"
FT                   /product="riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10698"
FT                   /protein_id="ABO10698.2"
FT                   /translation="MFTGIIESLGKVESLQSVGGDVRLRIQTDLDMSDVHLGDSIATNG
FT                   ICLTVIEWGDNWYAADVSRESLNRTTLGNWKVGQRVNVEKAMLPTTRFGGHIVSGHVDG
FT                   VGEITLVREDARSIYFEVTAPVELAKYLAEKGSVTVDGISLTINHLRGNILSLNLIPHT
FT                   AERTNIGTWQVGSKVNLEVDVLARYIERLLLGDKAAEQKTESNISMAFLAENGFLK"
FT   gene            complement(250436..250654)
FT                   /locus_tag="A1S_0224"
FT   CDS_pept        complement(250436..250654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10699"
FT                   /protein_id="ABO10699.1"
FT                   /translation="MDIPHQISTQIEQLNQGEQWTFSAQELYMSHNDFNSLSILLTRAS
FT                   EKGEFSITRTQHNKPWVGTHSVTLTKH"
FT   gene            complement(250785..251420)
FT                   /locus_tag="A1S_0225"
FT   CDS_pept        complement(250785..251420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10700"
FT                   /protein_id="ABO10700.2"
FT                   /translation="MALNVGQDFKKRWLNAPEAVRHAYQQDLARICDLLEPQTPIQLWV
FT                   LNDEKAQLESQQNIEKAYADLKAELIEQARIRRQLALEKALADKRAKEAAYAAELQADE
FT                   VRKFSEQTEALQALRSHLEQEVAEHTARYQKNPETPAIDYSSGTKLSITDDQILSELES
FT                   VRVRLELEAESLIEQAVTVFRAKLHAAAQEEIEYILKNSNFSDEKIEK"
FT   gene            complement(251462..251869)
FT                   /locus_tag="A1S_0226"
FT   CDS_pept        complement(251462..251869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0226"
FT                   /product="DNA polymerase III chi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10701"
FT                   /protein_id="ABO10701.2"
FT                   /translation="MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQ
FT                   TLDEKLWSFDPTSFIAHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIE
FT                   IVENNEAAKQIGREKFKMYRRLGIEPRTFKL"
FT   gene            complement(251862..253310)
FT                   /locus_tag="A1S_0227"
FT   CDS_pept        complement(251862..253310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0227"
FT                   /product="aminopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10702"
FT                   /db_xref="GOA:A3M1A8"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1A8"
FT                   /protein_id="ABO10702.2"
FT                   /translation="MKFTTYTTFPEQTSNESLWILVDSEQLQSNLNTYQINNLESILTA
FT                   TQFKANFNETLPLFGQLSTQPHSQLLGLGKAAELQAAKLAKLAQTIIKSAQNKFKHIAI
FT                   DIAALPVEYHYLFALSLTQAAYGYDEFKSKKNEFVLQQVDLISSQTSLDENQLALVHAV
FT                   QSGQSYARDLGNRPGNICFPEYLAEQALALAAEFPDLLKVTVLNEQQMADLGMYAFLAV
FT                   SKGSERPGRIVTLEYQAQLEQAPVVLVGKGVTFDTGGISLKPGLGMDEMKFDMCGAASV
FT                   LGTIRALCEARLPIHVVGAIAAAENMPSGKATRPGDIVTTMSGQTVEILNTDAEGRLVL
FT                   CDTLTYIKRFNPAVVIDIATLTGACVVALGKVLSGLFSPDDTLAAELQQAGEQSFDRVW
FT                   RMPVIDDYQELLDSPFADIANIGGPHGGAITAACFLERFTRDYRWAHLDVAGTAWLSGS
FT                   AKGATGRPVPLLMQFLANRVSTNG"
FT   gene            253454..254554
FT                   /locus_tag="A1S_0228"
FT   CDS_pept        253454..254554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0228"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10703"
FT                   /protein_id="ABO10703.2"
FT                   /translation="MIIRRYLVKQVVSTSLVVIALLTLIMMGGRLIKYFGVAAQGRLDA
FT                   SILFSIIGYRLPEFLTLILPLGFFIGLMLVFGRLYVDHEMAVLNGSGVSRHQLARLLIP
FT                   MTLVYMVCQSVLMLWMTPWGLREFEKLTTTQAVRTGFDLVRPREFISSGPYTIYAGSLS
FT                   EDRKNLKDIFFYQRAAKEGKPDVMILAKEATRVEVANDTANVVDLVQGRRYEIFPGQPK
FT                   YTQAEFQSYRLRLENDKDVKFESGDVEALSTSKLFSKANDPVVRSELGWRLFGPFTIII
FT                   ALMLSVALSEVSPRQGRYYRLIPSIFIFASLIVLMIAIKTRISKGELDIWAYPVALLVY
FT                   AIAAALFSRKQKLGPKIKKQIKRVKL"
FT   gene            254554..255624
FT                   /locus_tag="A1S_0229"
FT   CDS_pept        254554..255624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0229"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10704"
FT                   /protein_id="ABO10704.2"
FT                   /translation="MLARRIVAKYVTKTTALAMFGTTIVLSVLQILFTYLGELGELKPD
FT                   YNAWQAFIYVLWGAPRYLYEILPISALIGAVIGLGALASNSELIVMRSVGISLWRIVGW
FT                   VMRSALLLIVLSFALSEWVVPYTNEKAQSVKSHRSVAALGEVKGYWSREGQRFIYIDYA
FT                   NSQGNLRDIQVVDFNKDYHLQSLINAEQGKFIQDGQWTLQKASQMDILTDGNSILNNHD
FT                   QQSLGLALQPKYVHMVTLDPEDLSPSQLISFMRYMDEYSQVPKTYQLAFWQKVASPFSL
FT                   ITLVLVACSFIFGPLRQQSMGFRLVIALFIGLGFYYLQDFLGYASLVYAPSPAWFVLMP
FT                   IILMFGAGSYLLYRAR"
FT   gene            255750..257297
FT                   /locus_tag="A1S_0230"
FT   CDS_pept        255750..257297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0230"
FT                   /product="phosphoglycerate mutase III cofactor independent"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10705"
FT                   /protein_id="ABO10705.2"
FT                   /translation="MTDATAGKIPHVLVIMDGVGHREAIEDNAFLAAKTPNLTAMKAKH
FT                   PNSLISGSGEDVGLPDGQMGNSEVGHMNLGAGRVLYQDFTRITKDIRTGAFFEHEVLVD
FT                   AVEKAKAAGGAVHIMGLLSEGGVHSHEDHIVAMCELALKRGAKVYLHAFLDGRDTPPRS
FT                   AQPSLEKLDALFAQYEGKGRIATMIGRYFAMDRDNRWDRVEQAYRLLTEGEAVRTANTA
FT                   VEGLELAYAANENDEFVKATRIGESAKVQDGDSVVFMNFRADRAREITRAFVEKDFAGF
FT                   ERKVVPNLSKFVMLTRYQASIDAPVAYMPEELKNSLGEYLSSLGKTQLRIAETEKYAHV
FT                   TFFFSGGREDEYPGEKRILIPSPNVATYDLKPEMSAYEVTDELVKAINSGEYDLLVVNY
FT                   ANGDMVGHTGVFDAAVKAVEAVDTCLGRVYEAVMAKKGHMLITADHGNVEQMQDYESGQ
FT                   VHTQHTTELVPFIYVGPTQATIAEGGVLADVAPTILNLMQIPVPAEMQGRNLITLSA"
FT   gene            257313..258497
FT                   /locus_tag="A1S_0231"
FT   CDS_pept        257313..258497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0231"
FT                   /product="putative periplasmic carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10706"
FT                   /protein_id="ABO10706.2"
FT                   /translation="MLQHNIYKAFFVSVLMCCSQLVFSAPVVKEKLSPLHPDSPESEES
FT                   YAEVPIESIQQFVQIYGIVRDNYVDEKSDDALFLQAIKGLVSGLDRYSRYLSAEEYRQL
FT                   IQYTEGDLASVDFVLSPESHVHKWMIRDLKTGSDSYKLGLRNGQTILKIDNQELKNLTH
FT                   DQVLGLLYGSIGSTLQVQTEESNSPISLVRNKKIETDIEPVMLHNQVLVLKIRVFQQDT
FT                   ANEIKRLIEENSSSRLKAVLIDLRNNPGGLLSAAVESADLFLNHGIIVSTKSRSEGNQQ
FT                   FQALPGNDFQNIKVGILINHRSASAAEVFTAAMKEHQRAWVMGEKSYGKGVVQKLFPLP
FT                   SGAALQMTVSHYYTPNGNMIEGQGIQPNQTYPLPPEMKEEVYLDRVADLLLKRK"
FT   gene            complement(258501..259013)
FT                   /locus_tag="A1S_0232"
FT   CDS_pept        complement(258501..259013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0232"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10707"
FT                   /protein_id="ABO10707.1"
FT                   /translation="MDLILPPLRERGEDVLLLANHFIQKICMEWETPSKQLTEAAKTYL
FT                   LQQHFPGNVRELRNMIERAITLSEDATIDISHLHPAPLRANISNPFVSATQNIQTTVAA
FT                   PQVVKKLPSEGLERYLENIEKDILINALNMTHWNRTLAAKKLGMTFRSLRYRLKKFGLD
FT                   TETEQEV"
FT   gene            complement(259094..259297)
FT                   /locus_tag="A1S_0233"
FT   CDS_pept        complement(259094..259297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0233"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10708"
FT                   /protein_id="ABO10708.1"
FT                   /translation="MFGHKKGSFTGATQDKQGLILSAHGGSLFLDEIAELPLSMQVKLL
FT                   RAVQEKRSDLSVQIRKSMLISV"
FT   gene            complement(259416..259862)
FT                   /locus_tag="A1S_0234"
FT   CDS_pept        complement(259416..259862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0234"
FT                   /product="type 4 fimbriae expression regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10709"
FT                   /protein_id="ABO10709.1"
FT                   /translation="MQMTLARMGIKTHLAYRVEQAKQLFTQFHYDACLTDLNLPDGSGL
FT                   DLVKHVSQNYPNTPIAVLTAYGNMDIAIAALKAGAFDFVSKPVNQVHLDQLLQKALNRQ
FT                   KVEHDAAENALENKLLIGRSLPIQQLRIAIKKNCALTSTCICYR"
FT   gene            complement(259947..261470)
FT                   /locus_tag="A1S_0235"
FT   CDS_pept        complement(259947..261470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0235"
FT                   /product="sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10710"
FT                   /protein_id="ABO10710.2"
FT                   /translation="MGTWYGLYRLIIAVSLNIILVLTDAQTDNSLQQPALYSYTLLGYS
FT                   LLSLIQLLCFKFIATQATRQLILFFIVDIICLSLLTFSVGEPNLQLSLLYVIAIFTSAI
FT                   LLSARMSLLITLLAVIAVIYQRFVGSLFDYNNLNTIGNSALLAFLFFVVHRIGQIAVQR
FT                   FKLLEALTFHQSIELYQLQNINRYILEQIEEGYLVLDENYDIVVSNPAACSLLGIPPQF
FT                   ANEKYPLAKWHADLFEILKFGDLKEGDRFIFESRLSAYSINIKVQHLLVPQQTLTLLIL
FT                   QDAQQINQQAQQLKLAALGQLSASIAHEIRNPLAAIVQANELLKDSDPEQQNTLRHMIG
FT                   KQTKRIDSIVQDTLGLARSERTHPIQIDVKHFIDTLLEEDLFDVKHSIQLKISDSSLKF
FT                   LFDEKQLRQVMINLVRNALRHNATDSPYITINIHSQTNKIYIDVIDYGEGVSKRDISQL
FT                   FKPFFSTEINGTGLGLYLSHSFCEANHAKLTYVEQKQGACFRIECPIIY"
FT   gene            complement(261526..262161)
FT                   /locus_tag="A1S_0236"
FT   CDS_pept        complement(261526..262161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0236"
FT                   /product="response regulator"
FT                   /note="Global antibiotic and cyanide control protein
FT                   LuxR/UhpA family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10711"
FT                   /protein_id="ABO10711.2"
FT                   /translation="MITVLVVDDHELVRTGICRMLEDHADVEVIGQAESGEEAIAIVRQ
FT                   QHPQVVLLDVNMPGIGGVETTRRLLQTAPETKVIAVSGLAEEPYPSLLLKAGAKGYITK
FT                   GAPIAEMVRAINKVMQGGKYFSADIAEQLASSYLSDTQQSPFDSLSEREMQVAMMVVNC
FT                   ISAQEIADKLFVSVKTVNTYRYRIFEKLGIDSDVKLTHLAIRYGLIKP"
FT   gene            262374..263420
FT                   /locus_tag="A1S_0237"
FT   CDS_pept        262374..263420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0237"
FT                   /product="D-alanyl-D-alanine endopeptidase
FT                   penicillin-binding protein 7 and penicillin-binding protein
FT                   8"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10712"
FT                   /protein_id="ABO10712.2"
FT                   /translation="MKNSKKSLMHVLSMSILLSLSSTSFAELVNNPSSGSTGTASLNWT
FT                   AADASQLLNDEDDEPTPQGSTSVTTTLRGSNAPRVITSAPKVAPIRDTVGYNAQPSVSA
FT                   RAALVMDAQTGEVLYSKNTNASVPIASITKLMTAVVTADARLNMSEEITLEQIDFAGAG
FT                   GKNSSSTLRVGDKMNRAEVLLFALMKSENPAAAALARTYPGGRAAFVAAMNAKARALGM
FT                   NATHYYESTGLDPRNVSSARDLGILASTASQYGLIRQFSTTPTYDFNLGYRVLKSNNTN
FT                   ALVRNGGWNINLSKTGYINEAGRCVVMHTTVNSRPAVIVLLGEPSTQARNNDATNLLGW
FT                   LSNLPKRI"
FT   gene            complement(263529..264668)
FT                   /locus_tag="A1S_0238"
FT   CDS_pept        complement(263529..264668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0238"
FT                   /product="threonine synthase
FT                   pyridoxal-5'-phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10713"
FT                   /protein_id="ABO10713.2"
FT                   /translation="MSNANRYTGLVDRYRDRLPVSATTRAISLGEGNTPLIKLENIPRI
FT                   IGKDVEIYVKYEGLNPTGSFKDRGMTMAVTKAVEEGSKAIICASTGNTSAAAAAYAARA
FT                   GIKAFVLIPEGKIAMGKMAQAMMYGAITMQIRGNFDDGMRLVKEVADQAPVTIVNSINP
FT                   YRLQGQKTIAYEIVEALGRAPDYHCLPVGNAGNITAHWMGYTEAVANQPADQFEQVVYD
FT                   AATDQFTGPKPEGLPTMVGYQASGAAPFLRGAPVEKPETVATAIRIGNPQSWNHAKAVV
FT                   RDSKGWFDELQDSEILEAQRLLSMYEGVFVEPASAASIGGAIRDIKAGKIAEGSVIVCT
FT                   VTGNGLKDPDTAIKQCADAVMLSIDATMDQVKDSILSNM"
FT   gene            complement(264724..266025)
FT                   /locus_tag="A1S_0239"
FT   CDS_pept        complement(264724..266025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0239"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10714"
FT                   /protein_id="ABO10714.2"
FT                   /translation="MKPVRLAILGLGTVGGGALKLLQENAAEIKRRTGREIQITHVGTR
FT                   RPRPDLELEGIKQSADLLDIVRQPDVDVVVEVMGGIHPAYEIIMEAIKHGKQVVTANKA
FT                   LLAEHGNELFKAAEDNAVQIAYEAAVAGGIPIIKVIREGLAANHIEWLAGIINGTGNFI
FT                   LTEMREKGRAFDDVLKEAQELGYAEADPTFDVEGIDAAHKLTILASCAFGIPLQFDKVY
FT                   TEGISKITAQDVKYAEELGFRIKHLGIARRAEKGIELRVHPTLIPDEQLIANVNGVKNA
FT                   VLVQANAVGPTLYYGAGAGAGPTASAVVADVIDIVRDISYTEDGAGTIPQLAFEALTNM
FT                   PILSREEMTTGYYIRLNAEDQTGVLADVTTILSRAGISIDAIMQQSRLKDLIPIVILTD
FT                   PIVESKMDDALAQIQALPAIRGEIVRIRLESLDS"
FT   gene            complement(266270..267085)
FT                   /locus_tag="A1S_0240"
FT   CDS_pept        complement(266270..267085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0240"
FT                   /product="thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10715"
FT                   /protein_id="ABO10715.2"
FT                   /translation="MSFTRSQIFLACALASSLLFSACSKENKPQKEDALTATAPATGEA
FT                   STIIERNAKQRLIETLQKQFKNANINVKILDIKPTEVPNLYWVNLEGMTSVYTTSDGKY
FT                   LIQGDVIRLGGKELHNIGDSLQASENKKHLAALKNEDLIVYPAKGGKAKHVIYVFTDAS
FT                   CPYCHKLHEHLAEINEKSIEVRYIAWPRGEQFMPTMEAVWCSADRKAAFDQAVQGISIP
FT                   PAQCKNPVREQYQLGLNMGVNGTPAIYNVDGEYLGGYLTPDELIKRLDK"
FT   gene            complement(267232..268152)
FT                   /locus_tag="A1S_0241"
FT   CDS_pept        complement(267232..268152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0241"
FT                   /product="site-specific tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10716"
FT                   /protein_id="ABO10716.2"
FT                   /translation="MINKKPRIPSPVQIPEHLSFLQGFRDYLVAQTVSPHTRNAYLSDL
FT                   IQCSELHKKNRLPDWTSDDISDVLIELTKVGKSPRSIARCLSALRQFYKFLREQKLRSD
FT                   NPVATHHSPKIGRALPKDLSEEDVEALIQAPDITTALGLRDRAMFEVLYACGLRVSELL
FT                   NLRLELINLKQGYLRITGKGNKERLVPLGQYACDWVERYLNEARPQLYKSSTDYLFLTQ
FT                   HGGIMSRQNFWYAIKHYALQANIQAELSPHTLRHAFATHLLNHGADLRVVQMLLGHSDL
FT                   STTQIYTHVAQVRMQQLHEKHHPRG"
FT   gene            268260..268559
FT                   /locus_tag="A1S_0242"
FT   CDS_pept        268260..268559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0242"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10717"
FT                   /protein_id="ABO10717.2"
FT                   /translation="MYTSKKGLGSDAVRLSALKVKQAATITKVNRIEVESEQQDLVAIR
FT                   LESLGFVPGTRVEVITKGVFGGDPILIQIGFTRFALRKAEAEKIEIQVEEGVPA"
FT   gene            268556..270409
FT                   /locus_tag="A1S_0243"
FT   CDS_pept        268556..270409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0243"
FT                   /product="putative ferrous iron transport protein B"
FT                   /note="FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10718"
FT                   /protein_id="ABO10718.2"
FT                   /translation="MSDALRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVERKVGH
FT                   FQLPSGRSVRVLDLPGTYSLNATSPDEAITRDVCLGKIAEEGQQDAFLCVVDATNLKLH
FT                   LGLVLEMIELGRPILLVLNMMDEARRRGIQINTQKLSQRLGVPVVETVAVRNAGIENLL
FT                   HALDQEKYSVPQTELSGLTGTHHQKIDMIFKDVVHYVDQEDKRTDFLDRIFLHPVLGLL
FT                   SLAIMMFIVFQAVFAWAAPFMDGIEGFFGWLGEVVGSVITQPLLHSLVVDGIIAGAGGV
FT                   VVFLPQILILFFFILVLEESGYLPRAAFLLDKLMFQAGLSGRAFIPLLSSFACAVPGIM
FT                   ATRSISDPRDRFTTIMVAPLMTCSARLPVYALLIAAFIPEKMVWGIFNLQGLVLFGLYM
FT                   AGIVSALCVSFLMKFFQKDKSQHALLLELPSYRFPDLKSVGIGLLDRAKIFLKRVGGII
FT                   FALSILLWFLCTFPQPPEGATLPAIDYSFAGMLGHLIQPLFAPVGFNWQICIALIPAMA
FT                   AREVVVAALGTVYALSATDEDAVAQGLSHLISADGTGWSLATGLSLLVWFIYAPHCLAT
FT                   LATVRRETGSWKHVAAMTTYLFGLAYFASFVTYQIASHYWG"
FT   gene            270430..270681
FT                   /locus_tag="A1S_0244"
FT   CDS_pept        270430..270681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10719"
FT                   /protein_id="ABO10719.2"
FT                   /translation="MLQYLIIAVLVIWSAVVVFKKVFPKTANSAFSALSVFCEKQGWAT
FT                   LAKWLKPKMTFGCAGGCGCSSEDKPTNTVQEIKPVKWQ"
FT   gene            270842..272188
FT                   /locus_tag="A1S_0245"
FT   CDS_pept        270842..272188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0245"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10720"
FT                   /db_xref="GOA:A3M1C6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1C6"
FT                   /protein_id="ABO10720.2"
FT                   /translation="MLIQRGGLKVVAGLGISGVSAVNFLHEQGYQVAVTDSRPTPPGHD
FT                   QIPAGVKTSFGQLDQELLLQAEEIILSPGLAPQLPEIQAAIAKGISVVGDIQLLRRATD
FT                   VPIVAITGSNAKSTVTTLIGLMAKDAGKKVAVGGNLGRPALDLLKDQPELLVLELSSFQ
FT                   LETTSHLNAEVAVVLNMSEDHLDRHGNMLGYHQAKHRIFQGAKKVVFNRDDALSRPLVP
FT                   DTTPMQSFGLNAPDLNQYGVLRDADGTLWLACGLQRLIKSSDLYIQGMHNVANALACLA
FT                   LGEAIGLPMESMLETLKQFKGLEHRCEYVKTVHDVRYYNDSKGTNVGATLAAIDGLGAA
FT                   IEVKKGKVALILGGQGKGQDFSPLRSSIEKYAKVVVLIGEDAPVIEQAIQGATKILHAA
FT                   TLKEAVELCQRETQAEDVVLLSPACASFDMFKSYNDRGQQFVACVNSLV"
FT   gene            272213..273409
FT                   /locus_tag="A1S_0246"
FT   CDS_pept        272213..273409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0246"
FT                   /product="cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10721"
FT                   /protein_id="ABO10721.2"
FT                   /translation="MAGLAQTTIQKINHWYERILPKWPAEVTPRNVLIFCVVALLCIGS
FT                   VMVASASMPYAEYMHENPFHYVIRHGISIVAAGVVAYLTYRISLNTWFKNTFPLWLLTM
FT                   VLLLAALAVGSEVNGSTRWIKIGGFTLQPTEVAKVMMAIFTADYVVRRAKEVRTHWKGL
FT                   LRLSGVMAITVGLIIAEPDLGATVVIVMMMVGVFFLAGAPPTQFLIMLGAIVTGIVFLI
FT                   LFEPYRFQRLISFTDPWADPLGVGYQLSNALMAFGRGEWFGTGLGHSVQKLSYLPEAHT
FT                   DFMLAVLGEEFGFFGISIVIGLSFLMLACCIKIGHRALKHHYLRAGYLAYGISIIFLLQ
FT                   ILVNAGMNMGLMPTKGLTLPFISYGGTSLMMCAAMISLILKIDASTQEVNPEREESNF"
FT   gene            complement(273619..274443)
FT                   /locus_tag="A1S_0247"
FT   CDS_pept        complement(273619..274443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0247"
FT                   /product="putative glutamyl t-RNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10722"
FT                   /protein_id="ABO10722.2"
FT                   /translation="MTVKNSPAEFASAFAQQLNRLPEKYSFSLAQRRNNVPLNRCSYSG
FT                   RFAPSPTGPLHFGSLITAVASYCDARAHQGRWLVRVEDTDIPRIYPGSEDHILASIEAF
FT                   QFDPDAEIIFQKDRLDIYESVLDQLKKEGLVYACQCTRKMLGSNAIYAGTCRDLQLDFQ
FT                   HQAIRVKVQDQPICFDDRLQGLHCSNLEHDLGDFVLKRRDGIINYQLAVVVDDYLQGIT
FT                   HVVRGADLLDNTERQIWLGQLLGYPKLSYMHLPLAMNDQGQKTFKAKPCPCT"
FT   gene            complement(274446..274982)
FT                   /locus_tag="A1S_0248"
FT   CDS_pept        complement(274446..274982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0248"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10723"
FT                   /protein_id="ABO10723.2"
FT                   /translation="MANDNHNQVLDEHTEVVVEGDKASAKRARKVKPKTSDVGSTASLF
FT                   GIAPYQPKKNEEYMSEGQLEHFRQILQAWKAELMSEVDRTLNTMQDESTALPDVNDRAT
FT                   QEEEFAIELRTRDRERKLIRKIEQSLEAIKNEDYGFCETCGIEIGLRRLEARPTATLCI
FT                   DCKTLAEIKEKQNNG"
FT   gene            complement(275193..276005)
FT                   /locus_tag="A1S_0249"
FT   CDS_pept        complement(275193..276005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0249"
FT                   /product="cyclic 3'5'-adenosine monophosphate
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10724"
FT                   /protein_id="ABO10724.2"
FT                   /translation="MTFQVSTLSQKNHVIIQITDTHLLEYPQLEFVGMNPEESFHAIIQ
FT                   QILKQHPEADAIIHTGDLAQAPTPITYKRYINFMQTLGLPFFQTLGNHDNVDHFPLHNE
FT                   NHQQPVVVGLGNWRVIMLNSAVKGKVDGHLSSEQLENLANLLEQFADHPVLLACHHHPF
FT                   AMKSKWIDHHKLQNSNALLDTLSPFQNVKALVCGHVHQDSLNIWQGIEFFSTPSTSVQF
FT                   KPFSNDFALDQNAPGYRYIRLNNDGSFETKVFRLENFKTRINTDISGY"
FT   gene            complement(276010..276636)
FT                   /locus_tag="A1S_0250"
FT   CDS_pept        complement(276010..276636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0250"
FT                   /product="adenosine diphosphate sugar pyrophosphatase"
FT                   /note="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10725"
FT                   /protein_id="ABO10725.2"
FT                   /translation="MSIVERPSYTSKDVEVTSREPLFSGFIQVEKVSLRHRLFNQSEYT
FT                   PVLQRELVHRPEAAGVLLYNDQKQQFALIEQFRVGALDDSHSPWQLEIIAGVLDGNESP
FT                   ESCIRRESLEESGCEVQDLEHLFSFYPSAGACSELFHLYVAETNLPAVGGVFGVDNEGE
FT                   NIQLHLFSYSEIQTLLNSGRLRNAPVIMALQWLAQHSKTIINPKR"
FT   gene            complement(276712..278589)
FT                   /locus_tag="A1S_0251"
FT   CDS_pept        complement(276712..278589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0251"
FT                   /product="thiamine hydroxymethylpyrimidine moiety
FT                   synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10726"
FT                   /db_xref="GOA:A3M1D2"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1D2"
FT                   /protein_id="ABO10726.2"
FT                   /translation="MNQLTNLSSAEISAQHEQDAKDLTRILPASKKVYIEGSRPDIQVP
FT                   MREISLTDTPTGLGGEHNPPIMVYDTSGVYTDPNVQIDLNKGLPSVRQKWIEERNDTDV
FT                   LSGLTSKFGQERLKDIRTADIRFAHIQNPRRAKAGKNVTQMHYAKQGIITPEMEYIAIR
FT                   ENQRQREAVDMRQHPGQNFGAKNLKEITPEFVRQEVAEGRAIIPANINHPELEPMIIGR
FT                   NFLVKINANIGNSALGSSIDEEVAKMTWATRWGADTIMDLSTGKNIHETREWIIRNSPV
FT                   PIGTVPIYQALEKVDGVAENLTWEIFKDTLIEQAEQGVDYFTIHAGVLLRYVPLTANRL
FT                   TGIVSRGGSIMAQWCLAHHEENFLYTHFDEICEIMKAYDVSFSLGDGLRPGCIQDANDE
FT                   AQFSELKTLGELTHRAWEHDVQVMIEGPGHVPMHMIKENMDLQLEVCKEAPFYTLGPLT
FT                   TDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNKKDVKDGIITYKIAAHAAD
FT                   LAKGHPGAQVRDNALSKARFEFRWDDQFNLSLDPDTARSMHDETLPKEAHKSAHFCSMC
FT                   GPKFCSMKITQNVRDYANNLTNSDSEVEEGLKAMKEVYQEQGQKLYHKV"
FT   gene            complement(278848..279903)
FT                   /locus_tag="A1S_0252"
FT   CDS_pept        complement(278848..279903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10727"
FT                   /protein_id="ABO10727.2"
FT                   /translation="MCSALLLAGCSKTSEQDQTVSKEQKSTAQKATEQRDSSCLQIMVA
FT                   MHTINQNSKIEDLNQINEKLKTCVPSLKNEEQLKLIEASTAMYQRFLKQDYTDKTARAF
FT                   EAFGYAVLEQKQDLKKVIQSQKKLFAQLSPRDQYLLQHEGQAYIDLLYQGEGMFTYRRQ
FT                   PNYLVDVFSKALPADQKEFLSRMAKDNQNIFYNDGALAVSWKELTERALFWEKFIQKYP
FT                   KSYFINDAKLLFNEYRYFIFFGLDNTPVSNEYAPNTWFDPDALQQIRFLSTQSQSSLAK
FT                   PAQQFLKFIATPVDERNKQFKIDLTDENGQKKSTYQIVHEQLEQLLKFDSPWNTEVYRD
FT                   CHIDAVCIDTN"
FT   gene            280038..280619
FT                   /locus_tag="A1S_0253"
FT   CDS_pept        280038..280619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0253"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10728"
FT                   /protein_id="ABO10728.2"
FT                   /translation="MNDKTARQKILDAAATLFYNDGITATGINTVTAKADVAKMSLYNN
FT                   FSSKGELVDAYIAARHQEWLDLYQKRLEKTKTAKEAILAVFDAYQDHAEFAYEKGFRGC
FT                   GLLNAAAEFPANSSGRNAVRQHKEQVEAIVAEHLNHLLKDSQRVSYIASQLSFLLEGSM
FT                   ARAGLEGSSRQLQLARQMAEHILDRECQHD"
FT   gene            280612..281517
FT                   /locus_tag="A1S_0254"
FT   CDS_pept        280612..281517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0254"
FT                   /product="Permease (DMT) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10729"
FT                   /protein_id="ABO10729.2"
FT                   /translation="MISLIKNSSYGGTIAILVASFLWGTTGTAAAFAPTLGPLAIGAVA
FT                   MGGGGLLQALIASQAIREHRQFIGRNISIILLGVVAVGIYPLAFYSSMHYAGITIGTVV
FT                   SIGSAPLIAAVLERFFDRKVLSKTWFLSFVLGVVGVSLLSMGESHTAQESTNEWNKIFG
FT                   IFLGLVAGATYSLYSWAAKRLIDRGIAAKAAMGMIMGGGAVILLPTLLITGGGLLQSST
FT                   NLLVAGYMMLIPMFLGYLLFGFGLKTVNASKATTLTLFEPLVAAIFAIVLVGESVSWIG
FT                   WVGMFLIFICILMLSKPENT"
FT   gene            281598..282944
FT                   /locus_tag="A1S_0255"
FT   CDS_pept        281598..282944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0255"
FT                   /product="putative RND family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10730"
FT                   /protein_id="ABO10730.2"
FT                   /translation="MKIKLMLVAGLWSFTSSSFALDLVETYERAKLNDPTWQANQQQFE
FT                   ADQLNLGLATGALLPTVTLSGNITRNRQTVKRSNFPGVDQEGLSDALVSNTSTTKQATL
FT                   SARQPLFRMDAWEGYKQVKTSVALSEITLKLQKQDHVLNVAEAYFNVLRQQALTAAYLQ
FT                   EEKALLEQLNMMNAKLKEGLVARSDVSEANAQYQNARANRIATNVQLLLAQEQLSEYIG
FT                   PYQDKLAVLRSDFIFQKPYPAQLDEWLGLAQQQNLKIQQARLQKRYAEDQRRVEKAALY
FT                   PQIDAVASYGYTKQTPETLISTDGKFDQVGVEMNWNLFNGGRTRTSIKKASVELNKAQA
FT                   QLDAAIRRANVDVKSAFMQVDTDRAKLEARKAAMDSSALVSQASKASYNEGLKSMVDVL
FT                   LAQRNAFSAKQDYLNAQYDYLLNVLRLKAAVGQLGEKDLVELNSWLTYQ"
FT   gene            283071..283775
FT                   /locus_tag="A1S_0256"
FT   CDS_pept        283071..283775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0256"
FT                   /product="high affinity phosphate uptake transcriptional
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10731"
FT                   /protein_id="ABO10731.2"
FT                   /translation="MLSHHISSQFNEDLQDVNTKFMTMGGLVEQQVANAIHSLLDTDAN
FT                   LAIDVQFKDNAVNQYERDIDEGLTLILARRHPAAIDLRMVIAMSKANTDLERIGDEAAK
FT                   IARIAQNLCEEGGSPRGYMETRHIGNQVRVMIHDALDAFARLDADQALRVLLADADIDR
FT                   EYQSATRTLMTYMIEDPRHIARVINVMWVLRSLERIGDHARNIAEQVIYMAKGFDARHT
FT                   KIEEIEAKVHEK"
FT   gene            complement(284091..284360)
FT                   /locus_tag="A1S_0257"
FT   CDS_pept        complement(284091..284360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10732"
FT                   /db_xref="GOA:A3M1D8"
FT                   /db_xref="InterPro:IPR007457"
FT                   /db_xref="InterPro:IPR036766"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1D8"
FT                   /protein_id="ABO10732.2"
FT                   /translation="MSRQVFCRKYQKEMEGLDFAPFPGAKGQEFFENVSKQAWQEWLQH
FT                   QTTLINEKRLNVFEPEAKKFLEEQREKFFNNDESVEKAEGWKPE"
FT   gene            complement(284370..284483)
FT                   /locus_tag="A1S_0258"
FT   CDS_pept        complement(284370..284483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0258"
FT                   /product="argininosuccinate lyase"
FT                   /note="Arginosuccinase; ASAL"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10733"
FT                   /db_xref="GOA:A3M1E0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1E0"
FT                   /protein_id="ABO10733.1"
FT                   /translation="MTLEASVNARDHIGGTSPKQVEAAIARAHKRLEQLYA"
FT   gene            complement(284594..285628)
FT                   /locus_tag="A1S_0259"
FT   CDS_pept        complement(284594..285628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0259"
FT                   /product="argininosuccinate lyase"
FT                   /note="Arginosuccinase; ASAL"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10734"
FT                   /db_xref="GOA:A3M1E0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1E0"
FT                   /protein_id="ABO10734.1"
FT                   /translation="MLAKVGVLTEAERDDIIEGLSTIRAEIEAGTFEWRIDLEDVHMNI
FT                   ESRLTQRIGITGKKLHTGRSRNDQVATDIRLYLRDEIDDILGLLERLQKGLLGLAAKNV
FT                   NTIMPGFTHLQTAQPVTFGHHLLAWFEMLVRDTERLQDCRKRVNRMPLGSAALAGTTYP
FT                   IDRAYTAELLGFEAVSENSLDAVSDRDFAIEFNAAASLIMMHLSRMSEELILWTSAQFK
FT                   FVNIPDRFCTGSSIMPQKKNPDVPELIRGKSGRVFGDLISLLTLMKGQPLAYNKDNQED
FT                   KEPLFDAIDTVRGSLMAFADMIPALVPNVEIMREAALRGFSTATDLADYLVKKALRSVM
FT                   RMKL"
FT   gene            285793..286932
FT                   /locus_tag="A1S_0260"
FT   CDS_pept        285793..286932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0260"
FT                   /product="alginate biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10735"
FT                   /protein_id="ABO10735.2"
FT                   /translation="MWSWWLSKIKKSISLAEAQQTKLFSTAYRNQNSSYFFTKIDRWQH
FT                   LLELIIASNVLALVLALAEAQSWHALNGSRLLQYIVFINWVILSFFALVEHFQDFFSQL
FT                   QQKYALIIGFVMLQAIVVVTTIISNFFQFGVLKKTSVIAQDWSIYFTNVPLYLSYGILL
FT                   GAFCLRYLYVREQWLHQQYAELNARIQAMQARIHPHFLFNSLNNVVSLITIDPDKAESM
FT                   LISLSRLFRASFQELKLVSLHEEIELSKQYLMIEQIRLGERLKIEWKVEIEPLQLKQVT
FT                   IPLLTLQPLLENSIFHGVEPMMGKATIGVLVEILQNQVSIVITNPYTHDTINSRKGHGI
FT                   ALENVKQRLKAYYGNSVRFQVYKGEALYTTIMSYQYQSK"
FT   gene            286993..287733
FT                   /locus_tag="A1S_0261"
FT   CDS_pept        286993..287733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0261"
FT                   /product="alginate biosynthesis regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10736"
FT                   /protein_id="ABO10736.2"
FT                   /translation="MKVLICDDEPLAVERLSRLVSKMGHEVVATAHHGQDALEQARLHH
FT                   PDVILLDIQMPGMNGLVCAEQLSQLNPRPAIVFCTAYDQHALEAFKSQAQAYLLKPIDP
FT                   QELEQTFKQLTQLTQAQLSALPKPELLQDLKTQRHQIAAKTYRGVELIPVENIYYFLAD
FT                   QKYVTVRHKNGSVLIDETLKELETEFADQFIRIHRNALVSIAYLDGLELVSSGQYQVRL
FT                   RGLDERLSVSRRHLSTLRERIHQL"
FT   gene            287822..288751
FT                   /locus_tag="A1S_0262"
FT   CDS_pept        287822..288751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0262"
FT                   /product="porphobilinogen deaminase"
FT                   /note="PBG; Hydroxymethylbilane synthase; HMBS;
FT                   Pre-uroporphyrinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10737"
FT                   /protein_id="ABO10737.2"
FT                   /translation="MLEFMKTLKIATRQSPLALWQAEHIRARLQELHPDLTVELVKFVT
FT                   QGDKILDTPLAKIGGKGLFVKELEAALLDGRADLAVHSMKDVPMALPEGLTLAVICERE
FT                   DPLDAFVSNQFEKFADLPQGAKVGTSSLRRKSQILKQRPDLQIIDLRGNVGTRLAKLDD
FT                   GQYDAIILASAGLKRLGLAERIRHCIEPSVSLPAVGQGALGLECRADDQEVLALIQPLL
FT                   HPETDVCVRAERAFNAYLEGGCQVPIAGYATLQDGKIHIEGRVGSVDGQTLLRAELTDE
FT                   ANNAQQLGENLARNLLDQGAGDLLKALY"
FT   gene            288756..289523
FT                   /locus_tag="A1S_0263"
FT   CDS_pept        288756..289523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0263"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /note="UROS; Uroporphyrinogen-III cosynthetase;
FT                   Hydroxymethylbilane hydrolyase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10738"
FT                   /protein_id="ABO10738.2"
FT                   /translation="MLFINTRPDSRAAELTHALQKKGFQVESLPLLELVAQPFSESLSQ
FT                   LYQQLTGAQAIVVVSPTAVDVGMQYLTQSGLKIDELKYIQWIAVGQATANRLHDYGIEA
FT                   HVPEVETSEGMLNLPLLHRMQKSGSVAFWRGEGGRQFMMETLQQQGIQILNFVLYRRQC
FT                   PQASYSTFKHLTQNSNYNLDKWLVLITSEASWKYWLELCLKNKAQPDCVYLVLGPRLFQ
FT                   LVKDYRDQQQAHFHIIQLENLSPSGMIHHIQAL"
FT   gene            289598..290107
FT                   /locus_tag="A1S_0264"
FT   CDS_pept        289598..290107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10739"
FT                   /protein_id="ABO10739.1"
FT                   /translation="MWQISRTVPELQQSLLQSEQQYANLNDQLVALQRQIQNQPSHNSK
FT                   TTPLATTEVVQTGIAPTVLIKQKLELIQFAIDQQQFIYAVDHLTQLQQTLPQYGIAPAL
FT                   QHSLNQALEQDKQAIQQFVLAQNQRHQLIDDLLQNIDKNIQQALKQPKFEMDQSEAVSW
FT                   WKMVPY"
FT   gene            290151..290369
FT                   /locus_tag="A1S_0265"
FT   CDS_pept        290151..290369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10740"
FT                   /protein_id="ABO10740.1"
FT                   /translation="MLKEVQLRLLIAEQALNQGKMAEYQNELQTVMQKLNELPDATSQQ
FT                   LKNRIAKVAHLSVVPVPKLSTLGLIGS"
FT   gene            290379..291572
FT                   /locus_tag="A1S_0266"
FT   CDS_pept        290379..291572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0266"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10741"
FT                   /protein_id="ABO10741.2"
FT                   /translation="MKHLLWVYFLISLVLFAALALFSYGYGMGYVYIYWRQLQLQTNVW
FT                   GLVLTFVVMSFIAQVIWLWIKRYSSREQRKRENIFQFKNLHPYEQLGIVWLLEAAEDQR
FT                   VFIERVFTQSGLLKNIIDAKFLVLSGDYQKALEALDQSPPMAFELAELQRIEIFLAQNE
FT                   AERALTHLEFLYQHQLSPWLEEIETAYQQRLTALWGQLALQQPWVYLRSMKYGLLDAEH
FT                   RDLWLQQLLQQFDQASIDDLQALQQRYLDLESEIQTRPYSSKLLWLKLLARMPEMSIQH
FT                   EALTLHLLKEQFDPDVFYLWFQQQLLKQVPDYADVEEKINQFESQYMNLPVLTFAKWHV
FT                   YMATGRQAEAEILLSLYPDNILMSYLRIKSTLKEDDELIKQLNLIFENDANFLKFKI"
FT   gene            291580..292020
FT                   /locus_tag="A1S_0267"
FT   CDS_pept        291580..292020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0267"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10742"
FT                   /protein_id="ABO10742.2"
FT                   /translation="MKELSVYPVIYDQKVAWGDMDAFGHVNNVQYYRYIESSRILYMEN
FT                   VNILTPNIYTVVASSQCKYLKPVFYPDVLKVGVRVEELRKSAFRMAYILWSESQQQIVA
FT                   TGEAVMVCVNKMTGLKCEIPSEVKSKIIELEKSVGHDLIHLA"
FT   gene            292215..292541
FT                   /locus_tag="A1S_0268"
FT   CDS_pept        292215..292541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0268"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10743"
FT                   /protein_id="ABO10743.1"
FT                   /translation="MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAEN
FT                   VGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAKLE
FT                   DFLI"
FT   gene            292872..293615
FT                   /locus_tag="A1S_0269"
FT   CDS_pept        292872..293615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0269"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10744"
FT                   /protein_id="ABO10744.1"
FT                   /translation="MKKKSKQWKWWFFALIAFLIFIILQIPATWLISKFSKNNQTVHNV
FT                   SGNIWQGQADWHRGALRGTIHWKTRPLDLLLLRFAADVDIHSGNTQLTGIMAYGFGKKV
FT                   IVRDMNGQIAPETLKQVVNWQWPVNSIQLKDIQFNYKKEQGFAAVDGQLHWGGGALIYN
FT                   IGDRQDRMNMPSLSGQLTDQNGQLQVDIRDQRNQKMANLLLDANMMLDVQLTQRLLLNV
FT                   PSYDGKAGLDTFVISSRQPLLQGGN"
FT   gene            293615..294451
FT                   /locus_tag="A1S_0270"
FT   CDS_pept        293615..294451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0270"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10745"
FT                   /protein_id="ABO10745.2"
FT                   /translation="MKVWIDKLQQLQWQKLDRLSVVVLAILILWLCWKLASFFWLVIAP
FT                   PQLMQFDRVELGSQQPQIPNISTFSLFNEPSANAAQESVNLELQGVMVGYPNRFSSAVI
FT                   KIDNTAERYRVGETIGSTSYQLAEVYWDHVVLSQGNGSTRELQFKGLPNGLYQPMTPDA
FT                   SQQSATPSQPTEPMNTAQQALGQAIQQMQGNREQYLRDMGVSGNSGEGYEVTERTPTAL
FT                   RNKLGLRPGDRIVSLNGQTIGQGQTDVQLLEQARRAGQVKIEIKRGDQVMTIQQNF"
FT   gene            294493..296769
FT                   /locus_tag="A1S_0271"
FT   CDS_pept        294493..296769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0271"
FT                   /product="putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10746"
FT                   /protein_id="ABO10746.2"
FT                   /translation="MALLNHQRPLWALLAAAPLIATVTSSAYAQTWKINLRDADLTAFI
FT                   NEVADITGKNFAVDPRVRGNVTVISNKPLNKDEVYDLFLGVLNVNGVVAIPSGNTIKLV
FT                   PDSNVKNSGIPYDSRNRVRGDQIVTRVIWLENTNPNDLIPALRPLMPQFAHMAAIAGTN
FT                   ALIISDRAANIYQLENIIRNLDGTGQNDIEAITLQSSQAEEIITQLEAMSATGASKDFS
FT                   GARIRIIADNRTNRILIKGDPQTRKRIRHMIEMLDVPSADRLGGLKVFRLKYASAKNLS
FT                   EILQGLVTGQAVSSSNNSNNSSNSSNPINSLIGNNQNSGSNTSGSNGASISTPAINLNG
FT                   NSNSSNQNNITSFNQNGVSIIADNAQNSLVVKADPQLMREIESAIQQLDVRRQQVLIEA
FT                   AIIEVSGDDADQLGIQWALGDLSSGIGLLSFSNVGASLSSIAAGYLSGGSAGAASAIAN
FT                   GANKGNGATLGLGNFDNSRKAYGALIQALKTNTKSNLLSTPSIVTMDNEEAYIVVGQNV
FT                   PFVTGSVTTNSTGINPYTTVERKDVGVTLKVVPHIGEGGTVRLEVEQEVSAVQDSRGQA
FT                   ADLVTSKRAIKTAVLAEHGQTVVLGGLVSDDTSLSRQGIPGLSSIPYVGRLFRSDNRSN
FT                   VKRNLLVFIHPTIVGDANDVRRLSQQRYNQLYSLQLAMDKNGNFAKLPEQVDDIYNQKM
FT                   TPPSIASKPKNYQQVPSGGKSSTITTPVAVEPTVQKQTLQLPDPEINRTKNTVTTTTLR
FT                   PSTAP"
FT   gene            296810..297439
FT                   /locus_tag="A1S_0272"
FT   CDS_pept        296810..297439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0272"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10747"
FT                   /protein_id="ABO10747.2"
FT                   /translation="MTWKLQAITGEFTGQEINVDRDMLVGRHQDADLLLQAAEISRRHA
FT                   ALLLKDQALWVQDLNSSNGTFVNDIRIEQEKQLHDGDIVQFASLKFSVFAPAQENTDLP
FT                   EIEVEPVQTAPIQDLSDQGMPSIAERAAETEVSRDGMPQRVSVPKPAPIPEGVDIHAQP
FT                   EQTPVAIEEPISRVTEEKEQQKNASIGLVTIIILVILAVLAWLFFK"
FT   gene            297505..298173
FT                   /locus_tag="A1S_0273"
FT   CDS_pept        297505..298173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0273"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10748"
FT                   /protein_id="ABO10748.2"
FT                   /translation="MSVAQLSKRDLILFDLDGTLVDSAADLYRSMNLSLQSLSWPLVTE
FT                   AQIREWVGKGASKLCESVLLHIFGKLDVEQHKVLLQKFVEVYGAELCVNTQIYPGVPEF
FT                   LKHCQTLNIKMACVTNKPVKLAQGLLDALELSSYFQVVLGGDSLPERKPHPLPLLHCME
FT                   SLKISASQSLMIGDSSNDIEAARRAGIDCIVVSYGYNHGENIYDCQPQQVVDSLAELIV
FT                   "
FT   gene            298282..299775
FT                   /locus_tag="A1S_0274"
FT   CDS_pept        298282..299775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0274"
FT                   /product="anthranilate synthase component I; TrpE"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10749"
FT                   /protein_id="ABO10749.2"
FT                   /translation="MTTLAQFEQLKAAGYNTIPVYRQRLADTETPLSVFARFKDQTQAY
FT                   LFESVEGGENWARYSMIGLGESTVFSCNAGVLSIQHADGSVTQQNCLDPFQYIREFQKQ
FT                   FKVPTAKLLPDLPSFTGGLVGYLGYDAVRYIEPRLKNVPAADPITLPDLWLMLSKTVIV
FT                   FDNLKDTLFLIVHADTEQSNAYEDAQKKLDQLEQLLATPVSLQARPHTPPHFESITGKA
FT                   KFLETVEKVKEYIRAGDVMQVVPGQRMVSDFDGEALQVYRALRHLNPSPYLFLVQGQTI
FT                   TDKKPFHIVGSSPEILSRLENGIATVRPLAGTRPRGKTKEEDIALEKDLLSDEKEIAEH
FT                   LMLIDLGRNDVGRVSKIGKVQVTDQMVIERYSHVMHIVSNVQGEVRDDIDALDVFKATF
FT                   PAGTLSGAPKIRAMEIIDEVEPVKRGVFGGAVGYLGWHGEMDMSIAIRTCVIRDKKVYV
FT                   QAGAGLVADSNPESEWNETQIKARAVIKAVELSSNGLIL"
FT   gene            299874..299949
FT                   /gene="trnT"
FT                   /locus_tag="A1S_0275"
FT   tRNA            299874..299949
FT                   /gene="trnT"
FT                   /locus_tag="A1S_0275"
FT                   /product="tRNA-Thr"
FT   gene            300006..300089
FT                   /gene="trnY"
FT                   /locus_tag="A1S_0276"
FT   tRNA            300006..300089
FT                   /gene="trnY"
FT                   /locus_tag="A1S_0276"
FT                   /product="tRNA-Tyr"
FT   gene            300127..300202
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0277"
FT   tRNA            300127..300202
FT                   /gene="trnG"
FT                   /locus_tag="A1S_0277"
FT                   /product="tRNA-Gly"
FT   gene            300216..300290
FT                   /gene="trnT"
FT                   /locus_tag="A1S_0278"
FT   tRNA            300216..300290
FT                   /gene="trnT"
FT                   /locus_tag="A1S_0278"
FT                   /product="tRNA-Thr"
FT   gene            300453..301643
FT                   /locus_tag="A1S_0279"
FT   CDS_pept        300453..301643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0279"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10750"
FT                   /db_xref="GOA:A3M1F6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1F6"
FT                   /protein_id="ABO10750.2"
FT                   /translation="MAKAKFERNKPHVNVGTIGHVDHGKTTLTAAIATICAKTYGGEAK
FT                   DYSQIDSAPEEKARGITINTSHVEYDSPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCAATDGPMPQTREHILLSRQVGVPYIIVFLNKCDLVDDEELLELVEMEVRELLSTYDF
FT                   PGDDTPVIRGSALAALNGEAGPYGEESVLALVAALDSYIPEPERAIDKAFLMPIEDVFS
FT                   ISGRGTVVTGRVEAGIIKVGEEVEIVGIKDTVKTTVTGVEMFRKLLDEGRAGENCGILL
FT                   RGTKREEVQRGQVLAKPGTIKPHTKFDAEVYVLSKEEGGRHTPFLNGYRPQFYFRTTDV
FT                   TGAIQLKEGVEMVMPGDNVEMSVELIHPIAMDPGLRFAIREGGRTVGAGVVAKVTA"
FT   gene            301704..301779
FT                   /gene="trnW"
FT                   /locus_tag="A1S_0280"
FT   tRNA            301704..301779
FT                   /gene="trnW"
FT                   /locus_tag="A1S_0280"
FT                   /product="tRNA-Trp"
FT   gene            301855..302295
FT                   /locus_tag="A1S_0281"
FT   CDS_pept        301855..302295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0281"
FT                   /product="preprotein translocase IISP family membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10751"
FT                   /protein_id="ABO10751.2"
FT                   /translation="MSNDKSRDALSDAPIPQRNNSAEVVRSGSPLDIVLWVIAIALLLS
FT                   ATMVNQHLPAYWAPANDVWVRVGVIFACIVVALGLLYATHQGKGFVRLLKDARVELRRV
FT                   TWPTKQETVTTSWQVLLVVVVASLVLWCFDYGLGWLIKLIIG"
FT   gene            302303..302836
FT                   /locus_tag="A1S_0282"
FT   CDS_pept        302303..302836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0282"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10752"
FT                   /protein_id="ABO10752.2"
FT                   /translation="MKRWYIIHAYSGYEKQVMRSLKERIQRSAVADSFGDVLVPTEEVV
FT                   EMKDGKKRKSERKFFPGYVLVEMEMNDDTWHIVKECPKVLGFIGGTPEKPAPITQREAD
FT                   AILARVRNTGEAPRPKTMFEPGEELLVIDGPFTDFKGVVEEVQYDKSRLTLTINVFNRP
FT                   TQVELEFRQVEKTI"
FT   gene            302945..303373
FT                   /locus_tag="A1S_0283"
FT   CDS_pept        302945..303373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0283"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10753"
FT                   /db_xref="GOA:A3M1F9"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1F9"
FT                   /protein_id="ABO10753.2"
FT                   /translation="MAKKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAA
FT                   TQKVEPGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLTRA
FT                   QLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVEL"
FT   gene            303377..304072
FT                   /locus_tag="A1S_0284"
FT   CDS_pept        303377..304072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0284"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10754"
FT                   /db_xref="GOA:A3M1G0"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G0"
FT                   /protein_id="ABO10754.2"
FT                   /translation="MAKLTKRQKAIAAAVEANKVYTLEEAVQVLNSLPAAKFKESLDIS
FT                   VNLGVDPRKSDQVVRGATTLPAGTGKTVRVAVFAQGAQAEAAKEAGADVVGFDDLAESI
FT                   QGGNLDFDVVIAAPDAMRVVGKLGTILGPRGLMPNPKVGTVTPDVAGAVKNAKSGQARY
FT                   RVDKAGIIHAAIGQVGFDAAAIRQNVETLVADLKKLKPATSKGVYIKKITLSSTMGPGL
FT                   TVDVNNVSN"
FT   gene            304392..304898
FT                   /locus_tag="A1S_0285"
FT   CDS_pept        304392..304898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0285"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10755"
FT                   /db_xref="GOA:A3M1G1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G1"
FT                   /protein_id="ABO10755.2"
FT                   /translation="MALLIEDKKQIVAEVSEVASKAFAAVVADYQGLSVEQLTTLRVEA
FT                   RKLGVTTRIVRNTLAKRAFQGTQFDILNDNLVGPTILGFSTSEDDMGAAARLFEEFAKT
FT                   NKAFELKAAAFDGKVYQGADVSVIANLPNQEKALTMLASVLQAPISKLGRLITALKEKN
FT                   ESEAA"
FT   gene            304941..305312
FT                   /locus_tag="A1S_0286"
FT   CDS_pept        304941..305312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0286"
FT                   /product="50S ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10756"
FT                   /db_xref="GOA:A3M1G2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G2"
FT                   /protein_id="ABO10756.1"
FT                   /translation="MALTNEEILNAVAEKTVLELVELISAFEEKFNVSAAAVAVAAPAG
FT                   GAAAAAEEQSEFNVELTSFGANKVAVIKAVREATGLGLKEAKDLVEGAPQVLKEGVSKE
FT                   EGEELKKKLEEAGATVTLK"
FT   gene            305618..309691
FT                   /locus_tag="A1S_0287"
FT   CDS_pept        305618..309691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0287"
FT                   /product="RNA polymerase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10757"
FT                   /db_xref="GOA:A3M1G3"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G3"
FT                   /protein_id="ABO10757.2"
FT                   /translation="MAYSYTEKKRIRKNFGKLPQVMDAPYLLSIQVDSYRTFLQDGKSP
FT                   KNREDIGLQAAFRSVFPIESYSGNAALEFVEYSLGKPEFDVRECILRGSTYAAPMRVKI
FT                   RLIIKDRETKSIKDVREQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDHDK
FT                   GKTHSSGKVLYSARIIPYRGSWLDFEFDAKDLVYVRIDRRRKLLATVVLRALGYNNEQI
FT                   LNLFYEKVPVYLDMGSYQIDLVPERLRGEMAQFDITDNEGKVIVEQGKRINARHVRQME
FT                   AAGLTKLSVPDEYLYERITAEDITLRDGEVIAANTLLSHEVMVKLAEGGVKQFNILFTN
FT                   DIDRGSFVADTLRADLTRDREEALVEIYKVMRPGEPPTKEAAENLFNNLFFSSERYDLS
FT                   PVGRMKFNRRLGRPYEVGTDQKSREVEGILSHEDIIDVLRTLVEIRNGKGEVDDIDHLG
FT                   NRRVRSVGEMTENQFRVGLVRVERAVKERLSQAETDNLSPQDLINAKPVAAAIKEFFGS
FT                   SQLSQFMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHQTHYGRVCPIETPEGP
FT                   NIGLINSLSVYAKANDFGFLETPYRKVIDGRVTDDVEYLSAIEEVGTVIAQADSAVDKD
FT                   GNLTEEFVSVRHQGEFVRMPPEKVTHMDVSAQQVVSVAASLIPFLEHDDANRALMGSNM
FT                   QRQAVPTLRADKPLVGTGMEANVARDSGVCVIANRGGVIEYVDASRIVIRVNEDEMVAG
FT                   EAGVDIYNLIKYTRSNQNTCINQNVIVNLGDKVARGDILADGPSTDMGELALGQNMRVA
FT                   FMTWNGYNYEDSILLSERVLQEDRLTSIHIQELSCVARDTKLGAEEITADIPNVGEAAL
FT                   SKLDESGIVYIGAEVTAGDILVGKVTPKGETQLTPEEKLLRAIFGEKAADVKDSSLRVP
FT                   SGTKGTVIDVQVFTRDGLEKDDRALAIEKAQLDSYRKDLKEEYKIFEEAARERVIRLLK
FT                   GQESNGGGSTKRGDKLSEDLLSGLELVDLLEIQPADEAIAERLTQIQVFLKEKSAEIDE
FT                   KFAEKKRKLATGDELTTGVLKVVKVYLAVKRRIQPGDKMAGRHGNKGVVSNILPVEDMP
FT                   HDANGVPVDIVLNPLGVPSRMNVGQILETHLGMAAKGLGDKIEKMLKEQRTVLELREFL
FT                   DKIYNKVGGEQEDLDSLTDEEILALAGNLRAGVPLATPVFDGAEESQIKDLLELADISR
FT                   TGQTVLFDGRTGEQFDRPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQF
FT                   GGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGRTRIYKNIVDGNHYMDPGMPESFN
FT                   VLTKEIRSLGINID"
FT   gene            309792..313985
FT                   /locus_tag="A1S_0288"
FT   CDS_pept        309792..313985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0288"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /note="Transcriptase beta' chain; RNA polymerase beta'
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10758"
FT                   /db_xref="GOA:A3M1G4"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1G4"
FT                   /protein_id="ABO10758.2"
FT                   /translation="MKDLLDIMRKKTDSDGHAPVEFDRIRIGLASPEMIKSWSHGEVKK
FT                   PETINYRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKYKGVICEKCGVEVTTAKVRR
FT                   ERMGHIELASPVAHIWFLKSLPSRIGLLLDMTLRDIERVLYFESYVVTDPGMTPFEKYQ
FT                   LLNDEEYFTALEEHGDEFVAKMGAEAVQDLLKDIDLEAEISRLREEIPQTTSETKLKKA
FT                   SKRLKLMEAFKDSNNKPEWMVMNVLPVLPPDLRPLVPLEGGRFATSDLNDLYRRVINRN
FT                   NRLKRLLDLAAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQ
FT                   GRFRQNLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIFAKLQASGQATTI
FT                   KAAKKMVERETPEVWDVLASVIRQHPVMLNRAPTLHRLGLQAFEPILIEGKAIRLHPLV
FT                   CAAFNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYY
FT                   ITRDAVNAKGEGMVFADTHEVNRALATGQVAIHARVKVRVHQTVINENGEREQQTIIVD
FT                   TTPGRCLLWEVVPEGLSFDMINLEMTKKNISKLINSCYRKLGLKDTVIFADQLMYLGFR
FT                   QATRSGVSVGMEDMLIPPTKHTIIDKAETEVREIEQQFEQGFVTAGERYNKVVDIWART
FT                   NDQVAKAMMDNLSYTLVKNKQGEDEKQKSFNSIYMMSDSGARGSAAQIRQLAGMRGLMA
FT                   KPDGSIIETPIKANFREGLTVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDL
FT                   VITEPDCGTSGGLVMTPFIQGGDVIEPLRDRVLGRVTAEDVRRASDDEVVLPRGTLIDE
FT                   KIAAQLEEAGVDEVKVRSVIACESTFGVCAKCYGRDLARGHLVNPGESVGVMAAQSIGE
FT                   PGTQLTMRTFHVGGAASRTSAANSVQVRNKGTVRFHNVKTVQHAKGHLVSVSRSGEIGI
FT                   ADELGRERERYKLPYGASILLKDGELVEAGGIVATWDPHTHPLVTEVAGKARFSQIADG
FT                   VTATSKTDDATGMTTVEILPVTARPASGKDLRPAIVLDTTDGGEQFYFLPQNTIVTVRD
FT                   GETIGVGDVIGRVPQESSRTRDITGGLPRVADLFEARKPKEHAILAEVSGIVSFGKETK
FT                   GKNRLVITPDDGSEIYEELIPKWRQINVFEGEHVNRGETISDGPQNPHDILRLKGEVAL
FT                   TNYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKVDIIDGGDTSFIKGEQVDYIRVVQE
FT                   NQAVLAQNKFPAKFERQLMGITKASLSTDSFISAASFQETTRVLTEAAVTGKEDDLRGL
FT                   KENVVVGRLIPAGTGLAYHLERRRQEAEAAEHALHNDFSEVDQAFSQALNSEQF"
FT   gene            314152..314517
FT                   /locus_tag="A1S_3492"
FT                   /old_locus_tag="AS1_3492"
FT   CDS_pept        314152..314517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3492"
FT                   /old_locus_tag="AS1_3492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3492"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89917"
FT                   /protein_id="ABS89917.2"
FT                   /translation="MKKMMMIAGVGLMSTTLFVGCQNASPESKRIGSAAIGGGAGGAVG
FT                   KHVGGNIGAGLGAALGAGVAANAKGSSSKTVRNSAIGAGVGAILGGAVIGGDAGAAAGG
FT                   ALGGSAGAAYEEKKGKY"
FT   gene            314780..315088
FT                   /locus_tag="A1S_3493"
FT                   /old_locus_tag="AS1_3493"
FT   CDS_pept        314780..315088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3493"
FT                   /old_locus_tag="AS1_3493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3493"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89918"
FT                   /protein_id="ABS89918.2"
FT                   /translation="MFTGCQNMSPSDQRIGAAAAGGALGGGLGNHVGGGIGAGLGAAVG
FT                   AGVGSNTQGGSKQTTTKSAIGAGIGSVVGKAIIGGDTGAAIGGAIGGGAGAAIEEKK"
FT   gene            complement(315117..315614)
FT                   /locus_tag="A1S_0289"
FT   CDS_pept        complement(315117..315614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10759"
FT                   /protein_id="ABO10759.2"
FT                   /translation="MAILKKLQNIPSISKFLFNHYPPYRGAGIYIEVMNLELCHVRVKM
FT                   PLTWKNQNLVGTHFGGSLYSMVDPFYMLILMHHLGSKYIVWDKAAEINFLSPGRSTVYA
FT                   DIRVDLAEIEQIRELAENYAPVLRTYHLNIFDESGVRIAEVQKTLYIRRKKAKPSTNKI
FT                   SA"
FT   gene            315738..316610
FT                   /locus_tag="A1S_0290"
FT   CDS_pept        315738..316610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10760"
FT                   /protein_id="ABO10760.2"
FT                   /translation="MQPKIYAVTTSDQQTLCAKAWGDEKNTPLVLVHGYPDNQEVWESV
FT                   IEHLINDFYIVTYDVRGAGLSSIPKRIRDYRLERLSLDLQEVVDEVIPNRQFHMAAHDW
FT                   GSIQSWESATEPKFKGRLLSYTTISGPCLDHAALFLREKFKTSPAQILKILTKSWYIGA
FT                   FHLPLIAPTVWSLFSPEKWGKILKDLERKDNLPLNSNISSDGKYGINLYRANFIPRLTS
FT                   PRQRYAQCPVKAIILKYDTFVSPEYITEAMPKWVENFEYVELEANHWAILSQAEKVAAH
FT                   IRQFIDSQS"
FT   gene            316715..318139
FT                   /locus_tag="A1S_0291"
FT   CDS_pept        316715..318139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0291"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10761"
FT                   /protein_id="ABO10761.2"
FT                   /translation="MNAVVIAIAVMFLLSLARVSVVLTLVVSAIVGGLVAGLSLSQTVE
FT                   AFNAGLGDGAEVALAYAVLGAFALALSKSGLPDLLAHKLIGLLGMEAGKSRETKVKYLL
FT                   LGILLIAAIFSQNLIPVHIAFIPVLVPPLLRVMNHLKLDRRAAACVLTLGLVGTYIFLP
FT                   VGFGAIFLEQILMGNINKIGAAYGLHVERGMMPIGMAIPVLGMVLGTLVAVFISYRKPR
FT                   IYADRSISPVTTIDLDKPLRATAQDETADLKADAEELKHEAEQGPVIAKKTIFMALLAI
FT                   GLTLVAQLYSGSMILGGLVGFAVLSTAGIFKWQDADDVFVQGMRMMALVGFIMISAAGF
FT                   ASVMTHTGDINQLVKGVVEIIGDNRALAAFLMLCIGLFVTIGIGSSFSSVPVLAVIYVP
FT                   LCVQFGFSPLATIALIGTAAALGDAGSPASDSTLGPTAGLGVDGQHDHIWDTVIPTFIH
FT                   FNIPLLIFGWIAAMVL"
FT   gene            318464..319045
FT                   /locus_tag="A1S_0292"
FT   CDS_pept        318464..319045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0292"
FT                   /product="putative outer membrane protein W"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10762"
FT                   /protein_id="ABO10762.2"
FT                   /translation="MFKKALVIALMGVSSFTFAGNWQVKFGGSVIAPSEDTTTALGVVK
FT                   ADHEYAFTPSVEYFFGQSPFSAELLLATPVNHDVLLDGQKVARIKQLPPTITAKYHFKN
FT                   STRFTPYIGIGATAFIPWDEQGVADKVKEDFGVAGQIGFNFQPADAKNWGVFVDVRYAD
FT                   ISPEVTLTNGAKFDLDINPFVYTLGYSYKF"
FT   gene            319229..319582
FT                   /locus_tag="A1S_0293"
FT   CDS_pept        319229..319582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0293"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10763"
FT                   /protein_id="ABO10763.2"
FT                   /translation="MNRKFAMGLALFSGLAFTHSLQAASFSCNAAKTKTELSICKNRSL
FT                   NDADVKMATTYQIVLHALPMGGRDNQKDTQQQWLKKRNACAANVSCISKAYQQRQKQLD
FT                   TILQDRVLSHGPF"
FT   gene            319748..321599
FT                   /locus_tag="A1S_0294"
FT                   /note="contains frameshift; similar to chaperone Hsp90"
FT   gene            complement(321686..322333)
FT                   /locus_tag="A1S_0296"
FT   CDS_pept        complement(321686..322333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10764"
FT                   /protein_id="ABO10764.2"
FT                   /translation="MAVFGNDTLWSRAVQHKHPYKTFGKIKKKASTPHVSENNPLTASW
FT                   NTISTWMPFENDLDLGSNSESDVYVQFLAKKKWNLRHNISLDTEQIFRYGSTSRNYTET
FT                   TLNLTQKMQDNTLFSNTFNVNKSGKEDYNWGNWTFQQFEFVKDNRLTYGIYSGGVYANN
FT                   DIRLNSWGPYISWRQPIWRDWIFMQNDLNFFNYLDNDPKHQLSVQMNLEANF"
FT   gene            complement(322710..323849)
FT                   /locus_tag="A1S_0297"
FT   CDS_pept        complement(322710..323849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0297"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10765"
FT                   /protein_id="ABO10765.2"
FT                   /translation="MKTFHIITYRQLFALLTLGFGSVCMAHAEVNSSSTQQVNGLSSGA
FT                   QAEENKDENLLDQIPRWIDATPTIFPEQSNEPIVPPTEQTEDQTWFDRKQKKIRNWADR
FT                   TSGKIDNWFGEVDPQKPASATIRVMIDNYWNEYDNYEIKPRIRGKIKLPTLEKRLSVVF
FT                   GDDSLDDEFNNSPANINQNPNQDPNKKLDGKRTRDDNSSIALRWSNFSKKLPFETDADL
FT                   GIRSGDDIYVRLKASRDWQLRNDFKFYAEQIYRYGIDSENYLRTNLELTHARPNQPILS
FT                   NQFSLTYADDQDDDLTWENRLFREHSFFANNRFNYGIYTGGYYNDNDLRLNSWGPFVSW
FT                   RQPVLREWFFVQGDLNYFNDHREDRNHYVSTFLRLEALF"
FT   gene            complement(324208..324912)
FT                   /locus_tag="A1S_0298"
FT   CDS_pept        complement(324208..324912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0298"
FT                   /product="putative polyketide biosynthetic
FT                   dithiol-disulfide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10766"
FT                   /protein_id="ABO10766.2"
FT                   /translation="MRVDVWSDVVCPFCYIGKKRLEHVAAEAGIELDIHWHSFELDPDA
FT                   PAKHDTSNTERLAKKYGRTYEEMEEMERNIAAMAASEGIDFQWQKANSGNSFNAHRIIH
FT                   LAQSKGLGNEAKEAFFHAYMTEGLAIGEREVVEEIASRIGLDNAEVEYVLDTNELADFV
FT                   RHDEKIAHEQLNVTGVPFFVFDQRIALAGAQPREVFLQVLEQAQLKANAENIEQDDAAV
FT                   CNDETCDIPQNK"
FT   gene            325090..325848
FT                   /locus_tag="A1S_0299"
FT   CDS_pept        325090..325848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10767"
FT                   /protein_id="ABO10767.2"
FT                   /translation="MRRVLIAIASLVVITSIVFFTYQHIKQQQAKDSSQMFDVVMTEKM
FT                   NQLYDQAQDWTKPVQLDIHDKRLAGHYKQVSEFLLSYWVQNVNARNEYLRELKAAKLDT
FT                   FLNVDRLDHDKKQKYAETEKMLADVRRASDKYQSEYEKIHKTFLAKIQELSVDKEMRQI
FT                   LEIKLGAQQKADQDHAIFMIELQILDKAEEMFKLLKTYPWQKKDQMILFHENAQVKKFN
FT                   ALYQDVLKLNAKIEKIKKKNVAALEGELKE"
FT   gene            complement(325870..326235)
FT                   /locus_tag="A1S_0300"
FT   CDS_pept        complement(325870..326235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0300"
FT                   /product="transcriptional regulator MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10768"
FT                   /protein_id="ABO10768.1"
FT                   /translation="MNLAKVSELTKVSPRMLRYYENLGLIQPHRASNNYRSYTQKDIEN
FT                   IKKIKILNDAGMNLKDIHVLLPCFDLDERVFTLCPVVQEKLQTELKHVSDQLNKLQTSQ
FT                   SLLQSFLAKGKAESTNI"
FT   gene            326395..326952
FT                   /locus_tag="A1S_0301"
FT   CDS_pept        326395..326952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10769"
FT                   /protein_id="ABO10769.1"
FT                   /translation="MRQIFVLHGYSASINDHWFLDLKHQIEDENTTVTLIPFPDSEHPD
FT                   VDAWQKVLDEQIPAVNENTYFVAHSLGVITLLHFLQRHDYQNIGGMILVSGFSGPISDS
FT                   SPLSPYITKSKVDTNYFRDIKKKLVYLSDNDDLVPPQLTIQLAKDIDAPYITVPNGGHF
FT                   LGREGYTEFPQLVDSLKEMLEN"
FT   gene            complement(327021..327737)
FT                   /locus_tag="A1S_0302"
FT   CDS_pept        complement(327021..327737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0302"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10770"
FT                   /protein_id="ABO10770.2"
FT                   /translation="MNFKILNQNILMSCLLASFFLTGCVSNRIIGENTRELFTKYDSGY
FT                   EWITLTEDDVIAFGKPSVSLPNEPEDSIVIAGKKYSYVISKGGNDFIQLISQLNPQYIQ
FT                   ISNELDFNAPASNSNHFYGHIRFSYTPPNGKLNEKESALFKQYGVIPCDYEKTLELHKF
FT                   ELNLRGTVYPPVNNLKKITPLSKPYHVRIQYLHDKSGKVPLSTKEKLASLPLLPFTLTF
FT                   DIIALPAKVMGIIYQP"
FT   gene            328013..328504
FT                   /locus_tag="A1S_0303"
FT   CDS_pept        328013..328504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0303"
FT                   /product="putative peptide signal"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10771"
FT                   /protein_id="ABO10771.2"
FT                   /translation="MNFLKQSAFIAVFAFMGLPTVQAEEVATLPTIRVMAESELREEVG
FT                   FVPFQEDKKVRQALQHREYKTHNDIQNALVPEGMTTVDYQPVMAQPDLSQLSPFLREYI
FT                   LAVAGGIQSSDPTNGLFEMLKPLQINRSNVDAYREGTMKVNLDDILKLQQQIQDGLKGR
FT                   "
FT   gene            328558..331536
FT                   /locus_tag="A1S_0304"
FT   CDS_pept        328558..331536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10772"
FT                   /protein_id="ABO10772.1"
FT                   /translation="MKNKRCGIIGVTILFKNKDMSTQLIAHLKKKCEADDNVKILLSQW
FT                   EFDQKLVGKALENIGGFYPHFSNHNASHSQQILVNIERILGNDIDLLTATDTWLILEAA
FT                   YWHDVGMLVDAKSAKDVHGNEDFQFMVKTIAHDKGHDLHTFCLAYEQSDWVGAIGSEDH
FT                   PFDGVEKYRQLIAEWFRRNHDKRIGGLVEDPFEFLNITSPRTELLPKRIYRYLGKICMS
FT                   HGMNFTDLMEKLPFKQTGLGTEDCHPRFIGCLLRLGDLFDLDDNRFCPVMAKHVSHQPR
FT                   LSKAHEDKHLSLREFQLDERTVKLVAECPNEMSYVETQNWFGWIREEFQNQMSQWNLIV
FT                   PNFKFGSLPTIEQLDVKMEVKYENGIRKEKILLHNKPMKFTIDEKNGIELLQGANLYKN
FT                   KLSIYRELIQNSIDSTMLRVWLENKDELIDLNPYDQKYLNIIKNYQLIIDLEKVKDIES
FT                   SLDSVWELSIKDKGIGISQNDLFYMQKMAGSDKNLEKKRIINEMPLWMRPSGKFGIGLH
FT                   SAFLLLENTLEDTDKKIKFKTCSYFNNENLEVEMFSPLGGKQGFCFINKIQDNLKHEYG
FT                   AEFLIKIKRKFILSYRGLYRKKSPVRWSREFIDDNWKKNLIDNIYRNIVLNSPINPKKD
FT                   IEDILWDADRCVAFKFDILSSNDFFGFRGQNTSFRSKSYHKFLCGIYIDYYNLDPSKAL
FT                   NISRDTWNLKFVNKIEEDIFYYMGEYVRKIKNENTSLLRKLYYNKLSIDCVDDGQWKDF
FT                   VFKFSGENKSINDLNKIEEFYIISNSDYPDNGYNSEFISSINKVKFFVVEERVALQIKL
FT                   LVEEFSNEVFPEHRALQMVDNQFLHYRCFYFSKRKSKPLSKVLDKKLYWGEIIKKSIEE
FT                   NINYSIEMCFKAMQVFTKLQLKNDYYYGTKTWYSYLMGVSVIRDVEIISDYKILCIKEG
FT                   EEEVVINPYQVVDNRIELTNLEELSALLVSYLNIDMSEYQKILHDYKRLQLKIEKDLGI
FT                   YIQ"
FT   gene            complement(331587..332759)
FT                   /locus_tag="A1S_0305"
FT   CDS_pept        complement(331587..332759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0305"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /note="Fatty oxidation complex beta subunit;
FT                   Beta-ketothiolase; Acetyl-CoA acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10773"
FT                   /db_xref="GOA:A3M1H9"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1H9"
FT                   /protein_id="ABO10773.2"
FT                   /translation="MATLNPRDVVIVDGVRSAMGKSKNGMFRNVRADSLSAELVRALIA
FT                   RNQFDVNEVEDLIWGCVNQTLEQGMNIGRNIGLLAGLPKTVAGQTVNRLCGSSMQAIHT
FT                   AAAQIATNQGDIFIIGGVEHMGHVGMMHGIDLNPEASKHYAKASNMMGLTAEMLGRMNG
FT                   ITREEQDTFGVESHRRAWAATQEGRFKNEIIGVEGHDANGFKILCDIDEVIRPDANLEA
FT                   FKALKPVFDPKGGSVTAATSSALSDGASAMLLMSAERAQALGLKPRAVIRSMAVAGCDA
FT                   AIMGYGPVPATQKALKRAGLSIADIQTVELNEAFAAQGLSVLKGLGLYDKQDIVNLNGG
FT                   AIALGHPLGCSGARITTTLLNVMEQQDTQIGLATMCIGLGQGIATVIERV"
FT   gene            334235..334474
FT                   /locus_tag="A1S_0306"
FT                   /note="contains frameshift; similar to fatty oxidation
FT                   complex alpha subunit"
FT   gene            335498..336412
FT                   /locus_tag="A1S_0308"
FT   CDS_pept        335498..336412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0308"
FT                   /product="beta-hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10774"
FT                   /protein_id="ABO10774.2"
FT                   /translation="MIKWIILAIFVISALYIQHRGKVRHSFYRQFFDHSTLLAPINFLM
FT                   YIFSKVPNQPYIDTQHFKDLKVLDENWEMIRDEAKALYDQGGIKASSTYNDLGFNSFFK
FT                   TGWKRFYLKWYESSHPSAAELCPKTTALLKTLPTIKAAMFTELAPDSRLVRHRDPYAGS
FT                   LRYHLGLITPNDDRCFIDVDGERYSWRDGQSVVFDETYIHYAENKTDQNRIIFFADVER
FT                   PMKVKWMERFNHWFGRNVMTAASSPNETGDQTGGLNKAFGYVYQIRIKAKALKAKNRKL
FT                   YYFLKWFLMLGIFFLIFVRPYVF"
FT   gene            336585..337115
FT                   /locus_tag="A1S_0309"
FT   CDS_pept        336585..337115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10775"
FT                   /protein_id="ABO10775.2"
FT                   /translation="MAHAHHAAHAYVHHIKVRKEESSQGDLKTKAMLSKASSGNKKLHR
FT                   PASKRHKSEDQNIDLHKFSSKLESMSAKHSKEKCAKNIRIALQAAGADVSKHPVAASDW
FT                   GQTLEKNGYKKIKPAFNRPQEGDIYIIERTSGHTYGHIAGYTGNGWFSDFRQKTYAVYK
FT                   EKDVKYSYYRLDS"
FT   gene            337240..339048
FT                   /locus_tag="A1S_0310"
FT   CDS_pept        337240..339048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0310"
FT                   /product="EsvL"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10776"
FT                   /protein_id="ABO10776.2"
FT                   /translation="MPIVNQNARPHIEKILANLTQLPGVYKMLGKEGELLYVGKAKNLK
FT                   NRVSSYFVKTIEHPKTQALVARIYDIETLVTRSETEALLLEQNLIKQHRPPYNIMLRDD
FT                   KSYVYIFVSADKPYPRIASGRGKGKHQIGKFFGPYPSAYSARDTLLVLQKLFNVRQCEN
FT                   SYFSQRKRPCLQYQIKRCSAPCVGLVSPEDYKEDVNNSIRFLQGDTKELNQELIAKMEQ
FT                   AAADLEFEKAVFYRDRLSLLREVQAQQAVFKVKGEADILAIAYQAGVTCVQIMHVRNGR
FT                   MLGGKSYFPDMLGDDLGQMLSDFMANFYFQVADEVPSELIVNTALPDRKELEEALAQQF
FT                   GKKVQIKSSVRETRAEWLELAEMNVQHAIKGQLSNHLELNERFHQLEQVVGRPIDRIEC
FT                   FDISHTMGEAPIASCVVFDQGGARKRDYRQFAIQDITAGDDYAAMRQALTRRYKKAMLP
FT                   DLLLIDGGKGQLHMAMEVMQELGLEAFMVGVSKGEGRKPGLETLHFTDGTKIQLPEDSK
FT                   ALHLIQQVRDEAHRFAITKHRAKRDKRRSTSVLEAIPGLGPKRRRDLLTHFGGIQGVLK
FT                   ASEKELTVVPGLGEVMARTIYKILHE"
FT   gene            339169..339963
FT                   /locus_tag="A1S_0311"
FT   CDS_pept        339169..339963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0311"
FT                   /product="putative acyl-CoA thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10777"
FT                   /protein_id="ABO10777.2"
FT                   /translation="MSLLHLWEDVKQNEWIDIPAGWLQGRTVFGGLVAGLLMQKACSYI
FT                   QDSNKRLLSCSVTFVGPVQQGAARLTIEVLREGKSVTTLEARLWQDDAVQTILVASFGA
FT                   SRASSIEVKQEPVVPAYVSPENLSVIPFAKHMPECFQHFEVCWAEGNYPVTGSKHPDFG
FT                   GWSRFSPEQHANRQMTLSDLIVLMDIWPPGVLPMFKQVAPASSLSWHITYVHPVRHQLC
FT                   DWFKYKVTTEYAAEGYSTEYAYLWDQNDHLIAILRQTVTVFT"
FT   gene            340082..340669
FT                   /locus_tag="A1S_0312"
FT   CDS_pept        340082..340669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0312"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="Phosphatidylglycerophosphate synthase; PGP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10778"
FT                   /protein_id="ABO10778.1"
FT                   /translation="MTTGRILNIPNILTLARIALIPVFLVIAYWPPAIGIGEHVGSMTR
FT                   HIILTAIFVLAAVTDWFDGYLARTLNQTSAFGRFLDPVADKLMVAAALIVLVQWKPTIA
FT                   MAFAAIVIISREITVSALREWMAELGARTSVAVSTVGKYKTAFQMIAISVFLLNWQPLE
FT                   VLAYALLYTAVILTLWSMFIYLKAAWPYLKQP"
FT   gene            complement(340740..340835)
FT                   /locus_tag="A1S_3494"
FT                   /old_locus_tag="AS1_3494"
FT   CDS_pept        complement(340740..340835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3494"
FT                   /old_locus_tag="AS1_3494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3494"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89919"
FT                   /protein_id="ABS89919.1"
FT                   /translation="MWQSQQIAEKKAFASVTSLGTQSYFKVAKTP"
FT   gene            340976..341642
FT                   /locus_tag="A1S_0313"
FT                   /note="contains frameshift; similar to hypothetical
FT                   protein"
FT   gene            341642..342253
FT                   /locus_tag="A1S_0315"
FT   CDS_pept        341642..342253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0315"
FT                   /product="DNA repair system"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10779"
FT                   /protein_id="ABO10779.2"
FT                   /translation="MTLDLFSPEPCSNLLPYDGEVQDYGCILTAEEAEQYFHYLYHHLA
FT                   WRHDEAKLYGKHFITPRKVAWYGDEHYRYKYSGVFRDSLPWDKALAQLKQQVEQILSEK
FT                   FNSCLANLYEDGTQGMAWHSDSDVSLARTTTIASLSFGATRKFSFRHIQTKEKVEMWLQ
FT                   PGQLIVMRGETQQYWQHRLNRSTKILQPRINLTFRQFKFS"
FT   gene            complement(342448..343221)
FT                   /locus_tag="A1S_0316"
FT   CDS_pept        complement(342448..343221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0316"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10780"
FT                   /protein_id="ABO10780.2"
FT                   /translation="MAISSFGKILTVLDLFSVSRPVINVDIICEELGLSKPTSYRYLKE
FT                   LVSADLLKRINGTSGDYTLGSKIAVLDYVSRTTDPLVQISTPFMRNIVERTELCCLLTY
FT                   LNDDYCIDIHHEIFKDTELLSYGRGCPRPIYVGASPKTMVSHLSKQRMHDYYERFQHEL
FT                   SESGFAVDEPSFIQRMRKIKKQGFYFSQGEIDPNVSGLAVPVRFSSKEVPLALTLVASK
FT                   NRFDFLNIEKLIEILQENAALIEQRFMELSEKGEI"
FT   gene            343717..345816
FT                   /locus_tag="A1S_0317"
FT   CDS_pept        343717..345816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0317"
FT                   /product="putative fusaric acid resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10781"
FT                   /protein_id="ABO10781.2"
FT                   /translation="MLLKQILAFRPSKLDLIFAIKTFIAGMLALFVSFELDLINPMWSI
FT                   GTVLIIANPYSGMVSSKCVYRLLGTVGGAIIALTITPHLINTPWIFTVVLSLWVGFALY
FT                   VSLLDRTPRSYAFMLAGYSTAMIVYNAITYIDQYNIFDIALARVLEISIGVISSAVVSA
FT                   TILPMHIGSAIKQRVTKTLKDTENLFANLLNADQQQNNTQLLAAITRDTTDIHALAVHL
FT                   SYEKGELHGMTKPLQEMLHQMSMVVANLVALSERIKQLQELNFIESHSDKLKQLSGHVI
FT                   HFLEQKDQMTDENILQLPDEFENDFLNLNDSASEHQQVLLAAMKMDVRHFISNVLAVKV
FT                   LWQRIKQGNKEIPDNITPMTTTYPSLHRDHGVAVRGGISAVLITFIVTGVWILSGWKAG
FT                   FMMAQIGAVTACILTALDNPVPVLRIFIWGSVASAVLVFIYAFGIFPHVTTFWELGLVL
FT                   LPMFLFAVSMMANQALMPVGMVLGINTMMGLNLHNAYSMDAVSYLDSSFGMVMGVLVSL
FT                   VVIDVVRAMSPDTSANRILALHYRAMRQAIYIPYGIEFKVHLRGMLDRVGVLNTKMVQS
FT                   EEIKKSIQQALVESSAIIDLSRLQELANQVPTSSELAHHIGRLQQDLDELFRAKENEKG
FT                   ESDVLVQHIHQTLFELKQLASNIEDMTLRQRLFISLNNIAYSMCHVSSNQMNADRTLTG
FT                   ATAHG"
FT   gene            345809..346015
FT                   /locus_tag="A1S_3495"
FT                   /old_locus_tag="AS1_3495"
FT   CDS_pept        345809..346015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3495"
FT                   /old_locus_tag="AS1_3495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3495"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89920"
FT                   /protein_id="ABS89920.2"
FT                   /translation="MGEFNVYGIYVPALLVQAIFAYICFRWLSPLTNKWIAQGWIALPS
FT                   IFNLCFYLLLLLVIHQIFVGLGA"
FT   gene            346055..347056
FT                   /locus_tag="A1S_0318"
FT   CDS_pept        346055..347056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0318"
FT                   /product="Putative FusE-MFP/HlyD membrane fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10782"
FT                   /protein_id="ABO10782.2"
FT                   /translation="MNQLELKKVIRPVILIVALMIAVYTIVHLWNYYNAAPWTRDGRVR
FT                   GDVIQVSSDVAGLVTEVLVQDNQTVKKGQVLFKIDVSRRALDVEQAKSDLAKAKAAYAQ
FT                   AQAGLAQAKANLIKSSTNIKLAEKNANRYSNLMDGAISKQEQDQVFATRDQSHAEHEQL
FT                   QAAIQQAEATIKQQQALVEAATSNLHLAELNMHRAAVVAPADGTLSNFDLRPGNYVQVG
FT                   QAVAALLDRKQLYVVGYFEETKLDRIHIGDEATVQLMGDRQKIKGHVQGIASGIEDRER
FT                   SSSSKLLANVNPTFSWVRLAQRVPVKIVLDEAPKNELAFVSGRTATVHIIEK"
FT   gene            complement(347113..347553)
FT                   /locus_tag="A1S_0319"
FT   CDS_pept        complement(347113..347553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10783"
FT                   /protein_id="ABO10783.2"
FT                   /translation="MTATQSKSIMAFDFGTQKMGMAIGQSAIESANPLPLFVMKDGIPN
FT                   WDQLLKIVKEWQPDLFIVGLPLNMDDSESELSTRARKFARRLRHQTNIETWMVDERLTT
FT                   REAREELGFYQEQGRAKKLSADSFAAALLIQSWYRNPVGLTP"
FT   gene            complement(347553..348092)
FT                   /locus_tag="A1S_0320"
FT   CDS_pept        complement(347553..348092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10784"
FT                   /protein_id="ABO10784.2"
FT                   /translation="MTHRCLIAPPEMADDFFANTVIYLARHDEEGAQGIIINRPAGIQI
FT                   KELLNDLDIDADNVNPHEVLQGGPLRPEAGFVLHTGQPTWHSSIAVGENVCITTSKDIL
FT                   DAIAHNEGVGRYQIALGYASWGKNQLEDEIARGDWLICDADMDLIFNLPYDDRWDAAYK
FT                   KIGVDRTWLASEIGHA"
FT   gene            complement(348234..349901)
FT                   /locus_tag="A1S_0321"
FT   CDS_pept        complement(348234..349901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0321"
FT                   /product="recombination and DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10785"
FT                   /protein_id="ABO10785.2"
FT                   /translation="MLTHLTLINFALADHLAIDIEQGFNVLTGETGAGKSLLLDALSAC
FT                   LGERTDTNYVRYGSDKADVTAVFTYQDNSPEAKWLKEHELDDDSGEIHLRRVIFATGRS
FT                   KAWVNGRPSSLSELKELGRLLVQLYSQHSQQQLLEPPYPKHWLDRYSNFYAEANDVREA
FT                   YSTWQRNIRQHQAALDAQATRLQRIATLELQIEELEEIIQTDYKEIEQEFDRLSHHEHI
FT                   MQDCSYSLNALDEAEQNITQEMSSIIRRLESHAGRSEQLSEIYNSLLNAQSEIDDATSN
FT                   LRQFIDRQSFDPERMEELNSKLEVFHRLARKYRTQPETLKEEYETWQSELEQLHQLEDP
FT                   ETLAEQVEKSHQEFLEKAQHLDNIRREAAAPLAKQLTEQVKPLALPEAHFEFKFEPLEQ
FT                   PNAEGLSFIQLLFTANKGIPPQPLARVASGGELSRIALVMQVMNAEKTEAEVLVFDEID
FT                   VGISGGTAEVVGRLLADLAQHVQLLCITHQAQVAAQSDQHLLVKKQQTDPASSTIVQLD
FT                   ENQIISELARMSGGVEINETTLQHAKQLRQLKFQASST"
FT   gene            350016..351326
FT                   /locus_tag="A1S_0322"
FT   CDS_pept        350016..351326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10786"
FT                   /protein_id="ABO10786.2"
FT                   /translation="MKKTLSLPKAPIGMINRHKKTNPAEMNKILNQHFNAFKQAAAQGD
FT                   YVKAYQHVKKAVSLVPSHPGALSDLAYTELRLRRYDDAYQHYMQAIKASGSNVNTNLYD
FT                   GLTEVCHHLNKKEEKIKFGRLAISTKKELTKNEPTLNIPTHKPVPFSPNPQENIIVFSL
FT                   FGANPRYCETSILNTKLAQEIYPEWTCRFYVDESVPELVQQRLQANGAQVVHVSPTQKQ
FT                   LSGLFWRFLVMDDPVVKRFLVRDADSIVSYREKAAVDAWLKSDQWFHLMRDSYSHTELI
FT                   LAGMWGGCTGIFHNIEAHIRDYVATGRYPDNRVIDQHYLRYCIWPTLKQSVLVHDSQQF
FT                   DENSADFPVYDLTSMQNDQDNFHVGMDNGSPVVTTAVNHPTAEKVYWILFDENHDEVCR
FT                   YDAIVSKSRNIEVNLPHAFAKKIQLQQWKLQVYPYEN"
FT   gene            351403..351729
FT                   /locus_tag="A1S_0323"
FT   CDS_pept        351403..351729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10787"
FT                   /db_xref="GOA:A3M1J3"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1J3"
FT                   /protein_id="ABO10787.2"
FT                   /translation="MSSTQFDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVILPTE
FT                   QPLTFETHVPERMEIISGECRVKIADSNESELFRAGQSFYVPGNSVFKIETDEVLDYVC
FT                   HLEG"
FT   gene            351831..352580
FT                   /locus_tag="A1S_0324"
FT   CDS_pept        351831..352580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0324"
FT                   /product="putative tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10788"
FT                   /protein_id="ABO10788.2"
FT                   /translation="MAKPEYYYGVHSVESLLELEPERVLTLFTLKGRDDQRLQKILQLA
FT                   EPFGISVQKASRDSLEKLAGLPFHQGVVAAVRPHPTLNEKDLDQLLAETPDALLLALDQ
FT                   VTDPHNLGACIRTAAAMGVQAVIVPRDRSASLTPTARKVAAGGAEKVKFIQVTNLARTL
FT                   AHLKETTHVRVIGTMLDENALPIQKCDFSGAVVIVMGAEDTGLRPITQAQCDQKAYIPM
FT                   SGNLQSLNVSVATGMALYEACRQRSEV"
FT   gene            352616..353533
FT                   /locus_tag="A1S_0325"
FT   CDS_pept        352616..353533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0325"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10789"
FT                   /protein_id="ABO10789.2"
FT                   /translation="MSPRTQGYFFVLVTMCIWGGFTLFARLNAQWHISAWDIAALRFAI
FT                   AFLILMPILIYKKDLAFLWSKHAVILALIGGVIYCLTVYTAFLYAPAAHAAIFLNGCIP
FT                   ICTAIAAYILFRQPFDKHTWVSLAIMITALALMSALMLQSSTSAFGIGDLLLFISAIWW
FT                   GIFTVLLKQWKLSAWHSMASVAIWSAIIYLPIYLLFLPKHFMDVDPLHLAVQSIFHGVF
FT                   VVIIATLTYVAAIQRLGAFKTGSIVTLAPFIAAILAVPLLGESLSPSIVVGLVGMGIGA
FT                   LQPWRWWFRQDSLTQKIKQQNTQN"
FT   gene            complement(353530..354126)
FT                   /locus_tag="A1S_0326"
FT   CDS_pept        complement(353530..354126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0326"
FT                   /product="dephosphocoenzyme A kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10790"
FT                   /protein_id="ABO10790.2"
FT                   /translation="MAFILGITGGIGSGKSAATQWFESQGIQVVDADIVAREVVEKGQP
FT                   ALQKIQQTFGDWVLQPDGSLDRRALREYIFQNPQARHTLEQITHPAIRQSIIQQLQNRK
FT                   SPYVILVSPLLFETNQHELVNHTLLIDASEQTQIQRASQRDGQNQEQIQKIIAAQMPRE
FT                   RKRELANDIVFNDGLLEHLYQQLEPLHQSYLKRAN"
FT   gene            complement(354128..354988)
FT                   /locus_tag="A1S_0327"
FT   CDS_pept        complement(354128..354988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0327"
FT                   /product="type 4 prepilin-like proteins leader peptide
FT                   processing enzyme"
FT                   /note="Protein secretion protein XCPA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10791"
FT                   /protein_id="ABO10791.2"
FT                   /translation="MQDIIAYFIQNFTALYIAVALVSLCIGSFLNVVIYRTPKMMEQDW
FT                   QQECQMLLNPEQPIIDHEKLTLSKPASSCPACQQPIRWYQNIPVISWLVLRGKCGHCQH
FT                   PISIRYPAIELLTMLCSLVVVMVFGPTIQMLFGLVLTWVLIALTFIDFDTQLLPDRFTL
FT                   TLAALGLGINTFNIYTSPNSAIWGYLIGFLCLWIVYYLFKVITGKEGMGYGDFKLLAAL
FT                   GAWMGPLMLPLIVLLSSLLGAIIGIILLKLRNDNQPFAFGPYIAIAGWVAFLWGDQIMK
FT                   IYLGG"
FT   gene            complement(354988..356214)
FT                   /locus_tag="A1S_0328"
FT   CDS_pept        complement(354988..356214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0328"
FT                   /product="type 4 fimbrial assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10792"
FT                   /protein_id="ABO10792.2"
FT                   /translation="MAVKKAQMMPTFAYEGVDRKGVKIKGELPAKNMALAKVTLRKQGV
FT                   TVRNIREKRKNILEGLFKKKVTTLDITIFTRQLATMMKAGVPLVQGFEIVAEGLENPAM
FT                   REVVLGIKGEVEGGSTFASALRKYPQHFDNLFCSLVESGEQSGALETMLDRVAIYKEKS
FT                   ELLKQKIKKAMKYPATVIVVAIVVTIILMVKVVPVFQDLFASFGADLPAFTQMVVNMSK
FT                   WMQEYWFIMIIAIGAVIAAFLEAKKRSKKFRDGLDKLALKLPIFGDLVYKAIIARYSRT
FT                   LATTFAAGVPLIDALESTAGATNNVIYEKAVMKIREDVATGQQLQFAMRVSNRFPSMAI
FT                   QMVAIGEESGALDSMLDKVATYYENEVDNAVDGLTSMMEPLIMAILGVLVGGLVIAMYL
FT                   PIFQMGSVV"
FT   gene            complement(356244..357956)
FT                   /locus_tag="A1S_0329"
FT   CDS_pept        complement(356244..357956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0329"
FT                   /product="type 4 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10793"
FT                   /protein_id="ABO10793.2"
FT                   /translation="MSALHTSPKFTGFFRRLVEEKHVSAATMQTALDAAKRAKQDTVAY
FT                   LIEEVHLSPSLLAETISAEFAEPYFDLDVYDTSQIPKDLVDQKLILKHRILPLIQRGQI
FT                   LYVATSNPSNIEAIDAIRFNSKLLVEPVIVEHHKLEKVLGQHFAEESSFDFNDEEFDLD
FT                   VNLDGPTAQDDEEEAPQGDEAPIVKYINKLLIDAIRMGASDLHFEPYEKSYRVRYRVDG
FT                   VLRQIANPPLQLANRLASRLKVMSQMDISEKRVPQDGRIKLKLSKSKAIDFRVNSLPTL
FT                   FGEKLVLRILDPSSAMLGIDALGYEEDQKALFMEALDKPQGMLLITGPTGSGKTVSLYT
FT                   GLNILNTESSNISTAEDPVEINLEGINQVNVNPKVGLTFAAALKSFLRQDPDIIMVGEI
FT                   RDLETAEIAIKAAQTGHMVMSTLHTNSAPETLTRLRNMGVPSFNIATSVNLVIAQRLAR
FT                   RLCSQCKIPADIPKQSLLEMGFTEQDLAHPDFRVFQPVGCPECREGYKGRVGIYEVMKV
FT                   TPEISKIIMEDGNALEIAAASEKLGFNNLRRSGLKKVMQGVTSLQEVNRVTSE"
FT   gene            358247..359041
FT                   /locus_tag="A1S_0330"
FT   CDS_pept        358247..359041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0330"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10794"
FT                   /db_xref="GOA:A3M1K0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1K0"
FT                   /protein_id="ABO10794.2"
FT                   /translation="MSGSTITPWVVGNWKMNPMRANANQLIEEFKQLLQQNQIADENCH
FT                   VGVAPVSIALTTVQAQLQDAARTVYTVAQDVSRVAGTGAYTGEVSAELLKDSQINFVLV
FT                   GHSERRDIFGDNVEILKAKLQNALNAGMTVIYCVGESLEQREQGQAEQVVLQQICDIAP
FT                   VVTAEQWQNQVVIAYEPIWAIGTGKTASPQDAQAMHAKIREGLCQLTPAGSNIAILYGG
FT                   SVKAENAVELAACPDINGALVGGASLNAASFYQIVQAFAQSK"
FT   gene            359054..359383
FT                   /locus_tag="A1S_0331"
FT   CDS_pept        359054..359383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0331"
FT                   /product="preprotein translocase IISP family auxillary
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10795"
FT                   /protein_id="ABO10795.2"
FT                   /translation="MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGA
FT                   SGSGNFLTRVTAILTALFFVTSLTLAVFAKKQTTEAYSLKTVQTTAPAQTTSPETSPNA
FT                   PKTGQ"
FT   gene            359440..359524
FT                   /gene="trnL"
FT                   /locus_tag="A1S_0332"
FT   tRNA            359440..359524
FT                   /gene="trnL"
FT                   /locus_tag="A1S_0332"
FT                   /product="tRNA-Leu"
FT   gene            359567..359643
FT                   /gene="trnM"
FT                   /locus_tag="A1S_0333"
FT   tRNA            359567..359643
FT                   /gene="trnM"
FT                   /locus_tag="A1S_0333"
FT                   /product="tRNA-Met"
FT   gene            359859..360383
FT                   /locus_tag="A1S_0334"
FT   CDS_pept        359859..360383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10796"
FT                   /db_xref="GOA:A3M1K2"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1K2"
FT                   /protein_id="ABO10796.2"
FT                   /translation="MKLSNKSQALYDMIAPAVEACGVDLWGIEFLPQGKRSLLRIYIDR
FT                   PVDENAEPVINEDGEVEQGRGIGVEDCVRVTQQVGAMLDVHDPISGEYALEVSSPGWDR
FT                   PFFQLEQLQGYIGQQVALRLIAAVENRRKFQAKLLAVDLENEEIQVEVEGKHVLDIDSN
FT                   NIDKANLIYQD"
FT   gene            360421..361905
FT                   /locus_tag="A1S_0335"
FT   CDS_pept        360421..361905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0335"
FT                   /product="transcription termination/antitermination L
FT                   factor"
FT                   /note="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10797"
FT                   /protein_id="ABO10797.2"
FT                   /translation="MGREILTVVETVSNEKGVSREAIFEALEQALVAATKKKFYEGTNS
FT                   EEAQLRVEIDRRTGDYRTFRQWTVVADEDHEMPACQDAISDVDPAKWSIGDVRELEVES
FT                   IEFGRIAAQIAKQVIVQKIREAERALVADAYESKVGELIYGEVKKQTKDGFIIDLGDNA
FT                   EAYLAREEMIPKEILRPKQRVNAILYSVNREGRGAQLLLSRAKPEMLIALMKKEIPEIS
FT                   EEIIEIKAAARQPGVRAKIAVKTNDHRIDPVGACIGMRGTRIQAVQQELNGERIDVVVW
FT                   SDDPAQYIASALEPADVSGIVLDEDAKSADIIFATNDQLARAIGSQGQNVRLASDLTGY
FT                   KLDMMLEEEYRARQQNEAQQYLDMFVSRLDIEEDLAMALVEMGFTSLEEIAYVPAETFD
FT                   EIELDAELVELLQSRAKEAALTDALKQQENIQEPSADLLNMEGMTSEIAYSLAARGIIT
FT                   VDDLADQATDDISDIEGLGHEKAGQLIMKARESWFN"
FT   gene            362072..364611
FT                   /locus_tag="A1S_0336"
FT                   /note="contains frameshift; similar to initiation factor
FT                   IF-2"
FT   gene            364614..365015
FT                   /locus_tag="A1S_0338"
FT   CDS_pept        364614..365015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0338"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10798"
FT                   /db_xref="GOA:A3M1K4"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1K4"
FT                   /protein_id="ABO10798.2"
FT                   /translation="MAGGQRLKRMADSVQRELSELIRQELKDPRLGGLVTISGVKVSPD
FT                   LGYADVYVTVMGRELSDDQNEVAHRETLDILNKASGFLRQELSRRIKTRITPRLRFHYD
FT                   KTNAYGNYMFGLIEKAVQDLPKRESDDEE"
FT   gene            complement(365072..365476)
FT                   /locus_tag="A1S_0339"
FT   CDS_pept        complement(365072..365476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0339"
FT                   /product="pH adaptation potassium efflux system protein G"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10799"
FT                   /protein_id="ABO10799.2"
FT                   /translation="MQITMEIIVSIFLVFGAFFMLVGSIGMVRLPDLFMRLHAPTKSST
FT                   LGLGSFLIASMIFFAFQGRFGFAELLITLLAFITAPVSANLIAQAALHLRLRSLSGEVP
FT                   EAIERPLPWDRYKIGQRFSQNKPPMEPPQE"
FT   gene            complement(365761..366288)
FT                   /locus_tag="A1S_0340"
FT   CDS_pept        complement(365761..366288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0340"
FT                   /product="pH adaptation potassium efflux system E
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10800"
FT                   /protein_id="ABO10800.2"
FT                   /translation="MQLSKLLDRWFPHPFVSFLIIIFWLMLAHSLDASDLLMAVVLGLV
FT                   IPRLVRPFITRTPHIHWKPAIKLCFVVLWDIIVSNFRVAKLVLGSPKKLHPKWYRVPLE
FT                   TEHEQVNSLLAMIITTTPGTVSAGIDQERGDILVHSLSTENTESDVQDIKQRYEAPLME
FT                   IFDVKSKSEDNA"
FT   gene            complement(366291..368102)
FT                   /locus_tag="A1S_0341"
FT   CDS_pept        complement(366291..368102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0341"
FT                   /product="pH adaptation potassium efflux system D
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10801"
FT                   /protein_id="ABO10801.2"
FT                   /translation="MFDFLSFWQANTPIFSILIPAFTGFILLLLGNPGAGALKEDWRQP
FT                   WRRGISLISAIAGLITAVSYLLVANTGQITVYQLSEWSAPFGIVLILDRLSAFMLVLTY
FT                   ALAVPVLWYASENWDTRGRYFHAIFHFLLMGLCGAFLTGDLFNLFVFFEILLMASYVLL
FT                   LHGQGKPRFQLGVHYVIINLLASALFLIGLGMIYGSVGSLNMADVSRLLPTLDADQHKL
FT                   AVAGALLLFVVFGIKAAMLPVGFWLPKTYAVASTPVAAIFTIMTKVGIYAILRVNGTVF
FT                   NDVLSQEIFKSWLLPIGLVTSLYGVIGAIGADRLRRFVGFMVLSSIGTLLIAIAMSNTQ
FT                   AWSGALFYLVHSTLIGAAFYLFCGWMTSQRGDFKDHLKIAPRIKQEKAAMLTYFLIAMM
FT                   LAGLPPFSGFFGKVFILQATVETAYQGWVIGIVLLVSLLSIIALTRVGFILFWRASPPE
FT                   EDPINPAYIIYRALPEKAPPRNDTVIYILLAGLVAYVAFASPVLHYTTNTAQQIQDHAL
FT                   YQQSILKTDQNGEVISVQPYDSTYLPETKYGGEVEDHNAYLIPDIISKDTFNGEHISEY
FT                   KHRQIQQQEKLQTPTIADESQLKPMEP"
FT   gene            complement(368102..368470)
FT                   /locus_tag="A1S_0342"
FT   CDS_pept        complement(368102..368470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0342"
FT                   /product="pH adaptation potassium efflux system C
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10802"
FT                   /protein_id="ABO10802.2"
FT                   /translation="MISLEFLLASAIGLLVATGIYLILRARTFPVVLGLAVLGYAVNLF
FT                   LFAMGRLQVSSPAILTETTNITDPLPQALVLTAIVIGFATTAFIVQLALRSRYESGSDH
FT                   VDAKEDISPTYDPREDEP"
FT   gene            complement(368467..371316)
FT                   /locus_tag="A1S_0343"
FT   CDS_pept        complement(368467..371316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0343"
FT                   /product="pH adaptation potassium efflux system
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10803"
FT                   /protein_id="ABO10803.2"
FT                   /translation="MDTSVLPIIILLPLILGTTLVSLLQRFSRGVTALGAIGVSLTSFG
FT                   LLLTQAKTVLGGASIQQSWDWLPQLGINLSFRLDALGLLFSLLITGIGTLIYIYAYYYL
FT                   GPKNSLSKLYLLLMLFMAAMLGISLSNNLIILLVFWELTSISSFLLVGYWSHYEAAQRG
FT                   SRMALTITGMGGLAMLGGFVLLGQITGTYEINDIVGMKDLIQSHYLFVPTLLLILLGTF
FT                   TKSAQFPFHFWLPNAMAAPTPVSAYLHSATMVKAGIFLLARLAPIFIGAALYHNIVTFV
FT                   GLFTLCMAACFAIFKEDLKGLLAYSTISHLGLIVCLLGIGSPLAVAAAIFHIINHATFK
FT                   AALFMIAGIIDHETGTRDLRKLSGIWQLLPFTATLTMITAASMAGVPLTNGFISKEMFF
FT                   TELLASLSGSTVIFASIIATLAGIFAVSYSIRLVHGVFFDGPVGKQVPNKNAHEPPIGM
FT                   RAPAILLATLCILVGIFPALLVEPLVNSVTRASLMQPDFAGTHLAIWHGFNAPLIMSII
FT                   ALVGGTLFYFALAKDGMIRKIDLDPRLGRLQGRILFDLFLKHLLLTSRKIKQKTENGSL
FT                   QSYLFLIIAFSIVMVTLPLFNQGLTTGTRELTHAPWIAVVLWLTLFSGCWMMLWFHHER
FT                   IKAVLISGAIGLVVTMVFVTMSAPDLALTQITVDVVTTVLLLMSLSLLPQLTPYESRRS
FT                   RRWRDAALAIIGGLGIGWITWLILTRDHNSISWFFAQQSLPLGGGSNIVNVILVDFRGF
FT                   DTFGEITVLGIAAIGALCLMDGMRVHGTTMTQGLTYRFNPSPLMFRITASWVLPLALVV
FT                   SVYIFMRGHNYPGGGFIAGLITSMALIIQYIALGQDQAEQMLKAQSGRLYEIWIGSGLT
FT                   IAGLTGIAAWFWARPFLTSAHVYVELPVLGKLHLASAASFDLGVYITVVGATMLLISVL
FT                   GDSRHSSMSGPVPHGEKSS"
FT   gene            complement(371631..373013)
FT                   /locus_tag="A1S_0344"
FT   CDS_pept        complement(371631..373013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0344"
FT                   /product="putative ATP binding site"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10804"
FT                   /protein_id="ABO10804.2"
FT                   /translation="MKLESIQFKHIALFHDLKIQFQYDKQPITLILGEQATGKSMLLKH
FT                   IYHALTWFPARLKDARTPGIVMPDQDISHSRLQSKIEVSIQIPPEFGQLPETTSTQQTE
FT                   TSLCSWKLFKTLNSSGVGISQVETQQLDQTITLYHQVTRKDPLQGLPLLAYYPSERFVN
FT                   DINLLNKNLPGITQSISAYDISFIPFTTFARFFEWLREISDIENAQAAHVVQRIISKQS
FT                   NSQDQEEILRQLQLELAGHPKQLPSPNLYALKSALKIIFPELEDFYLQYHPKLQLMAHY
FT                   KGEVLAFQQLSNTTKTWIALVGDVVRRLCLLNPLSLDPCLEGEGVLLIDQIDSQLDSAH
FT                   CSEILNRLHRAFPRLQIIVTGSREELLEHAAAYQCFKLEHGKISPLDLNTTQQQLEHLY
FT                   TLLQRDEALTPHIDPLPLDTEPATAQIDSLYQQIQNLNEQQKNELLRMIHAGDTSEETS
FT                   SL"
FT   gene            complement(373037..374539)
FT                   /locus_tag="A1S_0345"
FT   CDS_pept        complement(373037..374539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0345"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10805"
FT                   /protein_id="ABO10805.2"
FT                   /translation="MSNIEKPKATYEQAIAIDNARLGQSFKVIAYAGTGKTTTLQMISD
FT                   AMPERRGMYLAFNKAIAGEAQNKFHRNVDCRTFHSLAFRSVPRGVTDKLRLPRLSPSFI
FT                   AKEYRLEPITLRRMMGGRYEKYVLMPSRLASLVANAVSYFCSTSSQYPAPRHIQAPNWL
FT                   HPDDITALQTHLYPAVERRWLESIDPNHQAGIGHDIYLKLWALSEPNIPADYVLFDEAQ
FT                   DADPLMLGILLRQKSTQVIYVGDAHQQIYAWRGAVNAMQQLPLPESRLTTSFRFGEAIA
FT                   DVANALLGGLNETVPLLGNPNQKSSVVNKPHTKMRDAILCRTNARAMELLLAGLVHGDK
FT                   VSLQADHQKLNRFVDAASLLKQGKRVTDVPELAWFNSWHDVHEYCETNEGSDIKPLVKL
FT                   VDDHGTDPLKKALAKITPLEQADYVISTAHKAKGLEWNRVHIEDDYQFKINGLEHKITD
FT                   EELRLLYVACTRAKVSLNIHHLYDLIQQLKLRAPLSLRQSVG"
FT   gene            complement(374549..375322)
FT                   /locus_tag="A1S_0346"
FT   CDS_pept        complement(374549..375322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10806"
FT                   /protein_id="ABO10806.2"
FT                   /translation="MNNTQWLDEVKFNEQGLIPAIAQHHQTGRILMVAWMNRESLALTA
FT                   EKNQAVYFSRSRQKLWHKGEESGHFQTVYEIRLDCDGDVIVLQVEQHGGIACHTGRESC
FT                   FYRKLTPQGWEIVDAQLKDPTAIYGDNAKTESHDHAHTTEQVDVLAHLGQLMQERKQAE
FT                   ADTSYVASLYKKGINKILEKVGEEGVETIIAAKDYATQNTESNLNDLIYETADLWFHSI
FT                   VMLGYFDLNPQLIIDELGRRQGLSGLVEKANRNKV"
FT   gene            complement(375476..376789)
FT                   /locus_tag="A1S_0347"
FT   CDS_pept        complement(375476..376789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0347"
FT                   /product="putative oxidoreductase; putative flavoprotein
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10807"
FT                   /protein_id="ABO10807.2"
FT                   /translation="MKTPHFAIIGAGTAGLATAILLAREGNHVTIFEQVDELSPVGAGL
FT                   LLQPAGLAVFEHLGVLDKALTLGAKVTGLEGQLPDKRLLVNSHYREASTNLYGLGIHRA
FT                   TLCHVLTQKLSEYSSQITWCMNHSVESFEEHNDEVRLFGSHQNQKFDACFDGLLIANGA
FT                   RSQLRPKAWVKVDKAYPWGAAWSIVPECQVLDSEILHQFYDRSKIMMGILPTGAIPTEP
FT                   QQRLSSVFWSLPPPQLQSFLQDEQAKQAWLKQVSERWPKVAEWLKEILYNSQTQPKWLS
FT                   ANYRDVVMTQFGQGRIGVIGDAAHAMSPQLGQGANMALLDAWAFSQSLRHAQKNQNIDW
FT                   SLLWQHYHQLRGSSTQFYQFLSRLLTPLYQSDHWWAGGLRDLVFPWMYQIPYFQKEMAI
FT                   TISGLKTGLFRHLEYDQVAQLPKESSAFHLKSESLTDF"
FT   gene            complement(376914..378533)
FT                   /locus_tag="A1S_0348"
FT   CDS_pept        complement(376914..378533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0348"
FT                   /product="2-octaprenylphenol hydroxylase of ubiquinone
FT                   biosynthetic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10808"
FT                   /protein_id="ABO10808.2"
FT                   /translation="MIPHVSRLLELWRIAAHYRLDTLFPADELPVKAKHALNIIKMHPA
FT                   AWSSRERKNPLKLKEALEDMGPLAIKLGQLLSTRRDLIPPEILAQLVLLQDQVKPFDGE
FT                   VAKQRIQDSLKADVNTLFARFDDQPLAAASIAQVHTAALHDGREVVVKVTRPDIRSQIL
FT                   QDFEILAWLGNTLESRLEAARALHLSEIIQDYRQIILNELDLSIEADNTRRMRHYFTGS
FT                   TMMYVPEVYMDTKDVMVAERITGVPISDTATFDRLGMDRALLAEKGLTIFFTQVFRDNF
FT                   FHADMHPGNVFVETINPSNPRFIALDCAIMGELSKHDQMTVARMLLAVMNSNFMQLIQI
FT                   VHQAGWIPPGTDQDALAREMRRTVGPMVSKPMDQLDFAGILIQVMDIARRFHLEIPPQL
FT                   MLLLKTLVHVEGLGTDLYPQLDIWKLAKPILTEWVKSNMNPVKNVKELGQQLPDLLLGA
FT                   QDFPSLIIDSLNGLKNQSAWQDRQLREIQQLRLQMEHQQRRSWMFGSTMLIFLTIAIIS
FT                   PWFVSIILIVLSSLLALWRVLK"
FT   gene            complement(378546..379214)
FT                   /locus_tag="A1S_0349"
FT   CDS_pept        complement(378546..379214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10809"
FT                   /protein_id="ABO10809.2"
FT                   /translation="MWSILALGAVERIIHHLIDLDALTRIQLNQLQGKMLRVIIDSPQL
FT                   SVDVFFDQEKVRLEPTVTGHSEKPSIFEQRPFDPQFKISEATATLHVKDVVELIKLLLS
FT                   DPDQIGNIPLQGDYHLLQDIQKIMQQAEPDLAAHLSKWVGPQLAHEIGKIQLAPKHLKR
FT                   SLQSHLFFAEDALKEDSGLFAPRWEMDDLNQATRKLNQDIDRLEAKLQQLNAQLQPTQD
FT                   "
FT   gene            complement(379226..380173)
FT                   /locus_tag="A1S_0350"
FT   CDS_pept        complement(379226..380173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0350"
FT                   /product="S-adenosylmethionine : 2-DMK methyltransferase
FT                   and 2-octaprenyl-6-methoxy-14-benzoquinone methylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10810"
FT                   /protein_id="ABO10810.1"
FT                   /translation="MSNENQKPTSPTEQAQSSDKVSPFLSSPLPQGTPQGQQQSLQQTL
FT                   TDTPVSGSVPKYNLPRGAGNTGNVGETTHFGYSTVRTEDKAQKVAEVFHSVASKYDLMN
FT                   DLMSFGIHRLWKRFAINMSGVRRGQHVLDIAGGTGDLAKVFSREVGPQGHVVLSDINES
FT                   MLNVGRDRLIDAGCTNVDFVLANAETLEPFADNSFDLVTISFGLRNVTDKDAALASMFR
FT                   VLKPGGRLLVLEFSKPVFEPFSKLYDLYSFTALPIMGKLVANDSESYKYLAESIRMHPD
FT                   QRTLKGMMENAGFQNCDYHNLTGGIVAVHRGFKL"
FT   gene            complement(380322..381029)
FT                   /locus_tag="A1S_0351"
FT   CDS_pept        complement(380322..381029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10811"
FT                   /protein_id="ABO10811.2"
FT                   /translation="MSKLAAFDELLQQYKTFNYHDNPVLAQRLQDVQTWLKERMKETHH
FT                   DFFNLPEHKLMAQYFLNRLYGGPEFDALAAQIERLLKYAHKAEKVLPENAIKTGTKSVS
FT                   LAVLATQLDEQVAMQLLEDYPADTVLTDEIMRLTLIKLDQAEARYQQLALLDDLGAALD
FT                   KYMRSFMMFTAFKMCKGIAQKYHFELMYDFIQDGFSAMKPLKSAEAFIKTFTEKERQIV
FT                   EKVHSGHPNPFRV"
FT   gene            381236..382654
FT                   /locus_tag="A1S_0352"
FT   CDS_pept        381236..382654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0352"
FT                   /product="polyphosphate-AMP phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10812"
FT                   /protein_id="ABO10812.2"
FT                   /translation="MSEQQPKFEIRDEEQLSVDLIEAQYALKESRGKPNAKSTLILMSG
FT                   IELAGKGEAVKQLREWLDPRYLRVKADAPRVLTDSEAFWQSYSAFIPTEGQIVVMFGNW
FT                   YSDLLVTATHVSEPLDDARFDAYVENMRAFEQDLKNNYVDVIKVWFDLSWKSLQKRLDK
FT                   IDPSEQHWHKLHGLDWRNKKQYDTLQKLRRRFTDDWYIIDGEDEKQRDQFFAQYLLQHM
FT                   RQLPEHETEVKGKWQQAKIPESLLKPAQEKMDKAEYKKELDKLSKKIADTMRFDKRNVV
FT                   IAFEGMDAAGKGGAIKRIVKNLDPREYDIHCIGAPERFEARHPYLWRFWNRINEAEKIT
FT                   IFDRTWYGRVLVERVEGFASPIEWQRAYDEINRFEKDLFDSQTIVVKIWLAISKDEQEQ
FT                   RFKAREETPHKRFKITAEDWRNRDKWDDYLKAAADMFERTSTEYAPWYIVATDDKYTAR
FT                   LEVLRAILKQLRAD"
FT   gene            complement(382677..383183)
FT                   /locus_tag="A1S_0353"
FT   CDS_pept        complement(382677..383183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10813"
FT                   /protein_id="ABO10813.2"
FT                   /translation="MKIDNIPDYIDPSLNLEQIRDECQELIQKRAYVSAGAAIVPIPFF
FT                   DVVVDLGILSQLIPDINSRFGLAPEHVSVYDPKTKTIHWDELRKRGFQFSGFVVARTTV
FT                   KKTFNGFFGKIVTKQVTKFVPLGGQLVAASLGYFMMKKIAQTHLNDSYNLAKRIQQKSR
FT                   GTVVN"
FT   gene            383529..386264
FT                   /locus_tag="A1S_0354"
FT   CDS_pept        383529..386264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0354"
FT                   /product="exonuclease V gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10814"
FT                   /protein_id="ABO10814.1"
FT                   /translation="MSANYQFHQRVRGFQWYAYQQVLTAHKEQVRKANIPRLIFKWRVH
FT                   QALQEFIQPDVMSIDSSHPLHSIVQRIYDSADRLEQGVEKQLKKQKMLYWVAEQVADLF
FT                   SNYMVYRGQCQRGCENMCTCPNNWLAAWGQGRSLDIEKYIAHKDKEVSAFTLQQTQELE
FT                   RWQRWLWQQHFHDDFIQMQQIDELFWQELEHPERQKKALSRLPQQIVIFTLLDLPPSQL
FT                   QFLRRLGQYIDVLILHYNPSQEYWADSVDPLWKQRYDLGVKERFIAKNPQATDAEIADF
FT                   FNKFTLNFNAEARESRHPLLTRLGKQARDHFSLLSNLSTGEEGKWVDAFVDDFPESLLG
FT                   KVQSDILHLVEPQAKQYELAPNDDSIQIHICHSTLRQLEVLKEQLIGWLAKPHEQPRRP
FT                   NDILVLVPNLAEVEPLIRSVFPATATEQGVHLPVKIAGIASLDALNAWRAVIGRIHLMQ
FT                   GRFSFDEFADWLGLHATQQRYALEYAQVERILNLLADAGFKRGLDAEHLKRSLCDGDDD
FT                   YRYSFKFALERLALGIAIPEHATFNQVLSYAKVQPGDFELIGTLIQIYQDLNERRDWLI
FT                   MHEQKKSHTVEYWLQILSQDIIEFEQAGVAALKTAREIVKKQERMLTLASYYAETETGT
FT                   LRKITLPLPYILDEIQRTLENQTAQAEPTGQITFAQIGQIRPLPYRLIVMLNLDAGQFP
FT                   NRDTHVPFDLMDALRQQLGDRSRLEDDQGAFLDALLLAQENLWLFYNGFDVNDGEVRDP
FT                   SSILQEFREHLALIVKPEPNAPDREVIEGIEIPTQLKQLYHLHYLQPFDPKGFMAENRY
FT                   IRYQDHWFNVAMQIQQASGVLKPWANISYPLEIPDMLVLDSHQWIQDVTFPARLYLKTL
FT                   GVENLGNVSVLDQNEPLLLDGLGRYTIRHFFTAKRTAGTA"
FT   gene            386422..386991
FT                   /locus_tag="A1S_0355"
FT   CDS_pept        386422..386991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0355"
FT                   /product="exonuclease V gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10815"
FT                   /protein_id="ABO10815.1"
FT                   /translation="MNITVPKSETQDWVSMEASSARAKRRAKVWLEYLLWLAYLNEGSA
FT                   GTERRRIVVFSDQTVICKGISSEQARQYLQPWFKIWRYAQQQPLVLPAALLLKPLEKAK
FT                   AYQWETTNPTEKIKLDEKSYAELLKYWNETGTFTSVDMTQNEACKLHQDWRFILQEQDA
FT                   QALLQHACDEFAYDLYHPVFQFQHSE"
FT   gene            387109..387504
FT                   /locus_tag="A1S_0356"
FT   CDS_pept        387109..387504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0356"
FT                   /product="exonuclease V beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10816"
FT                   /protein_id="ABO10816.1"
FT                   /translation="MVRIFLEKYLPGQVIATTFTRAAAAELKSRIRARLVETHRYLDAK
FT                   RSLTEKEILLQAEQESDLLLQHILKHFATRIAYACERLKLVIDQLDELFVGTLDSFSQK
FT                   LLREFAFESGKLNVPKLPMMPKPIADN"
FT   gene            387699..390692
FT                   /locus_tag="A1S_0357"
FT   CDS_pept        387699..390692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0357"
FT                   /product="exonuclease V beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10817"
FT                   /protein_id="ABO10817.1"
FT                   /translation="MAAEIDISLLEPYYSLDGEHYKHVSGTIFRNGAFNKLFSECLPQL
FT                   LQVLKQSDSILVFDGSLAIQRELVFKFLGQLADQKVFKKCPAEISDGFYQHPCIQQIQQ
FT                   LFGVLKKYAEQFDQLHIYLKAYLCVEVKKRLPQVLQNKGETTFSQQIRTLSEALKGEQG
FT                   QRFAVFVQARYPLILVDEFQDTNQDQDDMLASIWRHPERYQKGCMIMVGDRKQAIYGFR
FT                   GGDMLTFLNAYKDIQAKHGREYKLIHNHRSVADLVEVVDALFQRQIDFGEQVQYDPIRA
FT                   GTRPHPVLIDQNQPNPHPLRWLMLKDKETEAQQVAWKIRDLLNQSHAGQLYFQKDAQTQ
FT                   TLNEDDIAVLSRNHDGLDKVQFELERLGIRVNRPSKRSVFDCTIAQDVGALLTAILHPY
FT                   DEAKVKRALISRLFAMDLKQLLQLEQTAEGLSQFMTGFDTIRELWSAQGFLVAWQQCLN
FT                   QFGIWKNLVAVQSKDNERVVVNLRHLTEILSQHSEKYQGAQNLYHWYLKQLQSPLDREW
FT                   ELERRLSSEAGVQLMTIHQSKGLEFKIVFLLGADKPFRENNKTLNFSTQDITVPESAQT
FT                   LTQRVVAIADKTYLNEIELKQHEERALAEQNRLWYVALTRASHRVYALLQDTDGKSVSG
FT                   LAFWKNRAEPFQHRCCTDEIILEQPPAARHLNQHINIIEIQAQHFPDQRFYSRGKTSFS
FT                   YLAQHLRHKVGTDLLASQSHEAVLAEDELDQVISVEAPAAQPINWIKSNFPRGTLAGNF
FT                   LHEIFEHIDFQCSDEWVSEIRRRFKNDYSSLWQDLLIKYQESFPEEQEAEYSLYHAVAE
FT                   WLQEILSTPLYQGFRLNRLQPEHYLSECPFYLALSDRVLAMKRIQQLFAEYGMEMPELL
FT                   EARSARYLNGSIDLVYFDGQRYHIADYKSNYLGENLADYSVESIAQSMSLASYWLQAGL
FT                   YLVALHRYLKVKMQNYDIEQHLGGATYLYLRGMNGEAEQGYYYWQPSTEFVLRLDAILG
FT                   YFAEDKIA"
FT   gene            390789..392552
FT                   /locus_tag="A1S_0358"
FT   CDS_pept        390789..392552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0358"
FT                   /product="exonuclease V alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10818"
FT                   /protein_id="ABO10818.2"
FT                   /translation="MDKCVDNLNSPEQSDLSWLMTWSTFLNQAPFTAQTQAPEAAYFLQ
FT                   QLIEASLQGDSCIEISPEQIETLGQLVISAEQAKSQVAPCVHDGQGLALYRYWNLEQRL
FT                   AEQIRRLKQQPIQPVSCEEHLDLLTDPHQRAALQMVTRQSLSIITGGPGTGKTYTLARI
FT                   IAVLSQAIPHIRVAMAAPTGKAAQRMQEALQNSFNDPKLLESGLMSDELRNQSTQTIHR
FT                   LLGMGHSQTPRFNQKQPLPYDVIVVDEASMLDLNLATLLFEAVPESCRIILLGDANQLA
FT                   SVDVGAVLADLQQIEALSENRVHLQTSRRFAEGALIGQVARFIQMQTGQIDHEQVLQQF
FT                   EIDIVQVSELRSIPLEADMPDVVQLEYLPEESPIALETYYQKLMVGFQGYVQSLKAYLQ
FT                   DDRSTEHIENIVKSFDDYRILTAVRHGPFGLQQLNQYAERWLQQQLGIVTLGGWYVGRP
FT                   VMMTYNDYQLGISNGDIGLCFEHRTQPQQFEVYFPSLNKWVAANRLPKSIQSAFALTIH
FT                   KSQGSEFTHTAVVLDQAAKNLLSQELIYTAITRAKKVVSLLVDPEALLQSFTVRTTRKS
FT                   GLVEKVNRLVR"
FT   gene            complement(393269..394567)
FT                   /locus_tag="A1S_0359"
FT   CDS_pept        complement(393269..394567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0359"
FT                   /product="putative beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10819"
FT                   /protein_id="ABO10819.2"
FT                   /translation="MKIFSTNTCPVPNDLESVIHHKDEVPAELGGMSEQQVQKIWKSIE
FT                   SLYKTGNYPLITFCLRRQGKILLNRSIGYAQGNSPAGLQKDALIATPDTPVCLFSASKM
FT                   ITAMLIHLLDEKGEINLLDPVSYYIPEYGVNGKRRATIFHLLSHRGGIPYVDGDVTPEL
FT                   LFDKDEILRRLYAARPVSPAGNHLAYHAVTAGYILGEIIERVTGQDLRQFVHETIEKPM
FT                   DMPYFNYGLKPEYRAEVALNCATGLHPRLGTDHYLNHVLGGGLQLAVDVTNDSRFMDTI
FT                   CPAGNIYTSAEQAGRFFEMLLSGGSYQGKQILSEKTIFRATLPTTGVNIDRTLLIPMRY
FT                   ALGPMLGSNPVGLFGPMTGQAFGHLGFSNILCWADPERDISVSLLTTGKSVVGTHLPAL
FT                   ANLLYQISTQCPRIPRDQRRSLFGSDSHETDLV"
FT   gene            394780..395049
FT                   /locus_tag="A1S_0360"
FT   CDS_pept        394780..395049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0360"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10820"
FT                   /db_xref="GOA:A3M1M6"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1M6"
FT                   /protein_id="ABO10820.1"
FT                   /translation="MALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKA
FT                   HKHDHHSRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR"
FT   gene            395301..397394
FT                   /locus_tag="A1S_0361"
FT   CDS_pept        395301..397394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0361"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /note="Polynucleotide phosphorylase; PNPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10821"
FT                   /db_xref="GOA:A3M1M7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1M7"
FT                   /protein_id="ABO10821.2"
FT                   /translation="MSMFNIVRKEFQFGQHQVVLETGRVARQANTVLITMGGVTVLVAV
FT                   VAAPTAKAGQDFFPLTVNYQEKQYAAGRIPGGYGKREGRASEAETLISRLIDRPIRPLF
FT                   PEGYYNEIQVTATVVSSDKTMEADIAAMLGTSAALAIAGTPFRGPIGAARVGLINGEYV
FT                   LNPNFEQMAQSDLDLVVAGTESAVLMVESEAKELSEDQMLGAVLFGHDEMQIAIQAINE
FT                   FAAAAGAKPSDWVAPAHNEELRAKLKEAFEAKISEAYTIAVKQDRYAALDALHAEAVAQ
FT                   FVPEEDVDGIADEVDYLFEDLKYRTVRDNILSGKPRIDGRDTKTVRALDVQVGVLERAH
FT                   GSALFTRGETQALVTTTLGNTRDALMVDTLAGTKTDNFMLHYNFPAYSVGETGRESGPK
FT                   RREIGHGRLARRGVQAVLPAADRFPYVIRIVSDITESNGSSSMASVCGASLSLMDAGVP
FT                   LKAPVAGIAMGLVKEGERFAVLSDILGDEDHLGDMDFKVAGSANGITALQMDIKIEGIT
FT                   EEIMEVALNQAFAGRMHILNEMNKVISRARPEISMHAPTFEVITINPDKIRDVIGKGGA
FT                   TIRQITEETKAAIDIEDNGTVRVFGETKAAAKAAIAKIQAITAEVEPGKIYDGKVIRIV
FT                   EFGAFVNIMPGTDGLLHISQISNERIANVTDVLKEGQEVKVQVQDVDNRGRIKLTMKDI
FT                   EQA"
FT   gene            397479..398690
FT                   /locus_tag="A1S_0362"
FT   CDS_pept        397479..398690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0362"
FT                   /product="putative magnesium Mg(2+)/cobalt Co(2+) transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10822"
FT                   /protein_id="ABO10822.2"
FT                   /translation="MQVYYFYRHQSDGYVFLSREKHTEHILEFFWIDSVRSDVVSQNEE
FT                   WQQKIQQLADVSINEFHMRDIANIEHPCAFDTLEEYDLLIFRKLVTPDDEIKNGESHES
FT                   VFGLATTPISFIFTPKVLISVREQGNKSIENYIQRLENILCKTLEEQNKTRKLPNSPVD
FT                   LCLRLLNSMVDGYLDIRSPLTRRVEHWQQQLLQGNRRFKQWHQLFHENMAFQQVENLCE
FT                   EQIETLQEFRDEIVENYHHVIGEKTHSSQDLLLVRLNDLMSHVERIQKHTLRLRSAIQS
FT                   AIDLHFSAIANQTNENMRILAIITAVFAPLTLLTGIYGMNFEFIPGLKSPVGFWIMLGV
FT                   MLLSTILLLYYFYRQHLVGRGEKSVIDLLAQQHRQDRMNLFWFLEYEPIKQTLKEVEKI
FT                   TRLK"
FT   gene            complement(398937..399266)
FT                   /locus_tag="A1S_0363"
FT   CDS_pept        complement(398937..399266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10823"
FT                   /protein_id="ABO10823.2"
FT                   /translation="MTTIHYREIVCDGHTFSAEVVDEQCTFDLQQFAQACGQSPDWILQ
FT                   LIEYDILAIDTPPEKHQFMGEDVIRARKAYRLQRDFDASLAAVAVMLDLIDEVQQLRKQ
FT                   LKHFH"
FT   gene            complement(399278..400234)
FT                   /locus_tag="A1S_0364"
FT   CDS_pept        complement(399278..400234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0364"
FT                   /product="curved DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10824"
FT                   /protein_id="ABO10824.2"
FT                   /translation="MAKNYYEELGVKREASADEIKKAYRKLARKYHPDISKEKDAEEKM
FT                   QAINVAYDTLSNPEKKAEYDQMLDHPQGFNGFGQGAAQGGFDGARFYRQGFTGGEQADF
FT                   SGFEDLFGRFGTGFGGGQQQYQRQQRSYRGEDQHASIEVDLDIAYHGSTQHITLQIPTI
FT                   NAYGEPEVQRKTLQVKIPKGMKEGQQIRLSGQGQSGINGGANGDLYIEIQYKDTDRVHV
FT                   EGSDVYLTVDVAPWEAALGQGIEVKTPAGPLHVNLPKNAKQGQQLRLKDKGIPNKTPGH
FT                   LYLILNIVFPPAHSEKEKEAYQQLAEAFASFEPRSSH"
FT   gene            complement(400385..400996)
FT                   /locus_tag="A1S_0365"
FT   CDS_pept        complement(400385..400996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0365"
FT                   /product="putative amino-acid efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10825"
FT                   /protein_id="ABO10825.2"
FT                   /translation="MNYFDYFLFIFSVIIMIATPGPVMILVASVGLKGGYKKALETIFG
FT                   TNLASLVLIFISVLVLKGVLGINENYLNIIRVLGCLYIGYLGFSILKEVIQAPHPEAIQ
FT                   TVSAQNGGFKKGFLVGISNPKDIIFFSAFFPQFVSISPHLDLSLTILTLTWIVLDFLTL
FT                   SLVYIFFRRLSNSHLYPKILGLCGLLLLVIAVYGLYQTFT"
FT   gene            complement(401134..402009)
FT                   /locus_tag="A1S_0366"
FT   CDS_pept        complement(401134..402009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0366"
FT                   /product="heat shock protein Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10826"
FT                   /protein_id="ABO10826.2"
FT                   /translation="MSDLRQRFYIEDFPVRGEVVHLEEALKTILAQRDYMPAVQILLGE
FT                   MLSATALLASTLKIKGRISLQIQANGSFKWAMAECNHLGEVRALADYETDPRFGEATDS
FT                   STVLAALVNPVLFINIEPEHGERYQGIVPLDQANLAGCLMQYYDLSAQIPTRIVLASTA
FT                   QRSGGLLIQLLPRHDEEEQKLVDEDLWPRLTMLTETLKSEELTELSANEILYRLYNEEE
FT                   VRLPEVEHLKFGCTCSKERCAKALIQIGVDAVHETLEAQNPIQMDCQFCNTRYEFTAEE
FT                   ALGLFGEHLS"
FT   gene            complement(402175..404016)
FT                   /locus_tag="A1S_0367"
FT   CDS_pept        complement(402175..404016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0367"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein (K(+)/H(+) antiporter)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10827"
FT                   /protein_id="ABO10827.2"
FT                   /translation="MSFLLQATIFLGASLILVPLGKRLGIATVLGYLFTGILLGPSVLN
FT                   IAHDPEAIMELAEFGVILLMFLIGLELRPQRLWEMRDSIFVMGSLQVVITGIILMLTVL
FT                   LLFQQHLAASFVIGFALALSSTAFVLQLLTEKQQLNTTYGQQSFSILLFQDIAAIPLLA
FT                   VIPLLAGTESTHHGIAYFAAIIATFTGLFLFSRYVMRPFFRFVAKSGATELITAVGLFI
FT                   ILAVVLLMDTLGISTTLGAFLTGVLLADSEFRHELEASIAPFKGLLLGLFFMTVGMTTQ
FT                   LSLLIEMPWLIIGGAIGLLVIKTLVLTAIARYKKYSWNNSLLLGTCLAQGGEFAFVILS
FT                   LAKSEKILTDALLEPVTLIVTLSMVLTPVIYWIMACKIIPLFHKELPPEYDEIPQQDNP
FT                   IIIAGFGRFGQIIARIARLQHLGFTAIDNNLHQVDFVRRYGGKLYYGDVTQPDLLRSAG
FT                   IEKAKVFILAIDDVEDSMNVARHLRLNYPNLKLLARARDRHHVHLLRDLGVEHIWRETY
FT                   LSSLGMAYRALRELGISDEQAYNNIEIFRDYDEKLLIQQQSIYTDEQKVFETHRNALAE
FT                   LEHLFESDAQQATSKHDVNLKRHLQPNRIDITRDHEE"
FT   gene            complement(404093..406321)
FT                   /locus_tag="A1S_0368"
FT   CDS_pept        complement(404093..406321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0368"
FT                   /product="ATP-dependent primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10828"
FT                   /protein_id="ABO10828.2"
FT                   /translation="MTITPKPDSVVYRVRVAVPVHLYDTFDYTLTKAQYERAQVGSRVA
FT                   ISFGRQNLIGIITEKVDPQETFTGHFQLKAISELLDDEPILDEQVLNLLTWSAQYYQFP
FT                   IGEVMQTALPALLRQGKPMDVLFHLWKIIPCDNAEALLKRSIKQQDAYQILKLHPAGTT
FT                   ENILNLSGVETATLKALQKKGLVDCTLEPHDFSPSSVQLAQMPLTLNEDQKKATQHVLN
FT                   AQHQYQAFLLDGLTGSGKTEVYLHIMHEVLKQGKQVLVLVPEIGLTPQTISRFKSRFNC
FT                   DIALLHSGLNDSKRLQAWQQAQTGKASIILGTRSAIYTPLPRLGLIILDEEHDLSYKQQ
FT                   EGFRYHARDVALYRGHLQGCPVLLGSATPSIDSYHLVETGKLTALQLNQRAGHALLPKM
FT                   HLIDLKIVKKQHGISQPLIEQIKNTLARKEQVLIFLNRRGYAPVLVCESCGWQANCPHC
FT                   DAHFTLHTQPYSYLHCHHCGTVHRLPDHCPECQQKSLKTLGAGTAKVEEHLQELFPDHD
FT                   VIRVDRDSTSRVGSWQKIYDRIQQNKPSILLGTQMLAKGHHFPHVTLVAILDIDAGLLS
FT                   VDIRAPERTAQLIVQVAGRAGRGEHKGHVYLQTLRPDHPLLTTLIEKDYRAVAKQTLAE
FT                   RKVALLPPYRYTVLIRAESKDRDYTLHFLNEAAEQLRQIAGDIVDIWGPIPAPMERKAG
FT                   RYRAHMVILSADRARLHFYLRQWWAQLVHAPRQHQLRLSIDVDPQEFS"
FT   gene            406470..407675
FT                   /locus_tag="A1S_0369"
FT   CDS_pept        406470..407675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0369"
FT                   /product="general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10829"
FT                   /protein_id="ABO10829.2"
FT                   /translation="MPAYQFTAIDASGKQQKGVLEGDSARQIRQQLRDKAWTPISVDPV
FT                   EQKDKHQSHGLFQKKFSAYDLALMTRQLSVLVAAAIPLEEALRAVSRQSEKAHVQNLLL
FT                   SVRSKVLEGHSLAQGMQQSGRFPDLYIATVAAGERSGHLDLILDQLSDYTENRFAMQKK
FT                   VQGAMIYPIILMLMSFGIVMGLMTYVVPEIVKTFDQSKDALPWITVALMKASDFIRHAW
FT                   VFIILFAIVGVVAFVRFLKTTAGHYAFDRLTLKLPLFGKLSRGINAARFASTLSILTRS
FT                   GVPLVDALKIGAAVTNNWVIRDSISQAAERVTEGGNLGTQLERSGYFPPMMVQMIRSGE
FT                   ASGELDRMLERASTMQDREVTTFISTLLALLEPLMLVLMASIVLVIVIAVMLPIVNMNN
FT                   MI"
FT   gene            407699..408280
FT                   /locus_tag="A1S_0370"
FT   CDS_pept        407699..408280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0370"
FT                   /product="general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10830"
FT                   /protein_id="ABO10830.2"
FT                   /translation="MKVKNIQSEIAMKQHSESVVSNQFEPTCHSEHSSVSDVCSSSAFG
FT                   LATRSSRARMKRVSGFTLIEVMVVIVILGVLAALIVPNVMGRSEKAKIDTTQITLKGVA
FT                   GALDQYKLDNGHFPTMQEGGLDALINQPATAKNWMPGGYVKGGYPKDSWKNDIQYVVPG
FT                   KDGHPFDLYSFGADGKEGGEGNDADIYYQP"
FT   gene            408547..408891
FT                   /locus_tag="A1S_0371"
FT   CDS_pept        408547..408891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0371"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10831"
FT                   /protein_id="ABO10831.2"
FT                   /translation="MKAFLVLDELNQFHWAMLKSVLLILALLPIAEVSLKLWLSTEGSS
FT                   QIMIGFFALSIVSAWLMVSFFTALKTSVWQTKQMASKYEQLLFKAYRYVPMVFLSSLVA
FT                   YLSLQLSIAF"
FT   gene            409036..409374
FT                   /locus_tag="A1S_0372"
FT   CDS_pept        409036..409374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0372"
FT                   /product="protein secretion chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10832"
FT                   /protein_id="ABO10832.2"
FT                   /translation="MEQIEWNDFLKVELRVGKIIQAEVFEKARKPAYILHVDFGEELGV
FT                   RKSSAQITKFYQPQDLIGKLVVAVVNFPKKQIGPIQSECLVTGFHNADGDVVLCIPEFE
FT                   VPLGTKLL"
FT   gene            complement(409376..410866)
FT                   /locus_tag="A1S_0373"
FT   CDS_pept        complement(409376..410866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0373"
FT                   /product="apolipoprotein N-acyltransferase copper
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10833"
FT                   /protein_id="ABO10833.2"
FT                   /translation="MLIALFSGAVFSFALAPYYWWWLAILSPALLYATLHNRSAKQAFA
FT                   IGWSYGFGLWFVGAFWLYTSIHIYGDTNAFLSVCMIAVMALVMGLFTAFQTWIYRRFFP
FT                   ETPLTFAPLWIIFEWAKTWVFTGFPWLFVGYAFTERLLDGYAPLFGIYAISFVVIVLAC
FT                   ALVEVLRKRIFWVIPAALLVLGAWGASYIQFVQPKAAKPLSVSLIQGNIPQDLKWLTEY
FT                   QVRTLEIYAGLTQSEWGRDLIVWPESSIPLFQTDIEPFLDAMDAQAKKNHTAWVTGIPY
FT                   WDVAKSHQVGSPLYYNSIMASGSDSSGLYKKQRLVPFGEYIPLSGLLSWVLPAMQNDIS
FT                   MSGFTRGESDQKPLLIKGHALAAAICYEVAYPNLTRRNAEDSDFLVTVSNDAWFTGTAG
FT                   PWQHLQMVQMRAKENGRWFIRATNTGITAFIDQNGHITEQAPIDKEFVLRGDLPAMQGQ
FT                   TLYNRLGDYPILGFAILLLVLGWIYRPRKVDVSYKSRR"
FT   gene            complement(410695..410934)
FT                   /locus_tag="A1S_0374"
FT   CDS_pept        complement(410695..410934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0374"
FT                   /product="apolipoprotein N-acyltransferase copper
FT                   homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10834"
FT                   /protein_id="ABO10834.1"
FT                   /translation="MRAYFEKLLDSSQQQKQLPLIFHCSLLYFQVPCSVLHWHLIIGGG
FT                   WQFCLQPYSMRHCITAQPNKHLQLAGVMVLVYGL"
FT   gene            complement(410931..411770)
FT                   /locus_tag="A1S_0375"
FT   CDS_pept        complement(410931..411770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0375"
FT                   /product="magnesium and cobalt efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10835"
FT                   /protein_id="ABO10835.2"
FT                   /translation="MQEEPSPSWGMRGLRKWLGTAPETRDELLKLVQNSRRFLEPDTVA
FT                   MLEGVLDLPATKIREVMTPRTAMISMQEDDQLLDILHVLVESAHSRFPVFSADQPDNVV
FT                   GILLAKDLLPFLTEPNTKLDIGSLMRQPLFVPESARSDQVLRMLKHTQTHIAIVIDEYG
FT                   STAGLVTLEDILEEIVGEIEDEHDTADEDAQYIVPDNDHTIANAWMVQALTPIEHFNTV
FT                   LDADFSDDEVETVGGLLLQEIGLVSDLQGQTVELGNWLFTIVEADARTIHLIRAVRQ"
FT   gene            411955..412212
FT                   /locus_tag="A1S_0376"
FT   CDS_pept        411955..412212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10836"
FT                   /protein_id="ABO10836.1"
FT                   /translation="MSEQPISPTVQLNTRGLRCPEPVMMLHQAIRKAKSGDVVEVLATD
FT                   PSTSWDIPKFCMHLGHELLLKEEVLDEQNHKEYRYLVQKG"
FT   gene            412356..412736
FT                   /locus_tag="A1S_3496"
FT                   /old_locus_tag="AS1_3496"
FT   CDS_pept        412356..412736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3496"
FT                   /old_locus_tag="AS1_3496"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3496"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89921"
FT                   /protein_id="ABS89921.2"
FT                   /translation="MNDYFVKQSLIICLWFFCIAGLLRIEVSWLSENITILILFILIIL
FT                   GSVILGYSNTHFAPVPKVKMSLILHTRFMGFLLILDLLFGKSVWYFDLARNFGFLGLFL
FT                   LGTFIFYKRNLNLNVAKIPPFE"
FT   gene            complement(413439..414536)
FT                   /locus_tag="A1S_0378"
FT   CDS_pept        complement(413439..414536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0378"
FT                   /product="EsvG"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10837"
FT                   /protein_id="ABO10837.1"
FT                   /translation="MEHIERESMEFDVVIVGAGPAGLSAAIKIRQLAIENNLPDLSVCV
FT                   VEKGSEVGAHILSGAVLEPRAINELFPNWKEEGAPLNVPVTEDKTFFLLSETTSKEAPH
FT                   WMVPKTMHNDGNYVISLGNVVRWLGQKAEELEVSIFPGFAASEVLYHEDGTVKGIQTGD
FT                   MGIGKDGEPTHNFTPGYELHAKYTLFAEGCRGHLGKRLIAKYNLDKDADPQHYGIGIKE
FT                   LWEIDPAKHKPGLVMHGAGWPLSETGSSGGWWLYHAENNQVTLGMIVDLSYENPHMYPF
FT                   MEMQRWKTHPLIKQYLEGGKRISYGARAVVKGGFNSLPKLTFPGGCLIGDDAGFLNFAK
FT                   IKGSHTAMKSGMLCGEAVFEAIGCW"
FT   gene            414723..415334
FT                   /locus_tag="A1S_0379"
FT   CDS_pept        414723..415334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10838"
FT                   /protein_id="ABO10838.2"
FT                   /translation="MVNQNNSPSDMGKIPLSDDKNLMNIAQYLKGVQQSHKRSILPLEQ
FT                   WHPKHCGKMDLTVKANGEWWHEGQLIKRQALLDLFTKVLWKEEGKFYLKTPVEQIEIEV
FT                   EDEPLLVNQVDQIEISGDEFLQLTTTNQDVILVDAEHPIFMREYAGELRPYVHVRFGIN
FT                   ALIQRQAFYHLVNYGTLVENDKGETILQLKSGNLHLQLGT"
FT   gene            415383..416249
FT                   /locus_tag="A1S_0380"
FT   CDS_pept        415383..416249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0380"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10839"
FT                   /protein_id="ABO10839.2"
FT                   /translation="MTAIQPLFTELEPMPKALADAPIGIFDSGIGGMSVAAEIAKYLPN
FT                   ERIVYYADTAYVPYGPRSDEEIRELTARAVDWLYRQGCKIAVVACNTASAFSLDHLREH
FT                   YGEHFPIVGLVPALKPAVLQTRSKVVAVLATPATFRGQLIKDVVEKFAVPAGVKVMTLT
FT                   SLELVPCVEAGQQMSPVCLNALREVLQPAVEQGADYLVLGCTHYPFLNEAIHHLFDNQF
FT                   TLVDSGLAVARQTARILIKNELLCDQIRQNVARIECYVSGNNADALQPVLQNMIPQELT
FT                   WTLHNLS"
FT   gene            416370..417374
FT                   /locus_tag="A1S_0381"
FT   CDS_pept        416370..417374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10840"
FT                   /protein_id="ABO10840.2"
FT                   /translation="MLDTRYQIFISTSGREMQPERMVLSQTLVNMGFFAWGLEYRNPLT
FT                   TTLARRQIDESDYVVLLLGSQYGEQSISGASYFSLEYEYALSRAKPIVVFMHEQPESRD
FT                   MHLQETHPQLKEKFLAFRKKLLHEANHIFYFKSPRDLELAVRLNMPLMVEQYMGQGWVP
FT                   ARQAHHLEDEINRLKSKVLQLEQQLSESSIQANEVAPQDVFAFEYQIQAFQDGNFKELK
FT                   RQRQMTWSQLLSILAKHFETAMPEENFGTCLNEYLNQDGLEDARQELPRAHAVAGAQIN
FT                   RKALFRIKKQMQSQGWIVPTKIDQQHSLWKVTTKAQKLLLSYKWNHRSTRLKA"
FT   gene            417448..418464
FT                   /locus_tag="A1S_0382"
FT   CDS_pept        417448..418464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0382"
FT                   /product="ferrochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10841"
FT                   /db_xref="GOA:A3M1P7"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1P7"
FT                   /protein_id="ABO10841.2"
FT                   /translation="MSFEQKPKVTVILANLGTPDEATVPAVRRFLKQFLSDPRVIEIPK
FT                   FIWWIILNLFVLPFRPKRVAHAYASVWSTDSPMREIVFEQTQRVQAYLERENKQFDLTV
FT                   LPAMTYGNPGIDAVLEKLSAHPQEHVILLPLFPQYSATSTAPLYDAFAKWIPTQRNLPG
FT                   LTIIKDYYQHPMFIQALAESVLAYQEQHGKPEKLLMSFHGIPQPYADKGDPYADRCRIT
FT                   AKLVAEALHLKDVEWAISFQSRFGKQEWVKPYTDQLLQDWAKQGVKSVQVLSPAFSADC
FT                   LETLEELAIQNAELFQQAGGGSYAYIPALNSDQAHIDLLAGLVQANLDALTHTLAHR"
FT   gene            418488..419132
FT                   /locus_tag="A1S_0383"
FT   CDS_pept        418488..419132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10842"
FT                   /protein_id="ABO10842.2"
FT                   /translation="MLQVKIVPVTAFAQNCSLVWDSETKEAVLIDAGGDAAVLKKEVEA
FT                   LGLKVKALWLTHGHLDHAGAVGELAKEWSVPVVGPHKEDQFWLDMIQEVSARYGFPIPQ
FT                   PVKVDQWLEGGEVLKLGEDEFEVRFAPGHTPGHVMFYNKNHGLLWTGDVLFKGSIGRTD
FT                   FPRGNHEQLIESIQRECFSLPDETQFISGHGPMSTIGYEKQFNPFVAGKAG"
FT   gene            complement(419129..419323)
FT                   /locus_tag="A1S_0385"
FT   CDS_pept        complement(419129..419323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0385"
FT                   /product="putative Zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10844"
FT                   /protein_id="ABO10844.1"
FT                   /translation="MPRTFPCPRCGEPSVWEGNEFRPFCSERCKLIDLGAWANDEYRLP
FT                   TQDAPQQDKGSQHEDDYED"
FT   gene            419235..419333
FT                   /locus_tag="A1S_0384"
FT   CDS_pept        419235..419333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0384"
FT                   /product="putative Zinc-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10843"
FT                   /protein_id="ABO10843.1"
FT                   /translation="MQRSEQNGRNSLPSQTLGSPQRGQGNVRGIKQ"
FT   gene            419417..420049
FT                   /locus_tag="A1S_0386"
FT   CDS_pept        419417..420049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0386"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10845"
FT                   /protein_id="ABO10845.2"
FT                   /translation="MQIRQFQAQRMQAPRDFTPIENTPICVEIGAGKGKHALLFSGQNP
FT                   QHTLYAIERTREKFLAMQKQHGLEPRDNLIPVHADALPWVVHALYPAQVEHFFILYPNP
FT                   EPHNPAQRWLNMPFFEFLLSRLKTGGTITLASNIPEYIEEAEQQLLNVWKLPYQKEKIA
FT                   QTSARTHFEIKYLERGELCQQLIMTKPEGYNTRFDEFAPLQGQIHVE"
FT   gene            420039..421244
FT                   /locus_tag="A1S_0387"
FT   CDS_pept        420039..421244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0387"
FT                   /product="putative flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10846"
FT                   /protein_id="ABO10846.2"
FT                   /translation="MSNKRIAIIGAGPAGLMAAEVLSQYAYEIDVFEQKPSAARKFLMA
FT                   GKTGLNISHAEPLPQFIERYDHTEWLKPWVEKWDAVWIQKWMKSLGIESYVGTSGRIFP
FT                   VEMKAAPLLRAWLKRLAEQQVKFFYRHRCINLQGTTLTLENQNKQNTETFTQQYDAVVL
FT                   ACGAVSWSQLGSDGAWQQWMDQSSIEPFQASNAGVLHTWSAFMESCFGEPLKRINAWVE
FT                   PSQVTHGDIVITHYGLESGVIYKLGRALREQQKQGKSLNLFLDLLPDVELTQLVKKLQA
FT                   SKKQSLTNIWRKAGLDTAKINLIREVVDKALWSQPETMAQKMKALQIKLDGFRPIEEAI
FT                   SCAGGVKQDALTESLELKQTSGVFCCGEMLDWDAPTGGYLLTACFATGRAAGEGVHSFL
FT                   EK"
FT   gene            421322..421732
FT                   /locus_tag="A1S_0388"
FT   CDS_pept        421322..421732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10847"
FT                   /protein_id="ABO10847.1"
FT                   /translation="MSQASPVYQGSCLCQGIRYEIKGDIGDIIQCHCQRCRKSNGTAFA
FT                   TNAPINSADFKITQGEDLIKKFAVNGVYRWFCSECGSPLISSRDAQPELYRLRIGTLDT
FT                   PLDQKPTMHIFAASKAEWECIHDDLPQYDERP"
FT   gene            421968..422348
FT                   /locus_tag="A1S_0389"
FT   CDS_pept        421968..422348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10848"
FT                   /db_xref="GOA:A3M1Q4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Q4"
FT                   /protein_id="ABO10848.2"
FT                   /translation="MYYPLLSIALGSVLGAWLRWFLGLKLNPIYPQIPLGTVTVNLVGG
FT                   FIIGFAMAYFAHSDLSPNYKLFVITGFCGALTTFSTFSIEIVTLLQSGKWGMAMLAISI
FT                   HLIGSLIFTCLGLAAYYWVAGH"
FT   gene            complement(422851..423183)
FT                   /locus_tag="A1S_0390"
FT   CDS_pept        complement(422851..423183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0390"
FT                   /product="putative type III effector"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10849"
FT                   /protein_id="ABO10849.1"
FT                   /translation="MAQELLAQLQAGTAKFSDVLAYIEARYQHTPTAFQNGAQHNAATE
FT                   NQGSAKVFSFAKLQGLDQVQTLSLFAEHYASVLATPEGTDHQNIRQFMQNGWDGVKFEG
FT                   QALTEK"
FT   gene            complement(423436..423690)
FT                   /locus_tag="A1S_0391"
FT   CDS_pept        complement(423436..423690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0391"
FT                   /product="50S ribosomal protein L31 type B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10850"
FT                   /db_xref="GOA:A3M1Q6"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027493"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Q6"
FT                   /protein_id="ABO10850.1"
FT                   /translation="MRKDIHPAYQQVLFHDTNADVYFLIGSTIQTKQTKEYQGQVYPYV
FT                   TLDISSASHPFYTGEVRQASNEGRVASFNKRFARFNRKS"
FT   gene            complement(423792..425090)
FT                   /locus_tag="A1S_0392"
FT   CDS_pept        complement(423792..425090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0392"
FT                   /product="putative ABC1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10851"
FT                   /protein_id="ABO10851.2"
FT                   /translation="MAKNASSPGKRFMKLAGMTASIATKTVSNSIRNLTADEEQKLAAK
FT                   TKLFQDIGLQIADTLGEMKGAVMKVGQIASQYKDIFPPEVAKAISKLQRQAPAMPFAAI
FT                   QQQVERELGKPLNVAFKSFEQEPFAAASIGQVHKAVLPSGEQVVVKVQYPGVDEACESD
FT                   LKQVRLALRLMGVLKIDKKLQDQLFAEIQDSLSAELNYEIEAQNLEVFKTFHSKLDDKI
FT                   IIPTVYKDYSSRRILTLSLEQGDSIETASSWPIEIRNTIGRRLIRALGQEMFFLKRFHC
FT                   DPHPGNFAFRQDGSVIIYDYGSVKTLSNEIVYSFKRLVNAARHEDIDLIETELLELHSL
FT                   AEKGKFPSDLYKLWIEVLLRPLTTTYDFAENSSHHDGMLLVKKSLKYWDVFKPSPDTLM
FT                   VNRTISGHYWNLIHLKVHDNLNDLFEELVPLSN"
FT   gene            425348..426595
FT                   /locus_tag="A1S_0393"
FT   CDS_pept        425348..426595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0393"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10852"
FT                   /protein_id="ABO10852.2"
FT                   /translation="MTSLNSSYGRSQAVPLSVFEQSKDAHIIRSDEEAIEIAKQLAQEF
FT                   AQEASDRDRERRLPLNEIQQFSQSGLWAITVPKQFGGAQVKYRTLAEVIKTIASVDPSL
FT                   AQLPQNHLAFIEHLRLDAKPEQQQFFFNLVLRGIRFGNAFSEKHSKTVADLTTTLRKTE
FT                   HGYEINGKKFFATGALLAHWIPIVAVNELGQPYAALVPRETSGVNIINDWSGFGQRTTA
FT                   SGTVELNQVPVREEYLVPIYQAFERPTPAGAISQFIQAAVDAGIARGAIEETIQYVKNH
FT                   SRAWIDSGLEKASDDPYTIANIGDLKIKLLAAEAVLDLAGDAIDQAIANTTEEHVNQAT
FT                   LLVAEAKVLTTEIAILAANKLFELSGTRSTLSELNLDRHWRNARTHTLHDPVRWKYHIV
FT                   GNYYLNGVQPPRHAWS"
FT   gene            426628..427878
FT                   /locus_tag="A1S_0394"
FT   CDS_pept        426628..427878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0394"
FT                   /product="putative acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10853"
FT                   /protein_id="ABO10853.2"
FT                   /translation="MTTAQIELEELSVGADYENVANRFRPIFEKIAQGAIQREKERILP
FT                   FEPIQWLKEAKLGAVRIPRKYGGDGVSLPQLFQLLAELAEADSNIVQALRGHFAFVEDR
FT                   LVAHKEHSQEVWFQRFVQGDLVGNAWTEIGNVQIGDVVTRVTKDASGNLVVNGEKYYST
FT                   GSIFADWIDLFAYDEVNDRHVIAAIYRHETGVSVIDDWDGFGQKTTGSGTLKVHQVHLP
FT                   ASHLIPFDQRFKYQTAFYQVVHLATLTGIARAAVETFSQEIRERKRIFSHGNGDLVRHD
FT                   PQVLQVVGKASAQAYASEAITLKTAEALQKAYESHFAESEVKEHQFNVDAELESAQGQV
FT                   VISNLVLDLTSQLFNALGASASSQVKQLDRFWRNARTVSSHNPLIYKEKVIGDWEVNRT
FT                   DLPFVWQIGASPRAKTA"
FT   gene            complement(427913..429208)
FT                   /locus_tag="A1S_0395"
FT   CDS_pept        complement(427913..429208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0395"
FT                   /product="Na+-driven multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10854"
FT                   /protein_id="ABO10854.2"
FT                   /translation="MLPILITQFAQAGFGLIDTIMAGHLSAADLAAIAVGVGLWIPVML
FT                   LFSGIMIATTPLVAEAKGARNTEQIPVIVRQSLWVAVILGVLAMLILQLMPFFLHVFGV
FT                   PESLQPKASLFLHAIGLGMPAVTMYAALRGYSEALGHPRPVTVISLLALVVLIPLNMIF
FT                   MYGLGPIPALGSAGCGFATSILQWLMLITLAGYIYKASAYRNTSIFSRFDKINLTWVKR
FT                   ILQLGLPIGLAVFFEVSIFSTGALVLSPLGEVFIAAHQVAISVTSVLFMIPLSLAIALT
FT                   IRVGTYYGEKNWASMYQVQKIGLSTAVFFALLTMSFIALGREQIVSVYTQDINVVPVAM
FT                   YLLWFAMAYQLMDALQVSAAGCLRGMQDTQAPMWITLMAYWVIAFPIGLYLARYTDWGV
FT                   AGVWLGLIIGLSIACVLLLSRLYLNTKRLSQT"
FT   gene            complement(429293..429691)
FT                   /locus_tag="A1S_0396"
FT   CDS_pept        complement(429293..429691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0396"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10855"
FT                   /protein_id="ABO10855.2"
FT                   /translation="MAFQTAINAQLREQLHSPLQAALLSFFIGTIVLAIMVFFQSAEKP
FT                   SLSEISNIPWLLWTGGFLGVYAISMSIYTAPKLGFLTFTGLVVFGQLVISMLLDHFGWL
FT                   GTEKTPVTWQRFLGGVVIFVGVLLTLQR"
FT   gene            429872..431026
FT                   /locus_tag="A1S_0397"
FT   CDS_pept        429872..431026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0397"
FT                   /product="putative oxidase; putative coproporphyrinogen III
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10856"
FT                   /protein_id="ABO10856.2"
FT                   /translation="MAVLNPASVPLSLYIHMPWCVRKCPYCDFNSHAVPDGALSAELEQ
FT                   TYLKALVADFETQVEMAQGRSIHSVFIGGGTPSLISAKGYVWLFEQLKSLLNFEDDCEI
FT                   TLEANPGTLEHDPFAGYLEAGINRLSIGVQTFNTDHLQKLGRIHSANNAMDAIEQARRA
FT                   GFKRVNVDLMHGLPEQTLEQALYDLKTAVEHGATHISWYQLTIEPNTVFFRTQPVLPQD
FT                   EVLEDIQEQGEAYLKANGFINYEVSAWRKEQPSVHNLNYWQFGDYLAIGAGAHGKVTRP
FT                   DGVYRFQKTRLPKDYLAKVPAEHLQMKKIEADELPFEFMMNALRLNDGVKAELYEQRTG
FT                   LSLDDLNDLLTSLRSRELLVEDSGRLACTEQGHIFLNSVLEEFL"
FT   gene            complement(431078..431833)
FT                   /locus_tag="A1S_0398"
FT   CDS_pept        complement(431078..431833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0398"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10857"
FT                   /protein_id="ABO10857.2"
FT                   /translation="MTTHSLKDKVVLITGGAKNLGGLISRKFAEQGAKLAIHYNSSETQ
FT                   ADAEQTLADVKALGADAILIQADLTDIDNIEKLFLDTKQHFGGIDIAINTVGKVLKKTF
FT                   LETTEQEFDSMSDINSKIAYFFIQSAGRHLKNGGKICSIVTSLLAAYTGFYSTYEGLKA
FT                   PVEHYTRAASKEFGDRQISVTAVAPGPMDTPFFYGQESAEAVAYHKSASALGGLTKIED
FT                   IEPLVRFLVTDGWWITGQTIFANGGYTTR"
FT   gene            431946..432842
FT                   /locus_tag="A1S_0399"
FT   CDS_pept        431946..432842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0399"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10858"
FT                   /protein_id="ABO10858.2"
FT                   /translation="MDRLQQFYIFTEVAKRQSFSEVANQLDLPRSTVTSAIQQLETHYG
FT                   VRLFHRTTRKVSLTQDGQRILPECQNLLFDYEQLEQLIQTQKQHYRGTLKISMPSRIVH
FT                   QVIIPELPDFYHRYPDIHLQLNSSDDLTDLIEKGIDCVVRVGELDNSSLIARFIGHLVM
FT                   VNCASTQYLQDYGIPEQLNDLEQHKLINYAGAVGEKQGEFIYQGGTVMMDSALSVNNTE
FT                   AYIAAACAGLGIIQLPYYDVQDKIEQGILVEVLSAYSAPSLPLNILYPNRSYIPKRLEV
FT                   FMNWVGEVLNRKCIVIF"
FT   gene            complement(432905..432980)
FT                   /gene="trnK"
FT                   /locus_tag="A1S_0400"
FT   tRNA            complement(432905..432980)
FT                   /gene="trnK"
FT                   /locus_tag="A1S_0400"
FT                   /product="tRNA-Lys"
FT   gene            complement(433003..433078)
FT                   /gene="trnK"
FT                   /locus_tag="A1S_0401"
FT   tRNA            complement(433003..433078)
FT                   /gene="trnK"
FT                   /locus_tag="A1S_0401"
FT                   /product="tRNA-Lys"
FT   gene            complement(433311..435152)
FT                   /locus_tag="A1S_0402"
FT   CDS_pept        complement(433311..435152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0402"
FT                   /product="putative very-long-chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10859"
FT                   /protein_id="ABO10859.1"
FT                   /translation="MSQTTQTDIITLGDVATRLPSFIPKVPHILNGLKQAYLRTSNTPT
FT                   GLGIAFEKAVKRNPKGTALLFEDQSYSYEALNEWANQISHYYLSLGARKGDVIAVMIEN
FT                   RSELIATIVGLAKIGVTIALVNTSQVGKVLAHSINLVKPIAVIAGEEVRAAIDEIRQDL
FT                   NVPKDRFHWFADQATRQNSGTAPEGYVNLADQIDQFPKFNPSTTRSVTGNDGLFYIYTS
FT                   GTTGLPKAVIFKHSRWTLAYGTYGHILNLGPDDVMYVTLPLYHATGVVVCWCGVIAGSA
FT                   TLAIRRKYSTSAFWKDVQKFNASAIGYVGELCRYLMDAPVTELDRNHRVTKMIGNGMRP
FT                   NIWDKFKQRFGVKEVLELYASSEGNVGFSNIFNFDNTVGFSPTPYAIIQFDKEKNEPIR
FT                   DKNGWCQKVKAGEVGLLIGKITSRSPFDGYTDPEKNKSVIWKDVFKKGDSYFNTGDLVR
FT                   DIGFRHAQFVDRLGDTFRWKGENVSTTEVENMVCEYDKIAEAVVYGVEIPNTNGRAGMA
FT                   AITLADGEELNDADLTEMVTVFKKCLPTYAVPVFLRVQKKVETTGTFKYQKNKLKEEAF
FT                   NPSKTSERLLALLPGASCYCDITTEIFDNIQAYKYRF"
FT   gene            complement(435345..438677)
FT                   /locus_tag="A1S_0403"
FT   CDS_pept        complement(435345..438677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0403"
FT                   /product="ribonuclease E"
FT                   /note="RNase E"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10860"
FT                   /protein_id="ABO10860.2"
FT                   /translation="MKRMLINATHAEEVRVALITGNRLYDFDLENRTREQKKSNIYKGH
FT                   VTRVEPSLEAVFVEYGAGRQGFLSMREIANSYFQADPRQTSNIRELITEGTELLVQVEK
FT                   EERGNKGAALSTFISLAGRYLVLMPNNPKGGGISRQISGSVREELKEILASLNVPRGMS
FT                   VIVRTAGIGRTQEELQLDLQHLLDLWAQIQGTASSGPSPMLVHQEAGVVTRAIRDYLRD
FT                   DVAEILIDSEQAYNEAYNFVKAVMPRQLDKLKTYTLNEPLFAHFGIESQIQTAYEREVK
FT                   LPSGGSIVIDQTEALVSIDINSAKSTRGHDVEETALNTNLEAAEEIARQLRLRDIGGLV
FT                   VIDFIDMTKERNQRMVEAKLREATQSDRARIQFGQLSRFGLMEMSRQRLRPSLEEATGY
FT                   VCPRCHGTGMVRDLRSLSLSIMRKVEEIALRERHGEVQVEVPVEIAAFLLNEKRHSLVY
FT                   LEQTSGVRVTVLPHPHLETPHYEIAYNPDGFAPSSYERTEATRSSEKELGYESSEWHLE
FT                   EADHGHAHVTATASTHAAAQKKANHATQPVAQPSAQKAASPCAWLENLFVQKQAQTVDQ
FT                   SRSAQNAAAAIEQMVNTGAVSRGQFGQVAVPAVAEVAPVQSNNAYISQSPVKQDVREHV
FT                   EKDDKSQQQRQNNKKRKHKEQREQHHQSHEQQHQVHEEVVQLSRQEQRELKRQQKRQQQ
FT                   QDQQHQNNDVQHTENAVPRRDRNNQQRPNRPNRHRDPSVLNENQNTPVVVDEKQIKVDV
FT                   IDAPKHDVMNTALIINVDQGQSEIVALTPERRHVERVETTSTEVAQEPTPAPVVAEKAA
FT                   VVETKEEAQPSQEAAQPQIKRASNDPRMRRRQQREAKHAKAATPSIAPSQIPTLAQHTI
FT                   GSLIRHVYGEDCTVLIEQFGLVPTFNRALQKFAEQYASTLVVEVTAETEEKKPVTRDAE
FT                   LPSHKPAEEAEPAPVLPLTPPQAPAPRVANDPRERRRLAKLAAEQAFEQVKQQHSAQEE
FT                   VATPAPVAEETVAAPTAETQATVEPAQQPLELNQSTEVVQPEAAPAEEKATEETVAEAP
FT                   AAKEPAPSKAASKAKAAAEETVAPAEATTDTESEDVKADKDKPSRPRRPRGRPPKKANP
FT                   VAE"
FT   gene            439442..440328
FT                   /locus_tag="A1S_0404"
FT                   /note="contains frameshift; similar to 23S rRNA
FT                   pseudouridylate synthase"
FT   gene            440328..441002
FT                   /locus_tag="A1S_0406"
FT   CDS_pept        440328..441002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0406"
FT                   /product="putative phosphoglycolate phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10861"
FT                   /protein_id="ABO10861.2"
FT                   /translation="MSLKTELVIFDWDGTLYNSVGQIVASLQHAAEEHKLTLTDEAAKS
FT                   IIGLGLPEVMQTLFPEVPDLHDSILKAYGDHYIANSTNDAWFEGISELLHDLKAQGLKL
FT                   AVATGKNRRGLDRVIAKTQSTHLFDVTRAANETRSKPDPLMLQEILTVTGVSVEQAVMI
FT                   GDSSYDLEMAQRLGMPRIGVGYGVHSVEVLQQFQPLTIAKDVPELHNFLREYAKLSTVD
FT                   VA"
FT   gene            441076..441771
FT                   /locus_tag="A1S_0407"
FT   CDS_pept        441076..441771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0407"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10862"
FT                   /protein_id="ABO10862.2"
FT                   /translation="MSRSIRLLNLLQQLRESRYPVTAQVLAERLGISIRSIYRDIDSLR
FT                   AQGVRIDASAGLGFQLKEDILLPPVTFNENEAEALFLALEWLKDVPDQAMKSAAVSIYS
FT                   KLYAVLPEHRKYLIDDMTLGVTHYWHPVDEALVEQVRLAIRKQVKIKVDYCDEHKRISQ
FT                   RSLWPFALGYLHDKVVLAAWCELRQAFRHFRIDRIHDLQMSEEIYPEFKKHLFQRWWKQ
FT                   EMQRTTDKN"
FT   gene            441821..442426
FT                   /locus_tag="A1S_0408"
FT   CDS_pept        441821..442426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0408"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10863"
FT                   /protein_id="ABO10863.2"
FT                   /translation="MSLKLYTNNESRGVVIDWLLVELGVECERIEVAYRTEMKSPEYLK
FT                   LNPFGKVPVLVDGDVVIYELGAICAYLADKFSDKGLAPALDDPKRGLYYRWLFMMAGPW
FT                   EAAGVDKALGIEIAPEQKMFVGYGDYNDAYQALVQGLSEANPYVCGEQFTAADVSVGAM
FT                   LLWQLKIKTIESHPAITRYVETIKQREGLKQSSMGQLL"
FT   gene            complement(442486..443163)
FT                   /locus_tag="A1S_0409"
FT   CDS_pept        complement(442486..443163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0409"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10864"
FT                   /protein_id="ABO10864.2"
FT                   /translation="MVGLFQHLGRSVQNRPHFFIALIFGVVVASLLAWLTSWKWSTILL
FT                   ASWNGSISLYLLHVWKLMRSADHSQMQQQAKKQDESKWVIMLIVLLAITMSLVAILVQL
FT                   SQLPSGHYEKLGHVALALLTIISAWLFMHTVFALHYAHDFYMALSRNEENGGLDFPGTE
FT                   HPTYPDFLYFSYIIGTSAQTADVSITNKHMRLLNLFHAVLSFGFNTTILAICINVAAGF
FT                   LTN"
FT   gene            complement(443427..444326)
FT                   /locus_tag="A1S_0410"
FT   CDS_pept        complement(443427..444326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0410"
FT                   /product="hca cluster transcriptional activator (LysR
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10865"
FT                   /protein_id="ABO10865.2"
FT                   /translation="MELRHLRYFITVAEELNFSKAALKLYTAQPSLSQQIKDLEEDVGV
FT                   RLLNRTKRKVELTEEGEVFLEHARLTLAQADKAVAMARQVSKAKQQLLRIGFVPIAEMK
FT                   IFPYVLPNLRLQHPDLTIELSSLNNAEQLKALKRGELDITFTRDNTENDEIQSQFVLTE
FT                   PLIFLLPRNHPLAKYDRIPVKALHGIDFIIPAAEQSNTLHNTILEFTKTHGIDLNIVQK
FT                   ADSILLNINSIGSGLGCTILPAYVAPLGVSNTVVRPLDVELPSLDLFVSYRKNTESVGV
FT                   KRFIDQLNKVFHLDKNLD"
FT   gene            445063..446115
FT                   /locus_tag="A1S_0411"
FT   CDS_pept        445063..446115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0411"
FT                   /product="putative Zn-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10866"
FT                   /protein_id="ABO10866.2"
FT                   /translation="MKDKPTLTYQLPTQSCWTHTWIKPPFCHPELGHENDTRFYNQQPR
FT                   SPARGSKELLRWLVTRESYTWNVDIQNEYDVRVNTPIALPQNRPHADLDDWQVWFVGHA
FT                   TVLIQIGPYNFITDPVWCDYASPLHGRGPRRVCPAGFALEQLPTIHGVLLSHNHYDHMD
FT                   LATLEWLHKKFAMPIYTGLGNGFYLPKEFHVIEMDWWQEIPYHELRIVYTPAQHGSGRG
FT                   LRDQNKALWGGFSVLAKTGHCFFAGDTGYAGHFKQIHTRYGAPRVALLPIGAYEPRKLM
FT                   SYVHMNPQDAVHAHLDLQAHRSVAIHYRTFQLTDEGREDPEHALAQAIKASSKLANPFY
FT                   CIREGHKLTV"
FT   gene            complement(446182..448338)
FT                   /locus_tag="A1S_0412"
FT   CDS_pept        complement(446182..448338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0412"
FT                   /product="catalase"
FT                   /note="hydroperoxidase HPI(I)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10867"
FT                   /db_xref="GOA:A3M1S3"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S3"
FT                   /protein_id="ABO10867.2"
FT                   /translation="MSNESKCPFSGHNSKPQVTVGGGTANLHWWPNQLRVDLLNQHSER
FT                   SNPLGKDFNYRQEFKKLDYYALKADIKNVLTDSQDWWPADWGNYTGLFIRLAWHAAGTY
FT                   RMGDGRGGAGRGQQRFAPLNSWPDNASLDKARRLLWPVKQKYGQKISWADLFILAGNIA
FT                   LESSGFRTFGFGAGREDVWEPDNDVNWGDEKEWLAHRNSEALAGSNLAATEMGLIYVNP
FT                   EGPQASGDPRSAAPFIRATFGNMAMDDEEIVALIAGGHTLGKTHGAAPADHVQADPEGA
FT                   PIEQMGFGWANSYGTGVGKDAITSGLEVIWSQTPTQWSNYFFENLFKYEWVQERSPAGA
FT                   IQWVAADAEAIIPDPFDPSIKRKPTMLTTDLTLRFDPEFEKISRRFLNDPQAFANAFAR
FT                   AWFKLTHRDMGPKARYLGPEVPAEDLIWQDPLPAASATPSSASIADAKAKIVALGLSAG
FT                   ELVSLAWASASTFRGGDKRGGANGAHIALSPQREWEVNKKAVETLTQIEELKASTQLSL
FT                   ADLIVLAGNVGVEQAAQAAGFNITVPFAPGRVDALQSQTDVESFQLLLGLADGFRNWKK
FT                   QGVNTPAEVLLIDKAQQLTLTAPELTALIGGLRVLGTNWDGSQHGVFTQQVGVLSTDFF
FT                   TNLLDMSNVWAPVDSTSEVFEGKDRKSGTVKFTATRNDLVFGSNSILRALAEVYAQADG
FT                   KEKFVQDFVAAWTKVMNLDRFDLA"
FT   gene            complement(448854..451148)
FT                   /locus_tag="A1S_0413"
FT   CDS_pept        complement(448854..451148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0413"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10868"
FT                   /protein_id="ABO10868.2"
FT                   /translation="MSNMQLDTLRRIVQEINASVSLHESLDIMVNQVAEAMKVDVCSIY
FT                   LLDERNQRYVLMASKGLNPESVGHVSLQLGEGLVGLVGQREEIVNLDNAPKHERFLYLP
FT                   ETGEEIYNSFLGVPVMYRRKVMGVLVVQNRLPQDFSEAAESFLVTLCAQLSGVIAHAHA
FT                   VGNIDVFRKPSNGPAYKTFQGVSGAGGVALGRAIILYPPADLGSVPDREAEDISDELRI
FT                   LDQAISSVRSEIRSLDEKMHDSLMAEERALFSVFLRMLDENALPAEIKELIRDGHWAQG
FT                   AVRRVIEKHTALFAQMEDDYLRERVSDLKDLGRRILAYLQEEDSSHRELSPDSILIGEE
FT                   ISTAALVELPVDNIAAIVTSEGAANSHMVIVARALGIPTVVGVTELPVNTLDDAEMIVD
FT                   AYQGRVFVNPPRRLRQRYKEIQKEDEQIAKDLKQYETKEAITPDGVSVQLFVNTGLMID
FT                   VVRGVQRGAQGVGLYRSEIPFMLRERFPGEEEQRAIYRQQLSHFANKPVVMRTLDIGAD
FT                   KDLPYFSIEEENSALGWRGIRFTLDHPEIFSAQIRAMLKASIGLNNLHILLPMVTTVSE
FT                   VEEVLYLLERDWIAVQEEEQVKITKPKIGIMVEVPSVLLQIDEFAELVDFFSVGSNDLT
FT                   QYLLAVDRNNPHVANVYSHFHPSILRALTRLVKECHKYQKPVSICGEMAGDPLSAILLM
FT                   AMGFNTLSMSSSNILRVRKAICHVPMSDAQKLLDDVMKMNNPLIVKSWLEYYFKTHGLA
FT                   DMVKSNRLVSV"
FT   gene            complement(451234..451719)
FT                   /locus_tag="A1S_0414"
FT   CDS_pept        complement(451234..451719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0414"
FT                   /product="(di)nucleoside polyphosphate hydrolase (Ap5A
FT                   pyrophosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10869"
FT                   /db_xref="GOA:A3M1S5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S5"
FT                   /protein_id="ABO10869.2"
FT                   /translation="MIDSEGFRPNVGIILANDDGQVLWAKRIGHNAWQFPQGGIQFGET
FT                   PEQALFRELREEIGLLPEHVQIIAQTKGWLRYRLPHRYIRSDSDPVCIGQKQKWFLLKL
FT                   TAPAKNIQLNLADPPEFDEWQWVSYWYPLGQVVNFKRDVYRKAMVELCTQLPVQQLP"
FT   gene            451902..452552
FT                   /locus_tag="A1S_0415"
FT   CDS_pept        451902..452552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0415"
FT                   /product="putative hydrolase haloacid dehalogenase-like
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10870"
FT                   /protein_id="ABO10870.2"
FT                   /translation="MKLALFDLDHTLLNTDSDHSWGEFLVNEGLVDPVHHRQMNDKFYE
FT                   DYKAGQLDPYAYNEFVFGFLTKHDNNYLTELHQLFMEKVIRPQMRPKGFDAIKKHQDLG
FT                   HTIVGITATSDFITAPIFREFGITEILATNAEVADGKYTGKVAGLACYQKGKLARLEAW
FT                   LDGRSVSESWAYSDSINDRFLLEYATHAIAVNPDDRLEKLAQEHNWEIQDWSI"
FT   gene            complement(452557..453417)
FT                   /locus_tag="A1S_0416"
FT   CDS_pept        complement(452557..453417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0416"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10871"
FT                   /protein_id="ABO10871.1"
FT                   /translation="MNLAAFEAFVKVMETGSISVAADQLFITQPAVTKRIHSLEEYFGV
FT                   KLFESAGRGVQATHAAHSLLPKVKSWLNELRDIHHTLSHEQTQIQGRLKIGTSHHIGLH
FT                   HLPAPLKHFVQQFPQVTLDVHFVDSEQAHEQVLAGDLELAFLTLPPSGDERLNYITIWN
FT                   DPLVFVAAPFHPLAQKKNLTLQDLIEYPSLLPAAQTYTAQITLAEFEKQGLKPKITMSN
FT                   NPLESIRMLVSIGLGWSVLPKTLLNQDMQQLDLNVEMNRQLGMVWHPARTQSRAMQELI
FT                   KMMQE"
FT   gene            454027..455445
FT                   /locus_tag="A1S_0417"
FT   CDS_pept        454027..455445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0417"
FT                   /product="3-isopropylmalate dehydratase (isomerase) subunit
FT                   with LeuD"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10872"
FT                   /db_xref="GOA:A3M1S8"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S8"
FT                   /protein_id="ABO10872.2"
FT                   /translation="MAGKTLYDKLWDDHVVTQRDDGSCLLYIDRHLLHEVTSPQAFEGL
FT                   QLAGRQPWRLSANVATPDHNVPTSKKERDQGIAGIEDDTSRIQVQTLDDNCKAFNIVEF
FT                   GINDIRQGIVHVVGPEQGLTLPGMTVVCGDSHTATHGAFGCLAHGIGTSEVEHVLATQC
FT                   LVQKKSKNMLVRVDGVLGKGVTPKDVVLAIIGKIGTAGGTGYAIEFGGQVFRDMSIEGR
FT                   MTVCNMAIEAGARVGMVAVDEKTIEYVKGRSYAPKGEQWDQAVAYWNTLHSDDDAVFDA
FT                   VVELNGTEIEPQVSWGTSPEMVIPVSKAVPTLEQAKDDVQRNDWTRAYQYMGLNAGQAL
FT                   ADIQLDRVFIGSCTNSRIEDIRAAAEVVKGRKVAPSIKQAMIVPGSGLVKQQAEKEGLD
FT                   KIFLEAGFEWREPGCSMCLAMNADKLQPGEHCASTSNRNFEGRQGNGGRTHLVSPAMAA
FT                   AAAIAGHFVDVRSF"
FT   gene            455464..456111
FT                   /locus_tag="A1S_0418"
FT   CDS_pept        455464..456111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0418"
FT                   /product="3-isopropylmalate isomerase (dehydratase) subunit
FT                   with LeuC"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10873"
FT                   /db_xref="GOA:A3M1S9"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1S9"
FT                   /protein_id="ABO10873.1"
FT                   /translation="MKAYTVEQGIVAPLDRANVDTDLIIPKQFLKSIKRTGFGDNLFDE
FT                   LRYLDEGYPGQDNSVRPKNPDFVLNQPRYQGATVLIARTNFGCGSSREHAPWALNEYGF
FT                   RTVIAPSFADIFFNNCFKNGMLPVILPEDIVDQLFKECAAQEGYQLTIDLAAQEVRTPT
FT                   GEAFKFEVDPFRKHCLLNGLDDIGLTLQNADAIRAYEEKTKQVRPWVFQEIN"
FT   gene            456305..456814
FT                   /locus_tag="A1S_0419"
FT   CDS_pept        456305..456814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0419"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10874"
FT                   /protein_id="ABO10874.1"
FT                   /translation="MDTVRIKQAEQENLGQNAAIYCSGAKSCEFERLNDITVVDAQTRR
FT                   ISNQAIHQGIVRLNGSVLSQSNSLYLSVPAKQYEVVIRYYPISPDRAETIHVIHQFKAN
FT                   HRYMFKMYRDKSNRSGSLLNVSVPDPLCVDLEQDGRVIRRFCRPFDVTTGLGEFLEQKK
FT                   LTPRQS"
FT   gene            456846..457925
FT                   /locus_tag="A1S_0420"
FT   CDS_pept        456846..457925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0420"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10875"
FT                   /protein_id="ABO10875.2"
FT                   /translation="MSKQILILAGDGIGPEIVGAAEKVLNKVNEKFNLSLTWEHGLLGG
FT                   AAIDAHGEPYPAVTSEQAKKADAILLGAVGGPKWDTIERSIRPERGLLKIRSELNLFAN
FT                   LRPAILYPQLADASSLKPEIVAGLDILIVRELTGGIYFGQPRGIRELENGEKQGYNTDV
FT                   YSESEIKRIAKVAFELAGLRGGKVCSVDKANVLEVTELWKQTVTDLQQANYPNIQLSHM
FT                   YVDNAAMQLVRAPKQFDVIVTGNLFGDILSDEAAMLTGSIGMLPSASLDENGKGMYEPC
FT                   HGSAPDIAGQNVANPLATILSVAMMLRYTFREEAAAKAIEDAVGQVLDQGLRTADIMSE
FT                   GMTKVGTAEMGEAVVAALA"
FT   gene            complement(458975..459196)
FT                   /locus_tag="A1S_0421"
FT   CDS_pept        complement(458975..459196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0421"
FT                   /product="protein chain initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10876"
FT                   /db_xref="GOA:A3M1T2"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1T2"
FT                   /protein_id="ABO10876.1"
FT                   /translation="MANKEELIEFEGVVTETLPNTMFRVRLENGHEVIAHISGKMRKHY
FT                   IRILTGDSVKVEMTPYDLTKGRITYRAR"
FT   gene            459446..460471
FT                   /locus_tag="A1S_0422"
FT   CDS_pept        459446..460471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0422"
FT                   /product="putative transcriptional regulator (AraC family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10877"
FT                   /protein_id="ABO10877.2"
FT                   /translation="MEGHCVGQLTDASVVLRFGYQAIRRAGLPTEEILTKAGVALNQVD
FT                   TNARTPLSAQYAFWTAAQEVSKDPDIGLHLGEHLPLYRGQVIEHLFISSETFGEGLKRA
FT                   LAYQRLISDAFDAKLVVEDGRCYLTNGEQVGADNLVNRHFSECAISGVLRFFKFITEGQ
FT                   FHPIFIDFNFSEGASEDEYFRVYGCPVSLGQKETRLYFDPAILDFQLWQAEPELLQLHE
FT                   QLAIEKLQELARYDLVGEVRRAIGSTLESGETTLETVAAQLNITPRRLRTQLSEANTSF
FT                   QQILSDYRCRLAKKLLANTNESVERIVYLTGFSEPSTFYRAFKRWTNETPVEYRKRKQH
FT                   R"
FT   gene            complement(460491..461288)
FT                   /locus_tag="A1S_0423"
FT   CDS_pept        complement(460491..461288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0423"
FT                   /product="tRNA-pseudouridine synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10878"
FT                   /db_xref="GOA:A3M1T4"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1T4"
FT                   /protein_id="ABO10878.2"
FT                   /translation="MQRYAVGIEFSGIQYRGWQTQQPGVASVQETIERVLSKIADEPIT
FT                   LHGAGRTDAGVHATNMVAHFDTNAIRPERGWIMGANSQLPKDISIQWIKQMDEEFHARF
FT                   KATARRYRYVVYNAPHRPALLHKQVTHIYQKLDVQKMIKAASKFEGTHNFETFRAAACQ
FT                   SNQPVRHVKHCRLFEHGRYLVLDIQADGFLHHMVRNIMGCLLEIGQGMYEIDHIDAMFA
FT                   AEDRKAAGITAPPDGLYFIQCYYPEQFDLPHPPLGPHWLNLPE"
FT   gene            complement(461303..462250)
FT                   /locus_tag="A1S_0424"
FT   CDS_pept        complement(461303..462250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0424"
FT                   /product="putative L-asparaginase I (AnsA)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10879"
FT                   /protein_id="ABO10879.2"
FT                   /translation="MGGTFGCIGEPLAPMPYDQFLPQLEKVIPPHLTVDCFAAPNIVDS
FT                   SACTAPDWLRLIQRIQQLQLEGYQHFVVIHGTDTLSYAAATLARFLGQSCHIVITGSQY
FT                   PLLNIQGDNTREFTDAIENLYLALEQVIALPVGAYLAFHHQVFHAQTALKTHTTELDAF
FT                   SGLSSNVEFTPQQNELIVQDTQIEKAASFQILNWMMQPIATQYLVQQLRHLLPAPPHFL
FT                   VLQGFGTGNIAVNDEFLATLDELYARGCVPILATQVTFGGIDQRYAISAWAKTAKIVIN
FT                   DTHSHADLYAKALQIYLKYPTPEQWLNHWNENLH"
FT   gene            complement(462333..463592)
FT                   /locus_tag="A1S_0425"
FT   CDS_pept        complement(462333..463592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10880"
FT                   /protein_id="ABO10880.2"
FT                   /translation="MLYVIPFIILLVVAVILKKRENSQKQEATSPKNINRKSGKKASAK
FT                   SSKSSREKTKAKVIEENTPAIPQSNPVPEALRHNIQQLIQEKQFSAAEAQVNQALKKDN
FT                   TQHELYLLLLEIHIAQKDEFAIQQLISHIRSLGLNEIAAQAETRQKEYESSRQPDAIDF
FT                   PQAQTYEEPKNTDTTAQFDELTTSSSEASFDDLQKDYTPVKQEPAVEIEPLEFNFSFEQ
FT                   TSATENTNQPAQQPELSSTQETNELADLEFSFDLAPLHETEEKSQAVEVKADQENSINA
FT                   LDFHLDLNPSSSETKSVEQAPSLDEIKLIEQTPLEATSITPLEFSLDEPALVTAPEIEI
FT                   QNNEVVNERVTQTQIEDPLLEAFPKLKQINENELDLKLAEQYIKFGANQAARNLLQGDE
FT                   QKFNTEQQQHAKNLLNRIAS"
FT   gene            complement(463652..465016)
FT                   /locus_tag="A1S_0426"
FT   CDS_pept        complement(463652..465016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10881"
FT                   /protein_id="ABO10881.2"
FT                   /translation="MTAYNKLKIAIFTIMSSPSLYAITLDPIQIQSAPGELLYAEMNFQ
FT                   QADPNTPLQVSLATQDDLNGLGVTHQPPGNLNFYIRQNGQGSGVIVITSSRPIIDPELN
FT                   IVVKVSEGNATRLQHIKTVLKPSPIKKAAINESPLSPQFIVNEKDIALNLPESTQYTPT
FT                   ENTSTVAETTSNEHNLNISTGTAPALNSSSPAPVAPFTEKPSTQTLQPTIATMNTESSA
FT                   VEKQPSTSLKSSDGNQTTTVKKAAQSKTAQQKNVLSKNTPKKQKISAYKGPAPTGKYVV
FT                   QRNESLWSIANRIAAQTKQPVAKVMRDIQAQNRHAFIQGDVNRLRQGSSLNLTTNTTKA
FT                   SHLKPKSSEAHLAKPSSGRAKYRLQQAEMSIVAENSPNSAHGSAKKSTQQSQNNTELAV
FT                   KVMTTRKKTVTLQRNVTKLNQTLSLKDQRIQLLNARLAELQQQLQAQQQTHKQKH"
FT   gene            complement(465165..466283)
FT                   /locus_tag="A1S_0427"
FT   CDS_pept        complement(465165..466283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0427"
FT                   /product="aspartate-semialdehyde dehydrogenase
FT                   NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10882"
FT                   /protein_id="ABO10882.1"
FT                   /translation="MKVGLVGWRGMVGSVLMQRMVEENDFAHIEPFYFSTSNAGGEAPS
FT                   FGGKTAPALMEATDITSLKQMDVIITCQGGDYTSEVFPKLKATGWDGYWIDAASTLRMT
FT                   DDAIIVLDPVNLNVIKDGLAKGTKTFVGGNCTVSLMLMGVGALFQNNLVEWMTAMTYQA
FT                   ASGAGAQNMRELLTGMGYLYNNTKTLLDDPKSAILDIDRQVAELQRGEGFPSANFGVPL
FT                   AGSLIPYIDKQLESGQSKEEWKGQVETNKILGNSQIVPIDGHCVRIGAMRCHSQALTIK
FT                   LKKDVPLDEIEDMIRNSNQWAKVVPNTREASMTDLTPVAVTGTLTVPVGRLRKLNMGKE
FT                   YLGAFTVGDQLLWGAAEPLRRMLRILVEYKSS"
FT   gene            466473..467594
FT                   /locus_tag="A1S_0428"
FT   CDS_pept        466473..467594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0428"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10883"
FT                   /protein_id="ABO10883.2"
FT                   /translation="MIYIEVLAVVVIWLSFWSLIPRDEWWFRGADFPRLQILFIGLIAL
FT                   IGMLFWPTEWDVWRELLLAVLIAAIAYQLKMVLPYTLFWKKQVKKVKQHQLDPTKQISL
FT                   IVSNVLTPNDKYHLLLEHVRTLKPDLLLTLESDTTWENALKEIEKDYPYRVPVPLDNLY
FT                   GMHLYSRLPLKNTEVKFILSNEIPSIHTTVILRSGMPVQLYCLHPKPPSPTEAKDSTLR
FT                   DAELLIVGDQIKDLDESCIVMGDLNDVAWSRTTRLFQRISGLLDPRVGRHFINTFHADY
FT                   PLLRWSLDHIFHSTDFGLVKMQRLSHIGSDHFPVYVVLQTGRIFEEIHEELEQTQADEE
FT                   EAQAAIQEGIAKAEKEEKIVTDEIAQPYKEKNI"
FT   gene            468284..469570
FT                   /locus_tag="A1S_0429"
FT   CDS_pept        468284..469570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0429"
FT                   /product="glutamate:aspartate symport protein (DAACS
FT                   family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10884"
FT                   /protein_id="ABO10884.2"
FT                   /translation="MKNFKFSLAWQILIALILGIVVGAVLHNQPEIKDSIVNNVLTPLG
FT                   KIFISLIKMIVIPIVFSTLILGIAGVGSTKSLGRLGFKTILYFEIITTIAILVGLFAAN
FT                   IFHPGSGIDMSQLVQTDISQYKHTTEEVQSQSHGIIQTILSLIPTNIISSMAHGEMLPV
FT                   IFFAVLFGIGLSSLPATTKDPLLNVFHAVSETMFRVTHIIMKYAPVGVFGLIAVTVANF
FT                   GFASLIPLGKLVVLVYGAILFFALVVLGITAKMFSINIFTLFKILKDELILAYSTASSE
FT                   TVLPRIMQKMEAYGAPKAISSFVIPTGYSFNLDGSTLYQSIAAIFIAQLYGIEMSISQQ
FT                   VILVVTLMITSKGIAGVPGVSFVVLLATLGSVGIPVEGLAFIAGVDRIMDMARTALNVV
FT                   GNALAVLVISKWEKQYDYEKAAAYEASLK"
FT   gene            complement(469633..470733)
FT                   /locus_tag="A1S_0430"
FT   CDS_pept        complement(469633..470733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0430"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10885"
FT                   /protein_id="ABO10885.2"
FT                   /translation="MKVMQLLPELNSGGVERGTLEIARALVAQGHQSLVVSNGGRLVSQ
FT                   LEAEGSTHLTLPIHKKSLSSLWQIRPLRQLIEEHQPDIVHVRSRVPAWLTHFALRKIPA
FT                   NKRPHLISTVHGFYSVNRYSAIMTQAEKVIAVSDSVVKYITDHYKNCPPQDIVRIYRGI
FT                   DPAAFPHNYQPSAQWFNQVFNDFPELENKFLLCLPGRITRLKGHESLIELMQQLHSQYP
FT                   QLHAVIVGGADVKKQAYLSELQNTIQSKGLADKITFVGHRSDIREWLAFSDIVLSLSNQ
FT                   AETFGRTALEALSVGTPVIGWNRGGVAEILSHVYPQGLVEAENEKALLETVKHHIEQPQ
FT                   TVAPVTMFSLKDMCDQTLELYQSVLN"
FT   gene            complement(470999..471934)
FT                   /locus_tag="A1S_0431"
FT   CDS_pept        complement(470999..471934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0431"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /note="heat shock protein B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10886"
FT                   /protein_id="ABO10886.2"
FT                   /translation="MSQKQPYTPGEFQWSFLLPKYWGVWIAITFLMLLAILPWAIQWRL
FT                   AHGLANLAWKYLKSRRKTTIRNLEVCFPEWSPEKVQQQAKQVFVDMMLGIFETLNAWYK
FT                   PYWFKNRVTIEGLEHITNAQAQGKGVLLLGTHSTLLDAGGYVCAQYFEPDVVYRPQNNP
FT                   LLDMLIYRCRGTIYKAQIDHDDMRGLIRHLKEGDAIWYSPDQDFGLKQGVMAPFFGVPA
FT                   ATVTAHRRLLKISKAVAVPLYFYRHGDVQNPKYHILIEPAVDNMPSEDEVDDATRVNKI
FT                   IENQLRIAPTQYMWFHRRFKTRPEGYEEIY"
FT   gene            complement(472054..472686)
FT                   /locus_tag="A1S_0432"
FT   CDS_pept        complement(472054..472686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0432"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10887"
FT                   /protein_id="ABO10887.2"
FT                   /translation="MLDLSQILAFGLICLAMVLTPGPNMIYLISRSISQGKIAGFISLG
FT                   GVAVGFVFYMLCASFGITALVVAVPYAYDTIRIAGAMYLLWLAWKALRPNAAPIFNIKD
FT                   LAVDSPLKLFLMGFLTNLLNPKIAIMYLSLLPQFIHPQQGSILAQSIQLGTIQIFVSVS
FT                   VNALIVFSAGSIALFLQKKPLWASIQRWVMGTVLAGLAVRILLEHRR"
FT   gene            complement(472832..474742)
FT                   /locus_tag="A1S_0433"
FT   CDS_pept        complement(472832..474742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0433"
FT                   /product="transport protein Uup"
FT                   /note="ABC superfamily atp_bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10888"
FT                   /protein_id="ABO10888.2"
FT                   /translation="MAYITLRDVQLAFGGPALLDGANFNLERGERVCLIGRNGEGKSTL
FT                   LKLIEGSLLPDSGEVSVQNGLTVSMLAQDVPMSSGKVADIVAEGAGEAAAVLKAYHEAS
FT                   DACVLGDMEACDRMGSLQHKLDQLDGWALENKVNTILGKMELDPNADLADLSGGRKRRV
FT                   LLARALLTQPDVLLLDEPTNHLDVESIEWLEKFLLDQNNLTLLFISHDRSFVDRLATRI
FT                   VELDRGILRSYEGNYSRYLDLKAQQLEAEEKQNALFEKKLAEEEAWIRQGIKARRTRNE
FT                   GRVRALKALREESKARRFQQGKVNMGVQEAQRSGKLVFDIEHLSVSYDRQTLIRDFSAI
FT                   VMRGDRIGLVGDNGVGKTTLIKAILGEVQHEGVVKTGTQLEIAYFDQLRNQLDLEKSVS
FT                   ENVSEGSDFVDVNGQRRHILSYLQDFLFSPERARTPVKALSGGERNRVLLAKLLLKPSN
FT                   LIVMDEPTNDLDMVTLELLEEMLSEYKGTLLLISHDRAFMDNVVTSTWVFDGKGGIAEY
FT                   IGGYQDYLIQRPNERVVDQKGDVKKAQAKAEAEKNAAQTNVKKVKLSYKDQRELEQLPA
FT                   EIEKLENEQAELSDKLADGSWFVTDADAATKASQRLAEIEELLLEKLERWDELEQMSKG
FT                   N"
FT   gene            474775..475020
FT                   /locus_tag="A1S_0434"
FT   CDS_pept        474775..475020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10889"
FT                   /protein_id="ABO10889.1"
FT                   /translation="MTKPPYHDDQASFSAPIEDLQVRIAFLDDLVEELNQQLAIQTLEI
FT                   ADLKKQMQLLYQRVESADLSEGVAPFDPLTNKPPHY"
FT   gene            complement(474779..475009)
FT                   /locus_tag="A1S_0435"
FT   CDS_pept        complement(474779..475009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10890"
FT                   /protein_id="ABO10890.1"
FT                   /translation="MAYSLMDQKVQHLLINLQIPHVDKVIAFVFLNQLFLKFESRVADL
FT                   IPQLNHLKMQFALANLQWVRKMTLDHHDMVV"
FT   gene            complement(475068..476078)
FT                   /locus_tag="A1S_0436"
FT   CDS_pept        complement(475068..476078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0436"
FT                   /product="putative Zn-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10891"
FT                   /protein_id="ABO10891.2"
FT                   /translation="MKAVAYQKAGPITLPEALVDIELDTPVAKGHDLLIRVQAVSVNPV
FT                   DTKIRKNVSAEQSGWKVLGWDAVGTVEAIGDKVTQFKIGDVVWYAGALNRQGSNSELQL
FT                   VDERIVGHKPKTLEVTEAAALPLTAITAWEMLFDRLQIPKTAPANTTILVIGGAGGVGS
FT                   ITIQLLKQLTNLTIIATASRPETKEWVEQLGADYVLNHRQPLAAQIKQLGLSAPLYVFS
FT                   TTETDQHLSDIVELIAPQGHFGLIDDPDQLDIKPFKSKSVSVHWEFMFTRSMFQTEDME
FT                   KQSELLNEVSKLVDEGKIKTTVTQVLSPINAENLTRVHEQIESGSTKGKIVLHGF"
FT   gene            476178..476555
FT                   /locus_tag="A1S_0437"
FT   CDS_pept        476178..476555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10892"
FT                   /protein_id="ABO10892.2"
FT                   /translation="MAKARHSSFDCSPGCSVEAAISLIDGKWKCVILWHLLNEGTLRFN
FT                   EIRKRVPSITQRMLTNQLRELEQDGIIHREVYPQVPPKVEYCLTDLGRGLEQILLALKT
FT                   WGDAHLDQFGKLTTLETEKSA"
FT   gene            476703..477152
FT                   /locus_tag="A1S_0438"
FT   CDS_pept        476703..477152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10893"
FT                   /protein_id="ABO10893.2"
FT                   /translation="MDNIGIWVTVIIVLFVLGSIFGLRVSPREKALGIMRDKARKMGLH
FT                   PRVIAAPEWTHVPMATEKRASMVAYYSVLIPDARLPLMRARVIDGKLKVVQGDEKFNDS
FT                   PIALKGIYAIDMQANCVGLYWDEESDLKATQLDEMKAYLLALAEA"
FT   gene            477188..479824
FT                   /locus_tag="A1S_0439"
FT   CDS_pept        477188..479824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0439"
FT                   /product="DNA topoisomerase type I omega protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10894"
FT                   /protein_id="ABO10894.2"
FT                   /translation="MANTSRSASQSTASSASAAHKRALVIVESPAKAKTINKYLGSQYI
FT                   VKSSVGHVRDLPTGGSKATEKKPAARTKLTEAEKEQKANQALINRMGVDPEHGWQAHYE
FT                   VLPGKENVVAELKKLAKDADAIYLATDLDREGEAIAWHLREVIGGDDSRYHRVVFNEIT
FT                   KNAIQEAFKQPTRLDLNRVNAQQARRFLDRVVGFMVSPLLWEKIARGLSAGRVQSVAVK
FT                   LVVEREREIRAFIPEEYWQVFADTKAKKDDIRLEAVKQAGKTLKLKNKAETDALLDVLK
FT                   GAEYKVAQREDKPTKVNPSAPYITSTLQQAASTRLGFSVKKTMMLAQRLYEAGFITYMR
FT                   TDSTFLSDDAVSMVRAHIESQYGEKYLPAKPNRYGNKAGAQEAHEAIRPSNVALTGDQL
FT                   AGVERDAQRLYDLIWRQFVACQMTPAEYLSSTLTVEAGNVELKAKGRTLVFDGFTKVRG
FT                   ANKSDDDIILPAIKVGEILKLEKLDPSQHFTKPPARFTEASLVKELEKRGIGRPSTYAA
FT                   IISTIQERGYVKLENRRLFAEKMGEIVTDRLDESFNNLMNYAFTADLEGQLDRVATGER
FT                   NWKELLDTFYGDFKKRLTNAQGEQGMRRNQPVEVPAVHCPECSRPMQIRTGTTGVFLGC
FT                   SGYNLPPKERCKGTLNLTPVESLAALSDDDSAETADLMSKHRCPKCGTAMDSYVIDGGR
FT                   KLHVCGNNPDCDGYELEEGEFKIKGYDGPTIPCDKCDGEMQLKTGRFGPYFACTSCDNT
FT                   RKVLKNGQPAPPRVEPIKMEHLRSTKHDDYFVLRDGAAGLFLAASKFPKIRETRAPKVA
FT                   ELRSVADQLDPKYQFILQAPDVDPEGNPTIVKFSRKNQSQYVGSETPEGKQTKWSLIYQ
FT                   DGKWIEG"
FT   gene            479912..480670
FT                   /locus_tag="A1S_0440"
FT   CDS_pept        479912..480670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10895"
FT                   /protein_id="ABO10895.2"
FT                   /translation="MWKNIRILCLLIVLLIVAVQAWRDQNQDWNQPIVVVLHPINADGL
FT                   QTTQTYIHQLQNTDFQALKSYLSEWSQHYRGQSANFKIRLGQQLQQRPPEVPQNAGIFH
FT                   VVWWSLKFRFYAWRQQQPEDNGASLKLYLNYYDPNYQKVLVHSTALEKGRIGSVNLFAT
FT                   RGQALQNQVVIVHELLHGFGAKDKYDLKTGQPIYPLGYAQPEKVPLYPQKRAEIMGGRT
FT                   PLSEQTSKMPSDLQETVIGLPTAQEVGWLK"
FT   gene            480808..481380
FT                   /locus_tag="A1S_0441"
FT   CDS_pept        480808..481380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0441"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10896"
FT                   /protein_id="ABO10896.2"
FT                   /translation="MKTVGNDLVRNQLHADRKWYLILGFVLIIFGLVLFSSLPFATFSV
FT                   VFLFGILMMVGGVLHLIAALSVFKSGSRWLWALFGVLYLMAGYYAFSTPVTTAVVLTSL
FT                   LSIALIIAGVIRTINAFLLRPIAGWGWTLFSGLLTLATGILILVSKNSPFWVLGMFLAV
FT                   DILFQGINFLGLASAIKHLPSSSKTVS"
FT   gene            481497..483476
FT                   /locus_tag="A1S_0442"
FT   CDS_pept        481497..483476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0442"
FT                   /product="putative ATP-dependent DNA helicase (PcrA)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10897"
FT                   /protein_id="ABO10897.1"
FT                   /translation="MSLAKLINELNAQQKKAATTKAQNCLVLAGAGCGKTKTIVARAAY
FT                   LIDQGLPANQIQILTFTRRAASEIVARVEQHVGAQAKGLRASTFHTFCMYLLRRNPQAF
FT                   GLTQFSIIDRDDQLLMFRLLRGKDKDNVLPKAAELCDLYSYARNTQSKLSEALLKQLPE
FT                   AYEYKSQIAELMKTYEQRKRERNFLDYDDILSIVAVHLQNSEALTNWVAGFCQALLVDE
FT                   MQDTNPLQWALLQPLIGKVKLFCVGDDAQSIYGFRGADFENIHSFKERIPDAVIHTLDL
FT                   NYRSTQEILDLSNWLLAHSPIDYQKQLQAHRGKGQKPQLHLFGNEFEEANWIAQDLIER
FT                   HQQGANWYDHMVLVRSGYSARYLEGAFIAAEIPYRFIGGVKLLESAHVKDVLSLLRIVS
FT                   NPQDDLAWMRFLTLWDGIGDVGASKLAQELMSISEVEERCQRLERHGKVPLQAILILKQ
FT                   LDVLQQHVEASIGLALDALSEQLEQNYKTKDWSRRARDFDLVKQLARKHASLGEFLEEY
FT                   VLEPISISEIEKAGDDDLVTLITIHSAKGAEQKVCYVPHVSPNQYPYARAQGDFDEVEE
FT                   ERRVLYVALTRAENELILTKQNLNTWSQDTYDEQGRKTESYFLNDLPAHLVQAKIHRQV
FT                   PQPFAKKQWNTSRTVNLGFGIDLD"
FT   gene            483550..483789
FT                   /locus_tag="A1S_0443"
FT   CDS_pept        483550..483789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0443"
FT                   /product="putative RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10898"
FT                   /protein_id="ABO10898.2"
FT                   /translation="MKILVRNLDRSVTEAEVLELFKAYGKVESCVVVTDKDTGKSKGFG
FT                   FVEMPNPREAIKAIKGLNTLKVKGYGIRVKAAEE"
FT   gene            483797..483964
FT                   /locus_tag="A1S_3497"
FT                   /old_locus_tag="AS1_3497"
FT   CDS_pept        483797..483964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3497"
FT                   /old_locus_tag="AS1_3497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3497"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89922"
FT                   /protein_id="ABS89922.2"
FT                   /translation="MQQFLALSVVAPNGTRIAQRIKTLEVRSWVPAQLPLKDLFIVENQ
FT                   NFLINDGDEG"
FT   gene            484051..484584
FT                   /locus_tag="A1S_0444"
FT   CDS_pept        484051..484584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0444"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10899"
FT                   /protein_id="ABO10899.2"
FT                   /translation="MAILEQESLVMSRVARYHADRTNQKLYFARLACQQAEQTDHVQQV
FT                   QAYREAAVFHLHGAMLAFLQELVRYYRLNDLQPTLKSIEEHMAAKGQVSPEVSVLQQLA
FT                   KDGFVAELKRAYRMCQYAPEPTEPTPEEETSSNLIIKVTQGPQSWLPDVKILREWHREL
FT                   SHLIDGFRNEMVEF"
FT   gene            484697..484975
FT                   /locus_tag="A1S_0445"
FT   CDS_pept        484697..484975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10900"
FT                   /protein_id="ABO10900.1"
FT                   /translation="MSIQQLKELFGNQEAVLELVQLEGGELALRNAGSEKEPLVKIQFS
FT                   DELKAILGEQTPIVAQHMIQAALFGLLEKQVNEWQAEVVDEQPKFLS"
FT   gene            complement(485012..486721)
FT                   /locus_tag="A1S_0446"
FT   CDS_pept        complement(485012..486721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0446"
FT                   /product="putative transport protein (CPA2 family )"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10901"
FT                   /protein_id="ABO10901.2"
FT                   /translation="MPHDVDLIILLAVGFGVALFFGYIAARLRLPPLIGYLIAGIIISP
FT                   NTPGVEADIHLANQLAELGVMFLMFGVGMHFSLNDLLLVRRIALPGAILQIAVATLLGI
FT                   GVSMLWGWSFGSALVFGLSLSCASTVVLLKALGDRGLLDSVNGKIAVGWLLVEDLVMVL
FT                   VLVLLPATAVLLGGKAPAGAEGNIWLTLGITLLKVIGFIAFMLIVGKRVVPIIMQFVAR
FT                   LGSRELFTLTVVAAAVSIAYGSYAIFGVSMALGAFFAGMVVKESDFSHRAEEETLPLRE
FT                   IFSILFFVSVGMLFDPHILIERPLHILAVIAIIMVGKTLAAMALVLFFRYPINTALTVG
FT                   ASLAQIGEFSFILATLGVSLGLLTLEAQNLILAGALFSITLNSFIFSAIEPVQRWIRER
FT                   SHLARLLERSGDPLAMLPDEVDQSYLRDQVVIVGYGGVGRRITENLINQNIKVVIAEEN
FT                   REIVEKLRQANIAAVSGVATEPGVLIQAHIMHARLLVISPMDILDIHRIVDIAKQLNPQ
FT                   IQVLICAESKEEAAVIRDEHIGEVFYAKEEMAKNMSHHILNQIELAHQSTHH"
FT   gene            complement(486869..487024)
FT                   /locus_tag="A1S_0447"
FT   CDS_pept        complement(486869..487024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0447"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10902"
FT                   /db_xref="GOA:A3M1V8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1V8"
FT                   /protein_id="ABO10902.1"
FT                   /translation="MRDKIRLVSSAGTGYFYTTTKNKRTMPEKMEIKKFDPKIRQHVIF
FT                   KEAKIK"
FT   gene            complement(487037..487273)
FT                   /locus_tag="A1S_0448"
FT   CDS_pept        complement(487037..487273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0448"
FT                   /product="50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10903"
FT                   /db_xref="GOA:A3M1V9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1V9"
FT                   /protein_id="ABO10903.1"
FT                   /translation="MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKR
FT                   FVRLRLTTKGMRIIDKLGIEKVVADLRAQGQKI"
FT   gene            complement(487441..488889)
FT                   /locus_tag="A1S_0449"
FT   CDS_pept        complement(487441..488889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0449"
FT                   /product="coniferyl aldehyde dehydrogenase (CALDH)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10904"
FT                   /protein_id="ABO10904.2"
FT                   /translation="MNSQTKTNPETQVPYDVKHLHDLLEQQKIAYLRHPVPTAKERIDR
FT                   LARLKRVLVKYQDQIAEAINLDYGNRAIMETKIGELLTCLEQIKYYSKNLTGWMKPSKR
FT                   HISVLHQPAKGWVQYQPMGVIGIITPWNYPLLLSVGPLICALAAGNHAMIKISSASPNF
FT                   GQVLENALSEAFPQELVAVVNGGGVISDAFSHLPFDKMIFTGSTSVGKTVMAAAAQNLV
FT                   PVILELGGKSPALVHASVDMKDVAQRIAVGKLWNAGQTCVAPDHIFLPRGKTAEFIENF
FT                   KLIVAGMYPHFRNNQDYTSIINDKQYNRIQGYLENARDQGARIIEINPQNEILDDVRKI
FT                   APTLVTGVTTAMDIMQNEIFGPVLPILEYDQIEEVIEFINSRPRPLAMYYFDYDQARAD
FT                   YISQHTHSGHFGINMVITHVAQDDLPFGGIGASGMGKYHGPEGFFGLSHERSVMSNPKL
FT                   YSLKYILPPFNKPIHRFISKTLLR"
FT   gene            489002..489694
FT                   /locus_tag="A1S_0450"
FT   CDS_pept        489002..489694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0450"
FT                   /product="putative transcriptional regulator (TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10905"
FT                   /protein_id="ABO10905.2"
FT                   /translation="MSLPKALKTKDRILQISLQLFNERGERSVTTNHIAAELGISPGNL
FT                   YYHFRNKHEIIKELMHQYQVETLEMLSLPEDRPLTTNDKINYFQVLSGQLWNYRFIHRD
FT                   VYHLVESNEDFKKIYPRFAGQVMQQGQRIYQAFVDAGLMKMTPSEIEALIINLWIVLTN
FT                   WTNFLYMSGHISDNNHLEEKWVWQALRQMVFLEGPYLMGESRATYEQLLESLGPSDLFA
FT                   SLSSLKDE"
FT   gene            489769..490632
FT                   /locus_tag="A1S_0451"
FT   CDS_pept        489769..490632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0451"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10906"
FT                   /protein_id="ABO10906.2"
FT                   /translation="MNMTTANTARLLITCEDKPGIVQAVSSFLYHQGANITALDQYATE
FT                   AQGGRYFMRVEFELDHLQSRKDALIQTFAANVAERYGMQWRLAFVNDIKKVGILVSKVD
FT                   HALLELLWRHARGSLPCEITHVISNHEDLREAVENFGIPFTVIKVTKDNKAEAYAQIHE
FT                   MMQGNDLLVLARYMQILSEDFVSKWEMKIINIHHSFLPAFVGANPYKQAYEKGVKLIGA
FT                   TAHYVTADLDQGPIIEQDVERVSHDYNVEQLRELGEDVERNVLARAVKWHLEDRIIVDG
FT                   NKTVVF"
FT   gene            491024..491779
FT                   /locus_tag="A1S_0452"
FT   CDS_pept        491024..491779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10907"
FT                   /protein_id="ABO10907.2"
FT                   /translation="MSQSSAALNSPNPMKKKVITALIAVAIGHIGVLWAVSHIKPVELK
FT                   PIEKKPLQVRFVKIQEQPKPLPPKPKEPPKKPEPKKEVKEVKVVEKPVTPPKKVEKIQQ
FT                   VKKAETPKETVKTEPKVEPKIVTPTTTVTEKVVEKPKPVVQEAPKAQPAPDPSPKRVSI
FT                   GGSGVQWSRSPRLTVSPKDLQGEARSVVVLIEADEKGKITNVRVTRSSGIPSLDDKVVR
FT                   AVRSAKFKPYMENGVAYPIKAEQPFDLTP"
FT   gene            491824..492444
FT                   /locus_tag="A1S_0453"
FT   CDS_pept        491824..492444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0453"
FT                   /product="putative biopolymer transport protein (ExbB)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10908"
FT                   /protein_id="ABO10908.2"
FT                   /translation="MNFSIYWQHADAVSKTLYFILLAMSIATWTVFILRLMGTRQLKQQ
FT                   AYAQLSQAITSLKAKLQPLSFEQRKAVAEQALLRQISAEKANADKGISVLGTIASIAPF
FT                   VGLFGTVWGIFHALVAVGKSGQAGLAQVATPVGEALIMTGLGLAVAIPAVLAYNICVRA
FT                   NRGLAHDLQDQAHSLLIDTMLQQDSTVKSDVKTAQQSYVGGQA"
FT   gene            492444..492848
FT                   /locus_tag="A1S_0454"
FT   CDS_pept        492444..492848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0454"
FT                   /product="putative biopolymer transport protein (ExbD)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10909"
FT                   /protein_id="ABO10909.2"
FT                   /translation="MAFQLGEDHDSGMNEMNLIPLIDIMLVLMIIFLVTATVANPSIPL
FT                   TLPKTTAEIIDPPPKAITISINANGEVAWDTQVISLDELQKRFQEAGQGAVKPTVQLRA
FT                   DKESKYDTVAQVMSRASEAGLSDIAFVSEN"
FT   gene            complement(492909..493430)
FT                   /locus_tag="A1S_0455"
FT   CDS_pept        complement(492909..493430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0455"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /note="Protein-methionine-S-oxide reductase; Peptide MetO
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10910"
FT                   /db_xref="GOA:A3M1W6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1W6"
FT                   /protein_id="ABO10910.2"
FT                   /translation="MQQALFGGGCFWCVEAVFLQIRGVEKVTSGYAGGHTTHPTYEQVC
FT                   QGDTQHAEVVLIDFDEQQVTYSQLLDVFFATHDPTTLNRQGNDIGTQYRSVIYYFNEEQ
FT                   KQAAEHTIQTLKDDDLDIVTELSPTPTFYPAEDYHQNYYEKNPSQGYCNFAIPPKLLKL
FT                   HSKFQHLMKN"
FT   gene            complement(493531..494586)
FT                   /locus_tag="A1S_0456"
FT   CDS_pept        complement(493531..494586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0456"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10911"
FT                   /protein_id="ABO10911.2"
FT                   /translation="MHNIGTREFIIALLFGALHSLFTLFIVLSSIWVCLALWVQQPFGW
FT                   LGSRIIIGIWIAFALSMAGLYFNGHIISRRTDVLIYLLAFACSLVWYFSITARQDRDWN
FT                   PEVANMLSYEKHGDVITLHNVRNFNWHPDGTYDVRWETRTFDLNQLNGINIITSYWMGP
FT                   QIAHTLVSFEFKNQQPLVFSIEIRKEKTEEFSAIGGFFRKYELSLIASDEKDIVYTRSN
FT                   IRKEQVYNFPVNMPRSEQKALFLEYLKKADELRAEPKWYNTLTSNCTTLIFDMVQAINP
FT                   YQLPKDYRLIASGYLPNYLYDLKALDQNISLKQWYQIAHINPRTEHFEQFADQSSEHFS
FT                   QIVRQGLPKVK"
FT   gene            complement(494601..495110)
FT                   /locus_tag="A1S_0457"
FT   CDS_pept        complement(494601..495110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0457"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10912"
FT                   /protein_id="ABO10912.2"
FT                   /translation="MAWQNVEVVHVVAMDKNHCIGKGNALPWHISADLKHFKEITQGGV
FT                   VIMGRKTLESMGRALPNRVNWVITRDINWHFDGVKIAYSIEDALNAALEDAKNTEKQAL
FT                   FIIGGGEIFKQTLSIADRLELTHVDLDVQGDAHYPTIPSEFHKTASEQQVDEKSGTSFE
FT                   FATYKK"
FT   gene            complement(495155..495997)
FT                   /locus_tag="A1S_0458"
FT   CDS_pept        complement(495155..495997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0458"
FT                   /product="thymidylate synthase"
FT                   /note="TS; TSase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10913"
FT                   /protein_id="ABO10913.2"
FT                   /translation="MRAYLDLLQHILDNGGDKGDRTGTGTRSVFGHQMRFDLSKGFPLL
FT                   TTKKVHFRSIVIELLWFLKGDTNVKYLQDNKVTIWDEWATAEQTARFGRPEHELGPVYG
FT                   HQWRNFGATKNADGTYNQDGFDQIKWLINEIKTNPNSRRLIVSGWNPNEAGQVALPPCH
FT                   TLFQFFVQDNKLSCQLYQRSADVFLGVPFNIASYALLTHMIAQVCGLDVGDFVWTGGDT
FT                   HLYANHFEQAKLQLTREPLPLCQLKLNPDVKDIFDFKFEDIEIVGYESHPAIKAPVAV"
FT   gene            complement(496493..496852)
FT                   /locus_tag="A1S_0459"
FT   CDS_pept        complement(496493..496852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0459"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10914"
FT                   /protein_id="ABO10914.2"
FT                   /translation="MLEFWFNTQVPTFKKLIILIITLLICIGLYQYQPLPLDTILMFTG
FT                   TGVIFLICRYFKLHFAQSNPTGLLYRLFTWVPIALLFALIFVKTMPNLLIWGVQGIAFM
FT                   ALAAFIFSPQSLFNK"
FT   gene            complement(496926..497744)
FT                   /locus_tag="A1S_0460"
FT   CDS_pept        complement(496926..497744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0460"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10915"
FT                   /db_xref="GOA:A3M1X1"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X1"
FT                   /protein_id="ABO10915.2"
FT                   /translation="MLTYPNIDPVAIHLGPLQVHWYGLMYLLAFLCAWGLASYRAKQRD
FT                   GWTSDMVSDLVFYGALGVVLGGRIGYVLFYEFDKFLENPIWLFQVWTGGMSFHGGFLGV
FT                   MIAMLFWCKKYQKTWFQTLDFVAPCVPTGLMFGRIGNFIGGELYGRAVTDPNYPFGMIF
FT                   PTDPLHLVRHPSQIYQALCEGLLLFIILWWFSSKPRPRMAVSALFLMGYGVARFVMEFF
FT                   RQPDADQGFILFGWMTKGQILTVPMLLIGLWMMWYAYQKKIYDWGPQKNS"
FT   gene            497837..498616
FT                   /locus_tag="A1S_0461"
FT   CDS_pept        497837..498616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10916"
FT                   /protein_id="ABO10916.2"
FT                   /translation="MCIVALAWHVLDDMPLCLISNRDEFYHRPTALLHQWEHTPIIAGQ
FT                   DLQSGGTWMGVTPQGRWAVLTNFRDGRDKKQYETSRGHLVQAFLESDLLPIRFAQQLEQ
FT                   QQQNFAGFNLFMGTADQAVYMSNRGEAPQVLANGVYVVSNGLMSDHWEKTRHLRTRFTQ
FT                   EFLPMHQHKTEELSLQHAAWDILEDERKVTTALLPNTGIQPEMEELLSSTFIQSPVYGT
FT                   RCSNFLRMTNNEWIWLEKTQQGEHSGQIVQQQVLLNR"
FT   gene            complement(498660..500993)
FT                   /locus_tag="A1S_0462"
FT   CDS_pept        complement(498660..500993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0462"
FT                   /product="putative phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10917"
FT                   /protein_id="ABO10917.2"
FT                   /translation="MTELTPYHEDQELDNNTSDNIHFRDILEQHISRRSLITKAASGAV
FT                   ALTLASTLTGCNDNDDDSGSNNGGTKPVDPNKKPEKLTFTPVAKNLNDIVTVPEGYEAN
FT                   VIYALGDSINPRVGDWDDNNIPSGPSFQFRSGDCHDGMHYFGLNTSTNRFDETVSAQGL
FT                   LVMNHEYINQTFLHPKGPTKVDGRRPEDEVIRETNAHGVSVVHIKKDPTTQKVEIVKNS
FT                   IFNRRITASTVMEFAGAAAGSSLLATRFSPAGRQTRGTHNNCGNGYTPWGTYLTTEENF
FT                   IGYFQRSGSDEYARTDAEKIALKRYGLGVKKDEPYLYEKDEKGAPKKDKDGKIIYLKDK
FT                   NGELIPNVDEQGRQIYLGTSSRYGWETAIGQVESQDLYDRWNADVKAAQATQDYRNGPN
FT                   TFGWMVEIDPFDGRQNPVKRTSLGRFAHEDSACRAVVGQPLAFYMGDDSRGEYIYKFVS
FT                   TAVWDTKDINGGYTAGDKYMNAGKLYVAKFNNDGSGQWIELAYGKNGLNESNTTYPFKS
FT                   QADVVTFARLAADSVGATKMDRPEWCTVNPVNGEIYVTLTNNSNRGKDYATDAANPRNY
FT                   TDLYAGTKEQKGNVNGHIIRFKETDDKTTAETFKWDIYLFGAEASMASNINLSGLTDNN
FT                   DFSSPDGMWFDPRGVLWIETDDGAYTDVTNCMMLAALPGQIGDGGTATTSNGQQTITGA
FT                   KVTDATLRRFLVGPKQCEITGIAMTPDYKAIFINVQHPGEDSPSYAKPESNWPATQKDP
FT                   SNKTARPRSATVVITRKDGGVIAG"
FT   gene            complement(501201..503381)
FT                   /locus_tag="A1S_0463"
FT   CDS_pept        complement(501201..503381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0463"
FT                   /product="putative alkaline phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10918"
FT                   /protein_id="ABO10918.2"
FT                   /translation="MTTASNHPTRRDILKWFTGIPFLPLGAMATAATLAGCNDSDNDSS
FT                   IVTPSKPINFKNATFTSMPAPSTVADIATTACASKLAISWEDGSKTEYQLAYKPFFLTG
FT                   TEVPDGKGGKVIAGGYYDINNKPIIDKSVAGKERQFFSDCPDGSSLISFKQATGKDFTD
FT                   ADKKALGVTGNPVFHVVQFEYLSKDQNGGDTYGKLSSPIAVLTLDQDPKTGHLTLIKYH
FT                   NVDTSSAHGLWITCGASLSPWGTHLSSEEYEPDAFDQKLGQSLSTLKAFSKNIYGDENI
FT                   ANPYNYGHLPEITVNADGTGRVTKHYCLGRISHELVQVFPDNRTVLMGDDYTNGGLFMF
FT                   VADKEKDLSAGTLYVAKYTTVLSDTTTGQISWIRLGHATSAEIENLIKSGIKGTDIFES
FT                   VLQIAKYPSDATIAEKEAIDAGDKGTPEQQALAKAAKERLKLQQAAQKAELEAQGFKFT
FT                   YLSKTGVYLKLKDNSDRTKLAAAFLETHRYAAYMGASMALTKNEGTTVNIADKKAYSAL
FT                   ANIVDSMVEGGSGYLAEHNVKFPKITAGGILEHTLTGSQKDSSNVAINSEWVPSQSNLL
FT                   IKGKDISFDSLGNTADPEQIASPDNLKFSEKLRTLFIGEDSGNHLNNFLWAYNVDTKQL
FT                   IRILSTPAGAESTGLHAVDEVNGWTYIMSNFQHPGDEWNRFYKEKDGVRTGISADLLAQ
FT                   IDTAINTNYSNKFAAAVGYITADPIAPSVVKK"
FT   gene            complement(503555..504325)
FT                   /locus_tag="A1S_0464"
FT   CDS_pept        complement(503555..504325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0464"
FT                   /product="Sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10919"
FT                   /protein_id="ABO10919.2"
FT                   /translation="MNQLPSTAVNSQENLDQMPIMNHLVVLRRHLFRIVGVTLFLFFCL
FT                   LPFRNHTYQLLSEPLRLQLPASSSMIATDVTATFMAPFKLNLFVALMLAMPFILYEIWS
FT                   FVRPALYQKERHLALPLLIGSIILFYAGVAFAYYITLPAILHFFISVSPETVAPMTDIN
FT                   SYLSFCLKLFLVFGVTFEIPIATLLLILIGVVNTQSLAEKRRFIIVGCFFVAMFITPPD
FT                   AISMVMLAIPMWLLFEIGLLFGKILEKRKTHSAE"
FT   gene            complement(504322..504759)
FT                   /locus_tag="A1S_0465"
FT   CDS_pept        complement(504322..504759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0465"
FT                   /product="Sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10920"
FT                   /db_xref="GOA:A3M1X6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X6"
FT                   /protein_id="ABO10920.1"
FT                   /translation="MLDVGMTELLCFAIIAILVLGPEKLPEAARFAGRWYVRLKRYITN
FT                   LQNEIDQELRLSEFRKEMQEELNRIEALERKVQQQLDEIQKQQVSESLEVTETAKTTQK
FT                   PIWKCTPISGHYKVPYLTKVTSLAAQTDISETSPVELKIAV"
FT   gene            complement(504771..504989)
FT                   /locus_tag="A1S_0466"
FT   CDS_pept        complement(504771..504989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0466"
FT                   /product="Sec-independent protein translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10921"
FT                   /db_xref="GOA:A3M1X7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X7"
FT                   /protein_id="ABO10921.1"
FT                   /translation="MAGLSIWHVVIFAIVVILLFGTSKLKNIGKDVGGAVRDFKKSVRE
FT                   EDEAASLNSPRTIDAQVKTSESTSVKS"
FT   gene            505242..506117
FT                   /locus_tag="A1S_0467"
FT   CDS_pept        505242..506117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0467"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10922"
FT                   /protein_id="ABO10922.2"
FT                   /translation="MALLLPVLAFITGLLLAQTSISETVKPILSAWLARLLIPIVIIYN
FT                   MVFYQSGSLSLMLFSFGSAFIIFFAYLALFKDRLLALCVSYTNMGWLGFPFAMALFGPE
FT                   ATAPIVALYIGMSLFGNAWAVTAVTTAPQSKLNILKKVLTSPPCISIFCAVVLRLLGAQ
FT                   HIESPAIHWVYEVAKFAMTFAGMCVLGMWLRRTRVYTKDLIYSTKAQAFKVACGFVLCG
FT                   LSYRFLPIPNINQHIGVMFLMFCLPPAANIVALETHYQGTGRSAAYIASGTIVSCVCIA
FT                   IYAVFLHVAL"
FT   gene            complement(506310..506933)
FT                   /locus_tag="A1S_0468"
FT   CDS_pept        complement(506310..506933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10923"
FT                   /db_xref="GOA:A3M1X9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1X9"
FT                   /protein_id="ABO10923.2"
FT                   /translation="MSTPHWFDQGSLVLASNNKGKVAEFEKLFEQLKLPVEIIPQGRLN
FT                   IPDAIEDGLSFIENAIIKARHASKISGKPAMADDSGICVPVLGGAPGIYSARYAGEHGD
FT                   DAANNAKLLNDLLPFRKNGEVIEGMFVCVLALVTHAEDPLPQIFQGIWHGEILEAPRGE
FT                   NGFGYDPLFWLPELQVSSAELSKEEKNKISHRGQAMQLFRESLV"
FT   gene            complement(507102..507689)
FT                   /locus_tag="A1S_0469"
FT   CDS_pept        complement(507102..507689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10924"
FT                   /protein_id="ABO10924.2"
FT                   /translation="MKKTLFSTLIAGLLSMQAHADYIAQPQSVASQAARFSTMGIHDLQ
FT                   KAAQAGQAGAQFYLGTRYQYGKDVAKDDKQAFAWFKAAADQGLSPAQLNVGRMYADGIG
FT                   VKKDEAMARKYFEKAASNGDNRASYNLAMMEEQKKNYVGAYQWYELSTRDGMLDNKVIS
FT                   LSEGKKTALAANLTQEQIRMARDRADKWIQAQ"
FT   gene            complement(507686..508279)
FT                   /locus_tag="A1S_0470"
FT   CDS_pept        complement(507686..508279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0470"
FT                   /product="methionine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10925"
FT                   /protein_id="ABO10925.2"
FT                   /translation="MRIDQQLAEKWIKPGSSVLDLGCGDGELLAHMSQKHQIRAYGLEI
FT                   DQEKIAIAVSRGLNIIQQDLNLGLSRFADQSFDYVVMAQALQAVDAPDVLLRDMVRVGK
FT                   QAIITFPNFAHWKTRSFLALKGMMPVSDALPYMWYNTPNIHLCTFKDFEALCAENQIQI
FT                   INRLAVNGNQQGSLLSKHVPNLFGEVAIYRVSAL"
FT   gene            complement(508279..509439)
FT                   /locus_tag="A1S_0471"
FT   CDS_pept        complement(508279..509439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0471"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10926"
FT                   /db_xref="GOA:A3M1Y2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Y2"
FT                   /protein_id="ABO10926.2"
FT                   /translation="MSFPADSVGLVTPQKFQFEEPLHLECGRVLPRFELMVETYGTLNA
FT                   DKSNAILICHALSGHHHAAGYHHEDDKKAGWWDSCIGPGKAIDTNKFFVVALNNIGGCS
FT                   GSTGPTSPNPENDNRPYGPDFPLVTVRDWVKTQAMLSDRLGISVWYAVVGGSLGGMQAL
FT                   QWSVDYPDRLQKCVVIASAPKLSAQNIAFNEVARQSILSDPDFHHGRYLENDSYPKRGL
FT                   ILARMVGHITYLSEEAMKQKFGRDLKSGKFMYGFDVEFQVESYLRYQGEQFSRNFDANT
FT                   YLIMTKALDYFDPSREYGHSLTEAMSKTKCQFLIVSFTTDWRFAPSRSQEIVDALITNH
FT                   KPVSYLDIDAEQGHDSFLFPIPLYVKTLRAFLGGEEHLKSTSLEAS"
FT   gene            complement(509522..511219)
FT                   /locus_tag="A1S_0472"
FT   CDS_pept        complement(509522..511219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0472"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="Alpha-isopropylmalate synthase; Alpha-IPM
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10927"
FT                   /protein_id="ABO10927.2"
FT                   /translation="MMLADPSKKYRRMYQRVDLPDRQWPNNEITKAPIWMSTDLRDGNQ
FT                   AIFEPMNMEQKFKMFKMLVKIGFKHIEIGFPSASQIDFDFTRMLIEENHIPDDVYIEVL
FT                   VQARDHLIERTFEALAGAKRAIVHIYNSNSPTFRQKVLNVDVNGAKQLAVNAAQKVKEY
FT                   AAQYPETDWIFQYSPECFSATELEVAKEVCDAVTEIWDARPDHKVILNLPATVEVSTPN
FT                   VYADQIEWMHRNLARRDGVIISVHCHNDRGCGIAASELAIMAGADRVEGCVFGNGERTG
FT                   NVDVAAIALNMYTQGVAPELDFSNINEVIATVEECTGLPVHPRHPYAGDLVFTAFSGSH
FT                   QDAIKKGFEYQKNEEIWDMPYLPIDPKDLGRDYDAVIRVNSQSGKGGIAYLLESNYNVV
FT                   LPRRLQIEFSQVVQQYTDENGTEISAKQIWTLFKDTYVEVKNHHYTVKNYKLSDINGTQ
FT                   IIELEIDVEGETQQLRGEGNGPISAFLNALQLPIDVLNYEERSISSGANAKALTLIELQ
FT                   VKGTGRGSFGAGVHDNTVTSSIEAIIACTNRLIDQGVLSTDQVVAAAV"
FT   gene            complement(511678..512361)
FT                   /locus_tag="A1S_0473"
FT   CDS_pept        complement(511678..512361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0473"
FT                   /product="iron-uptake factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10928"
FT                   /db_xref="GOA:A3M1Y4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Y4"
FT                   /protein_id="ABO10928.2"
FT                   /translation="MIHHIPNVLNKEQVAEFRKLMEEANWVGGKVTAGTLSASVKRNQQ
FT                   LSEQDPLTHHLSDIVIKAIWQNPLFQAAALPHKIIPPLFNRYDEHESFGFHVDNSIRLI
FT                   RGTAEQIRTDLSCTLFLSEPDEYEGGDLVIEDTYGYHEVKLPAGDVVLYPSTSLHEVSS
FT                   ITAGTRFASFFWVQSLVRDDSKRHLLFSLDESIRELRKSHGDSYSEVMKLTNIYHNLIR
FT                   MWSEL"
FT   gene            complement(512467..514677)
FT                   /locus_tag="A1S_0474"
FT   CDS_pept        complement(512467..514677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0474"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10929"
FT                   /protein_id="ABO10929.1"
FT                   /translation="MAQEAVSQLPTIHTKATQEESLKVDQSANSKFVAPLKDTPKSVSI
FT                   LSQKLIKDTNSNTLLEALRYEPGITLGAGEGGTPFTDMPYIRGYSGQSSIYVDGVRNTT
FT                   SQNRDMFAIEQVEVIKGSSSALGGGGSVGGSINLIPKVAHEGDVYQGSVQSGTDNYRHI
FT                   QLDANKDFGNGIAGRVVIMGHENEKAGQSNGAEYKRVGIAPSITFGLDTATRGTLSYYY
FT                   LRSNDEPDAGIPFNNANPAKPPVGVTVTPGDGKPVDVKAGTYYGWKARDFDKRENHIGT
FT                   FKLEHDFNENLTLSNIATYNKSKSDYVYTNADDSKGNIYRGTVARRALSRILDTDAYSD
FT                   QLSLRGKFNTGSLKHSFNVGTEWSFQETDQGVHTFTNAAGETTSTILDSNIQNCTSAAA
FT                   VANGWCTSLNNPGNGAFTDKRGSITAQSTTRSHNVGIYALDSIEFNPQWLLNLGVRWDK
FT                   FETEKKYNKDVDGRTPHKAGDKLESDTDYFSYQAGLVFKPTEDGSIYLSYATSANPVGV
FT                   LAEGDTGSDSISDSGTASASANALKPEEARTFELGTKWDLFNNRANLTAAVFRTEKQNT
FT                   RIQIDPTTTANAGKSKVDGFEISLNGKITDKWDVSTGYSYLDSEITEAAYNAVAQEGKP
FT                   LPFVAKNSATLWSTYRVMPQLTLGAGVEYRDQVFVNTTAPKYLPTYTIYNAMAKYDVNK
FT                   NVNLQLNINNISDKRYFTSAHAAHYAFEGNGRNAVLAINFKY"
FT   gene            512640..512735
FT                   /locus_tag="A1S_3498"
FT                   /old_locus_tag="AS1_3498"
FT   CDS_pept        512640..512735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3498"
FT                   /old_locus_tag="AS1_3498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3498"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89923"
FT                   /protein_id="ABS89923.1"
FT                   /translation="MADISEQLCSQKLDRDIQHQHLESIEALLGK"
FT   gene            515170..516504
FT                   /locus_tag="A1S_0475"
FT   CDS_pept        515170..516504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0475"
FT                   /product="trigger factor septum formation molecular
FT                   chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10930"
FT                   /db_xref="GOA:A3M1Y6"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Y6"
FT                   /protein_id="ABO10930.2"
FT                   /translation="MQVTTEAVSGVARRLNVSVPTSRINEQFEARLKRTAKTVKINGFR
FT                   PGKVPANVVRREYGASIYQEVVNDIIRDSVFEAIQQEKINAVGMPNIEKVEHKEDALVF
FT                   EATVEVYPEVEVKAFDGLEVERKTAEIKDADVDTMIENLQKQRQTWAVTKGMAKKDMQV
FT                   TFDFEGSIDGEKFEGGSAEDFKLVLGSGRMIPGFEDGIIGMKAGEEKVIDVTFPEDYQA
FT                   ENLAGKAAQFKITVKQVEKPKLPEIDAEFLKIFGVSEEEGIEKLKADVRKNMEREVRNG
FT                   LRNQVKQAAFDALVAANEIEVPAAMVAQEIDRQRQQMVQQFTQQFGGAGAQSFDKSMLP
FT                   DELFKEQAERSVKLGVLVSKVLADAKLEVDQARVDAYIDDMASSYEDPTEVIEYFKNDA
FT                   QQRAQIEAVVLEDQVVDHILASAKVTDKAVSYEDLLKEQQARRMG"
FT   gene            516697..517302
FT                   /locus_tag="A1S_0476"
FT   CDS_pept        516697..517302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0476"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /note="Endopeptidase Clp; Caseinolytic protease; Protease
FT                   Ti; Heat shock protein F215"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10931"
FT                   /protein_id="ABO10931.2"
FT                   /translation="MYVPTIENALVPVVVEQSSRGERSFDIYSRLLRERVIFLTGEVED
FT                   NMANLIVAQMLFLEAENPDKDIHLYINSPGGSVTAGMAIYDTMQFIKPDVVTYCMGQAA
FT                   SMGAFLLNAGAKGKRYCLENARVMIHQPLGGFRGQASDIEIHAREILFIKERLNRLMAE
FT                   HSGQDYDTIARDTDRDNFMTAQAAKEYGLVDQVLSKRP"
FT   gene            517404..518717
FT                   /locus_tag="A1S_0477"
FT   CDS_pept        517404..518717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0477"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10932"
FT                   /db_xref="GOA:A3M1Y8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Y8"
FT                   /protein_id="ABO10932.2"
FT                   /translation="MSEHPQGQKHCSFCGKTQSEVGKLIAGEDAYICNECVDVCLDLVQ
FT                   TSQQVEAGDWASKALPKPHEIRAALDQYVIGQDLAKKTLSVAVYNHYKRLKVGQSGHVS
FT                   KDVEIAKSNILLIGPTGSGKTLLAQTLARLLDVPFAMADATTLTEAGYVGEDVENIVQK
FT                   LLQKADYDVEKAQKGIIYIDEIDKITRKSENPSITRDVSGEGVQQALLKMIEGTVASIP
FT                   PQGGRKHPQQEFIQIDTSNILFICGGAFAGLEKIVQQRQEKGGIGFTADVKNKDETKKL
FT                   AELFRQVEPTDLVKFGLIPEFIGRLPVIATLEELDEEALMQILTEPKNALTRQYQYLFN
FT                   MENVDLVFEDSALRAVAKRALERNTGARGLRSILENVLLETMYDLPSRTDVGTVFINEA
FT                   VINGEAEPVYKSERQPKEAVTHESVAKADLKVIDSKSA"
FT   gene            518865..519581
FT                   /locus_tag="A1S_0478"
FT   CDS_pept        518865..519581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0478"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10933"
FT                   /protein_id="ABO10933.2"
FT                   /translation="MRYLIIALSCAALLAGCQSSSHLEKNSGELTATLPKVDVDKEPGL
FT                   LDQYRLGGFTVGGWVNQKLGQTFAPVKPQNEQAAVVYLYRPDTKWNRQEIAAINLFVNG
FT                   KRIPSLLHNHYYWIELPAGTYRISASRPLLGIHFQEPKYIDITVDAGASYYLKYDEENK
FT                   MDRSEHTGPFMLMQDNIGRREIAFTELKSSSYNFVAEDASGKIRHKPQELKPAKYNEKS
FT                   DVHLIKPFKLWNPLTW"
FT   gene            complement(519606..519785)
FT                   /locus_tag="A1S_0479"
FT   CDS_pept        complement(519606..519785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0479"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10934"
FT                   /protein_id="ABO10934.1"
FT                   /translation="MKTPEGQSITRKNVQIMGQISEYMMELGQQTFNDPKARDHMQEEM
FT                   LKIIAPLMKDKEKS"
FT   gene            complement(520304..521830)
FT                   /locus_tag="A1S_0480"
FT   CDS_pept        complement(520304..521830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0480"
FT                   /product="fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10935"
FT                   /protein_id="ABO10935.2"
FT                   /translation="MTTIIKQDDLITSIKDALQFISYYHPQDFIQAMSRAYDREENKAA
FT                   KDAIAQILINSRMCAEGHRPICQDTGIVNVFLEVGLDVKFDLTMSLDDAVNEGVRQGYL
FT                   ENSNVLRASVLADPAFGRKNTKDNTPAVIHYKLVPGNKVDITVAAKGGGSENKSKLAML
FT                   NPSDSIVDWVLKTVPTMGAGWCPPGMLGIGIGGTAEKAMMLAKEALMEEINMDELLRRG
FT                   PENKIEELRIEIFEKVNALGIGAQGLGGLTTVLDIKIKDYPCHAAGKPVGMIPNCAATR
FT                   HAHFQLDGSGVAHIQAPKLEDYPSVTWDASQSKRVNLDTITQEEMDSWKPGDTLLLSGT
FT                   MYTGRDAAHKRMVEMIDNGEELPIDLKGKFIYYVGPVDPVRDEVVGPAGPTTATRMDKF
FT                   TRKVLEHTGLFGMIGKADRGPTAIEAIKDNKATYLMAVGGAAYLVSKAVREAEVVAFAD
FT                   LGMEAIYKFVVEDMPVSVAVDVNGTSIHAVAPKIWQAKIGKIPVIDAAAG"
FT   gene            complement(522059..524203)
FT                   /locus_tag="A1S_0481"
FT   CDS_pept        complement(522059..524203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0481"
FT                   /product="phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10936"
FT                   /protein_id="ABO10936.2"
FT                   /translation="MNTILLIPTGEGVGLTSACLGMIYALDCNGIKAGFLKPFSQVDQE
FT                   NLDRTTSLFGHLFQSKTVQSISHEKLTQRIAAGEVDELLEEAVSLHRSIAADNNVIIVE
FT                   GLLPNGQDHFASELNANLAQALDAEVVLVSTADIQNPRKTAEKVEAHLRQFGGATSNRT
FT                   AGVLFMRTRGLSEETAQIPVAFDPSLRPTEDIAKFTAELQKYNRYFGSSDLPIIGLVPF
FT                   SNTLSVPRTLDIASVIDGQWVNQGEAKTRRILHSSLIASSIEYELNKFIAGELIISASE
FT                   RTDVLLASSLATSNGIPLAGLVLTEREAPAPKLLEFCQSAIKQGLPILHTHLNTLETAQ
FT                   RLSDFGNEIPTDDTERAEQVTRFVSSHIDVEWLKQHSNNGATPRLSPSAFRHELVQKSI
FT                   AAKKRIVLPEGDEPRTIEAAAICQARGIAHCILLAKPEAVHDVAKARGIELPAGLEIID
FT                   PDQIRDQYIAPMVELRKGKLNDLQAKEQLQDTVVLGTMMLALNHVDGLVSGAVHTTANT
FT                   VRPAFQLIKTAPAYSLVSSIFFMLLPDEVYVYGDCAINPDPTAEQLAEIAIQSADSAKA
FT                   FGIDPRIAMISYSTGTSGTGADVEKVQQATQIAQQRRPDLLIDGPLQYDAASVESVGRQ
FT                   KAPDSRVAGRANVFIFPDLNTGNTTYKAVQRAANVVSVGPMLQGLNKPVNDLSRGALVD
FT                   DIVFTIALTAIQAEQQAAAK"
FT   gene            complement(524247..525449)
FT                   /locus_tag="A1S_0482"
FT   CDS_pept        complement(524247..525449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0482"
FT                   /product="acetate kinase (propionate kinase)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10937"
FT                   /protein_id="ABO10937.2"
FT                   /translation="MATSVLVINCGSSSIKYALVSERREDRIYGLAENLGAADARIKGI
FT                   TVGGEPLELSIPYADHAKALETLLARLANYKPQAIGHRVVHGGSLTKAELLTPEIVERI
FT                   RAATPLAPLHNPAHLIGIEATMRLFPELPQVAVFDTAFHQTMPAHAYRYAIPKFLYTEH
FT                   NVRRYGFHGTSHAYVSDRGSELAGKFQKGGWLTAHLGNGSSTCAVWNGQSVDTSMGLTP
FT                   LEGVVMGTRSGDVDPSLHSFLAKNLGWDLAKIDKVLNNESGLLGLSQLSNDMRTVIEAA
FT                   ENGNEDACLAIEVFSYRLAKSLAALSCGLPSIDGLIFTGGIGENSAYIREKTLAYLPHF
FT                   GLQLDKDQNNNLKRGTEGRIDSGTGPQIWVIPTDEEGRIAKETRQVVEVSQNTSPEVSL
FT                   A"
FT   gene            526212..528065
FT                   /locus_tag="A1S_0483"
FT   CDS_pept        526212..528065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0483"
FT                   /product="phosphogluconate dehydratase"
FT                   /note="6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10938"
FT                   /protein_id="ABO10938.2"
FT                   /translation="MDLPNPVLAKVTERVIARSQKTRSAYLQRIEHAQGKFPARGALSC
FT                   ANLAHGFAGMEDNEKLIIKVGREPNIGIVSSYNEMLSAHAPYKTFPDIIKTAARENGGV
FT                   AQFAGGVPAMCDGITQGNAGMELSLFSRETIAMGTAIALSHNMFDAALCLGVCDKIVPG
FT                   LLIGALQFGYLPTIFVPAGPMSSGLSNDDKAKIRQQFATGQVGRDALLEAESAAYHGQG
FT                   TCTFYGTANSNQMLMEVMGLHLPSAAFVHPHTPLRDALTAEAAKRVLDLTAERGNYTPI
FT                   GHVIDEKAIINGIVALLATGGSTNHTLHLIAIARAAGILIDWDDFDELSAVVPLLAKIY
FT                   PNGKADVNHFQAAGGVAFLIRNLLEAGLLHNDVTTVAGKGLQHYTKEPKLIDGKLTWVD
FT                   GVVQSLDDKVLRSIDAPFQPDGGLRLMQGRLGRGVIKISAVAPEHRKVKAPAIVFDSQE
FT                   AVQAAFDRGELHRDFIAVVRFQGARANGMPELHRLTPVLGVLQDQGFHVALVTDGRMSG
FT                   ASGKVPAVIHLSPEALLNGPIGKVQTGDMLIIDAEAGVLDIELDEQTWQSRPVAQPEHQ
FT                   AENEVGFGRELFGVFRAAAAPAEHGASVFGALVGEEPQGQI"
FT   gene            528086..528706
FT                   /locus_tag="A1S_0484"
FT   CDS_pept        528086..528706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10939"
FT                   /protein_id="ABO10939.2"
FT                   /translation="MSKIEDVVKLGPVIPVLAFDSAEQGEHVSRALHAGGVKVLEITLR
FT                   TAAGLAAIERASQLADDIVVGVGTITKPEHCAQAKKAGAKFGVSPGLTKDLHLAAQDAG
FT                   LPLLPGVMTPSDLIQAIELGYDIVKFFPAQQAGGVEMLKAFYGPFPNLRFCPTGGITAE
FT                   TAPDFLKQPNVVCVGGSWLTPKPVVAAQDWAEITRLAQIASQL"
FT   gene            528902..530245
FT                   /locus_tag="A1S_0485"
FT   CDS_pept        528902..530245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0485"
FT                   /product="high-affinity gluconate permease (GntP family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10940"
FT                   /protein_id="ABO10940.2"
FT                   /translation="METVQGGMLLVYTLIAIVALIVMIAKFRIYPFLVLIIVSLGLALA
FT                   VGMPMDGIVKSYEAGTGKTLGHLAIVIALGTMLGKMMAESGGAERIAITLIKWFGEKHI
FT                   HWAMMFIALIVGLPVFFEVGFVLLIPIAFNIAKRTGKSLLIVGLPMVAGLSVVHGLIPP
FT                   HPAALLAVQAYHADIGKTIMYSLLVGVPTAVVAGPLYALWINKYVKLPENNPLAKQFVE
FT                   ADANNTRELPSFGITLFTIMLPVALMLVGSWADVFFAPKTFPNELLRFIGTSDIALLIA
FT                   VLVSFITFGTMQGFNREQIEKFCGGCLASIAGILLIVGAGGGFGGILRDSGISNEIVST
FT                   ALKANLSPLLLGWLVAALIRLATGSATVAMATACSIVAPIAAAAGVVVRPELSISDRFW
FT                   IINFLACKRCWFLANQRIFWNDSWADTEDLVCTGNNYFGTWFVFHIVA"
FT   gene            530276..530788
FT                   /locus_tag="A1S_0486"
FT   CDS_pept        530276..530788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0486"
FT                   /product="thermoresistant gluconokinase"
FT                   /note="gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10941"
FT                   /protein_id="ABO10941.2"
FT                   /translation="MIVIAMGVCGTGKTLIGELLSERLACEFLDGDTLHSAANKSKMSQ
FT                   GIPLTDEDRLPWLQAIRQAIEAKQRDGETAVFTCSSLKRMYRDILRGQDQNVKFVYLKG
FT                   SYELLQQRLAERSGHFFDPALLQTQLDTLEEPDVNEAIAIDIALTPEQIIEQVIQKLGV
FT                   TDSVCRG"
FT   gene            531174..532588
FT                   /locus_tag="A1S_0487"
FT                   /note="contains frameshift; similar to putative
FT                   NADP-dependent glyceraldehyde-3-phosphate dehydrogenase"
FT   gene            complement(532692..533957)
FT                   /locus_tag="A1S_0489"
FT   CDS_pept        complement(532692..533957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0489"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="GPR; glutamate-5-semialdehyde dehydrogenase;
FT                   Glutamyl-gamma-semialdehyde dehydrogenase; GSA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10942"
FT                   /db_xref="GOA:A3M1Z8"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M1Z8"
FT                   /protein_id="ABO10942.2"
FT                   /translation="MQDSIEQYMQKVGQQARDASRVLTSASTSLKNHALSAIYTALENN
FT                   QAAILAANQIDMEKGRSNQLDSALLDRLELTPARFKGMLQGLKDVIVLVDPIGEITDLA
FT                   YRPTGIQIGKMRVPLGVVGMIYESRPNVTLEAASLAIKSGNAIILRGGSEALESNKAIA
FT                   EAVKHGLKVAGLPEHSVQVIETSDRGAVGHLITMAEYVDVIVPRGGKSLIERVTNEARI
FT                   PVIKHLDGNCHVFVEAQADLQKALPITLNAKTHRYGVCNAMETLLVDEKIAEVFLPHIA
FT                   ELYAEKQVELRGCPETRRILGSSVKPATEEDWYTEYLGPILAVKVVSGIDEAIDHINKY
FT                   GSHHTDAIVTENYTLARQFLARVDSSSVVVNASTRFADGFEYGLGAEIGISTDKIHARG
FT                   PVGLEGLTSQKWIVLGDGQIRQ"
FT   gene            534257..535570
FT                   /locus_tag="A1S_0490"
FT   CDS_pept        534257..535570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0490"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10943"
FT                   /protein_id="ABO10943.2"
FT                   /translation="MNSIIQMDSEINQAYAGFGFFDIYHRDSFKQPARTTWIDGWKIEY
FT                   MAIADPQTIHKTPIVIVGGAFQNFNSYKYCVEQLFESGPVILIDLPSMGANQQITNRDT
FT                   GISAGTLELPDLSEMLGRWLDIIGIQKVSVMGMSLGSVVASCFAYHRPDLMDRMILMGV
FT                   MQKTRKSWRMILEESLKLMQENRMEEFGQAVILYLVNHAKLDKTRMSPTAKKLFFRQMA
FT                   EFTGTERERYEINCNRLLRLTDVPIPECKTLVAAGQYDSFTLPHENANFALQCPDMEFA
FT                   LIANADHVPQLQRRKETMSLFTSFLKGESIQNLDGIIPMTREQMQNMERRGEERIPVLQ
FT                   PKTKLSHRECETEVPVTIVDVTFFGMYLKLDDVAQLEFVNEHPRDLALHLEDEEGAFSI
FT                   ECLIFEATEQGVRALFKHGSFELADRLSRFIARQKQAA"
FT   gene            complement(535624..536466)
FT                   /locus_tag="A1S_0491"
FT   CDS_pept        complement(535624..536466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0491"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10944"
FT                   /protein_id="ABO10944.2"
FT                   /translation="MTQHLSKHRHISFTAHYTGYIWYQMGISHEALATSKGKSLAYLVH
FT                   PLESWAEKYVGGSMRTTLKQRHTMLDHDLEKLIQENPDLQVLEIACGLSPRGWWFRQHY
FT                   PSISYRELDLPDMAQTKQNALQQIEKNAPEVLSVDLFTEAFAQAFEVFDSNRPLVVISE
FT                   GLINYFDKDLLKQLIQSIAHYGASFKKLHYLTDLYPEPVKNKLANIIWNSSKLLKLMSR
FT                   SSFSFHFKTPLEVKNFFKDAGFSQVNVEQPQIFFEQVSKDSDEEHLGDLVWTIHAQLK"
FT   gene            complement(536791..537810)
FT                   /locus_tag="A1S_0492"
FT   CDS_pept        complement(536791..537810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0492"
FT                   /product="beta-N-acetyl-D-glucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10945"
FT                   /protein_id="ABO10945.2"
FT                   /translation="MIGALMLDIAGTELTQEDIELLQAPQVGGMILFARNIESPQQVRA
FT                   LTDHMRQVRPDILIAVDQEGGRVQRLKSGFTLLPAMGRFGELYITQPQKALELAEQCGW
FT                   LMATEVLAVGIDFSFAPVLDLNAISDVIGDRGFSKNIEDIAPLAGAFMRGMKKAGMANT
FT                   GKHFPGHGSVKADSHVAAAIDSRSYDEIYNHDMQSFIKLMPELDALMPAHVIYDQVDPN
FT                   PAGFSSFWIQEVLRNRLKFNGVLFSDDLSMQAACVAGGADARIQAALAAGCDMGLVCND
FT                   RSAACTALEGIANLELPNQERLERMRGRIPQIQVGETLSLGNDWQAVKTAIEEFKNSI"
FT   gene            538003..540186
FT                   /locus_tag="A1S_0493"
FT   CDS_pept        538003..540186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0493"
FT                   /product="carboxy-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10946"
FT                   /protein_id="ABO10946.2"
FT                   /translation="MKLQTIACAVAIATGGLFFSHTMNEARAATNTAAVSQSIQPTQEQ
FT                   ALVARQLATLVDRQHYLNMRLDANTSNRILDMYLDSLDPDHSLFLDAEVQNYKKLYGSN
FT                   FGASLKAGNLTGPFAIHQQYRERLKQFYEFMLAELKKPQNLKQPNTFIEVDREKAPYFK
FT                   TSAEQQNHWRKMLVSQLINLTISREEEQAKQKALKENPSLADGQDLTGPEDLTPAQTLT
FT                   KRYTRQLERISRVKSDDVLDKTLNAMLATYDPHSNYYPPIDAIELNRQTTLQLEGIGVS
FT                   IRPERGNEDYTKIETIVEGGPASKSGQVKSGDRIVGVAQEGGKMIDVVGWSSSEIVGLI
FT                   RGKRGTKVTLKLLGAGASMSQARNVTLVRDVIQEEDAGVRSRTVEVTRDGKKHLLGVIE
FT                   IPSFYFDYRSRRAGQQYRSVSEDTANAFEALKAKKVEGIIIDLRNDPGGSLEEVARMLG
FT                   QVIKSGPVVQIRDGNGNVSVFEDNDGGQQIYTGPLAVLVNLASASASEIYSAAIQDYER
FT                   GIIIGSTTTGKGTAQVQLDTLAYGQATLTQRKFYRVTGGSTQNKGVVPDIKLVDIYNEE
FT                   FGERKSKNALKWDTIPTAPFKREGSVQPYVAKLSQLSEQRVAVDPQFKYLNKRTAIAKV
FT                   TSDQKQVVLDIDKRRAELLSLEKQTLDAENERRIATGQKPFPNWESYQASLDALAESRA
FT                   KMKANQRPALPEEETFVNEAANVLMDYAKLQNR"
FT   gene            540487..541095
FT                   /locus_tag="A1S_0494"
FT   CDS_pept        540487..541095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0494"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10947"
FT                   /protein_id="ABO10947.1"
FT                   /translation="MTETWPPEINGVALSLLQLCQGLQKQGHKILLVRPEQKAKCHDFL
FT                   PEQECLVMSQAIPKYPTLQFGWPQYLKVSKAFEKFVPDVVHIVTEGPLGLTAMQAAKAK
FT                   DIPVSSGFHSPFQDFSRFFDLAFLVKPIQKYLCWFHNNTQVTCVPSRDTEEALRGFGIT
FT                   CPLVVVGRGVDTTRFSPKHRSESLRQQWGVDSIHVSCCM"
FT   gene            541149..541622
FT                   /locus_tag="A1S_0495"
FT   CDS_pept        541149..541622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0495"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10948"
FT                   /protein_id="ABO10948.1"
FT                   /translation="MQNIQQQKTKLVVVGDGPDLARLKALPEAKNVIFTGSLRGHDLAV
FT                   AYASADVFVFASQVETFGNVVLEAMASGLPVIAYDYACAHQYLIHGVNGWLSPLGHKNH
FT                   FIQQIYQLPSIQQLREMGIQACHKVQQSGWQLPVQQLEQAFYQVVKEPSADFT"
FT   gene            541647..542198
FT                   /locus_tag="A1S_0496"
FT   CDS_pept        541647..542198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0496"
FT                   /product="putative phosphatidylglycerophosphatase B"
FT                   /note="PgpB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10949"
FT                   /protein_id="ABO10949.2"
FT                   /translation="MKFKNAKIKILDLDLRGCLYLNNFSHSQRVALFFKIISRAGDGPF
FT                   WYLMLAIVWGMQGITYSLQIIYLLLGGSVGTAIYKFLKHKTTRPRPYQVHQVIVLGERP
FT                   LDHFSFPSGHTLHAVMVTIVLGYIQPVLLAAMLPFMVLVALSRMVLGLHYPSDVIVGAL
FT                   IGAAVASLIIFVAPLLGIAL"
FT   gene            542298..542552
FT                   /locus_tag="A1S_0497"
FT   CDS_pept        542298..542552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10950"
FT                   /protein_id="ABO10950.2"
FT                   /translation="MGLRWTDTIDIAIELSEAHPEVDPQWIRFTDLHAWVCALPDFSDD
FT                   PNKSTEGLLEAIRWLGWMKFAKNSRKNRNFYTFKADYCL"
FT   gene            542611..543042
FT                   /locus_tag="A1S_0498"
FT   CDS_pept        542611..543042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0498"
FT                   /product="nucleoside diphosphate kinase"
FT                   /note="NDK; NDP kinase; Nucleoside-2-P kinase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10951"
FT                   /db_xref="GOA:A3M207"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M207"
FT                   /protein_id="ABO10951.2"
FT                   /translation="MAIERTLSIVKPDAVSKNHIGEIFARFEKAGLKIVATKMKHLSQA
FT                   DAEGFYAEHKERGFFGDLVAFMTSGPVVVSVLEGENAVLAHREILGATNPKEAAPGTIR
FT                   ADFAVSIDENAAHGSDSVASAEREIAYFFADNEICPRTR"
FT   gene            543165..544397
FT                   /locus_tag="A1S_0499"
FT   CDS_pept        543165..544397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0499"
FT                   /product="putative Fe-S-cluster redox enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10952"
FT                   /db_xref="GOA:A3M208"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M208"
FT                   /protein_id="ABO10952.2"
FT                   /translation="MSSAVVVSSENLDGQQQSSSTPASPAAEKVNLLGMSRAELEKFFE
FT                   DIGEKKFRAGQVMKWIHQYFVTDFAEMTNISGKLRAKLEQICEIKAPEVVHRHYSKDGT
FT                   RKWVFRVGEGSGSLVETVLIPAEDKTGSRKTLCISSQVGCALDCSFCSTGKQGFQRDLT
FT                   PDEIIGQLWMANYSYMEEVPVAERERSVTNVVMMGMGEPLLNYDAVLSSMHIMLDDFAY
FT                   GMSKRRVTLSTSGVVPKIDQLAKDIDVALAISLHAPNDELRNELVPINKKYPLAQLIAA
FT                   CQRYIAKDGNESARKHVTIEYVMLEGVNDQPEHAQQLLKLLKNLPSKINLIPFNPFPHA
FT                   PYGRSSRNRIISFQKTLSDAGFVCTIRQTRGDDIDAACGQLVGQVADRTRRAEQWQKKV
FT                   AQRQEILRTQG"
FT   gene            544437..545213
FT                   /locus_tag="A1S_0500"
FT   CDS_pept        544437..545213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0500"
FT                   /product="type 4 fimbrial biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10953"
FT                   /protein_id="ABO10953.2"
FT                   /translation="MLCMGVAVALLASGCQTSQTVKKDPEKAVKVRTQLAAEYIRSGDL
FT                   DSAKRSLDQALSVDSRDATANMMMGILLQQEGSKPNLEKAEHYFKRAISSEPDNAQAHN
FT                   NYGTYLYQMERYNDAIEQFRIAGATLGYDQRYQALENLGRIYLKLGDIASAEKTFKQAL
FT                   LANRDSYISMLELAEIFYLQQQIPAATQMYEQYVRTVGQKNQGARALWIGLRVARANAD
FT                   KMGMQVLVNQLRALFPESPEYQRYLQLQYSTEAVWK"
FT   gene            545204..545995
FT                   /locus_tag="A1S_0501"
FT   CDS_pept        545204..545995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10954"
FT                   /protein_id="ABO10954.2"
FT                   /translation="MEINPNSQQPTGSSLPTSALGNIQRPGEYLRQIRVSQKKELEQVS
FT                   SDLNMPLKTLNALEQDDYKSLPEATFIKGYYRSYAKYLNTDATAIIQRFDEIYANDTGL
FT                   LPNHALNNSPIKIMGKLPGSNSDRNKKWLKRALLAILIIAVVSLIVMGVQKWTSNKEDA
FT                   ELPKANQSNVEVLPMKGNTSATVGDQLVLNFNRPTSVHIVDATGKVLATGRQASTLTLN
FT                   GESPFQIRLDDATAVSLSLNQEQISLSPYTVNGKAEFRLSR"
FT   gene            546017..547132
FT                   /locus_tag="A1S_0502"
FT   CDS_pept        546017..547132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0502"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10955"
FT                   /db_xref="GOA:A3M211"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M211"
FT                   /protein_id="ABO10955.2"
FT                   /translation="MIENPIKRRPTRKIRVGSVYVGGDAPISVQSMTNTETCDVDATVA
FT                   QIERCVDAGADIMRVSVPSMEAAEAFGAIRKRVSVPLVADIHFDHRIALAVADYGADCL
FT                   RINPGNIGSDQKVREVVAAARHHGISMRIGVNAGSLEKDLQKKYGEPTGQALLESALRH
FT                   IDILDRLDFHEFKVSVKASNVFLTMDAYRLLSQQIDNPLHLGVTEAGIYRTGTVKSAIA
FT                   LGGLLMEGIGDTMRISLAAEPEDEIKIGFDILKSLGLRSNGINFIACPSCSRQEFNVIQ
FT                   VMQALEERLEDIRTPMDVSVIGCKVNGPGEAKEADIGVVGAAPRSLVYRNGEKSHLIDT
FT                   NQLVDEIETMVRQRVQELEEAKSKEIIRSSS"
FT   gene            547129..548421
FT                   /locus_tag="A1S_0503"
FT   CDS_pept        547129..548421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0503"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10956"
FT                   /db_xref="GOA:A3M212"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M212"
FT                   /protein_id="ABO10956.2"
FT                   /translation="MSSIVAIKGFNDVLPTQTAAWRRLEQHLASLMDAYGYQQIRLPIV
FT                   EQTGLFKRAIGDATDIVEKEMYTFFDKGNPPESLTLRPEGTAGCVRALVEHNLLRGATP
FT                   RVWYMGPMFRYEKPQKGRYRQFHQFGVETFGVATPDIEAEVILMTARLWKRMGVAHMVQ
FT                   LELNTLGEKEERTEYRNALVAFLNEHKDALDEDSQRRLTTNPLRILDSKIESTQKILEN
FT                   APKLYDFLKEDSLSHFQQLQDYLTAAGIKFVINQKLVRGLDYYNKTVFEWTTTALGSQG
FT                   TVCGGGRYDGLVGQLKGKADQSVPAVGFGMGMERLLLLIEQVEQAEIVRDCEAFLVAEP
FT                   AYQSKALVLAEQLRDQLEAANSNIRIKTGSQGSMKSQMKKADQAGAVYAIILGEREWEA
FT                   QQLAIKELATAEQSQVALAELVPFLIEKFTK"
FT   gene            548450..549148
FT                   /locus_tag="A1S_0504"
FT   CDS_pept        548450..549148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10957"
FT                   /protein_id="ABO10957.2"
FT                   /translation="MSLSDEEQFDSLKSFAKKYGSAMISGILIALIAFFGWEYWQKRNL
FT                   ATSQTETAKVQQLMDEANATADNPNALASITASADKIVKDDIDSVQAIQTQFVLAKLAY
FT                   EKQDYAAAEKALKKVENSKVKDEGLIQVVKLRLADAQLAQNKYDEALKTLSGDVDPAFK
FT                   ATVEELRGDIFVAKKDIDSAKKAYQAAWDSLLERKQERQILQIKLESVGVLVEDPQIER
FT                   PILETQVEES"
FT   gene            549148..550293
FT                   /locus_tag="A1S_0505"
FT   CDS_pept        549148..550293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10958"
FT                   /protein_id="ABO10958.2"
FT                   /translation="MNQKFKLPLAIAIASAVLVGCSSNKVKEAKPNPLPKLTESNKSLV
FT                   PVFSRSVSSTNKADPLRLQLDASEGVVFTLDPKGEVAAYRGKQRLWEKKVSKLGLSSGV
FT                   EAAEGIVVVGNSKGQLFALDQATGEQKWTAQLSGALLSPSLVQSGRVITIANDGTVFAH
FT                   DVSSGQQVWAYKLPNVQFSLRGQPSPVSLDPRTVLIASANAYVYAIDTISGIPRFQRRV
FT                   AVSEGRSDIQRLIDIDGDPVVAGQLMVTTSFQGQVTVTDLASQRVVWSEDSSSTKRPEV
FT                   YDNKVFVSSTDGKLTAYDLTTGEQLWQNDSLLNRHLSNPVVLGSDLIVGDLDGVLHLID
FT                   PTTGKLIGRSKTSGEVNTLRVIENQLYVSTRKGDLSIWQNR"
FT   gene            550481..551890
FT                   /locus_tag="A1S_0506"
FT   CDS_pept        550481..551890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0506"
FT                   /product="putative GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10959"
FT                   /db_xref="GOA:A3M215"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M215"
FT                   /protein_id="ABO10959.2"
FT                   /translation="MKPVIALIGRPNVGKSTLFNQITKSRDALVADFAGLTRDRKYGDA
FT                   TYQNKSFIVVDTGGIGESEGGIDNYMAEQSKTAINEADIIIFVVDARAGLLASDEQIAR
FT                   ELRTLGKKIYLVANKVDGVHAEAALVEFYKLGMGEPLQVAASHGRGVQQMLEDVLQDIP
FT                   EDENPEEHDKDTGLRLAIIGRPNVGKSTLVNRLLGEDRVVAFDQPGTTRDSIYIPFERE
FT                   GRKYTLIDTAGVRRKGKVDEMIEKFSIVKTLQAMKDAHVVVVVVDAREGIVEQDLHLIG
FT                   YALEAGRAMVIAINKWDNMSEYDRKQCKLDVERRFDFIPWARIHLISALHGTGVGELYP
FT                   SIHRAYESANLKVSPAKLTQILNDATDQHQPPTVQGRRIKMRYAHMGGQNPPTIVIHGN
FT                   KVDKTPADYRRYLENVFRKVYKLEGTPVKIEFKTSENPFEGRKSQVDERTAARRRRYIQ
FT                   KFKKAEKKFKR"
FT   gene            552087..552701
FT                   /locus_tag="A1S_0507"
FT   CDS_pept        552087..552701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10960"
FT                   /protein_id="ABO10960.2"
FT                   /translation="MVTLHLAHLTLTHAQPSYAALECIPAMQRRRLSPLAKLALNTAIS
FT                   SLDGRSADYIVWVSKYGDEAKTLNILQDVLNDQTPSPTQFSTSVHNAISGLYSILCQDD
FT                   TPSTSLSCSWTEGLIEAYALLKSMPEIKRVLVVAYDEPLPNIYAEAINFPAYAMAAVVT
FT                   LEKPNLQITAWTHIDEADAPAFAHFWQDADQLTSAFGWNKC"
FT   gene            552695..553489
FT                   /locus_tag="A1S_0508"
FT   CDS_pept        552695..553489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0508"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10961"
FT                   /protein_id="ABO10961.2"
FT                   /translation="MLNLKNLKQKSNYCWRVAATGFSFASFGLGGIAIASVIAPVLNAT
FT                   TSDPQKRQQRAQNVIKHSFKGFTDMMVKLGIMTYSVEGLEKLQNSRQELVIANHPTLID
FT                   VVVLIGMMQQANCVVKQSLWSNPFTKGPVQSAGYILNAGSQQFVEDCVKRLKENNAASL
FT                   LIFPEGTRTEKGMTLNEFQRGAANIAIRANVPIRPVIITCIPSTLTKNEKWYHVPSQPF
FT                   HIEVKVLDAVQVSDLLDDLTVGPKQVRQLSRSFYKIFDEELS"
FT   gene            553491..553619
FT                   /locus_tag="A1S_0509"
FT   CDS_pept        553491..553619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0509"
FT                   /product="putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10962"
FT                   /protein_id="ABO10962.1"
FT                   /translation="MSNLADELKQMIIDVLALEDITIADIDTEAPLFGEGLGLDSI"
FT   gene            553642..553752
FT                   /locus_tag="A1S_3499"
FT                   /old_locus_tag="AS1_3499"
FT   CDS_pept        553642..553752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3499"
FT                   /old_locus_tag="AS1_3499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3499"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89924"
FT                   /protein_id="ABS89924.1"
FT                   /translation="MKKRYNIHLNAESDETKQHFKSIQSLVALVEAQQKS"
FT   gene            553764..554012
FT                   /locus_tag="A1S_0510"
FT   CDS_pept        553764..554012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0510"
FT                   /product="putative acyl carrier protein (ACP)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10963"
FT                   /protein_id="ABO10963.2"
FT                   /translation="MLSQEQVLTKLREWMEDLFEIEPETVQLDSNLYSDLDVDSIDAVD
FT                   LVVKIKELTGKQVKPEDFKNVRTVLDVVTVIQNMTAE"
FT   gene            554033..554563
FT                   /locus_tag="A1S_0511"
FT   CDS_pept        554033..554563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0511"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10964"
FT                   /protein_id="ABO10964.2"
FT                   /translation="MTALFVLYPFIVGWSLSHGQFVWVSALLIGLGVIRLFSKGNSLLW
FT                   PLTGFAIVCGSLSLLSHDHAWLKLYPVGMSLGALIIFALTLIKPPSMIERFARLVEPDL
FT                   PASGVQWTRQVTKIWCVFFFCNALIALSTVLFTSTQVWVIYNGFISYVLMGILFLGEFI
FT                   LRKRHQRLHSSNH"
FT   gene            554573..556231
FT                   /locus_tag="A1S_0512"
FT   CDS_pept        554573..556231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10965"
FT                   /protein_id="ABO10965.2"
FT                   /translation="MYCHFQKFIDSAQPLCIDGTLNSTSFNQFWQDVALQAAAIAQMEN
FT                   LTWALWEADSYEFLVLFFAALLAKKQILLPPNRVRELEQDFSAQQIYFLKRQEIGEVVP
FT                   LSLTLDDTFLEQAQLYFYTSGSTGEPKKIPRTLRQLLNEVQGLSQSFSFDEHATAIATV
FT                   SHQHIYGLLFKLLLPLARGRSFYNPQMAFPEDVVQAQKQLETMGLSNYLISSPALLKRW
FT                   TTDVVLQDCQMVFSSGGKLESGVRPLLNRPIIEVLGSSETGGIAHRAKDEDAWTAFSNV
FT                   AIRIEDQQLMVKSNHAYENDWITTGDGAAWTDATCQIFKLLGRTDRIVKLEEKRLSLDA
FT                   IEQSIQALDVVKQCHVLVFEHEQRQMLGCIVVLTEQAREQLQQQGKLAFVSHLKQQLKD
FT                   GLETIAIPRQWRFLSQLPQNTQSKLNKNYLKTLFKPMLQPVVLSQSQNSDDHIWELEFP
FT                   PELACFKGHFPTQPIYPGVGQIGFLQHFAKSIWSDLSWCQGYEQLKFQNLIRPYAVVQL
FT                   KLARKEHKVSFELRDSEHILASGRLLFALQTEVED"
FT   gene            556234..556974
FT                   /locus_tag="A1S_0513"
FT   CDS_pept        556234..556974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0513"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10966"
FT                   /protein_id="ABO10966.2"
FT                   /translation="MQSNYGFVVPVYNHPHYLADLISYLDSFHLPIVLVNDGSDDACSQ
FT                   ILKALAEQYSQIHLIEHDVNKGKGQAVMTGLRAAYELGLSHVLQLDSDGQHCWDDIPKF
FT                   IEQSRQHPDAMVIGQPYFDASIPKKRLYGRYITHFWVWLNSLSFEIKDSMCGFRVYPLE
FT                   STIKVLNSAKFQPRMGFDSEILVRLKWENTPFINVPTPVVYPEQGISHFHAWRDNLGLS
FT                   KAHATLFMGMLIRLPKLLKQKLQG"
FT   gene            556977..557903
FT                   /locus_tag="A1S_0514"
FT   CDS_pept        556977..557903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10967"
FT                   /protein_id="ABO10967.2"
FT                   /translation="MTDSASPKWNDIKERGGMLPLMLMLWFYRFGGRWLCKFVMYFVIM
FT                   WYWLFAVTARQASLLYLQKLHHFAGSQSPFNHQPNWTNSYAHFMQFGECILDKIEGWLG
FT                   NIPEQELQVFGHENFSQHYQKGALIIVSHFGNIELLRAIKSEHPQKINVLVYQKHATKF
FT                   NEFLKKINDKADVCLLSVDELGIETAMLLQDKMQQGEWVIVAADRVPVQSDRVQHVDFL
FT                   GESAAFPQGAWILANLLKVPVIAVFCYRVQQQFQVHIHSIAEQINLPRANRIESMQTIT
FT                   KTYVAVLEQHCLRAPYQWFNFYNFWTK"
FT   gene            557905..559440
FT                   /locus_tag="A1S_0515"
FT   CDS_pept        557905..559440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0515"
FT                   /product="histidine ammonia-lyase protein"
FT                   /note="histidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10968"
FT                   /protein_id="ABO10968.2"
FT                   /translation="MRVLTVGEQPLSIEDVVSVARGECQVALPETSEWRELIQKGADFL
FT                   DQLLEEEGVIYGVTTGYGDSCLVEVPLHQVNELPLHLSRFHGCGLGENLDVITARAVVV
FT                   TRLCSLARGYSGVSIALLERLVWLLNENVIPVIPSEGSVGASGDLTPLSYIAGTLVGER
FT                   DVYIDGQIVPVAQVYAEKNMLPLTLRPKEGLALMNGTAVMTAIACLNYKKAEQIALAST
FT                   LITALNVLALEGNPSHFDEVLFAQKPHPGQQHIAKQLRDWLNSEVQTAHQSPRLQDRYS
FT                   LRCAPHIIGVFEDSKVWLRQFIENELNSSNDNPLIDPVGMRVLHGGHFYGGHIAQAMDS
FT                   LKIMIANIADLMDRQIAQLVDHKMNHGLPRNLTGATAERLPLNHGFKAVQIGVSAWTAE
FT                   ALKNTLAASIFSRSTECHNQDKVSMGTIAARDASRVITLTQQVIAALCCASVQAIHLKG
FT                   LTTQLSPTLQAFMQWTLQSFAFVEEDRPLQTELQQIVDRLDQLELFNQPEFMG"
FT   gene            559450..559878
FT                   /locus_tag="A1S_0516"
FT   CDS_pept        559450..559878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10969"
FT                   /protein_id="ABO10969.2"
FT                   /translation="MHADVIIEIPFHDVDTMNVVWHGHYLKYFEIARCKLLDQFHYNYM
FT                   QMKESGYAWPVIESHVRYAYGIEFEQKIRVRAILKEWENRLKIDYLIFDAESGKRLTKG
FT                   YTTQVAVNIEAREMCFQSPQVLFDRLNAWSEFQPKRNA"
FT   gene            complement(559466..559846)
FT                   /locus_tag="A1S_0517"
FT   CDS_pept        complement(559466..559846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10970"
FT                   /protein_id="ABO10970.1"
FT                   /translation="MHSSDQTKPVAIENTFHELQYSPPPVWYNPWLNVSLTQHQKSNNQ
FT                   FSNGFPILLKWPEPESFVQTQYRMHSEHGFQSQAMHSLILSSAYSCNEIDRAICSAQSQ
FT                   NILNSVHAKPHSWYRHHEMEFQ"
FT   gene            559878..560507
FT                   /locus_tag="A1S_0518"
FT   CDS_pept        559878..560507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10971"
FT                   /protein_id="ABO10971.2"
FT                   /translation="MSKFIKTLGLGAAVWMSSLSAVYAAPTQITQIFQQLSQSPTVRAD
FT                   FEQQKKLPSLNKTFVSNGSLLFSKSYGVAWQIKRPVQAVLIVTPTKLVQKTQRTFSQIQ
FT                   VDQSPYSSVATLFLQLMSGNEQALAKNFNVVSANYSPAGWSMSLTPKSSLFKKLFVRVD
FT                   AQGQQYVNQIVITEKANNLTTIRFSHQTSQPTTLTAAEHAIFQLAK"
FT   gene            560482..562797
FT                   /locus_tag="A1S_0519"
FT   CDS_pept        560482..562797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0519"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10972"
FT                   /protein_id="ABO10972.2"
FT                   /translation="MRFSNWQNKFTALWLIALLLVAVGLGVTWLNKDIHIQTNIFALLP
FT                   KVQQDPELARTQQYMNEQLNNKVFVVVDAKDEAAIQQATHFLTVQAKQSQLWQPLKPQL
FT                   DFDQFAKQLYQHRAGLLSAQDQALLQKKDYAALTEQSLMQMMSPGMPVTAESLKQDPLL
FT                   LFPRYAMQLATPSQQDIEMEQGFATIHHEQGISRLFVLQLTQSPYNIDYQEQTSTWIEQ
FT                   TKQKLAAMGLKSHWTGTILFSNFGTQSAKQEISTIGVGSTLGLIFLVWFGFRSLRPLAT
FT                   EFIAVSTGSFVAFAVTHWMFGEIHLMTLVFGASLIGVCVDFSFYFMAMQSQHRTLGGFQ
FT                   ILKPLLPSLFMGLMTTLVAYIFLSFTPFPGFKQIAVFSIVGLTAAWISSVLLLPRLPAL
FT                   NAQPAIKALSWIGQARLWFQQRTKIRYGLIAVILAVGTASLFYLKSNDDIRNLQGMDAS
FT                   LKQQDQVVREQFGQQQSSDYFVVRAASANEMQQQEQQLIGHLQQLQTNGKISAFQALGQ
FT                   WIPPLAEQQNNLQLLRNIPKATLQQYAQSMSLNVTDVLQWQQQLATQPLLDFSVFKDHP
FT                   LAFLQPQANERLVMVTGVKQPDALKQLQNEHIHFQQPITAMSQMFAEHRVQAQHLLIYA
FT                   LIGLAVGLALIYGLSSIVPLVLPVSLALLSTFAVQAWLGVEINLFSIMATFLIIGIGVD
FT                   YAIFYRHGHDHPQVVGMALFLCMMSTLLGFGLLSFSHTYAIHCFGLTVLFGVIFSFIYA
FT                   TLLTPADEKHIVNLQDHS"
FT   gene            562827..564122
FT                   /locus_tag="A1S_0520"
FT   CDS_pept        562827..564122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0520"
FT                   /product="putative oxidoreductase protein; putative
FT                   dehydrogenase (flavoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10973"
FT                   /protein_id="ABO10973.2"
FT                   /translation="MSTIEKIDVVIIGAGPSGSSAAALLRKKGYTVTVIEKQHFPRFSI
FT                   GESLLPQSMAFLEEAGLLETVREHVEQYAFQFKNGAAFLRGKQRSFYDFTEKFTDGPGT
FT                   TWQVRRADFDNLLAKQAQAYGADIRFGHEVLDVDVASEQPVITVLDEEQQRYQIQTKFL
FT                   LDASGFGRILPKLLDLESPSNFPVRRALFTHIEDGIADDPEFDRNKILITVHEKDHRAW
FT                   YWLIPFADGRASFGVVAEQDFFEKYTVEDAEDNELDAMFKRILADEPSLSYVLRRANFD
FT                   TPVRTLVGYSANVKHLADRNYALLGNAGEFLDPVFSSGVTIALKSSSLAVPLVERVLQG
FT                   QQVDWLEEYEKPLRRGIQVFRAYVESWYEGEFQDVVFSQNQNEGIRRMISSLLAGYAWD
FT                   EKNPIHKNAKRRLSTLAEYCREGLVQEQVFEG"
FT   gene            564125..564670
FT                   /locus_tag="A1S_0521"
FT   CDS_pept        564125..564670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10974"
FT                   /protein_id="ABO10974.2"
FT                   /translation="MQRKWATILLSSFIFLNGCQVMPHAKGLQSPLWQAQTYQRQDQVE
FT                   VQWKQQSFSFLLYQQQKGAVLDMVALSLTGQQLFKLQFDGHRVHVEQRIDQMRLLPFEF
FT                   VVRDLLFATYPQFSHLGQQAVEMKQQADKQVVYIEKQPVLQVKQGQGSIELINEQVPYT
FT                   MTLSSIENTLQTEESSTP"
FT   gene            564667..565869
FT                   /locus_tag="A1S_0522"
FT   CDS_pept        564667..565869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10975"
FT                   /protein_id="ABO10975.2"
FT                   /translation="MKHLPSANAAPMAVGIQFSVGLSALGSELNQIKQALQEPQQILTL
FT                   RNDLIADHDVWVGQYTHPLCSSVPDALQSVDSRNLRFALTALSKIETELKAYTASFENK
FT                   RLAIVVGTSTSGIADNELLLKQYFQGQTDLSISHYPQEMSCLAKALQLYLGWEGPAYTI
FT                   STACSSSAKALAAGQRLLHADLADVVLVGGVDTLCKLTLNGFNSLESLSEHICQPCGLN
FT                   RDGINIGEAAAFFVLSKEQAPVMLMGAGESMDAWHISAPHPEGKGAALAMQCALDMAHI
FT                   SAQEVGYINLHGTATPQNDAMEIKAVRQVFGDYPVALSSTKHKTGHCLGAAGAIEAFIC
FT                   EQVLKDQNWLPLHQNVEIDPDLADQNYVQEAELKQPIRYVMSNSFAFGGSNISLVFGVK
FT                   P"
FT   gene            565869..566294
FT                   /locus_tag="A1S_0523"
FT   CDS_pept        565869..566294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0523"
FT                   /product="putative 3-hydroxylacyl-(acyl carrier protein)
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10976"
FT                   /protein_id="ABO10976.2"
FT                   /translation="MKLDAIQYIPHEQPMVFIDHLTEVAEGRAQAELTITPELMFCEAE
FT                   GLPTWASIEIMAQTISAYSGWQGQQSKQAPKVGFLLGTRKLNLPIPYFALGSRLIIQIE
FT                   QQYFHEGLGQFSCEIQYAEHCIQATLSVFEPTESPFE"
FT   gene            566318..567043
FT                   /locus_tag="A1S_0524"
FT   CDS_pept        566318..567043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10977"
FT                   /protein_id="ABO10977.2"
FT                   /translation="MTRRILVTGSSRGIGKAIALQLAKAGFDVTVHARSRQAEAEQVVQ
FT                   EIQALGQNSHYLMFNVNERQTVQQILEQDVEQHGAFYGVVLNAGLTHDGAFPALTDQDW
FT                   DEVISTSLDGFYNVLKPLIMPMIHLRKGGRIVTLSSVSGIMGNRGQVNYSAAKAGLIGA
FT                   TKALALELAKRKITVNCVAPGLIETEMVTDEVKEHALKMIPLQRMGQVDEVASVVKFLC
FT                   SDEASYVTRQVISVNGGLI"
FT   gene            567043..568269
FT                   /locus_tag="A1S_0525"
FT   CDS_pept        567043..568269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10978"
FT                   /protein_id="ABO10978.2"
FT                   /translation="MKRVVVTGMAGITSLGETADDIFARFEAAKSGIRYMPEWEQYVDL
FT                   RTKLAGPVETFHIPKHFNRKVTRGMGRVALMSVVCAETALQNAGLLGHEILSSGEAGVA
FT                   FGSSAGSVDAVGEFASMLLHQSMSKINATTYIRMMAHTSAVNMTVYFGLKGLTLPTSSA
FT                   CTSGSMAIGQAYEAIKYGKQQVMIAGGAEELSAAGAAVFDVLFATSGMNDQPEKTPRPF
FT                   DAKRDGLVIGEGAGCLILEEYEHAKARGAHIYAEVIGYGSNTDGQHVTRPESEMMGRCM
FT                   ELALKDASVEAKDIAYVNAHGTSTDQGDVAESQATAKVLGYKPISSLKSYFGHTLGACG
FT                   AIEAWLSIEMMNRGRFIPTLNLDEIDPLCGELDYIVQQPRNLDADIIMTNNFAFGGINT
FT                   SLIFKRVKQ"
FT   gene            568281..568715
FT                   /locus_tag="A1S_0526"
FT   CDS_pept        568281..568715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10979"
FT                   /protein_id="ABO10979.1"
FT                   /translation="MLNKKLLFVAMLSAGFTATVQAADEVHHLNFKEAVDRAVADGTLD
FT                   GSVKFYLKGTKSGGKVIQKDAVTNKKTNGFGKSAATSCDWVLRSALIQMQNNAKAQGAN
FT                   AVTNIVSYFKANETTSTTTYDCYKGTMMAGVALKGDVVKF"
FT   gene            568739..569395
FT                   /locus_tag="A1S_0527"
FT   CDS_pept        568739..569395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0527"
FT                   /product="putative holo-(acyl carrier protein) synthase 2"
FT                   /note="AcpT; phophopantetheinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10980"
FT                   /protein_id="ABO10980.2"
FT                   /translation="MSKRKIEVYTQALSQLLLKSKQDFPDFRSFNHYKKQQIKSVRNRL
FT                   IAEKLRLTSMELEFAKHEHGKPYLLNHTLHFNHSHSQQYYALALSERIKDIGIDVEELD
FT                   RKVRLDSLAQHAFHPDEYATWQSLEQDREYWFKVWTTKEAVLKASGLGIRLDLNTLNTQ
FT                   AHPTNHGGLCSHELIGTFAYQNFVLGNMILTVAWRSEQSCRGFQFPSIQIHSLDR"
FT   gene            complement(569463..569921)
FT                   /locus_tag="A1S_0528"
FT   CDS_pept        complement(569463..569921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0528"
FT                   /product="protein exporting molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10981"
FT                   /db_xref="GOA:A3M237"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M237"
FT                   /protein_id="ABO10981.1"
FT                   /translation="MSEEQQVQPQLALERIYTKDISFEVPGAQVFTKQWQPELNINLSS
FT                   AAEKIDPTHFEVSLKVVVQANNDNETAFIVDVTQSGIFLIDNIEEDRLPYILGAYCPNI
FT                   LFPFLREAVNDLVTKGSFPQLLLTPINFDAEFEANMQRAQAAAVEGQA"
FT   gene            complement(569949..570206)
FT                   /locus_tag="A1S_0529"
FT   CDS_pept        complement(569949..570206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0529"
FT                   /product="glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10982"
FT                   /protein_id="ABO10982.1"
FT                   /translation="MAANVIVYSTSVCPYCVRAKQLLERKGVAYKEVNLSVEAPEVRAE
FT                   LMQRTNHRTVPQIFINDQFIGGFDQLYALEREGKLDELLA"
FT   gene            complement(570218..570634)
FT                   /locus_tag="A1S_0530"
FT   CDS_pept        complement(570218..570634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10983"
FT                   /protein_id="ABO10983.2"
FT                   /translation="MERWLEFMGNHPILFGTLGVLIVLFFIFEGQRNGRKISPQSLGIL
FT                   VKAKNALLIDLRDSKDFREGHISGSRNIPYSQIASHADELKASDRPLVFICNLGQVAGS
FT                   ALQKVAHHDSYRLDGGISNWKAQGLPLVKSKPKA"
FT   gene            complement(570731..571789)
FT                   /locus_tag="A1S_0531"
FT   CDS_pept        complement(570731..571789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0531"
FT                   /product="putative GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10984"
FT                   /protein_id="ABO10984.2"
FT                   /translation="MALIRKRRLTEQQQRRIEKQHKTRQEEVDTSQDLDGLVVQHYGRQ
FT                   LEVQALSVPDHHPEKPQVAEGEPEPFWKPIELNSVWRCHTRTNLELLVTGDRVKWQADP
FT                   NTGLGIITAIHPRTSLLTRPDRYHKVKPVAANISLIVIVFAPLPEPAPTLIDRYLVACA
FT                   DANIPALLVLNKSDLLTENDPILDMLKEYENLGYEVMICHSKGDISALSQRLDGETVAF
FT                   VGQSGVGKSSLINVLIPDAEQKTNIISENSALGQHTTTSTRLINFGKNGALIDSPGIRE
FT                   FGLWHLDLDKIRMGFPEIEAHLGSCQFRNCTHTHEKNCGLKQAVEAGEILPRRLDSFLR
FT                   LIDEIQEAQQKN"
FT   gene            571915..572481
FT                   /locus_tag="A1S_0532"
FT   CDS_pept        571915..572481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0532"
FT                   /product="oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10985"
FT                   /protein_id="ABO10985.2"
FT                   /translation="MSSTLNTRLIWIDLEMTGLDTDNDQIIEIATIITDDHLNVLAEGP
FT                   VLAIHQPDRILNAMDEWNTRQHGQSGLIERVRRSKLTARDAELQTLEFLKKWVNPKVSP
FT                   MCGNSICQDRRFLHRLMPELEQYFHYRNLDVSTVKELSKRWRPEIMSGLKKNASHLAMD
FT                   DIRDSISELKYYREYFFIMNTDGKD"
FT   gene            572637..573368
FT                   /locus_tag="A1S_0533"
FT   CDS_pept        572637..573368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0533"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10986"
FT                   /protein_id="ABO10986.2"
FT                   /translation="MQSNNPILTRVETVSDYSQPMTVQGAIQKSVMLTIIAAAVGVALF
FT                   FYAAFTANVGIAYAASIVGAIGGLVLALITTFKPTTAPTLAIPYALFEGAFLGGISFTF
FT                   QLKYPGVPLQALLATFVTTLVMFGLYKFQIIRATEKFKSVVISASLAIFIVFIVQMVMR
FT                   LAFGSSIPYIFESNWLGIGFAAFVAVIASLNLILDFDLIETNAAYRAPKFMEWLCGIAL
FT                   LATLVWMYISFLRLLGLLSDD"
FT   gene            573442..574308
FT                   /locus_tag="A1S_0534"
FT   CDS_pept        573442..574308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0534"
FT                   /product="NADH-dependent enoyl-ACP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10987"
FT                   /protein_id="ABO10987.2"
FT                   /translation="MQFRKTLNIGIMLKIVLSEIGMTQGLLAGKRFLIAGVASKLSIAY
FT                   GIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSKLVFPCDVAVDAEIDNAFAELAKH
FT                   WDGVDGVVHSIGFAPAHTLDGDFTEVTDRDGFKIAHDISAYSFVAMARAAKPLLQARQG
FT                   CLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSLGVDGIRVNAISAGPIRTLAAS
FT                   GIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWASGITGEILYVDAGFNTVGMS
FT                   QSMMDDE"
FT   gene            complement(574379..575785)
FT                   /locus_tag="A1S_0535"
FT   CDS_pept        complement(574379..575785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0535"
FT                   /product="putative RND family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10988"
FT                   /protein_id="ABO10988.1"
FT                   /translation="MSFSMTKLSAALLLTSSLVGCAAVVKTPYQAPAVQVPGSFQYDKA
FT                   KAKTASVEQYSDRWWTLFGDTQLNQLVTNVLERNSDLAVAGITLQQARLQADLTANKQG
FT                   LRTSSSVSTGHSFDLNSGDDSAKGLSMSAGVSYELDLFGKLARQTEASKWEALATEQDL
FT                   QATGQSLIATTAKLYWQLGYLNERYATAQQSLATSQKLYQLVQTQYKAGAVSGLDLTQA
FT                   EQSVQSQKASLSQIEQQLVETRTAIAVLLHEPLQQLNIQEPQRLPRTALPAIGAGLPAD
FT                   ILSRRPDLQAAELRLRKALATKDATKASYYPSISLTSSLGSSSTSLTELLRNPALTLGA
FT                   SLSLPFLQYNDMKKDIAISNLDYEKAIIQYRQTLYQAFADVENALSSRTELDKQVALQE
FT                   RNVELAEKTERLTEVRYRYGAVALKTLLDAQQTTRTARLSLVETKQSQYNAYVTLMQAL
FT                   GGSPVKELPQ"
FT   gene            complement(575796..577790)
FT                   /locus_tag="A1S_0536"
FT   CDS_pept        complement(575796..577790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0536"
FT                   /product="macrolide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10989"
FT                   /protein_id="ABO10989.2"
FT                   /translation="MTKQALLEVSNLVREFPAGESTIQILKGIDLTIYEGELVAIVGQS
FT                   GSGKSTLMNILGCLDRPTSGSYKVNGQETGKLEPDQLAQLRREYFGFIFQRYHLLGDLS
FT                   AEGNVEVPAVYAGVTPADRKQRATALLTELGLGTKTQNRPSQLSGGQQQRVSIARALMN
FT                   GGDVILADEPTGALDSHSGVEVMRILRELNAAGHTIILVTHDMQVAKNATRIIEISDGE
FT                   IISDRPNVPDQSLEEVKSDPDAAPALQNKQKKGKSISAWRSTLDRLSEAFQMALLSMNA
FT                   HRMRTFLTMLGIIIGIASVVTVVALGNGSQQQILSNISSLGTNTITVFQGRGFGDNSKT
FT                   ANFKTLVPADADALMTQPYVSAVSPMVSTSKTMRYQQNEANATINGVSNDYFDVKGLVF
FT                   KDGQTFDQRSVRDRSQDVVIDTNTQKQFFSDGTNPIGQVVLLGSVPARIIGIVEPQTSG
FT                   MGSDDTLNVYMPYTTVMSRMLGQAHVRNIVVRINDKYSTSAAENAIVNLLTQRHGAQDI
FT                   FTMNSDSIRQTIEKTTSTMTLLVSAIAVISLVVGGIGVMNIMLVSVTERTQEIGVRMAV
FT                   GARQSDILQQFLIEAILVCLIGGVLGVLLSLGLGQLINKFAGGNFAVAYSTTSIVAAFV
FT                   CSTLIGVVFGFLPAKNAAKLDPVAALSRE"
FT   gene            complement(577793..578041)
FT                   /locus_tag="A1S_0537"
FT   CDS_pept        complement(577793..578041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0537"
FT                   /product="putative RND family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10990"
FT                   /protein_id="ABO10990.1"
FT                   /translation="MTPEQKQLIEQGKATLSVVRVLQADGTTKPTQILVGINNRVNAQV
FT                   LAGLKQGDQVVIADSSENSAASANSGNNRRRSGPMGM"
FT   gene            complement(578044..578910)
FT                   /locus_tag="A1S_0538"
FT   CDS_pept        complement(578044..578910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0538"
FT                   /product="putative RND family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10991"
FT                   /protein_id="ABO10991.1"
FT                   /translation="MYVQLGDQVKQGQLIAQIDSTTQENSLKTSDANIKNLEAQRLQQI
FT                   ASLNEKQLEYRRQQQMYAQDATPRADLESAEAAYKTAQAQVKALDAQIESAKITRSTAQ
FT                   TNIGYTRIVAPTDGTVVAIVTEEGQTVNANQSAPTIVKIAKLQNMTIKAQVSEADIMKV
FT                   EKGQQVYFTTLGDETKRYATLRQIEPAPDSISSESNSTTSSTTSSAVYYNALFDVPNTD
FT                   GKLRIDMTAQVYIVLNSAKNALLVPSSALSSKQFSGQRKQGQSADKASSTPSAERKHQG
FT                   NGVRLER"
FT   gene            complement(579175..579267)
FT                   /locus_tag="A1S_3500"
FT                   /old_locus_tag="AS1_3500"
FT   CDS_pept        complement(579175..579267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3500"
FT                   /old_locus_tag="AS1_3500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3500"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89925"
FT                   /protein_id="ABS89925.1"
FT                   /translation="MWKNIIYTLGQPNHLPALLKYHKNSRFILI"
FT   gene            complement(579240..580229)
FT                   /locus_tag="A1S_0539"
FT   CDS_pept        complement(579240..580229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0539"
FT                   /product="putative DNA polymerase III delta subunit"
FT                   /note="HolA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10992"
FT                   /protein_id="ABO10992.1"
FT                   /translation="MKLDYLQALKRIPEARGAWILHGQEPLLEQNLLDTFRKSWQQQDI
FT                   ERQRYDISSVSDWKNVFNALNSLSLFSQQLAIEVHGNIKPDANGLKQLKSYIQHNETNL
FT                   LLIVLPKQDSSSLKSAFFQVVEANGVVVALTANYPQDRQRILAAEAEKLEIQLDNDAWQ
FT                   WLMQHHEHNLLAAKNSLMRVRDTFPDQKLIQIEQLYACLQDQSRYTTYDLSDALLEGNL
FT                   AQSIKIFQYLIGSGEPESLILWTLSKEMRLLMQLFEQPHNALQLGIWKTKVSLYQQALR
FT                   RLNPQQFLGWSALLLQIDAAIKGMSNENAQHLMQQAIAELCGKTLFIH"
FT   gene            complement(580249..580758)
FT                   /locus_tag="A1S_0540"
FT   CDS_pept        complement(580249..580758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0540"
FT                   /product="putative minor lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10993"
FT                   /protein_id="ABO10993.2"
FT                   /translation="MHLAQRLAAVVLTLGLSAGLVGCGFHLKGTNPTATPLVYKKLSLE
FT                   LPAKTDDLETQLKVYLTANGVQLSNDNDAYVLRVLEYTPRRQLLNGKLTEVLLRLTVTF
FT                   QIEDRQGNKITEPRTLTAARSYQYDLATVNTENQQESYLQRIVIDDLAQQITRQISANR
FT                   LPKAQP"
FT   gene            complement(580786..581502)
FT                   /locus_tag="A1S_0541"
FT   CDS_pept        complement(580786..581502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0541"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10994"
FT                   /protein_id="ABO10994.1"
FT                   /translation="MSKSKNNGIDPQAIIDQYGADTARVFMMFAAPPDQSLEWSDAGVE
FT                   GANRFLKRVWRLVASFLEKGNSATAIDKANLSKDAQDLRRKTHETIQKVSDDIERRHAF
FT                   NTAIAALMELLNASNKFEAKDDNDVAVEREAITTLLTLLAPFAPHLSQTLLAQFGTDLT
FT                   EATFPEVDASALTRNTQTIVVQVNGKLRGKLEVSVDISKDELLAQAKALPEVQQFLTGP
FT                   TKKEIVVPNKLVNLVV"
FT   gene            complement(581807..583279)
FT                   /locus_tag="A1S_0542"
FT   CDS_pept        complement(581807..583279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0542"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10995"
FT                   /protein_id="ABO10995.1"
FT                   /translation="MFPYPSGKLHMGHVRNYTIGDVISRFYRLKGETVLQPMGWDAFGL
FT                   PAENAAIAHKVAPAKWTFENIAYMRDQLKKLGLSVDWDREFATCTPEYYHWEQWLFVQL
FT                   YKKGLIYRKLSTVNWDPVDQTVLANEQVENGRGWRSGALVEKRDIPMYYFRITDYAQEL
FT                   LDDLDTLQDGWPQQVLTMQRNWIGRSTGMEITFPSANTEIYADGLTVYTTRADTLMGVT
FT                   YVAVAAEHPLALKAAENNPELAAFIEECRMGSVAEADLATAEKKGMATGLFVKHPVTGE
FT                   ELPVWIANYVLMSYGSGAVMAVPAHDERDFEFANKFNLPIKQVIDAKGADDADYSATEW
FT                   QEWYGSKEGKLVNSGEFDGLEFQAAFDAFLAKLEPQGLANSKVQFRLRDWGVSRQRYWG
FT                   CPIPMINCDTCGQVTVPEDQLPVVLPTDVVPDGSGNPLNKMPEFYETKCPCCGGDARRE
FT                   TDTLDTFVESSWYYARYASPDFTGGMVKPRSS"
FT   gene            complement(583598..583933)
FT                   /locus_tag="A1S_3501"
FT                   /old_locus_tag="AS1_3501"
FT   CDS_pept        complement(583598..583933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3501"
FT                   /old_locus_tag="AS1_3501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3501"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89926"
FT                   /protein_id="ABS89926.1"
FT                   /translation="MNLSYLKTSLYTAVTTAILLCSSQSQAQQYYKWMDQSGSTHYTTT
FT                   PPPKGAKHLNKVSTYGSQPLLKNPTSNSEQPSQDKDKVVQEVTNVAVEKGAPAVPVPPA
FT                   PSVSAPR"
FT   gene            584438..586162
FT                   /locus_tag="A1S_0543"
FT   CDS_pept        584438..586162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0543"
FT                   /product="acetolactate synthase III large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10996"
FT                   /protein_id="ABO10996.2"
FT                   /translation="MELLSGGEMLVRALADEGVEHVFGYPGGAVLHIYDALFQQDKINH
FT                   YLVRHEQAAGHMADAYSRATGKTGVVLVTSGPGATNTVTPIATAYMDSIPMVVLSGQVA
FT                   SHLIGEDAFQETDMVGISRPIVKHSFQVRHASEIPAIIKKAFYIASSGRPGPVVVDIPK
FT                   DATNPAEKFAYEYPEKVKMRSYQPPSRGHSGQIRKAIDELLTAKRPVIYTGGGVVQGNA
FT                   SALLTELAHLLGYPVTNTLMGLGGFPGDDPQFIGMLGMHGTYEANMAMHHADVILAIGA
FT                   RFDDRVTNNPAKFCPNSKVIHVDIDPATISKTIMAHIPIVGAVEPVLQEMLAQLKQLNV
FT                   SKPNPEAIAAWWSQINEWRKVHGLKYENPSDGTMKPQQVVETLYKVTNGDAIITSDVGQ
FT                   HQMFGALYYKYKRPRQWINSGGLGTMGVGLPYAMAAKLAFPDQQVVCITGEASIQMCIQ
FT                   ELSTCKQYGLNVKILCLNNRALGMVKQWQDMNYEGRHSSSYVESLPDFAKLMEAYGHVG
FT                   IQINHADELESKLAEAMAINDKCVFINVMVDRSEHVYPMQVAGQSMRDMWISKGERI"
FT   gene            586162..586653
FT                   /locus_tag="A1S_0544"
FT   CDS_pept        586162..586653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0544"
FT                   /product="acetolactate synthase isozyme III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10997"
FT                   /protein_id="ABO10997.2"
FT                   /translation="MRHIISVLVENEAGALSRLVGLFSQRNYNIETLNVAPTEDPTLSR
FT                   LTLTTYGDDHKIEQITKQLNKLVEVVKVVDLSEGSHIERELMLIKVKALGASRAEIKRT
FT                   ADIFRAQIVDVTPTTYTIQIAGTTEKLDGFIDALAENTILEVVRSGVSGIARGEKVLAI
FT                   "
FT   gene            586686..587702
FT                   /locus_tag="A1S_0545"
FT   CDS_pept        586686..587702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0545"
FT                   /product="acetohydroxy acid isomeroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10998"
FT                   /db_xref="GOA:A3M254"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M254"
FT                   /protein_id="ABO10998.2"
FT                   /translation="MQIFYDKDCDLSIIQSKKVAIIGYGSQGHAHALNLKDSGVDVTVG
FT                   LRAGSASWKKAENAGLKVAEVPAAVKQADLVMILTPDEFQSQLYRDVIEPNIKEGATLA
FT                   FAHGFSVLYNQVVPRKDLDVIMVAPKAPGHTVRSEFQRGSGVPDLIAIHQDASGNARNV
FT                   ALSYASGVGGGRTGIIETSFREETETDLFGEQAVLCGGAVELVKMGFETLVEAGYAPEM
FT                   AYFECLHELKLIVDLMFEGGIADMNYSVSNNAEYGEYVTGPEVINEQSREAMRNALKRI
FT                   QSGEYAKMFIQEGALNYPSMTARRRQNAAHGIEQTGAKLRAMMPWIQANKIVDKEKN"
FT   gene            588033..590087
FT                   /locus_tag="A1S_0546"
FT   CDS_pept        588033..590087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0546"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABO10999"
FT                   /protein_id="ABO10999.2"
FT                   /translation="MGHVDYDSTLIVGSFIAAGAICYIVISMEQLIFKQTYKKIEPFIL
FT                   LLNGLLLAAAISIVHIVGMHAYHLFEAASSNVPLITLAFGISAVLSSVAIWLTSRFTLP
FT                   IFRLILSSVIMGIGISASYYVSMLGWNIDIYKKDYTSFLILFSVLIAMSGSGLAFLLAY
FT                   KLKESERHRISLKLAFAVMMTLSIMGMHYTALISTNITDKFVSQYQAEHDLLLFTIILV
FT                   TCLVLVASFIVAVLEQRLNQRNLELRKANKELANLSIQDNLTKLPNRLYLVDYAEVLLS
FT                   DHRYKDQKIAFLYIDLDRFKSVNDAFGHHIGDQLLIQMANRLHWQLNEKCKLLRIGGDE
FT                   FLLIAENTDTEEAMQLAEKVLHLIQDSYQISGKEINISASLGIALFPEHGQNVQDLLMN
FT                   ADAAMLMSKEQGRNTYTVFSYSTHQQETRSQSKLINDLYKAVEEKQFVLYYQPKFNTNL
FT                   EICGVEALIRWNHPSLGMLTPHMFIGGAEKTGLIIPMGYWALEQACQQIQEWERSNTQF
FT                   YPIAVNLSALQFENKKLFSTLEGLLKKYQIQPHHLIIEITESTAMRHIDLSIRACERLR
FT                   DMGIRVAIDDFGTGHSSFLYLKDLPVDELKIDRGFIVDLKPGSKEEVILESIIHLAKKL
FT                   GLTVTAEGVETQQQVEILTRLGCQQFQGYLLGMPVNVGQLIQSQGAHFV"
FT   gene            complement(588230..588358)
FT                   /locus_tag="A1S_3502"
FT                   /old_locus_tag="AS1_3502"
FT   CDS_pept        complement(588230..588358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3502"
FT                   /old_locus_tag="AS1_3502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3502"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89927"
FT                   /protein_id="ABS89927.1"
FT                   /translation="MSLNIGSVKREVSQIATLESTALMPKASVIKGTFEEAASNKW"
FT   gene            590796..591257
FT                   /locus_tag="A1S_0547"
FT   CDS_pept        590796..591257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0547"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11000"
FT                   /protein_id="ABO11000.2"
FT                   /translation="MREAEVPKASFYNYFHSKERLIEMCLHFQKDILKEQVRSIIYIQK
FT                   DLILREKLKEIFFLHTNLDGYYHLLFRAIFEIERLYPAAYQVVVQYRHWLTNEVYKLLL
FT                   TVKKDATKSDSDMFLFTLEGAIIQLLDETRGDTRELLFTYILKGIFLKD"
FT   gene            complement(591474..592046)
FT                   /locus_tag="A1S_0548"
FT   CDS_pept        complement(591474..592046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0548"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11001"
FT                   /protein_id="ABO11001.2"
FT                   /translation="MSKRETIITTAMTLFNQKSYTSIGVDKIIAESKVAKMTFYKYFSS
FT                   KEVLIEECLRRRILEVQTSLLDKVNSADDPLNKLKSIFNWYIDWINTEDFSGCLFKKAT
FT                   IEVLQLYPSIKKQVNKYREWIYSLVLSIFLELEIEDPKVLSSLFLNIIDGLIIDGTINK
FT                   PEINSEETWSYINKLIELETKQKYEAA"
FT   gene            592377..593240
FT                   /locus_tag="A1S_0549"
FT   CDS_pept        592377..593240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11002"
FT                   /protein_id="ABO11002.2"
FT                   /translation="MSKKFEDFNNPREKALQGMKDSIPASQWEENLQFLKQLRNKIAKL
FT                   PVSKHPAIEILNNGYLDKQTLTRIHLEYRHAIVQIFTDALLKAQFLTKQLEPKLHSGAK
FT                   MFPRVLLSLNILDEFGFRPGLDKDHYYLGNPEYAHYPLYEDLLNDYGLTEADRRNYKPS
FT                   KIADQVRTFLEASYDRYINVVALLAVAEEEVILFSPPLRQATKFVNIDVEGGGYYHVHG
FT                   VSTDETAEAADDDHQDDLWFALAQAITKDDYESLTQLCLDYCALWTEFWDAQIADVQFI
FT                   EEKKLA"
FT   gene            593680..596445
FT                   /locus_tag="A1S_0550"
FT   CDS_pept        593680..596445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0550"
FT                   /product="putative VGR-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11003"
FT                   /protein_id="ABO11003.2"
FT                   /translation="MYLQFSDASLNSQVFLQRIDGQHYLNQGMTAELICLSTNAHIPLK
FT                   TFIGLQVAVDQVTDRGSFFRTTGIITGASQGQSDGALTLYKLAISDPTYLWHKRRNSRV
FT                   FMNKSVKEISEILFQEWQGKSPLFASSLTLDLSGLKQTYDVRPFVMQLNESDYDFLTRL
FT                   WRSEGISWLIDEAELTVASNTDNIQPQKLRLIDDNSQYQTLTRRTIRYHRSSATEQFDS
FT                   MTSLIAGRHLQPSSVFVQRWQSDVLQQTDGAGSVQSKHEHSSNYDNQSLNLEDAWHFSP
FT                   AWMQDLNGEDGATSASNQQLEKFNQNLSAYHDAQSKQFVAQTTVRDTQVGYWFELNEHP
FT                   EIDLHSGADKEFLIIGKHYYNQNNLPKDLDQQIQTLTTQSHWQSSHTKERQGNQLILQR
FT                   RHIKTVPEYQPLQDRPQASVQRARVVGPEGESIYVDQWGRIKVRFLFTRANDHSHDGGA
FT                   GSNDNDTDSAWVDVLTPWAGAGYGARFLPRVGEIVVIDFFDGNIDRPFVVGRIHEAERH
FT                   PAQFDQKGQLPDTKKLSGIRSEEVDGKGFNQLRFDDTTGQISAQLQSSHAVSQLNLGNL
FT                   SHPKDKAESDGRGEGFELRTDQWGAVRAGKGLLVSTHKQDQAQGTHLDAADAKQQIEGG
FT                   LNNAKALSEVAKNQQTDPLEMLENLKTFIEQIEEKDQDKAATFKQALMVLTAPNSIAVA
FT                   SNEDIHLSADGQLSQNAGDSISLSTQKNLIAHAQNKISLFAAQQGARLYAGKGKVEIQA
FT                   QGDGADLIARKGIQIISTEDKIEINASKEIVITSGGSQIKINSSGIFPVTGGKFEVKAG
FT                   QHVFMGGAKADYVLPSLPTQEIKTDDLLLEYLHSDGTPVKGADYEVLLSDGSIRKGKLD
FT                   ASGKAIVSGVPAGRAKIQYGEDQSKDEFPALEVDDWFTQLGSSTKTGKEE"
FT   gene            596452..598041
FT                   /locus_tag="A1S_0551"
FT   CDS_pept        596452..598041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11004"
FT                   /protein_id="ABO11004.2"
FT                   /translation="MPDPQNQQFWSKIAERPTEIQQQFWYGAEKLAKYLNDNPAMYKGY
FT                   MTYDTSKPDPNLSWWEKILFYSGQAHYNEAVTHYNTSKVIADQGSWLWGMLKGDFNKDP
FT                   SMSQIIVGGLISLIPVADQVCDIRDLIANFITLSDEKARTKDNYMALALTSVGIIPEVG
FT                   SAIKTIVKSSRAKDVSKVKLFKFMEYFEEALTKLKIKCPWGKAPEAWLRSRPWKGIATQ
FT                   AFNTLKNNIDRILSVINKCLIRFNGALKVALAKFQATLNHVLNTIKKYIDQLCDEVDKA
FT                   IGRLLPQQPLAMAHAGGGGKNAPTGRYEANVSSGKKTEASHRQKKETPPPPRKMKPKHV
FT                   VEPCLEPKKGLRNSWGKKTGKSQAELDAEFDRQLKRQEEGLNRLTVEEYQQNRQLYEKY
FT                   KRAGTGTQQQRIREDMQRQLEESEYKKLKTEQPQLSKGQIERMAENNAKKTLEGLDVLH
FT                   NPDMQLGGFDVKYDPKKPPTLDDFGHSGVNRSIGSQMAAKKRLANMDAAAAQAKAKGMG
FT                   KDAMDVELKRCK"
FT   gene            598056..598916
FT                   /locus_tag="A1S_0552"
FT   CDS_pept        598056..598916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11005"
FT                   /protein_id="ABO11005.2"
FT                   /translation="MNQEDIDYFYEKYGQPIDKVEVTEDIIKKYRGKLPESILEQWHLF
FT                   GFAGYLNGLYWITNPDDYAEVIYDWLEETPLPDDDVYHVLARSAFGELLIWGERNYGRY
FT                   YIKTMEGILHDNGEQLESAEFYGSDFFFLPKKNYLDYTDKNGNKLFDRAVKKLGVLKAD
FT                   EMYAFEPALALGGEESLQHLTKVNLPVHMKLLKQVTPLRLRTFEDLTAALYGTSYSVDD
FT                   LTSGQDAESQYQESVQAGEVCPRTGYWTTPAQPNTRHYCKKGEVLPEIKEQDWGEVYWY
FT                   WDGEN"
FT   gene            599043..600110
FT                   /locus_tag="A1S_0553"
FT   CDS_pept        599043..600110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11006"
FT                   /protein_id="ABO11006.2"
FT                   /translation="MSITVNDQEIDWQKWLDLEITDENEFRDHHLLKQDYHENFDELVN
FT                   GLYSVTDGFSNYKNEKKFGGYIAAGHQRLRDTLDLMSLQYSAGGDIGFIKELYPYLLHW
FT                   TEEYAETSHLYNLSPDAGGRYVWHISLGTEDYWYIALRLICFGLLTGYADQMYQIMPII
FT                   DYVEATPEGQEKDGLVERLVAPFVTDRGTPPDEARRHLPYRKLIKVFNAAPEQRPALML
FT                   QYLESWYEASRREPYHDQHPQTDLRSGVSYYGYWSWEAAAVTWLLEIDDTLYRDHEFYP
FT                   KDLVDFARSQSNMVSDEEQSEHIKVKGGEVCIKTGYWITPARPDTRLYFTQGTTLPILS
FT                   ETDWGEVYWYWDGEN"
FT   gene            600280..601872
FT                   /locus_tag="A1S_0554"
FT   CDS_pept        600280..601872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0554"
FT                   /product="peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11007"
FT                   /protein_id="ABO11007.2"
FT                   /translation="MSFKDELAAQVAQRRTFAIISHPDAGKTTMTEKLLLWGKAIQVAG
FT                   MVKSRKSDRAATSDWMEMEKERGISITTSVMQFPYKGHTINLLDTPGHEDFSEDTYRTL
FT                   TAVDSALMVIDGAKGVEERTIKLMEVCRMRDTPIISFVNKMDREIREPLELLDEIENVL
FT                   NIRCVPITWPLGMGRDFAGVYNILEDKLYVYKAGFGSTITDIEVRDGYDHADIREKVGE
FT                   LAWASFEESLELVQMANEPLDRELFLQGKQTPVLFGTALGNFGVDHVLDAFMNWAPEPK
FT                   AHPTQERMVEAKEEGFSGFVFKIQANMDPKHRDRIAFMRICSGKYEKGLKMNHVRIGKE
FT                   VRISDALTFLAGEREHLEEAWPGDIIGLHNHGTIQIGDTFTSGENLHFTGIPHFAPEMF
FT                   RRVRLKDPLKSKQLQKGLKELSEEGATQVFMPQISNDLIVGAVGVLQFDVVAYRLKEEY
FT                   KVDCVYEPVSVNTVRWIHCDDEKILNEFKKKAHDQLSIDGGGHLTYLAPSRVNLQIMQE
FT                   RWPDIEFRSTREH"
FT   gene            601975..602265
FT                   /locus_tag="A1S_3503"
FT                   /old_locus_tag="AS1_3503"
FT   CDS_pept        601975..602265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3503"
FT                   /old_locus_tag="AS1_3503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3503"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89928"
FT                   /protein_id="ABS89928.1"
FT                   /translation="MVAAIALILAICVFVWKKPQSSSSSQENSASTQDHPVEKAEVLPY
FT                   LNLTETKANYAVPFCEKKNCIDVDIQTIKTQDAWLNSWIRKKSGESYSSSN"
FT   gene            602309..602785
FT                   /locus_tag="A1S_0555"
FT   CDS_pept        602309..602785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11008"
FT                   /protein_id="ABO11008.1"
FT                   /translation="MKKSDEWQDKYSKNRAYELHIRTRIASQRNQYVLLQLALDSKQEE
FT                   ITIKDRYYFFVADRKLHKNLTLLDVLKKDQQPTVHQIVQTAYQDWLKKQTADVKKQAPK
FT                   TLYWGQADWFFDGEGVGLHYQANQITKDAPQLDIYLTTEQTKKILQPQVYEQMF"
FT   gene            602873..603814
FT                   /locus_tag="A1S_0556"
FT   CDS_pept        602873..603814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11009"
FT                   /protein_id="ABO11009.2"
FT                   /translation="MLTSKASLHLTLLASAIFLVACQPKSDPKESEDQQKPAVVEQKPV
FT                   ELTLKGETVPSKVTLPDCDGKTCPEFTVERLQSNFPFIDKIIDQQVLKALGQILEIAEP
FT                   DAKAAQADKKTEASAAATTEQQDSFDAQVQRYANSFIDLDNELKALSSNHQINLLVKPK
FT                   IIQSQGKVVTVVVNSSSYLGGAHGSAAQQYYNFDLKKEKQVKLEDLLRPEKKAALEKLA
FT                   HEAFKAWVTDSKLANSVSEYEQAWPFKLTENFLLGDQGLILQYGEYEIGPYVVGLPRLV
FT                   IPYDQLQEVLKEEYLPQPKAKPASTPAVKSAS"
FT   gene            603814..604644
FT                   /locus_tag="A1S_0557"
FT   CDS_pept        603814..604644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11010"
FT                   /protein_id="ABO11010.2"
FT                   /translation="MHLFDTHTHFDVADFDEDRHQLALEAKKVGVDALVLIGFLQSRFD
FT                   ELVQTHHQLKQWENVPASYLAPGLHPFYIEQHKPEHLSHLEQILQQEDCVAVGEIGLDT
FT                   FLKEHKQPDIYAKQKQYFADQLDLATQYQKPVLLHIRKAHGDVLALLKAHKFKLGGIAH
FT                   AFSGGVEEAKGLIKLGFKIGVTGQITNPNAKKLHTVVQTIGAEHLVIETDCPDMTPLCC
FT                   QTSTEQRTRNTPVNLPYVLKSLAVNLNMAESELADLLWKNSLSALKLIVIKIKD"
FT   gene            604752..607508
FT                   /locus_tag="A1S_0558"
FT   CDS_pept        604752..607508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0558"
FT                   /product="aconitate hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11011"
FT                   /protein_id="ABO11011.2"
FT                   /translation="MAKYSNINSFNALQTLTVGSSNYQIFSLTQAEKKLGDIAKLPKSL
FT                   KVLLENLLRFEDQHSVKTEHIYALAEWLKTRTSDQEIQYRPARVLMQDFTGVPAVVDLA
FT                   AMRAAMAEAGGDPEKINPLSPVDLVIDHSVMVDHFADDQAFEENVQIEMQRNGERYQFL
FT                   RWGQSAFNNFSVVPPGTGICHQVNLEYLAQAVWLGEDNGQTFAFPDTLVGTDSHTTMIN
FT                   GLGVLGWGVGGIEAEAAMLGQPISMLIPEVIGFKLTGKLQEGITATDLVLTITQMLRQK
FT                   GVVGKFVEFYGDGLADLPLADRATIANMAPEYGATCGFFPIDEVTLGYLKLTGRQSDRI
FT                   ALVEAYSKAQGLWRNPGDEPVFTDTLSLDMSTVQASLAGPKRPQDRVLLSEVPKTFNAL
FT                   MELTLKPAKEAKERLENEGGGGTAVEATKANIQHESPSCVIEGQEYPLNHGDVVISAIT
FT                   SCTNTSNPSVMLAAGLLAKKAIEKGLQRKPWVKSSLAPGSKVVTDYLLAAGLTPYLDEL
FT                   GYNLVGYGCTTCIGNSGPLPEPIEDAIQCHDLNVASVLSGNRNFEGRVHPLVKTNWLAS
FT                   PPLVVAYGLVGNIRTDLTTQPIGQGKDGQPVYLKDIWPSQAEIDAVLQKVNTDMFHKEY
FT                   AAVFDGDESWQAIQIPISKTYEWADDSTYIRHPPFFEGIGEPPKPIKNIEQARILAVLG
FT                   DSVTTDHISPAGNIKKDSPAGRYLQEQGVEPKDFNSYGSRRGNHEVMMRGTFANIRIKN
FT                   EMLGGEEGGNTIHVPSGEKLAIYDAAMRYQQEHTPLVIIAGKEYGTGSSRDWAAKGTNL
FT                   LGVKAVIAESFERIHRSNLVGMGVLPLQFVDGQTRQSLNLTGHEVISIRGLSDGIQPHE
FT                   ILEVDVKGPNGVASHFNVLCRIDTLNEVEYFKAGGILHYVLRNLIAS"
FT   gene            607843..608604
FT                   /locus_tag="A1S_0559"
FT   CDS_pept        607843..608604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0559"
FT                   /product="putative NAD(P)-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11012"
FT                   /protein_id="ABO11012.2"
FT                   /translation="MTDLQQDEYDRRFAGVAKIYGDSSFQHYEQSHVMVIGIGGVGSWA
FT                   VEALARTGIGEITLVDMDVVAASNVNRQLPAMTSTLGCEKVEIMAERCRQINPRIKVNI
FT                   IDDFLTPENVAELLNPVPDIVLDCIDDVKAKLALMLHCRFNKIPLIVSGGAGGKLDPLK
FT                   IRVADLSKTEQDPMLAKLRSQLRARGICKKPKEKFGITCIYSIDNPFSSADVCPSAGLR
FT                   CGGYGSAVVVTSSFAMIAVAEVLKKLDLKKA"
FT   gene            608887..609786
FT                   /locus_tag="A1S_0560"
FT   CDS_pept        608887..609786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0560"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11013"
FT                   /protein_id="ABO11013.2"
FT                   /translation="MVMLTLKQFQYFIKIVEEGSFIAASEKLFIAQSALSRQMKLLEEE
FT                   IDFLLFDRTDKRVKLTVAGEVFYKKIKDNLLYLNEIIDLSKSVSEGKNRQIKIAHSSSI
FT                   VVDNTKVQILKEVSLTQQLSFEINTLSSEQQVLALLNGEIDIGLIRPPVRHSLDGINTL
FT                   KLYEEPLMVAVHIDHAKFSKSEKVYLKDLKDECFVSTPHAERGGLSYLVANLCLAAGFT
FT                   PQKASIQSRKISQLQLVAANLGVGIVPAEFQQILPANVKLIPLEDSLSLSEVLLVYRKD
FT                   HDEIIQHCAELIHQMFLS"
FT   gene            complement(609794..610303)
FT                   /locus_tag="A1S_0561"
FT   CDS_pept        complement(609794..610303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11014"
FT                   /protein_id="ABO11014.2"
FT                   /translation="MIIYDGQVADNYMYQDSNQAAIVVSHSTPSLPYPFTMKPNNHSTE
FT                   TNTPPAIDVEKFVAKLESITSRRSKARCARSIRIALESAGADVENHPIAASDWGDTLKK
FT                   IGYKEINPAFDEPQEGDIYIIHRTRNHIYGHIAGYTGSEWVSDFKQSSYDVYKDDNVTY
FT                   TYYRLG"
FT   gene            complement(610638..611642)
FT                   /locus_tag="A1S_0562"
FT   CDS_pept        complement(610638..611642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0562"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11015"
FT                   /protein_id="ABO11015.2"
FT                   /translation="MQSLQSLQPRISVAPMMDWTTKDYRFFARLFNPNVVLYTEMVTTG
FT                   AILFGDAKRHLDYNAQEHPIVLQLGGSTPQELATCTKMAEDWGYDEVNLNVGCPSDRVQ
FT                   NNKIGACLMAEPDLVAECIHSMQKAVNIPVTVKHRIGIDDMQSYEEMLHFVDTVAATGC
FT                   THFVVHARIAILKGLSPKENREVPPLRYEDVYRLKQERPHLTIEINGGIKTFAETQAHL
FT                   QHVDGVMIGREAYHNPYLLAELGQLWNLEAPDRFDIMEQMLPYIEQRLAEGAPLSIITR
FT                   HILGLFQNLPGARKWRQALSGGNAKTLTDVENAIHNMQAAIIRTEEYLKEHQF"
FT   gene            complement(611791..612975)
FT                   /locus_tag="A1S_0563"
FT   CDS_pept        complement(611791..612975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0563"
FT                   /product="putative transport protein (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11016"
FT                   /protein_id="ABO11016.2"
FT                   /translation="MSTPEDISQNKPLLWLMAAACGLCAGVNYYCQPLIHSIQQDFAVT
FT                   QAQAALTVTFAQVSYALGLLFIVPMGDIVNKAKAIPFLMMLCAVGLFTSAFAVNLPMLW
FT                   IGTILAGLFSVAAQVLIPLATMTVKPEKTGEIIGFLMSGLLVGILLSTSLAGLFSNLFH
FT                   WKVVYAISGILMLLLAYTLKSRLPYVMRMKLNYGQIFVSMAQLLKEEKRLLLRALTGAF
FT                   AFASVSILYSTIALLLTSAHHLPDLFIGLVPLVGIFGALSTRYIGKYADQGYTRLLTWM
FT                   GCGLFLVSWICFYFGQILLSAYVIGFALIQLALALVHTSNQSIIFRLRPDAKSRINAIY
FT                   MTTYFIGGAAGSALGIFAWNRGGWTMTCLAGVGLVVFCILFSMIDAFLQKKQMA"
FT   gene            complement(612994..613401)
FT                   /locus_tag="A1S_0564"
FT   CDS_pept        complement(612994..613401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11017"
FT                   /protein_id="ABO11017.1"
FT                   /translation="MNKEIFKIINPSTLYDPIPNAYSHVAVVSNFNNIIHIAGQGGEDQ
FT                   QGQLSSHFSEQVLQAFENINYALVAANAELTDIAVLRILVVDHSVEKHEILIKIMKDLW
FT                   KNHPFPACTLIPVPRLALEHMLIEVEATAYT"
FT   gene            complement(613469..614395)
FT                   /locus_tag="A1S_0565"
FT   CDS_pept        complement(613469..614395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0565"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11018"
FT                   /protein_id="ABO11018.1"
FT                   /translation="MKISLSSFQIGSFFALCSAFLFSTKAIFIKQTYALSPLVDGTVLM
FT                   ALRMLSALPFFLLICWFNRHHNQGIKKKDWLILIFAGLLGYYFASWLDFMGLMFISASL
FT                   ERIILFLYPTLTVIASSLLYKQKLDVKSLFAIFLSYGGTVLVMLQEHNNAPIQGNFWLG
FT                   TSFVFASAVAFAGYLLLTPPLIKKFGSWNFTGLALTVACIGTLTHYTLSTSHPFQLLLQ
FT                   LPSSVIWYGIGLGFLVTVLPTVMLMQSIERLGASQSAMIASIGPVLTILLAVAFLNEHL
FT                   NIWQWVGCFLNIVGVMMITLRKKRLKH"
FT   gene            614633..615760
FT                   /locus_tag="A1S_0566"
FT   CDS_pept        614633..615760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0566"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part1)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11019"
FT                   /protein_id="ABO11019.2"
FT                   /translation="MQIGIPTETVVGENRVAATPETVKKLISAGHSVVIERGAGVKAAY
FT                   IDSAYEQVGATITDDAYTGSQIILKVRAPQGGEIQKLAANTTVVAMFDPYRNTELDQFA
FT                   NQQVSAFALELLPRTLSRAQNMDVLSSQANLAGYKSVLLAAAEYQRMFPMLMTAAGTVK
FT                   PARVVIMGVGVAGLQAIATAKRLGAIVEATDLRPTAKDQVESLGGKWLDVPMSEEEQQR
FT                   AADAAKNGYGWMPGEQYIKDQAAIVDKAVSNADIVITTALLPGRDAPRLIKAETVAKMK
FT                   PGSVILDMAVETGGNVEGSKVGETVVTENGVKILGIPNIPATVATEASALYARNVFNFV
FT                   ETLFDKDKNFAINQEDEIQKALLVTHGGQVLLKRG"
FT   gene            615772..616086
FT                   /locus_tag="A1S_0567"
FT   CDS_pept        615772..616086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0567"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump) alpha subunit (part2)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11020"
FT                   /protein_id="ABO11020.2"
FT                   /translation="MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGA
FT                   MLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK
FT                   "
FT   gene            616099..617553
FT                   /locus_tag="A1S_0568"
FT   CDS_pept        616099..617553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0568"
FT                   /product="pyridine nucleotide transhydrogenase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11021"
FT                   /protein_id="ABO11021.2"
FT                   /translation="MEFIQANANWLYLVGAILFILTLRGLSGPKTAIQGNRYGMIAMAI
FT                   AVVTTFFVANNPVIWMIGGAMVLGAIVGIARARTVPMTQMPETVALMHSLVGLAAVLIA
FT                   VAAILHNNQLTALFAQNEAALTAAGVQHAHMSKVHLFELFVGCFVGAITFTASVFAYGK
FT                   LAAKKWAKTIFGGWVKPVQALIFVAMLACGFYFFTTGNMTAFWAMTALALAFGWVWIAP
FT                   VGGGDMPVVVSLLNSFSGWAAAGIGFTLENNMLIVAGSLVGSSGAILSYIMCKAMNRSI
FT                   INVLFGGAMGGAAVSTAAKGEQVQRNYRSGSADDAGFLMSNADSVVIVPGYGMAQGRAQ
FT                   NAVKELCEILKEQGVRVRFAIHPVAGRMPGHMNVLLAEADVAYEDILEMDEINSDFPAT
FT                   DVVLVIGANDVVNPAAKDDPGSPIYGMPILEAHKARTIMVIKRSMATGYAGLDNDLFYN
FT                   EKTMMIFGDAKKVVEDMTKAINGTGH"
FT   gene            complement(617606..618427)
FT                   /locus_tag="A1S_0569"
FT   CDS_pept        complement(617606..618427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0569"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11022"
FT                   /protein_id="ABO11022.2"
FT                   /translation="MKILITGANTGIGFATAEQLVKQGQHVILACRNPQKAQEAQNKLR
FT                   SLDQGQVDVVSLDLNSLELTQKAAEEITDKYGSLDVLINNAGLFSKTKQLTVDGFEQQF
FT                   GVNYLGHFLLTQKLLPVLKQSPQARIIHLASIAHWVGSIKPNKFRAEGFYNPLFYYGQS
FT                   KLANLLFSNALAEQLTDSSITSNALHPGGVASDIYRDLPKPVYAAMKVGLVPTSVPAKL
FT                   ITEMATGDTWQNRNGEYVSAHMPDWKSSHAKNQQLARDLYQQSMTLVEKFL"
FT   gene            complement(618678..619079)
FT                   /locus_tag="A1S_0570"
FT   CDS_pept        complement(618678..619079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11023"
FT                   /protein_id="ABO11023.1"
FT                   /translation="MNLEPSPSVSNSHDFAMNTSNKDIQACLKVVHDALVDVKAKDILQ
FT                   LDVSSISNVADAIVIASGTSTRHVKALADNVAEEARKAGFRPIGVEGERDAEWILIDLG
FT                   FVVVHVMLPTARKFYDLESLWRTAPESVA"
FT   gene            complement(619161..619955)
FT                   /locus_tag="A1S_0571"
FT   CDS_pept        complement(619161..619955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0571"
FT                   /product="hydroxypyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11024"
FT                   /protein_id="ABO11024.2"
FT                   /translation="MGRLAVNLSMIFTEVPLIERFALAHAEGFEHVEIQFPYELAISDI
FT                   QDQLERYNLNLCLINVPAGDLMQGGNGLAGIPGQEAAFREALQLAIRYATALKVPRVNI
FT                   LAGKQPQDSDLLPCLKTLASNLKLACDLLTEHDIEPVFEMINGTDMPRFLVQNIAQAQE
FT                   MLEAVNHPALKMQYDCYHMAMMGEDVLEGLQENIHQIGHIQFADCPGRHEPDTAQIPYE
FT                   QIFSWIKQSAYEGYIAAEYKPKNGSNQSFTWKKKYFSDDVNI"
FT   gene            complement(619972..620838)
FT                   /locus_tag="A1S_0572"
FT   CDS_pept        complement(619972..620838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0572"
FT                   /product="putative 3-hydroxyisobutyrate dehydrogenase or
FT                   2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11025"
FT                   /protein_id="ABO11025.1"
FT                   /translation="MNFDRNTPIAFLGIGLMGSRMASRLIQAGFQVAVWNRTASACEEL
FT                   IDIGAHALDLSNIGHYPLILTCLADDKAVQAVFDQIQTNLKAGQVIVDFSSLSVAATKA
FT                   LAQAAASQDVIWIDSPVSGGTAGAEQGTLVIFAGGDAQTIEALSPVYNVLSQRVTRMGD
FT                   TGTGQATKICNQLIVAANSALIAEAVALADRAGVDTTLLAPALAGGFADSKPFQILAPR
FT                   MATHTFEPVQWKVQTLSKDLNNAVTLANNVNLDIPVAQKALLQLQTHQKNGFAEKDLAT
FT                   MIQVVEQ"
FT   gene            complement(620849..621637)
FT                   /locus_tag="A1S_0573"
FT   CDS_pept        complement(620849..621637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0573"
FT                   /product="putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11026"
FT                   /protein_id="ABO11026.2"
FT                   /translation="MALLRIEKNNGIATVYLNRPDKRNAMSFALLKELVTTAKAIQKDR
FT                   DIRCVILTGEAQVFSAGIDLSDLNNPKNSAFAIWELVKPGQSLFQKAFLIWQNLPVPVI
FT                   AALEGYCFGAGMQLALAADIRIAHPDTKMSIMESRWGLVPDMGLTRSLKGLIGVDLAKE
FT                   LTLTARVFDGNYAKDIGLVTHLSENPLEKANAIASEMLQRSPDALTAAKRVLDAMEHQP
FT                   EKSLRLEKIWQLKLLLGKNSKLARKKDKHPEVKFLPRQYR"
FT   gene            complement(621734..624541)
FT                   /locus_tag="A1S_0574"
FT   CDS_pept        complement(621734..624541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0574"
FT                   /product="GacS-like sensor kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11027"
FT                   /protein_id="ABO11027.2"
FT                   /translation="MSNFNKTLSKRLRLNHAYGQLIALIFVPIMILTCVGAFLVLTETS
FT                   RSAKQQQLHHASAILARYNQIAKDLYTLVELQPDEYDHAQHIMQSMFSEKNLKRAALID
FT                   SNGQTYLSIGYRDNRYWPNFTQNNNFFGPISYNHNNIYGVRIIDTAGKPPVWLLIEMDN
FT                   QPLELARYRILIALVITGLMTLLLLLLCLNFYSRRWIAPMYEIRMQLQRLNADTLDQHI
FT                   VINSSGELRLLQRDIANVVKRLHFSFLELKEHTEQTEEDLRRTLDTLEVQNITYRQARD
FT                   QAISSNQAKSVFLANISHELRTPLNSIDGFIHLLLRQQNLSNEQNLYLQTIRKSSAHLL
FT                   ALINDVLDFSKIDAGKLELETAPFDLEEAVFDVMDMLSPLAAQKHIAMAFYYADNIPQQ
FT                   VIGDALRFKQILTNLISNAIKFTPDGEIIVRVRMEHDDIGQCLLHFSVQDSGIGLSGTD
FT                   RKKLFESFSQGDASVTRQFGGTGLGLAISKQLVHLMHGQIGFEDNQERAPTEKGSTFWF
FT                   TAQFAVDEEHEIEHPHFEHLQVVSYLAHPATASVLRYYLENYQVPHIETQSILDLFSRL
FT                   KHLDQKDNTWLIVDHSGDTEALLKEIRSRYQGNLAVYGYQMTLEPNMLTEYRARPLYQP
FT                   LSRSGLIQLLSDQPIFEEEQQDFNGQGLHILAVDDHLPNLIVLEALLGELNVKTTKALS
FT                   GQEALNIIQERIDQKLKPFDLVFMDIQMPVMSGIDTTRAIRSLESTLDGEMQLPIIALT
FT                   AHALADEKQKLLKVGMNDYVTKPIQMEQIIQILTQWTKNNFTAQNLAKDPHVVAEALDP
FT                   EILNWQQSLQLAANKEDLAQDLLKMLVDSFPTELEEMQQLIELEDFPQLEHVLHRLYGA
FT                   TRYVGTPKLQQVTGDFEQFISTLRKERRRADDGFIEEVMRRFDELGLVIKEVESAAHQI
FT                   LVIPD"
FT   gene            624714..625628
FT                   /locus_tag="A1S_0575"
FT   CDS_pept        624714..625628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0575"
FT                   /product="cysteine synthase B"
FT                   /note="O-acetylserine sulfhydrolase B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11028"
FT                   /protein_id="ABO11028.2"
FT                   /translation="MSNTQPDFLADEFLLDHYVGKTPLVRLQRLACHTQATVLAKLEGN
FT                   NPAGSVKDRPAYNMIMQAEKRGQIKPGDTLVEATSGNTGIALAMVAAMRGYKMKLIMPG
FT                   NSSQERKDAMRAYGAELIEAPNMEAARDMALQMQAEGLGLVLNQFGNPDNVEAHYLTTG
FT                   PEIWKQTGGKITHFVSSMGTTGTIMGVSKYLKEQNPDIQIIGLQPSEGSNIAGIRRWPQ
FT                   EYLPTIFEPKRVDQIMDIPQIEAEKTARRLAREEGISAGTSSGGAVWASVKIAEENPDA
FT                   VIVCIICDRGDRYLSTGLFSVQD"
FT   gene            625651..626469
FT                   /locus_tag="A1S_0576"
FT   CDS_pept        625651..626469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11029"
FT                   /protein_id="ABO11029.2"
FT                   /translation="MRFPTLVFDIETLTDLKAGAHLYHLDLPETDVEQALTKIRRQESG
FT                   MDFQRLPLHEIVCISGLWIDESGFRLFSFSREHYSEAEILQKFLSIFDKRHPTLVSWNG
FT                   SQFDLPVILFRAMYHGLSAPGLFDQGELDSQKRFNNYQNRYHHRHIDLMDVMAMFNGRN
FT                   FQKLDDVACILGLPGKRGESGYHVPEYVRTEQWLKLTSYCEGDVLNTWFIYLRWLLLKG
FT                   QMNVDEHNHWISSSIEYLQTMPQQADFLEVWQRTSKHTEFTSHYFNPLNF"
FT   gene            626698..627866
FT                   /locus_tag="A1S_0577"
FT                   /note="contains frameshift; similar to 23S rRNA
FT                   methyltransferase"
FT   gene            627900..630206
FT                   /locus_tag="A1S_0579"
FT   CDS_pept        627900..630206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0579"
FT                   /product="GTP pyrophosphokinase"
FT                   /note="ATP:GTP 3'-pyrophosphotransferase; ppGpp synthetase
FT                   I; pppGpp synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11030"
FT                   /protein_id="ABO11030.2"
FT                   /translation="MVTVREQLPEQLTELSEETTVEHAAETQVGLASWLDRVREILDGA
FT                   ELKQLEEVAHLTLQKELDSTVNHRSNTFATGVGMADILAHLHVDEDTLSAAMLYRSVRE
FT                   DITDIEEVKRKFGEQVYNLVKGTLAMGKLSELIEKNKRLEDHFNNNQREHLSGIYKMLI
FT                   SVTEDVRVVLIKLAERTYSLRELANSSRERQERVAREILTIYSPLAHRLGIAQLKWELE
FT                   DLAFRYLAPDRYKEIASLLNEKRLEREHYIQFVIDRLKSELAAHGIEAEITGRAKHIYS
FT                   IYRKMKSKNLSFDQLYDIRALRVLVNSVPECYHSLGIVHQIWRHIPHQFDDYITNPKAN
FT                   GYRSLHTAVIAENKSLEVQIRTHEMHDEAELGVCSHFNYKEGSKNTDHSFNHRLHSLRA
FT                   VLEHYQERNETTVHQNEDETEGFDQLQDFEGFEKIYVFSRDGDIKELPRGSTVLDFAYH
FT                   VHTEVGNKCYAARVNQRYVPLTYTLKTGEQVEILTKKDREPNRDWLVNSLGYIKTARAR
FT                   DKLRHWFRQQDRSKNLEVGRELLNKELSRLAIHPKSIDLNDYSSHFNVKTGDDILVSLV
FT                   SGDISLHALINQINRQMHLDQDEPELVLKPTLNPRASHTLSAHGILIDGLDNVELHIAQ
FT                   CCQPVHGESIAGYITLNRGVSIHKVLCSDYQRMIKQEPERAVEADWEMQPTRGQSVQIV
FT                   VEAYDRRGLLKDLTQVIFSDQINIRQVNTISEADGIANMKLLIEVKGLAQLSRLLARLE
FT                   QQPGIISARRMIQGV"
FT   gene            complement(630251..631024)
FT                   /locus_tag="A1S_0580"
FT   CDS_pept        complement(630251..631024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0580"
FT                   /product="putative short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11031"
FT                   /protein_id="ABO11031.2"
FT                   /translation="MKHSILISGAAQGIGAEIARVFYQRGYKVGIYDINESLAQNLAQE
FT                   LGPNACAGYLDVSDYSQWQHILKEFTDWAGELNILVNNAGILYSGAFENIDIKSHQRTI
FT                   NINVNGVINGCHAAFPYLKQASFARVINLSSASAIYGQADLISYSASKFAVRGITEGLD
FT                   VEWKKYGIRVLDVMPLFVQTAMVNNMDAGSIQNMGIDLTPNDIAQQVLSLVEKKAHFWT
FT                   PTHTPVGIKTKLLYQLSTISPQFLNRLTNIYLSRK"
FT   gene            631136..631942
FT                   /locus_tag="A1S_0581"
FT   CDS_pept        631136..631942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0581"
FT                   /product="hypothetical protein (MazG family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11032"
FT                   /protein_id="ABO11032.2"
FT                   /translation="MDKLLKIMQELREKCPWDQEQTPMSLTKYAIEEAYEVEAAIRQGD
FT                   INEIRNELGDLLLQVVFQSQMFSEQGAFNFQDVVEAISEKLVRRHPHVFQADQFNNLTP
FT                   EQVSELWKQIKQQEKQGKPQSRLDEIKHGPALSQAQEIQKNVAKVGFDFETVEDAYTKL
FT                   EEELDEFKQALKNQNSDEIQDEFGDCLFSLVNVGRKLGISSESSLLSTIHKFRSRFAFI
FT                   EEQAIKQQRTLEDMTLSEMDELWNQAKRQLKSGEKPHAIQHEILEK"
FT   gene            631923..632321
FT                   /locus_tag="A1S_0582"
FT   CDS_pept        631923..632321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0582"
FT                   /product="putative DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11033"
FT                   /protein_id="ABO11033.2"
FT                   /translation="MRFWKNKYFVLIMLCLGGISPSVYAQSFDKNFQEWKAKQQMYDQK
FT                   LNISKFSHSNGSKISQTKNFNDSTGQIHLNQANVNEFQQLKGIGEKKAQAIVEYRQKNG
FT                   SFKNIDEIKNVKGIGPAIFEKNKSRLAL"
FT   gene            632446..633909
FT                   /locus_tag="A1S_0583"
FT   CDS_pept        632446..633909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0583"
FT                   /product="poly(A) polymerase I (PAP)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11034"
FT                   /protein_id="ABO11034.2"
FT                   /translation="MQTLRASKCGLSTAQLPSSILDVIDSLTKAGYEAYIVGGGVRDLM
FT                   LGLNPKDFDAVTNATPSQIKEVFGRRCRIIGRRFELAHVYSGRELIEVATFRAPPKKAV
FT                   TSASGMILRDNNWGTIEQDFARRDFSINTLYYQPRKGIVLDFCKAIDDVKSKTLRLLGD
FT                   PVQRFEEDPVRMLRTLRFAAKLNFKIDPAILDIFDVEMTQLLRDVSPHRLYDESQKLFT
FT                   MGHLARVLPMLIDFGVWKQLFADIRPDLTPFIQRAAKNTDQRIQVGKTINPAFFYAVLL
FT                   WQPFLERCDFYLSKGVVPAEARAQAGLDVLKRQATRTVIPRFAETFIREVWEMQTRLLN
FT                   PKPQQIEALASHARFRAGFDFLLLREKSGDDTTQGMGSWWEAYQEMSNDEKEAAISQYN
FT                   RQKAKSRRKVAAEPVESNKVDTEIEPLVDVPEPRSRRGKKERARQEQSIDRFIEKSSAA
FT                   QTNVMSDHPILKRKRVQRDLSQVIFGPTQ"
FT   gene            633906..634388
FT                   /locus_tag="A1S_0584"
FT   CDS_pept        633906..634388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0584"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /note="78-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
FT                   HPPK; 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase;
FT                   PPPK"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11035"
FT                   /protein_id="ABO11035.2"
FT                   /translation="MTVTTYIGLGSNLGDSRQILSEAITKLKSLGEVKVSKLYQSPPMG
FT                   PQDQPNYLNAVAQLKTELLPLDLLDQLQRFEQEAGRVRLRHWGERTLDLDLLIYGNEKI
FT                   QNERLTVPHVGILQRDFVVIPLLDLDAGLHINDQPLKNLELIQQPTLTVLADESWA"
FT   gene            634570..634968
FT                   /locus_tag="A1S_0585"
FT   CDS_pept        634570..634968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0585"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11036"
FT                   /protein_id="ABO11036.1"
FT                   /translation="MAIQGRDSTLPVTVEDMAYHTAAVRRGNQHALIMTDLPFMSYATL
FT                   NDALQNAKTVMQAGAQMIKIEGGAWLSETVQVLTRNGVPVCVHLGLTPQSVHVFGGYKL
FT                   QARTREAADQLIADCTAVVEAGAAVFIT"
FT   gene            635024..635242
FT                   /locus_tag="A1S_0586"
FT   CDS_pept        635024..635242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0586"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /note="Ketopantoate hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11037"
FT                   /protein_id="ABO11037.1"
FT                   /translation="MIGIGAGNATDGQVLVVQDMLGLTFGRVARFVRNFMKEQSGETAI
FT                   LDAFKAFHAAVQDQSFPAKEHTFQVEL"
FT   gene            635246..636094
FT                   /locus_tag="A1S_0587"
FT   CDS_pept        635246..636094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0587"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /note="Pantothenate synthetase; Pantoate activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11038"
FT                   /db_xref="GOA:A3M294"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M294"
FT                   /protein_id="ABO11038.2"
FT                   /translation="MKTETTIQGLAASLNPARAARKIIGFVPTMGNLHEGHLTLVREAK
FT                   KLCDVVVVSIFVNPTQFGPGEDFDNYPRTLEQDSRLLADVGCDIIFAPSVEQMYGTQPR
FT                   LTNISVSQITDDLCGSSRPGHFDGVALVVTKLFNIVQPNYAFFGQKDYQQLAVIRQFVQ
FT                   DLNIPLEVIGVPIVRAEDGLALSSRNGYLTPEQRQVAPVIYQGLKQAEEQLHQGKDLQQ
FT                   VLADLKTLLTDNGFVVDYVEARQPNLLAASQFDRDIVLFVAAKLGGTRLIDNLQVAFTP
FT                   Q"
FT   gene            636117..636968
FT                   /locus_tag="A1S_0588"
FT   CDS_pept        636117..636968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11039"
FT                   /db_xref="GOA:A3M295"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M295"
FT                   /protein_id="ABO11039.2"
FT                   /translation="MKRILIVTGQSGSGKSSALQVLEDLGYYCIDNLPLALLPEIVAKL
FT                   DHENNLEQLALGVDVRSTRADMQEFDHVFEQLQKHGTVDVIYLTTQDQDLIARFSASRR
FT                   PHPLANRFKSLLQCIHEEKQLLIPIQFRATVHIDTTDKSVHDLKHILLSKLGQSDNLIV
FT                   ILQSFGYKHGIPLDADYVFDVRHLPNPHWDLELRRFSGLDEPVKQFLEASPQANEMFED
FT                   ILHFLKKWLPAFAEGHRHYMTISIGCTGGQHRSVYMVDRLKQALEAEWSVQVLHREMKH
FT                   WS"
FT   gene            636965..637234
FT                   /locus_tag="A1S_0589"
FT   CDS_pept        636965..637234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0589"
FT                   /product="phosphocarrier protein (HPr-like)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11040"
FT                   /protein_id="ABO11040.1"
FT                   /translation="MIDTTVDVINKLGLHARASGKLIEVTTKFRSSIQIGKGDHLVDAK
FT                   NIMSLLMLGAGKGTTLRLVIDGTDEEQALNEVQALFAAKFYEAD"
FT   gene            637237..637773
FT                   /locus_tag="A1S_0590"
FT   CDS_pept        637237..637773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11041"
FT                   /protein_id="ABO11041.2"
FT                   /translation="MARRPKRYTEEDFDSLEGRASKTEQKKAVQRMAALGEQLAQLSIK
FT                   QIQKLPVDERLIDALLEVQNISSFEARRRQFQRVGKLLRNEDETVILSYLTPQQGAKKQ
FT                   AQLMRWVDRMIEQGDPAINEFSKIYNASERHTLRQHVLRINRDKTQQVAEADLEATKMK
FT                   FINYVQQVALLSDQG"
FT   gene            complement(637833..639461)
FT                   /locus_tag="A1S_0591"
FT   CDS_pept        complement(637833..639461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0591"
FT                   /product="putative AMP-dependent synthetase/ligase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11042"
FT                   /protein_id="ABO11042.2"
FT                   /translation="MVSAYNELPRTPANFVALSPLRYLERAAYIYPDQASIIHGNRQIS
FT                   WKQTYQRCRQFASQLQQLGITKNDTVSVLLPNVPAMIEAHFAVPMAGAVLNTLNTRLDA
FT                   KTIAFMLEHAETKVLLVDPEFVNLAREALSLIPNQHIIVIDVADEEYEGENQFLGSFEY
FT                   EEWIAQGDANFEWHLPQDEWDAISLNYTSGTTGNPKGVVYHHRGAYLNAASNILACGMK
FT                   PRAVYLWTLPLFHCNGWCFAWSIAASGGTNICLRKVDPELVMQLIAKHKVDYFCGAPIV
FT                   LSMIINLPKEKQPIIEHHVEVMVAGAAPPVAVIEGMRNIGINVNHVYGLTETYGPSALC
FT                   ASQAGWSDLSITEQAQLHSRQGVPYPLQDSMRVLDPETMQPVPNDGETMGEIMFRGNIV
FT                   MKGYLKNPKATEEAFAGGWFHTGDLAVCHPDGYAKITDRSKDIIISGGENISSLEVEDV
FT                   LYKHPAVLTAAVVAKPDERWQEVPCAFIELKTGASVTPEEIIEHCQKELARFKVPKDVV
FT                   ITEIPKTSTGKLQKFILREWAKERA"
FT   gene            639873..641795
FT                   /locus_tag="A1S_0592"
FT   CDS_pept        639873..641795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0592"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11043"
FT                   /db_xref="GOA:A3M299"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M299"
FT                   /protein_id="ABO11043.2"
FT                   /translation="MPIITLPNGDQKSFDHPVSVMEVAQSIGPGLAKNTVAGRVNDRLV
FT                   DACDLITEDSTLQIITPKDEEGLEIIRHSCAHLVGHAVKQLFPEAKMVIGPVIEEGFYY
FT                   DIWMPRPFTLDDMAAIEERMKKLIDQDYDVIKKMTPRDEVIKVFTDRGEEYKLRLVEDM
FT                   PEEKAMGLYYHQEYVDMCRGPHVPNTKFLKSFKLTKISGAYWRGDAKNEQLQRIYGTAW
FT                   ADKKQLAAYIKRIEEAEKRDHRKIGKALDLFHMQEEAPGMVFWHANGWTIYQVLEQYMR
FT                   KVQQDNGYQEIKTPQIVDFTLWEKSGHAANYAENMFTTHSESRNYAVKPMNCPCHVQVF
FT                   NQGLKSYRDLPIRLAEFGSCHRNEPSGSLHGIMRVRGFTQDDAHIFCTKEQIGKEVADF
FT                   IKLTLDVYKDFGFEEVQMKLSTRPEKRVGDDALWDLAEKSLADALDAAGLEWELQPGEG
FT                   AFYGPKIEFSLKDCLGRVWQCGTIQCDFNLPVRLDASYVTEENERDQPVMLHRAILGSF
FT                   ERFIGILIEHYAGFMPPWLSPVQACVMNITDSQAEASEQVVAKLKENGLRAISDLRNEK
FT                   IGFKIRERTLERIPYLLVLGDREVEEGTVNVRTRSGKNLGTMSVDAFIDLVKSAVAERG
FT                   RYIVE"
FT   gene            642014..642352
FT                   /locus_tag="A1S_0593"
FT   CDS_pept        642014..642352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0593"
FT                   /product="protein chain initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11044"
FT                   /protein_id="ABO11044.2"
FT                   /translation="MDYNKHLFDLKQKQKDAKKKQHQVQVKEIKLRPATDVGDYQVKLR
FT                   AILKFLEEGNKVKITLRFRGREMAHQQLGLAQLQKIEADVAELGVVEQAPKMEGRQMGM
FT                   LLGPKKKK"
FT   gene            642558..643178
FT                   /locus_tag="A1S_0594"
FT   CDS_pept        642558..643178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0594"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11045"
FT                   /protein_id="ABO11045.2"
FT                   /translation="MIDLYYWGTPNGHKITIALEEMGLDYTLYPINILENDQFQPDFLK
FT                   ISPNNKIPAIVDQDGPRGEPISVFESGAILQYLGRKTGLFYPIDEQERVEVEQWLMWQM
FT                   GGLGPMLGQNHHFNRFAPEKIPYAIDRYVNETKRLYGVLNKQLIGQKFVAGEYSIADMA
FT                   ILPWILRYEWQGIQLEDYPYVQEYIVRLTARPAVQKALSIKVI"
FT   gene            643231..643659
FT                   /locus_tag="A1S_0595"
FT   CDS_pept        643231..643659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0595"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11046"
FT                   /protein_id="ABO11046.2"
FT                   /translation="MLSYFLLFLSAFGAATLLPLQSEAVLAALLLKNQHSAFLLILIAT
FT                   FGNVLGSCINWWLGLKIEQFKHKKWFPVSEKRLEQAQRFYHKYGFYSLLLSWTPVIGDP
FT                   ITLVAGLFKENFWRFLFMVLIAKAGRYIFIYWVITGFI"
FT   gene            complement(643699..644949)
FT                   /locus_tag="A1S_0596"
FT   CDS_pept        complement(643699..644949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0596"
FT                   /product="putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11047"
FT                   /protein_id="ABO11047.2"
FT                   /translation="MQKHDAFAALRYRDFSIVTINQFCLTLAILIQEIIVAYSLYQITK
FT                   DPLTLGLIGLAEAIPFIALSLWGGYFADKFNKQVIMKICLFFSVPLPLVLWLLFHLHGL
FT                   GHISVNFLSWGIYAVIFGLGTIRGFYNPSATSLKPFLIPRELYANGATWTTIGWQSGVI
FT                   IGPMLGGFMLAYLGRETSLFSVAGLLSICFILINLLHKRSFPKIETANVIESLGDGFRF
FT                   IWKTKIVLWAISLDLASVLFGGVIALLPIFAEDILKVGPEGLGYLRAAPSIGALITMIA
FT                   LTRFPPTQHAWRNMLLAVAGFGVFTILFAFSNNMWLSLFALAMTGACDSISVVVRQTIL
FT                   QIFPPENMRGRVAAVNGMFVSSSNELGAFESGLAAKYLGTIAATIFGGCMTLAVVTFCW
FT                   LKTNDLFKVDITKSSED"
FT   gene            complement(645116..645289)
FT                   /locus_tag="A1S_3504"
FT                   /old_locus_tag="AS1_3504"
FT   CDS_pept        complement(645116..645289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3504"
FT                   /old_locus_tag="AS1_3504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3504"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89929"
FT                   /protein_id="ABS89929.1"
FT                   /translation="MWRLNACLRLKPFAVALKRLAAPRRVFNLAIVTSFGHLFGTIAPL
FT                   QNRPAGKEARIL"
FT   gene            645404..645763
FT                   /locus_tag="A1S_0597"
FT   CDS_pept        645404..645763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0597"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11048"
FT                   /db_xref="GOA:A3M2A4"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2A4"
FT                   /protein_id="ABO11048.1"
FT                   /translation="MARVKRGVVAHRRHKKILARAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQKKRQFRALWIARINAGARQNGLSYSRMIDGLKKAQVIIDRRVLADIAMHDAV
FT                   AFAALAEKAKGALAA"
FT   gene            645851..646042
FT                   /locus_tag="A1S_3505"
FT                   /old_locus_tag="AS1_3505"
FT   CDS_pept        645851..646042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3505"
FT                   /old_locus_tag="AS1_3505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3505"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89930"
FT                   /protein_id="ABS89930.1"
FT                   /translation="MMIDEKFLNDLIQKIQQGHQFKYLYFWGHTPKKANLIDKSCFSQW
FT                   FPAQFNVEDIEYFTLSTI"
FT   gene            646090..646407
FT                   /locus_tag="A1S_0598"
FT   CDS_pept        646090..646407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11049"
FT                   /protein_id="ABO11049.1"
FT                   /translation="MQVKHPNEAKQLGRKVRNYDEQIWREKRFDIVVQANFAKFSQHPE
FT                   LKKFLLATKDRILVEASPVDKIWGVGMAQDHPHIQDPSLWQGLNLLGFALIHVRELLLT
FT                   E"
FT   gene            646466..646969
FT                   /locus_tag="A1S_0599"
FT   CDS_pept        646466..646969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11050"
FT                   /protein_id="ABO11050.2"
FT                   /translation="MKPLNDTDIRIASFKDALSIAEVHVQSWKETYTGMIKQEILNKLN
FT                   VLDKQQLWKEISRSPDHRLFIYTENGVVKGFLDGYLNPENNIAEIRAFYLLGEIQRKGV
FT                   GRALFQKFYQCALNQGYAFIRLEVFNKNPSRFFYEKMGAKLTGEAELPEFGLGIIELFY
FT                   EWQL"
FT   gene            complement(646976..647545)
FT                   /locus_tag="A1S_0600"
FT   CDS_pept        complement(646976..647545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11051"
FT                   /protein_id="ABO11051.1"
FT                   /translation="MNEKLSKKVEADLKAPQWDEIANFMETELFRSKYAAGFEEPEFQK
FT                   KYFDGSTHQISVEHQPTLALIPESYPADCAHQLLYRTQALSDYLEQKKRTANDPLGEDL
FT                   DQEQIINLRNFTHKTDDLFAKLIVKAANHYQTAQLKPVEKPSPFDATNESAAHLKVPHH
FT                   KAGGTGVIKLIVLTIIICALAYYFGL"
FT   gene            648134..649114
FT                   /locus_tag="A1S_0601"
FT   CDS_pept        648134..649114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0601"
FT                   /product="phenylalanyl-tRNA synthetase alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11052"
FT                   /protein_id="ABO11052.2"
FT                   /translation="MSLEALTTEALAAIAAAQDLVALDQVRVQFTGKKSQLAEQSKALG
FT                   KMDPEERKVQGAAIHAVRETINNALTERQTALQQAALAQKLASETIDITLPGRGQRVGT
FT                   VHPVTQVQERICQFFTKAGFTVATGPEVEDDYHNFEALNIPGHHPARAMHDTFYFDANH
FT                   LLRTHTSGVQIRTMETSQPPIRIVCPGRVYRCDSDQTHSPMFHQIEGLYVAENTSFAEL
FT                   KGLLINLLNEFFEKDLKVRFRPSYFPFTEPSAEVDIMDERGRWLEVLGCGMVHPNVLRA
FT                   AGIDPDKYKGFAFGLGVERFAMLRYGINDLRMFYQNDVRFLRQFA"
FT   gene            649148..651529
FT                   /locus_tag="A1S_0602"
FT   CDS_pept        649148..651529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0602"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11053"
FT                   /protein_id="ABO11053.2"
FT                   /translation="MKISENWLRTWVNPAIDSDTLSDQLTMLGLEVDELAPVAKPFTGV
FT                   VVGEVLTVEQHPDADRLRVTTVNIGSGEPLQIVCGAPNVRAGMKAPVATIGAILPGDFK
FT                   IKKGKLRGVESQGMLCGASEIDLEDKIDGLLELPADAPVGVNIREYLKLDDNVIDISIT
FT                   PNRGDCFSIRGIAREVAVINQLQMNEPEIKSVDATITDEKKVVINTDGAPRYLGRVIKN
FT                   VNVKAATPEWMEQALARSGIRTHSILVDITNYVLMELGQPMHAFDLAKIEGTVHVRQAK
FT                   PKEKLQLLNDQEVELQDDVMVIADDQKALAIAGIMGGLASSVTDDTTDIFLESAFFAPL
FT                   AIAGRARRFGLHTDSSQRYERGVDFELPLIAMNRASQLIQELAGGEFGPITVAEKSDLL
FT                   PKREAIELKQAQVDQLLGYKVAAEFITDALTRLGCEVTVQADGEWSVVPPSHRYDMAIY
FT                   QDLIEEVARIDGYDNIQISLPSMDVQLAKYQDRFEIAQLRQTVVTLGYQEAISFSFADA
FT                   KLEKQLNPQVSPLMLANPISSDLAAMRSTLLSSLIPCVQYNLNRQQSRVRFFELGLRFD
FT                   YQNANSIQDLKQIPTLALVAVGSREPESWHAKPQPMDFFDFKGEVEEILAAGRVKVEYV
FT                   RSERPWLHPGQSAEILVDGQSIGYLGRLHPSLENELDLSTTWVAELDQAAVLQSYVSNF
FT                   TELSRFPSVRRDIALLISDNINVRDIQQLIEKTGGELLDSTWLFDVYTGQGVEEGKRSL
FT                   AFALLWQHPSRTLEDAEIKSGMDNIIQVLENTYQATLRAS"
FT   gene            651526..651822
FT                   /locus_tag="A1S_0603"
FT   CDS_pept        651526..651822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0603"
FT                   /product="integration host factor alpha subunit"
FT                   /note="DNA-binding protein; DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11054"
FT                   /db_xref="GOA:A3M2B0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2B0"
FT                   /protein_id="ABO11054.2"
FT                   /translation="MTALTKADMADHLSELTSLNRREAKQMVELFFDEISQALIAGEQV
FT                   KLSGFGNFELRDKRERPGRNPKTGEEIPISARRVVTFRAGQKFRQRVGNEQID"
FT   gene            complement(651993..652244)
FT                   /locus_tag="A1S_3506"
FT                   /old_locus_tag="AS1_3506"
FT   CDS_pept        complement(651993..652244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3506"
FT                   /old_locus_tag="AS1_3506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3506"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89931"
FT                   /protein_id="ABS89931.1"
FT                   /translation="MLFKKFAVAAAVAATLAFVGCSKKEEAPAAAAASEAVAAASEATA
FT                   AASEAAVAVDAAASETAAAASEATTAASEATAAASAAH"
FT   gene            complement(652662..653868)
FT                   /locus_tag="A1S_0604"
FT                   /note="contains frameshift; similar to transcription
FT                   termination factor"
FT   gene            complement(654250..654576)
FT                   /locus_tag="A1S_0606"
FT   CDS_pept        complement(654250..654576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11055"
FT                   /protein_id="ABO11055.1"
FT                   /translation="MSATIVNTTDDNFQADVLDAETPVLVDFWAGWCAPCKAIAPVLED
FT                   LSSEYAGKVKIVKVDVTSCEETAVKYNIRNIPALLLFKNGEVVAQQIGAVPRSKLVSFI
FT                   DENV"
FT   gene            654856..656376
FT                   /locus_tag="A1S_0607"
FT   CDS_pept        654856..656376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0607"
FT                   /product="exopolyphosphatase"
FT                   /note="ExopolyPase; Metaphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11056"
FT                   /protein_id="ABO11056.2"
FT                   /translation="MSDFLIDEELLAAIDMGSNSFHLAIARVDHGEVKKVASMSEKVQL
FT                   AAGLDENKNLTEAAQQRGLACLARFVGRLGSVQPNRLRIVATNALRQAKNGHEFIQKAA
FT                   EILPKPIEIIAGREEARLIYLGVSHTMANGGRRLVVDIGGGSTEFIIGEEFEPIYTESL
FT                   QMGCVAYTKAYFADGEITQKAFDKAVVAARKELSAIATTYKMEGWDTVVGSSGTIKACR
FT                   QIMVNMGLSDEQENITREGLHKLKDKLLKFKNISEIDFEGLREDRRAVLPAGLAILYAV
FT                   FEVLEIERLAYSDGALREGVMYDLLGRFKHEDIRDRSVQALMGRYNADPKQAERVVNTA
FT                   QYLFDSVAKSLNLTSEDSDLLRRAAYLHEIGLAISHGGYHRHGAYLLQHSDIPGFSQID
FT                   QNHLSHLVAHHRRKLRNDVKNEVLKAGGHKLVYLSLLLRLAVLLNHSRSDQMLPAIELT
FT                   IINDQQWQLSVSGDAKQWPLLVADLHDEQEQFKHWDIELNIQSEKFID"
FT   gene            656395..657216
FT                   /locus_tag="A1S_0608"
FT   CDS_pept        656395..657216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0608"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase (alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11057"
FT                   /db_xref="GOA:A3M2B3"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2B3"
FT                   /protein_id="ABO11057.2"
FT                   /translation="MKKATQSKAWTTVQIARHPERPQFLDYVGEIFTEFDALHGDRLFG
FT                   DDGAMVGGLARFDGQPVMVIGQHRGRSTREKLKHNFGMCNPEGYRKSQRLLDMAERFNL
FT                   PVFTFIDTMGAYPGVGAEERGQAEAIATSLAQLSSLKVPVIATVLGEGGSGGALGIGVA
FT                   DRVIMLSHSIYSVISPEGCASILWKTAEKAAQASEALGLTADKLQSLGIVEYVVDEGEG
FT                   AHLDPERVMQNLKVVLKQALDELLPMDANERCEARYQRLMKFGSENLGMAS"
FT   gene            657273..658556
FT                   /locus_tag="A1S_0609"
FT   CDS_pept        657273..658556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0609"
FT                   /product="cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11058"
FT                   /protein_id="ABO11058.1"
FT                   /translation="MDSMLLLHLMAQIFPQKIRAIYIDHQLQDQSAEWAEVVATQATIL
FT                   NIPYIIQKVQIANGNLEAQARQARYQAYQQHLQENEILLLAHHQQDQAETVILRLLSGA
FT                   GVDGLAAMQAIDYRKDMTIWRPFLDLTREQIALWTAQLEVKYIDDPMNYDTHYDRVWCR
FT                   EALWPFLTSRFPKMQQALSRTSYLMQDASEILEEVLKDDWQYSGSADYLDLTKLYELSF
FT                   ARQRQLLSAWMKGQGQYRPAFEMVERLRTEVIESKSDAQAALHWNQFYYVRYQNILYRL
FT                   SREVYLAETLNPVVAELEHSFKLEERWQGAAGLFHVECKKIGLSHSLLNKKLKIIRRQG
FT                   GEKIHLYGRVGQWPLKKAIQEAHILPWLRHTIQILVLDNVMLGVFTPKGFWLAQSPYCE
FT                   EGGWQPDLISHSCNLVNGEYSYGNSSEL"
FT   gene            658534..659364
FT                   /locus_tag="A1S_0610"
FT   CDS_pept        658534..659364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0610"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11059"
FT                   /protein_id="ABO11059.2"
FT                   /translation="MATAVNCNICFIGGGNMAQALIGGLISRGLPPTRITVSDPVEQIR
FT                   QLLQEKEVHVTQDNTAAIQNADVVVLAVKPQVLANVLRPLKGLLSDKLVISIIAGAEIK
FT                   TISNLIDSERIVRVMPNTPALVQTGAHGIYATDVVGASDRELTSQILAATGLTIWVNSE
FT                   AQIDAVTAVSGSGPAYFFYLMESMIRAGKNLGLDEKVATALTLQTALGAAQMAITSSNT
FT                   PSELRKNVTSPNGTTQAALEVFDRAQISQNIQSALAAAQKRSQELAQELSDSAK"
FT   gene            659386..659955
FT                   /locus_tag="A1S_0611"
FT   CDS_pept        659386..659955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0611"
FT                   /product="putative integral membrane resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11060"
FT                   /protein_id="ABO11060.2"
FT                   /translation="MGANSALIFGILINVAILLVFFRFLMQLAAVSPYNPVVLSTVKAT
FT                   KIVDIFGRIFPTVAKGRFNLAALVLLIILYLLKIFGVMYLSGSMPNSPVHLVILTFVTM
FT                   IQDLIRFCRYLIFATIILSWVVMFTQSRSPYIEVIQDLAEPLLAPFRRLLPNMGMIDLS
FT                   PILAFLALYIAEILMNEVAKVLLTGL"
FT   gene            complement(660015..662786)
FT                   /locus_tag="A1S_0612"
FT   CDS_pept        complement(660015..662786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0612"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11061"
FT                   /protein_id="ABO11061.2"
FT                   /translation="MPPFVLVDGSYFLFRAYHALPPLTTSTGLHTNAIRGAISAIQKLM
FT                   RRMQPTHMAVIFDTPEPTFRHKLSPIYKGDRPTMPEELSQQIPYLHALIKAQGIPLYSL
FT                   PGAEADDIIGTLAKRAVKEGHHVLISTGDKDMAQLVNDYVKLEDSFKDRVLDTDGVFEK
FT                   FGVWPNQIIDYLTLMGDASDGIMGVPGVGAKTAAKLLTEYGTLDNIIANVDQLKGKLSQ
FT                   NIKDNLDNIKLDHQLASIVCDLPLELDWHELKLTDPNVDALRNLYTELEFRNQLQSLDH
FT                   PNNPNSSSYKQQASQTIVQNEVKPAQTIETEDQASLTSQDDQLGTANYHTVLTQEAWDQ
FT                   LWQRMQNADHFAIDTETTSLDYRIAEMVGFSIAFDAKDAYYIPLAHNYENAPQQLNREQ
FT                   VLAQIKPVLENEAVKKIGHHLKYDAHIFANHGIELKGWYFDSMLASYVLNAAATRHGMD
FT                   DVARVYLSHLTTTFEQIAGKGAKQKTFNQIEIEVAAHYAAEDAHVTYRLYEVLSNKLKA
FT                   HPELENILYNIEMPVARILSGMEEDGIRLDHAFLDKLSVEFAKTMEDLENQAMEIAGET
FT                   FNIASPKQVGEILFDKLGIKGGKKTATGQYSTSESVLEKIEHPLTEIILEHRGLAKLKS
FT                   TYTDRLIEQSHNDTHRVHTSYHQALTATGRLSSSDPNLQNIPIRRQIGRQIRKAFIAPE
FT                   GRVLLAADYSQIELRLMAHFSQDDALVHAFQHGQDVHRRTAAEVLGIAIEDVTNDQRRQ
FT                   AKAVNFGLLYGMSEFGLIRQLGFTREESQNYIKQYFQRYPGIYEYMQRTRQVASEQGFV
FT                   ETILGRRLYTPDIDARNVMVRKAAERAAINAPLQGSAADIIKLAMIEVDKILPKDQAKL
FT                   LLQVHDELVFEVDSNIADELSKQIADVMQSVLEISVPLVVEVGQGKNWDDAH"
FT   gene            662940..665747
FT                   /locus_tag="A1S_0613"
FT   CDS_pept        662940..665747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0613"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11062"
FT                   /protein_id="ABO11062.2"
FT                   /translation="MYKKDKQGMIIVLIALTLFLAISIGFKFQSAVVALSIALTVILVQ
FT                   SLSSLHQRLTHLEQQFSHQTTPLYSIHMQRTVIYTAALVALIAYINHWMWIAGGALLVL
FT                   LLCLIQTISAFHTRLLFLETAKQTVNINESIHTEVITPVLEQVDPNNITEPALPETIAL
FT                   NQKEQTVRTQTIAWWQPAVDWMIHGNPILRVAVAVLMVGVVLLLRFASEHWQLSLGVKL
FT                   GFIAIAGGVLTAFGYALQKKNQLFAVALQGVGLAVVFLTLVFSHHFGVITSLTTASILF
FT                   TILLAITVFLSLKQQAIYLAILALGMAYAAPLVIPQYRPDVTFLFSYYLVINLAVAAVN
FT                   FIQPWKILNQIAFFATMFIGGSAIAFYAEPAKFDTLDWILWLHIALFIWLSVRYSQNIS
FT                   RVSEHEKQEGIRLPPLLDVGLIFSVPVLGFTLHAYLVHESTQALTIGAAVLAGTYAVLT
FT                   FWIKKTHPQLSVLAKSFFILAVAFFALIFPLAKGAHWTAIGWVAQGTALIVWGVTERYR
FT                   LSRYIGVILVLLSSLALFYQVWANEEFPTLSTSIYAIAQFISAFYLLQYNSKEQRYFSA
FT                   SMFSGIFLCLGMYAGAVAGVEIMAWHHHALSPYLIFAVALIAIFSAIVHYKLRVQWQSL
FT                   QLILISLLLLLVLGEAFMSQVFTLFKWVDSLQQTTFLVATIILGSLFIMAQPQSDESGY
FT                   LKVWAGLSWLALAIVGVTIFPQMPVVALAFVPVIYSLWAYKIHKTTLLHQIPVWCLSLI
FT                   WLLVVSVDVHSAEYLYFVPLINLTDFFSILVFAGLLFIIYQHAFDQDKSLEWTFKITTI
FT                   LVGLLVFSSVVVRGLHHYWATPLWSASIWTNGVVQLSLTLLWVILAFILTTYSSRKMIR
FT                   QLWFVGAALLGIVVLKLILLDLSQSATLTRVISFIGAGGVMLIIAYLAPLPPSSSVQKN
FT                   QEPKL"
FT   gene            complement(665737..666654)
FT                   /locus_tag="A1S_0614"
FT   CDS_pept        complement(665737..666654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0614"
FT                   /product="putative small conductance mechanosensitive ion
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11063"
FT                   /protein_id="ABO11063.2"
FT                   /translation="MADSSIPKDIADSLKSIFTNINTERISEILVGVVLCFIGFVLARI
FT                   ISNTFIRTVGSRFNAHQRLVWRRGIFYFIFLLFIMTSLKEAGFKLSVFLGAAGILTVAL
FT                   GFASQTSASNLISGLFLIGEGSFEVGDTIQITLIRGNTIEGEVISIDLLSVKLLTLDNV
FT                   YIRLPNEQLIRAPVHNLSKYPIRRIPITLAINFHEDIIKVREVLLNVAANYPLVLDDPK
FT                   PAVTVTAFRESSIELLFAMWCRQENSLKVRDEMQERIRNGFLDNQIEIPVPKMGLIDRP
FT                   STAFAEDDIDQYSNQKELKREPKA"
FT   gene            complement(666664..667485)
FT                   /locus_tag="A1S_0615"
FT   CDS_pept        complement(666664..667485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11064"
FT                   /protein_id="ABO11064.2"
FT                   /translation="MFENNEYQPHPQNSLKWWGEQHFEINQSKAWQFGSMLFRLTRGIK
FT                   EWRIEYYRPTLQDDNEQDWHIITDANFGFPHSVQVERYMFRKTNPKFLLMPRLADRSVV
FT                   IKPVDPIYIPAGQRGTLYISTPLWIAGLVESQHEPLFEIPVIQPKDTWFGPNAQQGEIC
FT                   YATSVDGRTDLNLLTPRAFRAVTPIDFHNTSNHQLRFDRMNVPVTALPLFYSESTGRLW
FT                   TSQIKVYYEGSDRPARIRIENRTPPLAGEVTYVHPPRSPGGALFNMFDSFF"
FT   gene            667591..669072
FT                   /locus_tag="A1S_0616"
FT   CDS_pept        667591..669072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0616"
FT                   /product="secretion protein XcpR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11065"
FT                   /protein_id="ABO11065.2"
FT                   /translation="MKQIQVPYSFAKRHGVLFRYDGDQVFIVRRQNTEKIALQEARRIL
FT                   GKPAHYQLCTEQEFNSLLSTSYAGDTGESQQVAAGLEDHPDLLSLADQVPETEDLMDQE
FT                   DDAPIVRLINALLSEAIRVGASDIHIEAFEKKLSVRLRVDGQLREIVQPRRELAPLLVS
FT                   RIKVMAKLDIAEKRVPQDGRISLRLAGREVDVRVSTLPSSHGERVVMRLLDKQAGRLNM
FT                   THLGLMANDYERLTQLVHRPHGIILVTGPTGSGKTTTLYAALSDLNDNTRNILTAEDPI
FT                   EYQLEGIGQTQVNTKVDMTFARALKAMLRQDPDVVMVGEIRDLETAEIAVQASLTGHLV
FT                   LSTLHTNTAIGAVTRLKDMGIEPFLLSSSLIGVVAQRLVRTLCPHCMTWREADTFEKQV
FT                   FQHISHEPSLKLPEAQGCDQCSHLGFNGRTAIYEIVPIDEPMRRLIHGNAAEFELENHA
FT                   RQYSGSIRDDGLRKVLSGKTTLEEVLRVTNEASEA"
FT   gene            complement(669127..669558)
FT                   /locus_tag="A1S_0617"
FT   CDS_pept        complement(669127..669558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0617"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11066"
FT                   /protein_id="ABO11066.2"
FT                   /translation="MSLEKVVYRAKAKATGGRDGRATSSDGVLDVQLGVPKEMGGAGGA
FT                   VTNPEQLFAAGYSACFLGALKFVANRDKFNISKDAYVEGEVGIGPIPTGFSIEVTLNVY
FT                   LIGMDREEAEKLVAAAHIVCPYSNATRNNIDVTFNIVTE"
FT   gene            complement(669646..670083)
FT                   /locus_tag="A1S_0618"
FT   CDS_pept        complement(669646..670083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11067"
FT                   /protein_id="ABO11067.2"
FT                   /translation="MDQDCQNLKLENQLCFLIYSTNLALNQLYRKLLTPLGITYPQYLV
FT                   MLVLWEKDEITVSEIGSKLFLESSTLTPILKKLEALQLLNRTRSKEDERQVIITLSEKG
FT                   KKLKEQAVNIPTHILEASSCDTATLLGLKDQLTQLRTNIAK"
FT   gene            complement(670243..670620)
FT                   /locus_tag="A1S_3507"
FT                   /old_locus_tag="AS1_3507"
FT   CDS_pept        complement(670243..670620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3507"
FT                   /old_locus_tag="AS1_3507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3507"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89932"
FT                   /protein_id="ABS89932.2"
FT                   /translation="MWKYLFSIFCLGANIHCYATDFGTTNNFVSPNLQLKQNVLPPTPK
FT                   NIPLPAFGQRIIGWGTGAEGARQRLENIQPADVSMIKKQGTTLEMITAWQDFYEQEQQR
FT                   NENNPTAKYRARLMKKIADLW"
FT   gene            complement(670635..671459)
FT                   /locus_tag="A1S_0619"
FT   CDS_pept        complement(670635..671459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0619"
FT                   /product="putative carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11068"
FT                   /protein_id="ABO11068.2"
FT                   /translation="MTLVSVVQMNSQDDIESNFQVIESLIQQSKVQNASLIVFPENFVC
FT                   FAAGKQRETAEQFESIQQRLEKLAHQYQIWIVAGTLPCPFRPDGSIIQDGRVRTVSLCI
FT                   SPERTEARYDKIHLFDVQVGDAVGGYQESRFFEPGTDVVVTSTPFGNIGLMVCYDLRFP
FT                   ELALTLRQQGAHLLTAPAAFTYTTGQMHWQLLLQARAMDSQCYVLGAAQQGWHGEKRQT
FT                   WGHAGATDSRGQVLSMIGYEGNGLITVPFDLAAQELVRTSMPLMMHRKLIHY"
FT   gene            complement(671486..672007)
FT                   /locus_tag="A1S_0620"
FT   CDS_pept        complement(671486..672007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0620"
FT                   /product="putative anti-anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11069"
FT                   /protein_id="ABO11069.1"
FT                   /translation="MSTGHVEYASLNGTHIFKLIGEVRAHSCISLDKLLNRIEQQENVV
FT                   GAIVDLTQTTFIDSTVLGILAKLGLKLKQTHHIQAVMLSTNPDITTLANSMGLGQVFVI
FT                   LNYCGDPNVCTLTLTDEHITHNAMLRTVLDAHKTLMKLNANNQNMFEPLVKQLQKEQDT
FT                   LEQVSDKQNA"
FT   gene            complement(672110..673078)
FT                   /locus_tag="A1S_0621"
FT   CDS_pept        complement(672110..673078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0621"
FT                   /product="putative two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11070"
FT                   /protein_id="ABO11070.2"
FT                   /translation="MYFIKPTRSIPFVEQALEALPDLQVIHIDDLDLYDPTIIAIADVQ
FT                   DFLTYKWRLPTIVIAFEHEGSALAQAWEAGALAGWVWNQLPKDLNKALTRIDAQYKRNQ
FT                   DSRDLPSAAELQKRLLPNPIDLLNYEVETFFQPSAYLSGDWYDYWKLNDKEVLFYLADV
FT                   SGHGVTSSLLTSWMAAFHGRSKTPRQLIKKLNGMLVQENIEKHITIVVGILNLETHSLR
FT                   WSSAGHYPPPIIFEPNQPPKILTTSSFPLGLTDELEVEEHVCTLNRHARFIICSDGALE
FT                   PFDGGLNDQFQQLVQHLQNQSFQAPDHVADDIAIFSLCRMN"
FT   gene            complement(673194..674093)
FT                   /locus_tag="A1S_0622"
FT   CDS_pept        complement(673194..674093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0622"
FT                   /product="putative lipoprotein precursor (VacJ)
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11071"
FT                   /protein_id="ABO11071.2"
FT                   /translation="MNYSNLLLSSLLTVGLYTSAHAQENLTEESAASSEDVTSTQTQHS
FT                   RPHLQIIKDLKGIKVKDLKINANAAQPDTVKDPLQSLNRPIYSFNDMLDRHVLRPVAVE
FT                   YREKTPEDVRGSYRQFRKNLGEPWNAVNQLIQGRPGRAAKTLGRFTINTLTTLGLADPA
FT                   SRLGLPPEEESFGVTLGYYGVPSGPFLMLPFFGPSTLRDGVGLAVDAQARPQKYIMDDQ
FT                   DGLYWSTNLLQAVDTRAQYLDLDQTIQGDQYAMIRDLYLQRKAFQIAEKKGDSADVSFI
FT                   DDDESEDVPEDNTDKTEK"
FT   gene            complement(674836..676950)
FT                   /locus_tag="A1S_0623"
FT   CDS_pept        complement(674836..676950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0623"
FT                   /product="DNA mismatch repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11072"
FT                   /protein_id="ABO11072.2"
FT                   /translation="MTSTTKKFKLHPKFIVNAIEQQANGLPKAIVELIMNSIDANATQI
FT                   NIKLWLNAKKHLQFEIIDDGKGFTKKSIDEYFAMFGAPHEEGDATYGKFRIGRGQVFNY
FT                   AITTWTSNNYQLKVDIYKPLREKSDEELGFTITRLAKKFNGCKISGYIYTNITDSMGSI
FT                   TEIIEEIQSIIKYVQIPVFINKNQINKNISDCLDSECKIIEDDYAYYILDPNSDSLKVY
FT                   NIGVWVPYARFKNAIFKGSIISKSQFKITSSRNEIIEDRCELFKNIEGKIRDVVDPTFI
FT                   KLTTINEKKNKKLSSKLALGMLANILKNPLKDCRYDKEAILMMLNTPLDVFTDYKGYKQ
FT                   SLIDISKSKAIMMLIRSDYDVLVVEKIEKRTNCLILEETYDISHLQGYLRTRLIQEYID
FT                   KNEQPDNENLYDYDYMLMKLLSEFKDIVVAYTNYEMFTDIPPVTLLNYKDEKEKVCFDR
FT                   KIIDQKDLNNEQTGFLEFLKKLNTSFCDAYPDFINDCYGKREIFLGKSELDNAWTNMTS
FT                   NIVFDIRTISFYQQNSYLRLLLILIHEYAHLLDDEEGHNFEFYERFHDFVIRNDFIPLL
FT                   ESLSSSNNSIHSNSSSTAPDETELKLLAMIDQPTPQNARELYNILHDLNYSFKAVEEGK
FT                   KNKELFGLSYDTFNAWLADPKSTRYRNPKLQTWQSFIYETIAKKRGFNDFNAMVLSNVF
FT                   NCGTTTKEKV"
FT   gene            complement(677113..677907)
FT                   /locus_tag="A1S_0624"
FT   CDS_pept        complement(677113..677907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0624"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11073"
FT                   /protein_id="ABO11073.2"
FT                   /translation="MINKALSVILISSVLSGCMTTIQNSASGLSRKQFLLIPSQDYYIE
FT                   ANKGYVVLMNNYKNSGALDRKPELTKRVVNIAKKITAQVQDIKPETNQWTWELHVINTT
FT                   TINAFCVGQGKMAIFEGMIKTLNLNDDEIAAIIGHEIAHALLEHGREKASRNLVSDLAL
FT                   GQIGGNAQILAYFGTKLGLTLPHSRSQESEADLLGLEIAAKAGFNPDAAITLWKKVGDQ
FT                   QKGQNNKLSQMLSTHPMPQKRMEDLALAAPKFRPFYLATLHK"
FT   gene            678351..678923
FT                   /locus_tag="A1S_0625"
FT   CDS_pept        678351..678923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0625"
FT                   /product="putative transcriptional regulator (TetR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11074"
FT                   /protein_id="ABO11074.2"
FT                   /translation="MEFEIMTKVISKRKTILDTALSLFKQYSFKFVGVDRIINESQVAK
FT                   MTFYKHFPSKTLLIQACLCEEQKTIEESILNELSLLSEAGNIARLKALLNWHVAYINQQ
FT                   NFNGCLFQKAVYENEVSEEVLSVIQAHKQWKFKLVSDLMEVPECCTAFVSSSMVYSMLE
FT                   GMLLPANINPCVDHETAIKNLIQTFEA"
FT   gene            679422..680321
FT                   /locus_tag="A1S_0626"
FT   CDS_pept        679422..680321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0626"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11075"
FT                   /protein_id="ABO11075.2"
FT                   /translation="MIDTLLSPFSVKHELYSKLKKHQENRINIVDKDSIYLFDIFSFES
FT                   FKIKSKSPYSHLAYFSCSYTDDVTELELCFNPIFQDYDIPKLTIDISQLCGFGHSKSDL
FT                   FKYKSIDEFVENECPSYIETISQTQLRLMLSHNGIQIVNSPDSTFDNFYMYGWQPKVFL
FT                   SNEDGSHHLASAQYIALRLNQPVPLTARLIYKVIRGEQLANFHDRICKRYITPLHELDD
FT                   YFKWFDNSNIKFIRLDDSLHEYAVYFFKRTSENERIIELFSSKFSSLNQILWKRLSDQT
FT                   NNMLLKALVPLNSGCWSY"
FT   gene            680323..680808
FT                   /locus_tag="A1S_3508"
FT                   /old_locus_tag="AS1_3508"
FT   CDS_pept        680323..680808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3508"
FT                   /old_locus_tag="AS1_3508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3508"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89933"
FT                   /protein_id="ABS89933.2"
FT                   /translation="MATPQSCNKFALKASCKDCPFRKDSGGYLHPERVREIVNYMSKDD
FT                   ALFPCHKTVGTARTNLNEALELLEDELAFTGLSQNLTARKELEEKYQIDNLQEALLKDM
FT                   KSEKVCAGWLILGKKEQIINNNFPLRLAQMQGLLQLNDLTREDEIYDSIEQAIEDHS"
FT   gene            681320..681889
FT                   /locus_tag="A1S_3509"
FT                   /old_locus_tag="AS1_3509"
FT   CDS_pept        681320..681889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3509"
FT                   /old_locus_tag="AS1_3509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3509"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89934"
FT                   /protein_id="ABS89934.2"
FT                   /translation="MTNKASQPRTFTLSDEKRNHILTTALNLFDQFGFQHISIMRIITE
FT                   AKIAKQSFYMAFPSKDSFIIECLDMEINRLKQSLSNLLGQCGKDDHTSILKSFYQWHVD
FT                   LAYREGYNGTLLTKAVIEYWNLPDIKMKVEDFNKWKYEIFAEYLAEEINNARLRIIVSA
FT                   MNGILLPASTYLPTWEDIESLYGEQF"
FT   gene            complement(682606..682713)
FT                   /locus_tag="A1S_3510"
FT                   /old_locus_tag="AS1_3510"
FT   CDS_pept        complement(682606..682713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3510"
FT                   /old_locus_tag="AS1_3510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3510"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89935"
FT                   /protein_id="ABS89935.1"
FT                   /translation="MLSVFETTSKEVLSNFALRLKEFKKNFFSLDITIP"
FT   gene            682619..683410
FT                   /locus_tag="A1S_3511"
FT                   /old_locus_tag="AS1_3511"
FT   CDS_pept        682619..683410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3511"
FT                   /old_locus_tag="AS1_3511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3511"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89936"
FT                   /protein_id="ABS89936.2"
FT                   /translation="MSNEKKFFLNSFKRNAKLLNTSFDVVSNTLNTPFKAPTYTQCLEI
FT                   SARALGFKTFKGLTLSDLTEVNEIRYLSDFDKTKLIESYLDVNRKKITTMPLKIDSSLD
FT                   LNSTIDAVCTLAYHIQTFPLLRDFYLPKRYLSKHLDFDKGPFTINDTLSKICAHWCISL
FT                   LIEKPKGYEFYKGVYENNNDILYDVPMSFFTKKKINDWYKSRDFLHDFTDLFQHCDFIR
FT                   VQSGWTDFDNMSNSKINIFIPPALHERITELVNPLKGGPAN"
FT   gene            complement(683475..684857)
FT                   /locus_tag="A1S_0627"
FT   CDS_pept        complement(683475..684857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11076"
FT                   /protein_id="ABO11076.2"
FT                   /translation="MNQNNTEAEVNLFRFTFHFITQNTNSFFVSVEGPDENETLINFVN
FT                   DMYRVLYASNVKQDLDPAHPNQIKASALQRMTPSLRTQVNAMLSDYTKLKPSIHKAISK
FT                   LNSIEDDEYFFVFPYEFTEKMQAQMLLQTFLRAKNSLNSDEEVNQYMQTHMEGFNSLFD
FT                   DLLEQYNIAVFGETERKTVIGQKPTKEHGVCRFCKSPVDENTTFRKVAHTISEALGNKS
FT                   IVTADECDTCNEKFGRDFEPHLIQYLDILRVYYGTRGKKGIPHLKFKNGQVYQHKLEGS
FT                   EEHSIVIASQDIVETENGLIVSLLAHQKVNKLKIFKSLCKYAISVLPAEELPAFESTIN
FT                   WLFLDPELGEEEQQFHIAKMYGQSYTEHPELTLYTRISDTDPEWPHVVAEFKLGTLHLI
FT                   FILPFSKKDSSIFNLETDFPKLCQLFRHYQKFEDQIIFENLSNSEDRECDYKVRFSTDK
FT                   IN"
FT   gene            complement(685573..685686)
FT                   /locus_tag="A1S_3512"
FT                   /old_locus_tag="AS1_3512"
FT   CDS_pept        complement(685573..685686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3512"
FT                   /old_locus_tag="AS1_3512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3512"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89937"
FT                   /protein_id="ABS89937.1"
FT                   /translation="MKKTGINVSSHIGFGASHQWAIQLLDELHKALVLEFS"
FT   gene            686258..687379
FT                   /locus_tag="A1S_0628"
FT   CDS_pept        686258..687379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0628"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11077"
FT                   /protein_id="ABO11077.2"
FT                   /translation="MKKFCLVLIPALIAGCSSPATEAEIRAAVQECEAVMHDIENQIQP
FT                   ALLHKPICKGFFQRYNFQMKKPTHKIYRTTNWPAYNRALLSRGNIAIWFDPATQWYAPS
FT                   KGKQGRNQTYSDAAIQCCLMIKSLFRLSLRIVTGFVQSLIKLCGLNWTAPDYTTLCRRQ
FT                   KHIDIVINYQKSSDGLHLLMDSTGMKFLGEGEWKRKKHGPEYRRQWRKLHIGIDAKTLQ
FT                   IRAVQLTTNNVSDSQVLGDLLDQIPQDERIDSVYTDGAYDTKQCRQVIADRQAHAVIPP
FT                   RKNAKPWKDTKSSSLERNELLRTVKRLGRTLWKKWSGYHRRSLVETKMNCIKLLGDKLS
FT                   ARSFDSQVNEIHARVAVLNRFTELGRPLTQVTP"
FT   gene            687433..687732
FT                   /locus_tag="A1S_3513"
FT                   /old_locus_tag="AS1_3513"
FT   CDS_pept        687433..687732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3513"
FT                   /old_locus_tag="AS1_3513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3513"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89938"
FT                   /protein_id="ABS89938.1"
FT                   /translation="MNANHYIQLAREFRKSNSEPILASQKIEHLARYIKLHPKIGAYED
FT                   YIRKLPLGSRLPRGKYFKGRKAGDNIRVMDEYWSMFNQLRNESLIPNQNDALSN"
FT   gene            complement(687879..688160)
FT                   /locus_tag="A1S_3514"
FT                   /old_locus_tag="AS1_3514"
FT   CDS_pept        complement(687879..688160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3514"
FT                   /old_locus_tag="AS1_3514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3514"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89939"
FT                   /protein_id="ABS89939.2"
FT                   /translation="MKEFNLDGYSSIELENLIKAASLEKGKREIEEKVAAFGQLEEIAK
FT                   SVGLTLDQLIEFGKTHNKKKKQRLLSHVIEVRLIRRTLGQDEDRCQDG"
FT   gene            complement(688205..689929)
FT                   /locus_tag="A1S_3515"
FT                   /old_locus_tag="AS1_3515"
FT   CDS_pept        complement(688205..689929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3515"
FT                   /old_locus_tag="AS1_3515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3515"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89940"
FT                   /protein_id="ABS89940.2"
FT                   /translation="MNVQSQELTSSDAESLSPADLGYSQANSLSQGHPNLASFKYETEF
FT                   KLPVSLIHVTHECSLVEHKIWLCLLNHACEILENFQDNGSHPIVNFKIPFDLLRFKTNS
FT                   QHRLKEINKSLSNLRDAEIQIDIFNAQGLKSSSSQFSFIQDFAIYNKNMMLNREEVEAD
FT                   NKPDYQSLEIVYSLPPFFSSIITDSISIEKVKRLFSWTQIQSLSTSTGRNGKIELLIYK
FT                   LLEGTDEPITLAYETFKQYLGYGDVEENRYFLRDTLKPALKNFNANELLEYEVETDFIR
FT                   GKRQKIESIKLFKKYKFVDNEQAAHAWQSLLDSPPENTTNLRIRIKQLVPENYDIDSLT
FT                   DDSIYTILSRLKQWINGLKKKGQTINFVGACRSAFKDKSWIDSKNGKGQSSLILGEEVD
FT                   DVVVKASRTNYESAVGKGDIPKTSQESDYNNPVNKIAKSVATLISTLAIKGSKTTFFEN
FT                   ISKENFDELTNNNLKYFNYFSENIDSFKNDYVIDMVKRIFFVGNENALNSLLNQSNQSK
FT                   VLYPYLFSVNFAMQNYTQIISDPIRSGAYSTNLANNELAVNIVVGDLIKYFKSQLSI"
FT   gene            complement(690085..690240)
FT                   /locus_tag="A1S_3516"
FT                   /old_locus_tag="AS1_3516"
FT   CDS_pept        complement(690085..690240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3516"
FT                   /old_locus_tag="AS1_3516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3516"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89941"
FT                   /protein_id="ABS89941.1"
FT                   /translation="MFSTKLVSEYVSFDKDGQIFYSFNYAPFFETMFKENLHKKNQSQP
FT                   YLDQVV"
FT   gene            complement(690099..690749)
FT                   /locus_tag="A1S_3517"
FT                   /old_locus_tag="AS1_3517"
FT   CDS_pept        complement(690099..690749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3517"
FT                   /old_locus_tag="AS1_3517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3517"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89942"
FT                   /protein_id="ABS89942.2"
FT                   /translation="MTNLASMPYAHSLYLNEPAEWKKQSSVQLSLLDDVQEPSVVERSL
FT                   PALPLKRFSKLFSFLDFDFDTKSYEYMVGSDRFTIETKIDKADQAFVCLINEVLMAYKQ
FT                   KNILLTSFDSKLTHTINASEISKVVGISLDEFEKRMKSLASCSLSAHQHRLLRHTKTGR
FT                   ESFRFVICFQPNSLVNTFLLIKMGRFSTALIMHLSLKRCLKKTYIRKINHNLI"
FT   gene            691527..692903
FT                   /locus_tag="A1S_3518"
FT                   /old_locus_tag="AS1_3518"
FT   CDS_pept        691527..692903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3518"
FT                   /old_locus_tag="AS1_3518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3518"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89943"
FT                   /protein_id="ABS89943.2"
FT                   /translation="MIKNNDLDNLRNLNRNIIQNKPNSAPATPQRLFVYLDGIAQNNDG
FT                   HDYAYGTNVLTNEKVKVRLTTIDERIDDLVDSGRAKNRQQVASQVTNQYQNSANPRQSL
FT                   KARLNSNVVVLSFDQSFEIKSEDNYRSYRSHWAESVTSNPSSQLITAPVHIQFVNNQRP
FT                   FGRVEILEENFKIDIGSSKENIKDAFLKSLVHQDEFSAERSGSLNYILRYKDTNEPIYQ
FT                   GSLQTFLQQVSVGPDRSIRIPADINTTLNNLMRKPLTTQDFTPDDSMMFNHDLNRILVN
FT                   RFLGVEFSQKLETSNPQLQDNLRLISGKLKKGEIYLDAYSTQNIFFGRDTLKTYQAKAN
FT                   RNSSPLKIYTVTDMHNEQPVYQKGYIHSLVGIDRHSDTLAPFVTFSSTTDPMAVSKKIQ
FT                   DLNINEENLKRTIYLKEEFQKHPLPNSAAPVVDKERANINRIREEMQNQSNNSINFNNI
FT                   "
FT   gene            692918..697468
FT                   /locus_tag="A1S_0629"
FT   CDS_pept        692918..697468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0629"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11078"
FT                   /protein_id="ABO11078.2"
FT                   /translation="MSVLDKKGFIWVNLESFGYLTRPSRRKENNQIGIEIVDLNNQLDI
FT                   DKLRSFNVHVEKVNKSSVLDVYWSSISIKDFSNFIGVDNNNIPFQSITLTQLNAEFNNS
FT                   VRSLAQQRVDYAIRHATLIGQNLNKQYVYATQYSRFYLDQPLTEIAKNGTISIDPAQFE
FT                   ARLPQEDYWKILKVGNQPKFKRANMAHCAKSFASSIVEGTTNIHDSDVELFLKKILNDN
FT                   HDRSYLNEIKPTIKQFFYEQLECCFNSLSNQFNVHNFNSFEKIIEIHNKQPVKPIIGIS
FT                   ELQLQQFSTPITISAICQKLLFNPETLDTGKTLLEPTIGNGSLVAHFIKKPQLKIVGVE
FT                   IDSNRVKNTQLFLDANIEHSNLRVIEGDYSKIKLKQLNNNELFDFTIANPPFGKIDKTT
FT                   LTLNQAGSLERLNFSTQRLDHKILLETLSLRKDKGRSVFIIGSDSFYEAGVVKGGSKNL
FT                   LNYLYDNYNVEAAVELDGSLYKKQGTRVNVRVLVIGDLLENNRTYEVPHELPIINNVQD
FT                   LWRWSENVLQKRLQPELSYDEPSPSINQSESVISEANLDQNLDVVDDADFLTSALDSYL
FT                   NDQIVPDESGNVGDLNKPDDDDFFGNEEEDTAVKPLSTGDEHQNNEILDLEIVEDESQA
FT                   QEIIFESKSLQVAYVPVSQLSLPETMLPADQAILIKQAQDNQIKKILLLAEVNHELQKS
FT                   IDLANNNPFDGFLLYKLQYSDLSSLSKAFSAEQVDAVTSAILSIENDRSYILGDQTGIG
FT                   KGRSLAGMLRYSLINGFRPVFFTRNAQLFNDLWRDIVDTGTDKFISNPFIFNSDGFITH
FT                   KDKVVYSPMKTSDIYNLDRIGNQFDIIFSTYSQFSGRSGKKENLFLSSIDKNTLLFLDE
FT                   SHVAASGESNISRFLSVVKERTGPTYHSSATDRKKANNLLFYSDIFPASFKGQLKSLIE
FT                   NKPSNELLEAISMALVKDGVFLRREHDFSKLEFRTYHASTQYQTASRELSDQLAQVLSK
FT                   MAYLSGDVEEKVAKMNSEIKHNLEHMKEGSWQENRMQVNSMNFASRMHNISRQILLSVT
FT                   TPLIIDQALESLKENRKPVIGLENTGESLLKMLLLKDSKAFELLDQINELKDSSDYDRA
FT                   LSDLNSGKMNQNEFDQEPIIVKLKKLEQDLAQFKQEDTILAKPPTIADLLENMVHKLDI
FT                   IQVRDRYGQVRSETIDDEIYSDFKQDILDNIRKLPDIPLCPLDLIKAELESRGYKVGEI
FT                   SGREYQLKKIDSNQGSVFKVEVRQENNPTAKTKACNEFQSGILDAMIITRAGSTGLSLH
FT                   AIPVNDGSPSQSDHLRQREFLTGQSPQAIDEFLQMIGRVDRKGQVSAPIISQFDTGLPI
FT                   QRKFLMMHNAKLAELSANVTSNRENVNKQVTDVDLLNSYGDDVALEYLVQNRSVAQMLV
FT                   INLPKENDKNGAEGMVKKIFNRLNFVSIYQQEKIIDDLTFAYNEKIQKLNEMGINPFVV
FT                   QVCDWKLKLSLNKSYKVAWALCRMFLIVHFSNRLISKKLAINLKQNLFMAMMLSL"
FT   gene            697363..698877
FT                   /locus_tag="A1S_3519"
FT                   /old_locus_tag="AS1_3519"
FT   CDS_pept        697363..698877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3519"
FT                   /old_locus_tag="AS1_3519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3519"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89944"
FT                   /protein_id="ABS89944.2"
FT                   /translation="MSHVSDSAFFEPAYFQKVSYKSETKPFHGDDVISLIDKSRQLTRQ
FT                   QLFKHLCNFDDNFASTMEGKDQELSLSSLIKFYNDAQKQILERELRESIKYSASQSFFK
FT                   SKIDKYEFTEIENFILNKPNLDEIKEFLKISAENNNFLHIYQGLNKALTVVEFVEKLQI
FT                   LEEHQSFNINFAISMKESLWDQHYHRETNENALIRVMFPKLGASSLLASNYEIRYVYPS
FT                   SDFVHSSKLKYLIEDAALTPTLLRNVGTHLFIDGNKKEEEFSFMKTLNEIEYLKTNSPL
FT                   LLSFDKYEPTAIERTATLLTGNIINALNAASVAKLSSQMINYTDASGNRQRAVMLYDDC
FT                   ELEEVLDKVKGLSTIQEAITYFERVHDAIEMNEKPTLPDFYIVRSNSNGNPTIELNLKP
FT                   LNEETYNFVITGSRKHIKQVAEMDSIFVQAGSGNRSDSLNLVLKGDLSQGTRSSQTVQV
FT                   PIEKVTKLLTNLSTEFSTVKINNLDPDVLDQLKPNTSNKLTQNLMY"
FT   gene            698891..700942
FT                   /locus_tag="A1S_3520"
FT                   /old_locus_tag="AS1_3520"
FT   CDS_pept        698891..700942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3520"
FT                   /old_locus_tag="AS1_3520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3520"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89945"
FT                   /protein_id="ABS89945.2"
FT                   /translation="MDNKEEMKAAPQALNEIDWKDEIVFDELLSKVGPITPPDTTLKSS
FT                   DLEAYGYQSQVMLPVSEARAKELYEKIELYRLYEDGTEALVEDLADLNSHAQKDGLFGV
FT                   QENDWRNYQLKIEKSNDSENSNDLENFQYFSYPALAQSIIKREGDQFFANYELSRSLGS
FT                   DEDITILNKEFYKEHKADLDILLNELTISEQYEHQGYAVLYATKSNLSALNSDEEIEAE
FT                   ANEIKLFLEGNNDDPKYAYVYDTLYELSAENVFNEFKALETRIERDMDLEEGNFDLPFQ
FT                   HAVEETMETFDNNAPISNLPFDSLKEPEGFMEDIEQYSYAEDQNFGSSLPINNEEMIQK
FT                   SEVKEEKEKIDVNDVGVPEQLIINGKEFNFEQIDPNDIEKHEQLRAALSQLLGNTNAST
FT                   FQSPSQINPVTSTPLIPPSMPDFNENSAQPSTVKNYSLFPSFANLKKATPDNALSLLQA
FT                   EQLLQTSQNIQAPASENSGAHMNTQNVQHMLSSHLASSKYNDLVNSHKNYSDSINEFWK
FT                   FDKFEDFRGTLIERGQKENKDLKTLINEMNTDPNSPYRKEFQDLIVNVGSTEKGKALLS
FT                   KLNNSHQDFLSRSDSMFEVIQKSELSPDDKTKFENKLSEVVENQAELSSTLPNYINDDG
FT                   VRISLADEMKKYAESLKKALQVVVDFVKSKVGLSVDGPTEQPSSSPSP"
FT   gene            701359..702009
FT                   /locus_tag="A1S_3521"
FT                   /old_locus_tag="AS1_3521"
FT   CDS_pept        701359..702009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3521"
FT                   /old_locus_tag="AS1_3521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3521"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89946"
FT                   /protein_id="ABS89946.2"
FT                   /translation="MNIVEKHSKIKPTDNANTPAGIWDNKMESLVERSAKQDLDTFLRF
FT                   ICTYALNDTYVSKDLITESLKDLPQSVVTFVYLLEFSPNDQISSITSISDSVLKTLSEL
FT                   IHNFRNERINSNGYSIIFDFFSANPFSYFIYFLRNVITANIDELPLVVNLNITDFFQFL
FT                   LDRKSSVFHSRIFYFIRAWQTVSVYNEANISELKETMLYASQNKVFPNISVSS"
FT   gene            702027..703073
FT                   /locus_tag="A1S_3522"
FT                   /old_locus_tag="AS1_3522"
FT   CDS_pept        702027..703073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3522"
FT                   /old_locus_tag="AS1_3522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3522"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89947"
FT                   /protein_id="ABS89947.2"
FT                   /translation="MHKRTSALNKNPQKLNSVEKKHSFKPKLGFTTGIVLGVSSAIALS
FT                   TTASVGDGLSTIQSSLNQTSNTSTNITNSYTNTTTSTIPTLSASPFAASSNATAAQSAI
FT                   EASSVGCGDASQQGSIAWTQQEVIKNRQILNTAPVDIDALFNGSKGSSSGSCFSDITKI
FT                   IDLSVAIPDWGGMRAAAIAALRQYAQRKVCTMVNEATKKALEPLNNAIDIINKNGTIDL
FT                   NGAVQGAITGGLGKLDPDLANIYQTQAPQGETVNIFDSNQTTFNTDVAKVQDQVNGAIN
FT                   QIGTIGTNTGSTGSTNPTGTSGTTWSNNTSTQSIPNLSANTSNQTQQKAQPQEASRSSI
FT                   FDALFGGS"
FT   gene            703051..703842
FT                   /locus_tag="A1S_3523"
FT                   /old_locus_tag="AS1_3523"
FT   CDS_pept        703051..703842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3523"
FT                   /old_locus_tag="AS1_3523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3523"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89948"
FT                   /protein_id="ABS89948.2"
FT                   /translation="MRFLAVVEVAMSKLVKVALSTAITMSLIGSSYAQIAHTTYNQNTR
FT                   DLTSAIGVLTKQEGLSAQQQAESAMISSKALATAIGAINMSDRVLRFIVDDAGRLGSTQ
FT                   TTTCTVFAEQQAEKIKILQSSINAANMVSNYMKVMMSNSVESEKDKILRHENYCSIAEA
FT                   AMGTCTLLPNGLQAADSNYALVFSKSKLQDDTFNAATDYIANITDSRFSAQDICSNTQC
FT                   MTKQIDFLNKTSGNSLAAFVLSNQVSDRLSYSLNANSSGAN"
FT   gene            703843..704970
FT                   /locus_tag="A1S_0630"
FT   CDS_pept        703843..704970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11079"
FT                   /protein_id="ABO11079.2"
FT                   /translation="MKYKYLCVVAALPFLGLSFKAWAAADVLYGSVAPTFHQNVQTLNS
FT                   KMVSEFASTQANLLNAIQENTRQLQSALSVSIAQSSAGTTQVIDARKRAGQALATAYQA
FT                   IEMQDKVIDTVLNYGSTGQGYNTCKVLVSNATLSKGKEVSRQTAAKMVNETSTGTGRVV
FT                   HDLNQVQKETVQKHRELFCTQAEASLGLCTVSKLAGGDTNAALLFQPAKPNSLEAEARR
FT                   TLRGNILGSPDVALNAVNGMTPRGQQYLFALNRKTALQAFPAYSLAAIDAANLQTIKNE
FT                   AGELRSPNQMIDETIGRYYGTDEAKKFQATMMNQSARGLLVELARQRGAAIWLLNEDYE
FT                   RGLRLEGNLASLLLISAEESKSKMRDSYRTMAGRS"
FT   gene            704973..706106
FT                   /locus_tag="A1S_0631"
FT   CDS_pept        704973..706106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11080"
FT                   /protein_id="ABO11080.2"
FT                   /translation="MKKKTTFLLLSVFSTSVIAAYCPPFSNPLILRDFISGFQQLNATF
FT                   TTGLNTLDQSVSAALTTERQLLLNAIALKTTQEAMNASSIAHADQEIAKATANAIGAVK
FT                   QSERLKETAIDFGAAGQGYNPCKVLNERRTITETQERDKENRPDLIFKEISAGTGKYAN
FT                   PVVAQEQTLKLHHDYFCTSEQVSAGLCMSVGEMSGANLQASTLFEYSSANDKYAIAKTS
FT                   FINNMVGLPDAPLSANAAKTPRGKEYMRQKVENDAVISPAINSLMAIKSEFTENPNGGE
FT                   FGQPVKPLRQQYREQVDRYLGHGEEYKNWNRTLVAAPERGVLVEILKEGALELAIMGNK
FT                   HAQNERIEANLASLVALENKKANSLNKSNIAGSAKAK"
FT   gene            706230..709964
FT                   /locus_tag="A1S_0632"
FT   CDS_pept        706230..709964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0632"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11081"
FT                   /protein_id="ABO11081.2"
FT                   /translation="MKWLNLSEFGLHLGFRKATSFRDKVAVLTVNDLNTLSRFIHLNDF
FT                   SEKLQAVGFNRVNSDDGNAKFVKADNSINPKQLASILPITNKHLQDMPENDARAKFHVD
FT                   KQAWIDLTAKLAQQGSVWKLDENYYNEAGIHWKNKISENYLDLSTKQDDRYINLAFESP
FT                   LPVNMLETYKYDSRALGVLTTNKEILIRKGLPEEAFTEVQLNFMLPLLSLEDEVHIVLN
FT                   DIREVPEILELHPDIWRQSINSFESFLTRSKLLEKINNLLINDELLEKSNEIVNDIKVF
FT                   YETYNNCLLSKEEFSNDDDLTNHRIQLLKNQIIKLDKFGVINENLLPKLDNIYDSSIED
FT                   TVLEPEKENKSLNERIEDYGEYVFGARKHFYQKSKNALFEELNNSKDLSLDVLIDKFQK
FT                   RNLWSFKNETMSQIEDNNVIFFLAQSVYNMIPSKISFSKDERKDSEECIDKLKSYMYSV
FT                   NHFKEMVHTAIELDKNERMPIANFVNQMVNYRNVLRGYAQDPQQFLFDELDEDRLLADR
FT                   IYKVVKGTTLRGSPLFQIMNNLDTVKTQYCKMMFNEVYPETKEVSYDQFQDYVESGGHI
FT                   YDGSAIKQFIDAANGKLDYTYLSRQFERLEDSLGQELFLNMIVTGNKPFSDALFKNVEK
FT                   ILESDKSIKTPLDFEKDDSKLNYLLSLYRFKFDSKYSIPDIYIKDENQHTQVITDLSST
FT                   DKFDGLVRKILKDQEPNRLDLRYPSIVSGLAHETSKNFRHGENVNPEQFSNVFGFRAIQ
FT                   FGNWVTQQERQHLLNITFDGLSELRDALGFDSKNISLNGTLAIAFGARGQAGRNAASAH
FT                   YEYASKIFNLTKQNGAGCLAHEWFHGLDAYMAQLVRKDVEKLIYKSGNFESVENNYFLT
FT                   HLMSDVDYKTCKTVIDNNPLLKSVYELQLKLNGKMHRDEIFSENGKELIVNRIHELVDS
FT                   NLIKVNVLKDAISKSLEKQGLSRIASLLDGVTTNHVDNVKKLKNHELTKNIKNYLVDND
FT                   LHIKRDQMYSAVKTIFKELQNNNAPVGKYTIANPITREFNSLVRGSQVNDDLAKSEKEI
FT                   LKHLRSHKIIKEMEKLLHESVFYLVQRQTLPLFIDQVNSIGGNKISILKGVALDHYQSY
FT                   MEKSFQTGKGIANKLDLDLVFNNNNFASQSKLLDKDKKQYFSLVAERFARCGEALVTDL
FT                   LAEKSVQVDYLVTCMEDPQTVGQRAGITPSGNDRTEILKAFKSVIEACRSYAFNLDKDI
FT                   KEENEVNQKLSTTLSFGAN"
FT   gene            710418..711071
FT                   /locus_tag="A1S_3524"
FT                   /old_locus_tag="AS1_3524"
FT   CDS_pept        710418..711071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3524"
FT                   /old_locus_tag="AS1_3524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3524"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89949"
FT                   /protein_id="ABS89949.2"
FT                   /translation="MNASQTIQTVQFGLDQYSKLVKDLKVLSGIDAFYTAKCLIESFPN
FT                   VVNDEFYGYDFYADEKILDISSYIHIDENKWFNLNCLIDLEEKIVSINLASEMENGEIF
FT                   LFRTDKNYQVAVNYNYSFENFFSLQSNFEYSLFDLVLSSMGLSLLPKKIFNNFELKDIF
FT                   LFSMSIVTGRYKNYIPDQLFFNSIHKNIVLDLKSDELELPSRLINYRDEIDLKW"
FT   gene            712236..713729
FT                   /locus_tag="A1S_3525"
FT                   /old_locus_tag="AS1_3525"
FT   CDS_pept        712236..713729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3525"
FT                   /old_locus_tag="AS1_3525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3525"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89950"
FT                   /protein_id="ABS89950.2"
FT                   /translation="MRIFKYELEDALQSLDNSVSYAGFINKLFPKFISKDVDNINTITI
FT                   NIILKKIQDLLSSGYYSVFINYKNYMTNGERVWGLHHFCMCIYLHENFEPFGTYSWDAS
FT                   SHPQMILDFWSLTSSNRYELHEVGLTYNQVNNSDHTERMNIDIEMAWEELVILNPTFNF
FT                   PFFRNFFYLSCLSIFNISDYQKFGKLLSLNYSIDHLLDQLRHNLFNFLDLLDDYMLNID
FT                   LSESTYSFADGTSFTMFAEVSEQDLLNYDFSFVSDSSSSEDSTAQQSQTFSTSDQHSVP
FT                   SRVDNSYLSFLSKQDIHEEITSNYVRELIKQFFYNYSKVSFSIHNTSIPCGFVADFLDY
FT                   LNRSLEQIFIKVESLKVNYLKLQFIYQTSHTLSSMYFYKYIVDNYTSIFINISVPESLK
FT                   KEVLVKVRSLSIFIKNKINKLNDVLVHDPLFINVYSLIFFYLDSFSQSLNYIRCSGGEL
FT                   DKDRLDLIYNNELEYIDALDFNFFQYLARRLPRQVYRLP"
FT   gene            complement(713733..714230)
FT                   /locus_tag="A1S_3526"
FT                   /old_locus_tag="AS1_3526"
FT   CDS_pept        complement(713733..714230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3526"
FT                   /old_locus_tag="AS1_3526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3526"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89951"
FT                   /protein_id="ABS89951.1"
FT                   /translation="MKSENSIECSKIIPLTGILNQSPLLNTLHKSVKLEIPEINNQRRA
FT                   LSNIFNRLGIDNIQQVIISEPKLNKEVLSELANNFFTSSFPQKAEELIRKMSMPEYGFT
FT                   DPKQPSPSTLAMNTVTQPQSDIQKQIIEEIKQRSAESMQEFNQQKNESNNKTNEIDLNN
FT                   FF"
FT   gene            complement(714272..714841)
FT                   /locus_tag="A1S_3527"
FT                   /old_locus_tag="AS1_3527"
FT   CDS_pept        complement(714272..714841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3527"
FT                   /old_locus_tag="AS1_3527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3527"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89952"
FT                   /protein_id="ABS89952.2"
FT                   /translation="MYSSTKSFSNLYASIVHMQEHQSLEELQANQIINHAMKNGPDHKL
FT                   NRLLEDQILNGVKGFNIENMGMKHEIFNDKVLMNLKRERATLQDINSIIIDTALQFSRN
FT                   PDQIELNEEKLKSSLNTIKNLHCERSLKIDLIRNMKEGVLTFVPEEQRNDIERVIISKQ
FT                   REIERTATQSNKVVLESKIPNSFNPR"
FT   gene            715175..717829
FT                   /locus_tag="A1S_0633"
FT   CDS_pept        715175..717829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0633"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11082"
FT                   /protein_id="ABO11082.2"
FT                   /translation="MSIFCPSQTDSTCQNDAAIDLLGKIFGDGFIQAFVLGKSAAATAP
FT                   ATGELTPVLFGALGHLALVFAAFLFLFLVFTSVLHTARDGEVFGAGKKKHWVILRILMS
FT                   GVMILPTTSLYSVSSVVLMMVVLASNGETNKAYREFLNTVVMNPSPSFASVDGLDPYGF
FT                   RAYAIQKLRQYTCVRVLNQNFAAEGVSVGEKKYSDGQTYYVSNIGGERQFNSSLVDRNN
FT                   VLDQGYFGAICGTSSYIVANADSVDSNFKYLTSENPDLESYKDFKKRLLLNIQNLKFQG
FT                   IVRLNEAVLAYVNRLPSEAISPEEYARNFNQAFNNEEFDKIITDEIRRTDASINSHLQS
FT                   NQNSYINKTIQYFAERGWTQVALTKKKLGEFQRDIYEARAKTIYEGTNPDLQRLNREGV
FT                   ASEKERMIYNVLVTQMDSTVNNYLKTPQVVTTLSTNDIQNLIPEDITNSDVSFKQISKD
FT                   VEAANTTLVSNTMRIFIETFTGTGQDDGVDAVTRMQNTGNVLHIALTAVDTTLTGVRTG
FT                   LSAAGATGAVFSDNIGTAAEIVIGLVDYYSEKLGKIMVMGKLVAYYLAVIIPTLPFVFF
FT                   FFAVIGWIIHILQTMVGLILWSVMHMIPEQSFVGSQTQGYLTVVALFFRPMLSLVGFFL
FT                   AFIISDPLLTFTTDGFFAIMGAVQFTNNGFIAALAQFFWLMGWVILYCLILLPIIYLIF
FT                   GLPSSLADSVLAWLGTNLSRSLGETNLGQNVGRAANPAAGYYNTSGGGRGGSGGGSGGN
FT                   GGGGSPAGGGGAGTRGDGSVLMNKGQPNEQSSGAQTHLPNATPSSSNSNWQSAAAAGAR
FT                   EGGIGGAIASSVSFAGRRGLQNEASAGTSVLSDVNAGANQTGYIPTEYRIVPSSASGAN
FT                   SVAPDPVDKKPKN"
FT   gene            718515..720347
FT                   /locus_tag="A1S_0634"
FT   CDS_pept        718515..720347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11083"
FT                   /protein_id="ABO11083.2"
FT                   /translation="MSAAVIADLHASATNFEYAKPSGQTGKPSNLDAGDFPLTGNLLVT
FT                   SRFGITRFRSDGSPRSHSGLDIINSNGNHSLYAIADGVVIANGWMTGGGNYIRVKRKEN
FT                   NDVYQYLHLATRSPLNIGTEVKKGQYLGTMGNTGISFGTHLHFDYAIPQKEGSRARNAW
FT                   LGSPKGSANANPYQNIQTIGLSKNGIEGYYVTDPTPYLKDDIKITDSTYKNYLGSTIRQ
FT                   QFNILYGANLPVGAGATQPKFAGVQFKLPQGYGATDEQLAKVNISVIEARQKALENGEI
FT                   TEAQAYDPNITYREVEDIFKDSGQVGSSEETKLDIGDDGSVKGHIENLAFKRFASAGWA
FT                   QDLVKASNRSLWVEFLNIEIAKNHLKTQLLKQNERIEALFAAYAIAKARVLQGKIEELR
FT                   QAIENGRNIALISRLELEDLPPIASDTEVMNATVTKRNGSYGLTADKKAAIIAVAQAIG
FT                   ANPNDLAAVISFETAGSFSPSIRNPKGSATGLIQFMQYTDGTGNDKTPRDQWDYWGMTR
FT                   SQFGSLSFTEQMKYVEKYFKDRGLRESKPVSLATLYGLVMGVPKGGYTIARHSAVFRDN
FT                   PAWDVNGDGVITAAEAVNGSKFKAHIRVYFPDFP"
FT   gene            721099..721383
FT                   /locus_tag="A1S_3528"
FT                   /old_locus_tag="AS1_3528"
FT   CDS_pept        721099..721383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3528"
FT                   /old_locus_tag="AS1_3528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3528"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89953"
FT                   /protein_id="ABS89953.2"
FT                   /translation="MAVNKAHILNNLNPIERSALTSVSESLIAIRVIIRRAQGNGGLSV
FT                   KDIQNIESLADACHNIPSVIANNESEQLKFLLESGTREAKMILAQGAVF"
FT   gene            721728..723065
FT                   /locus_tag="A1S_0635"
FT   CDS_pept        721728..723065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0635"
FT                   /product="hypothetical bacteriophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11084"
FT                   /protein_id="ABO11084.2"
FT                   /translation="MKKKSYENRDVLVQDFNDFMKAKYSGNELYAAGRRKGRVVQHPLY
FT                   FNLHSRIRFKNLLNIGWPHKLILDSDCFGAYEFSDNDSKNLFWYAIEGIKERRIRSLDN
FT                   WAKHDHYEAALQVAKSAFRSIIQKRKEEQPENNSKVRSKPPKRPTFNRPFVRVGETYRQ
FT                   SNISTEEFLSTFKFRGIEWGNYVTQSERQGFLDATYDSFIDLTRLCGLPPSFASLGGKL
FT                   GIAFGSRGRGYDGAAAHFELDQWLIHLTKTKGVGALAHEFGHALDAYLALKSKTKRDFL
FT                   TESFITKYNNHSLSLNTNSLKVSESESLRCFKVLLENMIFTSDKNIIDEDQVRINSTFA
FT                   KNACLLDQGRKEAYWTDPTELFARVFEVWVSDKLKASGYINEFLVYGPDEPPSSWHTKV
FT                   NTYPEDQERIRIVHYLDRWLSELVTTWKFEKKRKLTISRIMSKNSQ"
FT   gene            723347..723850
FT                   /locus_tag="A1S_0636"
FT   CDS_pept        723347..723850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0636"
FT                   /product="DNA polymerase V component"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11085"
FT                   /protein_id="ABO11085.1"
FT                   /translation="MNRVINSELEHAKLLLGLGQVCTDVLSMHEVVGSSIKEIPFVSER
FT                   ISAGFPSPAQDYVDKLMDMNEHLIRNEAATFIVKVCSLSMINAGIDINDELVVDRSLEA
FT                   KNNDIVVALIENEFTVKRLKIEGSKIWLKAENPDYQDIYFNEGQKLIVWGVVTFILKNV
FT                   RKRS"
FT   gene            723831..725141
FT                   /locus_tag="A1S_0637"
FT   CDS_pept        723831..725141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0637"
FT                   /product="DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11086"
FT                   /protein_id="ABO11086.2"
FT                   /translation="MLEKDHESKQENFFLVDVNNMYTSVETAFDPSLTGRSVIVLSSND
FT                   GNVVARSPAAKKLGIKMGEPLFQILDLVMRNDVIVLSSNYIIYGEMSRRFHKILAEYVS
FT                   PENHEIYSVDEAFLELTSYRGIYNLNQCAQDIKEKLLKLLSLPVCVGIGRSKTEAKIMN
FT                   YIAKTYPHLNGICNVFDLAEVKDSIFRNTDVGEVWGVGSQQKKKLRLMNINTVYDLMTA
FT                   SPSHIQSVFSVVLKRTVLELNGISCIDIEHTPPTKKQIVSSRTFGQRITDIHDLKEAVI
FT                   KRTQEAFTRARNEQVLVGCIIVFAYSNPFDKTKPFYKKEQSSSFAVPTDDLRLLVQTAT
FT                   RLMDQVYKSGIEFKKAGVILTCLEPKHTYTYDLLTDHQDLEKTEQLMKAIEEVQQIFGK
FT                   NKIGFGGSMFKNRIWNLTANYQTRNYFSFDGMIKIKN"
FT   gene            725349..726344
FT                   /locus_tag="A1S_0638"
FT   CDS_pept        725349..726344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11087"
FT                   /protein_id="ABO11087.2"
FT                   /translation="MSDFISTPRLSTYQNILKLTDPNQILRAYYWNIALAGAIYPLMQT
FT                   LEITLRNAIDVSVKNNHQPKSANGSNFVSYKNNDLWFEQLVTAVQDRKITKMRPHQALK
FT                   WVRGGKRIKFSTTESHVKKARDDASTVKSWVKGEDILSRLPFGFWTTLLSKDYEDVTNK
FT                   HLLWPNLLHHVFPNAPSHIKRKDIEDHFNLIREFRNRLSHHEPIWKFYYRNPANNALDY
FT                   TTPIFGLNASLNLLNNQYDDMLMLLQWMSASAYDNFNYSRIGNEFKKLCSIDGFYAYVD
FT                   REKVANCYPASRAKREFFKLAETLQNVNVVYMKTNGKRGYILGLNEPSLP"
FT   gene            complement(726400..727281)
FT                   /locus_tag="A1S_3529"
FT                   /old_locus_tag="AS1_3529"
FT   CDS_pept        complement(726400..727281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3529"
FT                   /old_locus_tag="AS1_3529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3529"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89954"
FT                   /protein_id="ABS89954.2"
FT                   /translation="MSSLLDLVLDGDESKANSAKQTEIELHLIDLDPENPRKTFIEAKE
FT                   KDLEESIRESGVRIPVILIKHPHDDNRFIVKDGNRRVKNSLRAGLQKIPAVVVESFSEL
FT                   DQLTANTMNEDMTIYDISRAIVRLKAKGYSQRQIGKTLAYGDAKVSKIVAITDGLDEEI
FT                   LETLEDMCNRNLLNDFSAMYEIAVLYRDHKVDVRAWVEKQSATAKKIGIAEVQKFKKTF
FT                   ETDLEKDKPKSKEVSLNETVIEDILSKAKESLPLVSKLHKGEIKDPEEREEVVNSLGEL
FT                   IKDLTLILKQYK"
FT   gene            complement(727285..728169)
FT                   /locus_tag="A1S_0639"
FT   CDS_pept        complement(727285..728169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0639"
FT                   /product="IncC protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11088"
FT                   /protein_id="ABO11088.2"
FT                   /translation="MNDKTSQIKDAGILTIGNGKGGIGKSTFTVHSAYFFSQHGYKVIV
FT                   VDLDNQGNSSGHLLKLNSNTVLPEYVTRPSTPVHNLGDAVSLFHKDNQNLKCDLQNGSI
FT                   GVFRPTKALASINTSSDKELVAIFQENINKLLKYKTVIIFDTPPTLSNLMLLPLSVSNV
FT                   VIIPTMLSQYALDGIRDYISFTNNIKKALNTKLLLGGIVPNRVNMKSSIQKEELAKLLA
FT                   EGESNSIFYKDKNNIAYITDKNVIEEAVNYGCACWHINKTSSRDVKRTFFNIFKQVGVQ
FT                   LKLAAFNSSSKGE"
FT   gene            complement(728966..729157)
FT                   /locus_tag="A1S_3530"
FT                   /old_locus_tag="AS1_3530"
FT   CDS_pept        complement(728966..729157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3530"
FT                   /old_locus_tag="AS1_3530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3530"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89955"
FT                   /protein_id="ABS89955.2"
FT                   /translation="MYYDHLQQYIPAFKNAYIGKIGPSPAGINKWNISEFSNLPIPVRP
FT                   QLTPINRQHALSNKTSFL"
FT   gene            complement(729256..729573)
FT                   /locus_tag="A1S_3531"
FT                   /old_locus_tag="AS1_3531"
FT   CDS_pept        complement(729256..729573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3531"
FT                   /old_locus_tag="AS1_3531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3531"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89956"
FT                   /protein_id="ABS89956.2"
FT                   /translation="MAKKLPPHIVDALEALEENEIESASLNALRLRAWLYFIRFLSSFQ
FT                   TNYETKNPYSSIQFTHHQASLFAFGIDDKNPENFLLFAQENDFWWLSEIGIEYFTFIEN
FT                   S"
FT   gene            complement(729566..730534)
FT                   /locus_tag="A1S_3532"
FT                   /old_locus_tag="AS1_3532"
FT   CDS_pept        complement(729566..730534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3532"
FT                   /old_locus_tag="AS1_3532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3532"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89957"
FT                   /protein_id="ABS89957.2"
FT                   /translation="MESKQRLNFSLDEYYSAITHLIASKPKKEASDFSILENGFFTDDK
FT                   ELSLKITRGEKSNLHNPLSSSNKQYPLFNDNQLADLINFFDTAIWTVERRLPVQSYCRA
FT                   ISQNFDLIVDLKAEFVIALSILNNLEFSKIQSQFHIDGTSHLIDKTRQLSRLICDINDP
FT                   KVLQDIVAQCNKRIDDLDTAPYIERMVVTGHDHIINSLQLYSKVKPYANMVQDGNSDFS
FT                   IGKTLDIRKCDVKRIRKMSNIEGLLNTDNRSARSRALKTDIEKILDTPSYSWVLEQSQT
FT                   HGISEHQALKKIIKEHKKFTLKSNLDSSDEDEIENTGEVNG"
FT   gene            complement(730544..731401)
FT                   /locus_tag="A1S_3533"
FT                   /old_locus_tag="AS1_3533"
FT   CDS_pept        complement(730544..731401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3533"
FT                   /old_locus_tag="AS1_3533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3533"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89958"
FT                   /protein_id="ABS89958.2"
FT                   /translation="MKLFNKKVSLPDTTHLPSVTSNVHEKEDKSFLTIQVHTDDNCTIH
FT                   NRAPKLVSIQLPELPSFNYALDFDQSTLNADPVHTSEEVPYKIVKFKAVLEISPSFKNE
FT                   TDETKTYEIADIDFKVYPNDYDSKADKYFFNTPDEIKEYLNGQWEDAFNSIISTYNLNN
FT                   RTFGNQNNGGGYTPITPSGHASVSTVRQPRTFSIFGYEFSLLQLFLAAIVLLLLAFISL
FT                   SLWGHYVNSKNGYANSSQNPYSSSSIDQQVQIAEDVVSRVQGKLGVPATAKSNDLGCLQ
FT                   DSLN"
FT   gene            complement(731423..732367)
FT                   /locus_tag="A1S_0640"
FT   CDS_pept        complement(731423..732367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11089"
FT                   /protein_id="ABO11089.2"
FT                   /translation="MKTKSLGNSNKKSSFKFPHVALAALLGFGAAGGWFYYESHNVPTG
FT                   VTSNSTNLYSENLFAQMSKLGQVSNVQPMAGELLAWTMLINGQPQVVFTTKDEKVVITG
FT                   NAFDTATMDSVSLPILQKAQQGGAPANSTGVAAPTGGNVAVDFAEIVGKWDKEVPPSIS
FT                   LLDKLKGAKEGNASAVDTLYIVFDPRCSNCHDAYRATRKYVEKGFSIKWIPTTLLGKHE
FT                   EGAKLAAAVLRDPKQLERAFSKDPNIVVNPTPEEKKALEENVQFLTEATVQSTGSQTIA
FT                   VPTAFYLNKKTGEPKMTTGLSDESILEMIFGKI"
FT   gene            complement(732448..733818)
FT                   /locus_tag="A1S_0641"
FT   CDS_pept        complement(732448..733818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11090"
FT                   /protein_id="ABO11090.2"
FT                   /translation="MSNNHNASHGSTDDTLILIGVLCVGIPLLVFGGWKIGKVAIITIT
FT                   RNVYGLIELPFYYLQLFIQKITGSNAGYLDFTTNAITKLCYPDPNHAMNPLMHCTANLK
FT                   VVPFSFYSENCIFPTILIGALLVGWIWYKHAINLKYLPDTRYVQEHDLESLIGELGSYQ
FT                   PHLRYIQRFIQSNYATDKGFYRLLLSPREFIKIHNLVYGFRKYEIENAEDFDDFKGSNS
FT                   PKDDAYPLLDQSKFEKLMMHQLGQMLDKPSNLSDGEIILYALFLPMACATDERMSDKEF
FT                   KKIKAQKDMLLHYFWDKAIEHLTSEKAFINPKNYEPREFKYFERKRLQKIVERYWNHPV
FT                   AKEVFSKHAYVRTALIALIYKTRTLGVLAPCELRWLRNYDRTLWALVQNVGRPSVYVEQ
FT                   LAAFSHYTSEAYYHRRKISPDFSYGWNGLLESLKQYRYADPHVYLPAPPKANEITVN"
FT   gene            complement(733837..734586)
FT                   /locus_tag="A1S_3534"
FT                   /old_locus_tag="AS1_3534"
FT   CDS_pept        complement(733837..734586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3534"
FT                   /old_locus_tag="AS1_3534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3534"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89959"
FT                   /protein_id="ABS89959.2"
FT                   /translation="MPQKHRLRISVSLAKLPKRQRDFLDKFKNIKEIDVHSFYAHLISY
FT                   FFFHPTKSLQLIGAVGKNESKIALNFHHEALVKTLTGKTQYQRELYCLTALYEMSNMLA
FT                   YKLFMYYTYVTNRNFNELAALENQFFELGISAFLDDFIELTNETKFFQNIQIMASSFNT
FT                   ESTRAFALLESYVHSETMITATSHPDPLQKPILDDLTTNALSPTPEYTLASPKQETIDQ
FT                   IQNPVDQESFDEQSSSTIEDWSQIQVG"
FT   gene            complement(734600..735658)
FT                   /locus_tag="A1S_0642"
FT   CDS_pept        complement(734600..735658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11091"
FT                   /protein_id="ABO11091.2"
FT                   /translation="MKGYKTLTVGVDDGHDGIKIYCGEVGKSFRLPSRVANGRTIIGDT
FT                   DEVNKQIIHVNGKYFTVDEFTKEHIDTRTEDYPLSDANVALVHHALHQAFDGQYRKFKI
FT                   ATGLPLNRYYGGKDKAKNEKLIADKTQNLLINKDFNNPTVYNLYEHDKKNDPLQILNHI
FT                   VLSEGQCAYFDALMDDNGKRSSMYEDLWEGGCAIIDIGGRTTDIAMINPRGGTMQASRC
FT                   DTLDVGIITLKNKVSQNLKEFFGLSSNITDWRLSKALKTGIYNHGGKDHDISKILNAAK
FT                   VEITDQIENSIKVNVQDGQDLGAVLLVGGGSITLGDELLKRFNYDNWHLVKQPEFANAR
FT                   GMYKCAKYISKL"
FT   gene            complement(735943..737232)
FT                   /locus_tag="A1S_0643"
FT   CDS_pept        complement(735943..737232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0643"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11092"
FT                   /protein_id="ABO11092.2"
FT                   /translation="MNVYARDTVAEEPKAEHPYQMLRHETIDLDNISINSEEDVRKILT
FT                   VANAFNASDVLINSGRPILIRRYNKLYALTLKNLKDVELNMFLTIINGNEALSSIKKGK
FT                   GLNFAYNCSAFQDRNSKSGKGYITTQNDESWLHVNAVEKEKIIFRCNVSACNDRTGNSS
FT                   FQIVQRIIPSDPPTYDQIGLTEEFVLKAIPRLGITYVVGETGHGKSTTLASMVRYVYEE
FT                   DTHIQGNIITLEEPIEFRYDGIKSKHSIIVQSQIPEHFMTFGLAVREAMRRKPALLLVA
FT                   ELRDQESFSAAIELSKTGHPVMSTIHSNDVANVLPRIMDLVPPDQQHRKLTETISTAHA
FT                   FIAQRLVETPEGKLIGVREHLFFSKSIRNDLLDLAIQAGGYGLVIQYIRKMMNDNPQGT
FT                   ENSSPNFENQAKDLLNKGLISKKGFDALIA"
FT   gene            complement(737245..738063)
FT                   /locus_tag="A1S_0644"
FT   CDS_pept        complement(737245..738063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11093"
FT                   /protein_id="ABO11093.2"
FT                   /translation="MADLPNYQYYLQQSPIIISQDDSAKQAESSARLESIKTLVHEAAT
FT                   RNALRARLTEIDKVVYNPNNVRKLDSIYDFQRLMINTVVVPPVIVQANNISDVQNPRTL
FT                   SVLGVRYEIKENARFSHTPPNWRDFLQFNVKSYEIGVDALPNELKPKNSAEERAFKEAM
FT                   NKGIEDGVREADAIFKHQLNRLNQTYKGMIAFHRFVMDGKITMPAIARRDIALTGNGNT
FT                   LMLNQTNFEITSLPQFVNNTKLWNSRILSIKERSVVKDPVETPVAIETQQ"
FT   gene            complement(738105..738575)
FT                   /locus_tag="A1S_3535"
FT                   /old_locus_tag="AS1_3535"
FT   CDS_pept        complement(738105..738575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3535"
FT                   /old_locus_tag="AS1_3535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3535"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89960"
FT                   /protein_id="ABS89960.2"
FT                   /translation="MKIVPSIRRSLTVLCISVATLTGCQSYYYVPSPKFDVESPLGILS
FT                   QAAQDAVAEQQTYALDKKAFNEDLALRQRSFRTDVIRVDYVGEPQTLLQSAAYHFGYRF
FT                   IEAGNIHQLPIVNFSKRKLTGFDLIKDVGLQLGNSATVDVDENDKTITLIHR"
FT   gene            739513..741417
FT                   /locus_tag="A1S_3536"
FT                   /old_locus_tag="AS1_3536"
FT   CDS_pept        739513..741417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3536"
FT                   /old_locus_tag="AS1_3536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3536"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89961"
FT                   /protein_id="ABS89961.2"
FT                   /translation="MKAGSELEFNAKKYPKSIKGLETRVFDYSEKTIIRYTNVWKKLLK
FT                   QYGLEDQVLVNPEYTLETVVNNLISEYGNNELRNSTFRHYRSALIHRMGVILSEQKRDG
FT                   EKLVALPKLARLFESLKAVEATDDKKQPNRSSSSKLKYFPKDLYEFVLGSSFNLNRSNL
FT                   GLMLKLFIEANTMIGLRPVEWQSLRLACDVEERCLSLVVDNAKNTQGRANGDIRILNMI
FT                   EPDSIKLKNQLRAILGFKRLLDLELEARARKFLTERSRETNETYKIYIASKEPDSFEFE
FT                   FIHWKGSQTVNCIEAVNCIKPVNGTGETVNWISTENELEQNIEDRTNGALPSINGPDTV
FT                   NRISSGHGQDTTDDNKAGGGEFNYERVIEDGAHSSVNGINTVDRIKTVDGINKVDGSDH
FT                   GALPSANGPDTVNGIKAIDGNNTVDGINAVAGIKGGGTNQAISTASTAPAPELTDFGFN
FT                   SVAGEIQQTGRNTDHGKMAALLGAYNAVVIESYVDRYGTIQYALCQSVMDSLQRKLKDM
FT                   SNEFYEKKKFGLPEELASNKANATIYSTRHQAVANRKKYKWKEEEVAGWFGHASVQTAS
FT                   RHYGVAGKGWGDKPMFRTSKFSLEKVRMREQQLNQTKQLTEEDVLNSVLSDKDLDDLL"
FT   gene            741576..741908
FT                   /locus_tag="A1S_3537"
FT                   /old_locus_tag="AS1_3537"
FT   CDS_pept        741576..741908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3537"
FT                   /old_locus_tag="AS1_3537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3537"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89962"
FT                   /protein_id="ABS89962.2"
FT                   /translation="MKIPLIIIVVLCTLYFLNLSLKSNMKDIHKKEISDKAYFRLSSEY
FT                   GFVKASHAGDEMRSKIIKALSDGIIDGNEYVSITGEEPDYDLSTDAEKATYKEAKQKFI
FT                   DEFKPS"
FT   gene            742373..742675
FT                   /locus_tag="A1S_3538"
FT                   /old_locus_tag="AS1_3538"
FT   CDS_pept        742373..742675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3538"
FT                   /old_locus_tag="AS1_3538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3538"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89963"
FT                   /protein_id="ABS89963.2"
FT                   /translation="MKTDDVIEHIEKQNVTAVELLDEFDPNLQFKFAKAMTALKQVIDD
FT                   VRILYPDASYYIQDDAFYLMLGDSHSGDHKQNANTNLIALTDNHKLAGCISGGGF"
FT   gene            743977..744693
FT                   /locus_tag="A1S_3539"
FT                   /old_locus_tag="AS1_3539"
FT   CDS_pept        743977..744693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3539"
FT                   /old_locus_tag="AS1_3539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3539"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89964"
FT                   /protein_id="ABS89964.2"
FT                   /translation="MSEQKQNQNPKTKPRFPTTPEQVNSGLVEMAKKNDELEDKIKSQR
FT                   RQLLGCIIGIGVLGTAVAVLGGIIGLMPKVEYFQTVNNEVICKINPNDNPAFTDVNVAE
FT                   FASEGLLNAYSLDYQNADADINNTLRRYFTDRGRESFITTLRQSGLIDQIRNNFLVLRT
FT                   SKLQTPEVAKNNGIDSRGNRFWIVMQPVRMDYFNGKSQPADTRQYMAEIRVEVTPRDVY
FT                   NPKGLGIASIVLRAKN"
FT   gene            744711..745841
FT                   /locus_tag="A1S_0645"
FT   CDS_pept        744711..745841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0645"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11094"
FT                   /protein_id="ABO11094.2"
FT                   /translation="MQLKFKNLALSMALVVAGSSYAEPSQQQSGQQQQATAQQTVPSSQ
FT                   PQGNNQSQGNNQQQGQQQANNQQAQAEAPSYIGTPPPNTINLGNVQTFGNSFPPPVRVA
FT                   KTKDEIVAEILSMELTPQQVKNIKDLLLRQERDASTPYTTTARPIVRSVPIDLSPAAQP
FT                   PVLRLSMGMLTSIVFSDLSGNPWEIEKVTFNKELFADDRPEQGQGQGEKSDISSKNTNI
FT                   FSIEPLTATAYGNVTVRLKGLSTPVIFILATGQNEVDMRIDARLAGRSPTSVNSSLRAN
FT                   MNATGVMSSIDSQTLLFLDGTPPVEAERIRTSDTSVEAWNFNGQYIVRSNDTVLYPSYK
FT                   STARSTGGTSIYVYPDPINQVTISRNGQPTTVYFNN"
FT   gene            745851..747482
FT                   /locus_tag="A1S_3540"
FT                   /old_locus_tag="AS1_3540"
FT   CDS_pept        745851..747482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3540"
FT                   /old_locus_tag="AS1_3540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3540"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89965"
FT                   /protein_id="ABS89965.2"
FT                   /translation="MSAENNTNKPDDIQSSQEQFTGQNEATHSTHNSDPERRDPLTPEY
FT                   ETFEENQTATWIPRNDADNRINMKFGDKFKLYWRENGVFRFIILTVGAVILLILFFLMK
FT                   FIFRQDAPEQINPANIKMDAPQSNTKQAEYVSQEQYTAIRKQEEILARQAAAKGESYTP
FT                   RNLVIAPTDAQGQVVLPSTSNAQYGAMNPQQAGLMNSTGQLTYANPAVAGQQGQMQQQG
FT                   MQQGQPQPQYIPVQTQDYVSDVAANYEQNNNQFANWFDEESQRQITANKEQEQTINSFV
FT                   LKQIGQITGAEFDANGNMIPKSKDKKTKAGSYAQKTYYTAPASADNSGNGSNTGNGANN
FT                   AQDASPFSANGNNPVNGKKSGTGKVLIPAGTRSIARLLGEVNTDDGNQVFAQVTNGPLK
FT                   GRKVFGTVSKSNDNIQFKIDRVLSDGKNKEFSIDAVGQTLQGSYGMATYIKRHTLQRYG
FT                   ALIASGIAQGYGQAYSQAYGQQTYTSGATVIETKDPSGERIAGNIIGQVGQNASQEIQQ
FT                   IGRKQVTYITPVGTVFYIFFNQDVTE"
FT   gene            747507..748361
FT                   /locus_tag="A1S_3541"
FT                   /old_locus_tag="AS1_3541"
FT   CDS_pept        747507..748361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3541"
FT                   /old_locus_tag="AS1_3541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3541"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89966"
FT                   /protein_id="ABS89966.2"
FT                   /translation="MSNEPQQPNYDDDFDYQTQTQQPVDSTDRRNKFILIGAVIFAICV
FT                   LTFMFISTKMKKAPPKDQTIEAPAPDQTAYQPPPQPVQMQPQQPVGYSQNSMVAVPETM
FT                   PKSTDPVNGTVMVKDMTGKDVDAYSVDGQNAIIQFNNANGLQPIPLNMPAPVAPNINNQ
FT                   ANNFNEQRVITLEQENSQLKAQNNSLRTLAQDQQLKIGQYQALIKNARANNGANIVQLR
FT                   ETKKGVALNKALPRGQEVVATVGNRVWLSDGKQYNSYGVGQRLPTGYRVLDVNEMAGEA
FT                   SFK"
FT   gene            748400..748978
FT                   /locus_tag="A1S_3542"
FT                   /old_locus_tag="AS1_3542"
FT   CDS_pept        748400..748978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3542"
FT                   /old_locus_tag="AS1_3542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3542"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89967"
FT                   /protein_id="ABS89967.2"
FT                   /translation="METIDILQNMGFFFVAATELLRYFFVVSGFYIFLHALVDFVQISQ
FT                   PALAGRFMTQIRRPSAFGASMKLIIAAFLCTLGLRLQLLDIVGSLISDTTPAGVTYYDY
FT                   TQYTGSSYTDELNLAVLVIIGVLQFFGLLAIGRGLWIWRDNADGIAKLSVGQGTMFMIG
FT                   GMLAYKVEVVHAFLASWFGLDFFKIIGLT"
FT   gene            749083..749502
FT                   /locus_tag="A1S_3543"
FT                   /old_locus_tag="AS1_3543"
FT   CDS_pept        749083..749502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3543"
FT                   /old_locus_tag="AS1_3543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3543"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89968"
FT                   /protein_id="ABS89968.2"
FT                   /translation="MSKINNLQKVKNVGQDIYAQLGVAFTMGSLGITNAIAAPDTTNLT
FT                   GGNRQGQATGGDSVGDIRDRGINAMDAFMSFLQYAGMLVGFIVFVMGVIDFLNIGKPGK
FT                   DATAGKAGLKLLIGAVLAGAGYFYWSAANSASGNV"
FT   gene            749581..750339
FT                   /locus_tag="A1S_3544"
FT                   /old_locus_tag="AS1_3544"
FT   CDS_pept        749581..750339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3544"
FT                   /old_locus_tag="AS1_3544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3544"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89969"
FT                   /protein_id="ABS89969.2"
FT                   /translation="MINKSIQLDTIGDTEKFLHALKIDSSSFFKKHDHRCYFCDFRDLR
FT                   FLEVHHLDGNHNNNNESNLVPACTLCHRAHHLAWVLTDRSGLLGICHELDQIRINHLQR
FT                   FVLVLANHPDPKLKAFFIKGGMFQTVLDNIAMEYYRPDVDEKTIRESIDSEFPQATIDL
FT                   KESLFTDRINAIYVRQSLSSNDGLERLIYAINEVKQSNKTIAPNAFFPFVLLYNQNIFS
FT                   KEQIDYYLSLDEFNPEKWTQLFEEQLLKAG"
FT   gene            750339..751358
FT                   /locus_tag="A1S_3545"
FT                   /old_locus_tag="AS1_3545"
FT   CDS_pept        750339..751358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3545"
FT                   /old_locus_tag="AS1_3545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3545"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89970"
FT                   /protein_id="ABS89970.2"
FT                   /translation="MEVIMIESNLNPFLFRALPNIEHACIGNAYDLMANQFEQAPINVQ
FT                   EWFHLHTGFIDTGLELTDDVETAFVTILSNQVVRLLEQTRLPLFSTPDPELEPFIADSM
FT                   DDELCLVSISLENLTAQQIKIRTLLGFGPQLVILKSNSDFFDMHGFELVVTDSFPCTSF
FT                   RLFIESSKRNLLSTFNKTFMLQQNTIANELLNGPAIYSDLFKQALRQQICSKLCAEDDL
FT                   EISVHDKELCDDAGNLYFHIGFNQTFKHQFFHLVSKNILISPFHIERLIGEGNELLETP
FT                   AAAQSNLESLVTFMLVYMAIYEKEALDSINSTNINDDDVLNMIMSKLEQHSNNYPSFS"
FT   gene            751375..754647
FT                   /locus_tag="A1S_0646"
FT   CDS_pept        751375..754647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0646"
FT                   /product="IcmB protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11095"
FT                   /protein_id="ABO11095.2"
FT                   /translation="MVSTATPKRADTRSTANNSKANTKPTKVKRRSSLVSSLELILVSL
FT                   AKMFKASANDYCEIETVDGRFNLVMQDGTMVTILKYEGIRSTIDYHQTFMGEIDRLNNY
FT                   LKNNLNAVNSHKIMVLFRRDDAVNSELNRIVDIQKNTARKVNIRLDSFIDEMRDVYAPY
FT                   IYDEEIYFALMTNPKILDKSEIAGDYRRTADIVKKYNIPPMSDAQNLLHGLSSLKSIHD
FT                   TFVSGVISELEHQDFKGVVDKLDVSAAITATGRMMNPRYFDPNFKAFLPNSGMPIPLRW
FT                   KNRTDPQDLSHVLYPRISDQLMTQTITPLNSKDKAGDITVPKSAVQCGDMVYVPIPLKT
FT                   PPSPSFSGTSSVMPTFIDFFDRMNQQTTETSDGSSRAIPYAVSFMLSGDGMASIGIKRA
FT                   VTAVVGWQGAANQQIKAAGDSLQRYKDYGGCVVGLQVSLMTWDEATPRGIERLQIRRSK
FT                   LWRAAQNWGHAVPLERTGDAVKAYLTHFPLSTMHHAPLCPAPLPDALHLLPLDRPASPF
FT                   KKGTMVQRTPCGKLIRIEHFSEELAYNYTIISGTMGSGKSMRMNDELFEACLAAGLERL
FT                   PYIFISDVGVSSSGLVYGIQNALDPSRKHWCVYKRISKSAKDAINPMETAVGLQYPLSN
FT                   EFDQIRAFLVTLVTPAENEHPEPEMSAVISLIIREAFKFFATDNDQSQPKIYQTGQSHE
FT                   LDLLLRELRISLSETLPLHDLALLCHQLAEQIVSNEEIQQVRKNKLLRARNLAHRYAMP
FT                   ILSDLITVAKKEEIQRIYGDYKTSHGENILDAVTRSLSQAANDYPNFSTFTQFDISDAR
FT                   IASVDLQDVIVKNNRKNNSLFFQIVRMFYKKRIAYSEEDLTRGEIPKDYLDYYSNLVAE
FT                   LKIDKKYMVFDEMHNIKSDNFMIAELERDSREIRKWGIAYYLSSQYISDFGILTKAASR
FT                   FVVCSQGSPEERKDIVKYLQLTPAQEKRLTSIVGLRSSGMTYLSKVINERNDQYIQFFT
FT                   SMIGPKRLWLLTTNPEDQAVRSIMRKKHDLETCIDILATVHPRGVKTIVNTLKEQRALE
FT                   ITSSAALSLEEEENIKLGIYTELVDEAIKTYNFIQSQKLRVA"
FT   gene            754709..755119
FT                   /locus_tag="A1S_3546"
FT                   /old_locus_tag="AS1_3546"
FT   CDS_pept        754709..755119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3546"
FT                   /old_locus_tag="AS1_3546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3546"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89971"
FT                   /protein_id="ABS89971.2"
FT                   /translation="MNFHGNSLSQIQDKIQILIFESDKEESFLGETIHFYQFWIELLFF
FT                   LNQKKEVEIDMSKIQSSEDLQDLAELAYGHLYTSFMEKYGNDYYQTVKPLREYLDSLPA
FT                   FNPEDPNSYESTATKEQHAKIICKFSNTGLKQ"
FT   gene            755129..756706
FT                   /locus_tag="A1S_0647"
FT   CDS_pept        755129..756706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0647"
FT                   /product="IcmO protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11096"
FT                   /protein_id="ABO11096.2"
FT                   /translation="MATPRFKGASDRFKPKDQRVDTRDIITKIHVALQTSEGSMYFAIT
FT                   ITIVVFVSFFFPLLLIIATPIAILITRKYLIPQLRYINMPYRVPKHANMPDGSFDGVAR
FT                   KVNLRKNPEKAYGQGVYYYGIDRQNHQQIWKSDSDERVHDLLIGTTGAGKTETIKMVLT
FT                   NPLLQNSGFILSDAKGTTELVAELMYLLTRFMRQDDYLVTNFITAGRDLLVRQEDKMTN
FT                   TFNLMSYTSAAMLSEQLVYLLADSEGSGGDMWKDRTITYLTATTHLLTFLRDRGLLLLE
FT                   PKTYVEYQELNQLIRAAYGEDFDDNYKNFGEIYITAVSPLRAYLKSLAGFDEGKLYKQP
FT                   EKCVEQHGYVIMQFTRAISDLSFNFGHIYGTKSGEIDMFDVVLNRRCLINVLPALQNAP
FT                   PTIRMLGKLFVGSIKQMMAGALGNRIDGMVRNVIEAKITASATCFKIVLDELAYQIVKG
FT                   LSVIPAQARGLTFSLTFSAQELKDIFVADEAEGEAIVANTGTKTFGRINSGTEGLSMQA
FT                   LRNVWWTK"
FT   gene            complement(755227..755340)
FT                   /locus_tag="A1S_3547"
FT                   /old_locus_tag="AS1_3547"
FT   CDS_pept        complement(755227..755340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3547"
FT                   /old_locus_tag="AS1_3547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3547"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89972"
FT                   /protein_id="ABS89972.1"
FT                   /translation="MINIAIGVAIMSNKGKKKLTKTTIVIVMAKYIDPSDV"
FT   gene            756694..757866
FT                   /locus_tag="A1S_3548"
FT                   /old_locus_tag="AS1_3548"
FT   CDS_pept        756694..757866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3548"
FT                   /old_locus_tag="AS1_3548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3548"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89973"
FT                   /protein_id="ABS89973.2"
FT                   /translation="MDQVTQSVVNGYNIASSAMGINYQSSTNVNIEKQDRISYQDIASQ
FT                   QEGQFTIVVAKKIDGGKEGGVFAIHAQTMFVQPPKLAKIRLNDFVSIEKELTYFDSKKY
FT                   DNELKNFAYQLAENKILQSCPNYKKHAIGALNQVDTHLESISKMAKLYETDVKSGFFAI
FT                   MRTMQNMLDSVQISGFSAPFYEVVDSTFANEIDGALDSIFTEIKLDTEEVDVVLNKTID
FT                   HIQDERSQDLLTKTSETIIDEIVDQYLNLDSSEIETIEAVNAYIEALPNVYDDQLYSEE
FT                   FATTVREHLKQHDIYIQSLDIPSFEDLLELDQCAAEAQKSIFSDDFEEDDLFSDAQERY
FT                   NYVTDFIKCKNLVFEEKEKEIESEDQEILSKLEKYHEIVYRMISAKLKDK"
FT   gene            complement(759190..759483)
FT                   /locus_tag="A1S_3549"
FT                   /old_locus_tag="AS1_3549"
FT   CDS_pept        complement(759190..759483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3549"
FT                   /old_locus_tag="AS1_3549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3549"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89974"
FT                   /protein_id="ABS89974.1"
FT                   /translation="MTKKPTRYFYALLTSKDLNSTVKGEASIFAFKCPIHRTNWIDEMN
FT                   RRSHEYQAQPIVSNKAYRYLSGKTSDLEFHEIFDGSFKVYGVKAYQPTTPKI"
FT   gene            complement(759480..760109)
FT                   /locus_tag="A1S_3550"
FT                   /old_locus_tag="AS1_3550"
FT   CDS_pept        complement(759480..760109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3550"
FT                   /old_locus_tag="AS1_3550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3550"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89975"
FT                   /protein_id="ABS89975.2"
FT                   /translation="MNNIVADIVNSYEVKSFEQVKEFIAIEKLKYSFYNKCFKVVSLLN
FT                   LIGWPPFIVCVLVGLAAFCFSKAELVFFSTSLVYFLLLYCLIVTALWMYTASKADKESD
FT                   LLIKKNFPNYFNVYGHHDLLDEESLKYLLSTEVTLDEYKIIKSLAELSPEFNIKLKEIM
FT                   KFRNGVFTIYDYRVLNCKRLLSISEKENNRSKEQAEIDEFKKEIIK"
FT   gene            complement(760150..760611)
FT                   /locus_tag="A1S_0648"
FT   CDS_pept        complement(760150..760611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0648"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11097"
FT                   /protein_id="ABO11097.1"
FT                   /translation="MKNIFVLSLALLGAPVAYADFQGKVIKVADGDTLTVLVNGNTQER
FT                   VRLENIDAPESSQAYGQQARNFLNSQVYGKFVYVKSNKMDLYKRHIGTIYLGNYNINQS
FT                   IVQNGYAWAFREYLTDPNYIKYEQYARQNRLGLWKDNNPIYPSNWRRSK"
FT   gene            761009..761101
FT                   /locus_tag="A1S_3551"
FT                   /old_locus_tag="AS1_3551"
FT   CDS_pept        761009..761101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3551"
FT                   /old_locus_tag="AS1_3551"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3551"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89976"
FT                   /protein_id="ABS89976.1"
FT                   /translation="MAHGTGLLSDQKLCLRSKQNAEAKLNRFGP"
FT   gene            complement(762204..764054)
FT                   /locus_tag="A1S_0649"
FT   CDS_pept        complement(762204..764054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0649"
FT                   /product="putative phage primase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11098"
FT                   /protein_id="ABO11098.2"
FT                   /translation="MRLNISEYDARQIFANYLRETAELDITADQLKVDGTRHYVKCLKR
FT                   SQKNKHSKSGWYRLNFAFDVPSVIWGNYNTGNKEVWHLDPKLLKKESNLSLQELRKLER
FT                   EKKQYEIRMRRNHRFQRTLQRIAKTWSRIEYNRAQPVQSIHEHPYLKNKAAFPEGYNLG
FT                   LVRIIKKQPLFAKSLHIAISRVVKKAEAKGLNIDYIKPKYFQHAWFQNHHIRPTLINAY
FT                   YDVDLKIQNCQLISALQDRETGKLKFFKGNLTHGRKDGVFCPIHRLPAQDEKIFALTEG
FT                   FATGKSFARICKEKPNTIAAFDKESLISVAIAIRNKWPDTTIYIAADNDLNEQLNGKTK
FT                   TNGGLIKAYEATQAVSGYVLIPPIKKDELTLSDWNDLELKYGTQHCREIIKQQLIDIAE
FT                   FNQSRNMSNFKMPAMASANIHKPQINIQKTTAALDPAIFTSWLIHLMENQKEKDVDLSM
FT                   AKDIVQAVSSNEQKQVLPMLKVICQKNGWHDLDQALNLMSDKVEIRNNNEKEALNRVNM
FT                   TLQAIFYASNNTTIDASKKEKAEEMLKNTIEFIGYLPISRAEKVNIYTNIKDNIFEATD
FT                   EAEPRWSKTLLKLCKETISEMENKQVNQFENQKSLSYERT"
FT   gene            765518..766249
FT                   /locus_tag="A1S_3552"
FT                   /old_locus_tag="AS1_3552"
FT   CDS_pept        765518..766249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3552"
FT                   /old_locus_tag="AS1_3552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3552"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89977"
FT                   /protein_id="ABS89977.2"
FT                   /translation="MLKKIGKAFVYLYVTLPLKGIAGNLGYKHLKNDYEFNKQQYKSLK
FT                   KIHCPACFKSIVQTSQIKLTDNEIVEHKAPAKAVKVTLKCANPECSFENSFISGPSKKE
FT                   ISEKTNNAILAVGRESAKRIFEVIPVGQVNNSIKEHYEMAIMLRNISIFCVIGCFAFTF
FT                   YQIFFKDNSLFFTALSAFSWLVIGLGIFLNALKYSHKSWQAQTLKVFEQQSQFYFWFKN
FT                   HAWFSKPKYWRISGEGKNATK"
FT   gene            766236..767063
FT                   /locus_tag="A1S_0650"
FT   CDS_pept        766236..767063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0650"
FT                   /product="conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11099"
FT                   /protein_id="ABO11099.2"
FT                   /translation="MLQSKRLFYFLGCMVCVSGITNAKVPQMSSQQLGLYANQLNGSPR
FT                   ANFVNSGTTSNHSINPKTANTSVVLPQRRTGNYTTISYTNSPAPEAKQLEIVQQSQTSN
FT                   TNWVQEYAFRGNVAAPEVLNNYSYQKPKVNINYVRGREANLTCVIAAARSEGVPLYVLL
FT                   GIQSKERGRNGEVNATNDMGHFQVNKQHFRNGGMFNPQDMERARTDGCYNAVLAAKILR
FT                   DRLSTKVASVDFWTRAAAYHSWTPSVNARYRPDLIRYSMQWKQWLTQNGINPN"
FT   gene            767080..767373
FT                   /locus_tag="A1S_3553"
FT                   /old_locus_tag="AS1_3553"
FT   CDS_pept        767080..767373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3553"
FT                   /old_locus_tag="AS1_3553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3553"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89978"
FT                   /protein_id="ABS89978.1"
FT                   /translation="MVQKHISQNYIFKKLVHLTNLNDDIETLITLFKEKDIVVDSALIE
FT                   SWLSEEGQSNFKEISENNLFSFFEILFSVKKEALSKDINLFDLSYIFEDIRN"
FT   gene            complement(768039..768803)
FT                   /locus_tag="A1S_3554"
FT                   /old_locus_tag="AS1_3554"
FT   CDS_pept        complement(768039..768803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3554"
FT                   /old_locus_tag="AS1_3554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3554"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89979"
FT                   /protein_id="ABS89979.1"
FT                   /translation="MYGECIATVLVATPEEISIPDDDNLILNISLYNIFNLQNSHHYNE
FT                   KQIGIEIQHCIKNFTPAHTDLSASSRDLINEQLSKMLVIANAVQKTVEEKELFKDGEQF
FT                   IALDLKGNPIVFNSTNAINNRISLGYGIVDAHDHLLTTFSGHLKTENIVRFLECLAQSQ
FT                   SNIENYYNNFLSNRILSFLDGTLNFLDCSDPEFALEKCRKLYEESKSALLDIIDEICIS
FT                   DLNKFLFNQFEKSINYVCLDFKDNLQDYCRLR"
FT   gene            complement(769266..770369)
FT                   /locus_tag="A1S_3555"
FT                   /old_locus_tag="AS1_3555"
FT   CDS_pept        complement(769266..770369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3555"
FT                   /old_locus_tag="AS1_3555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3555"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89980"
FT                   /protein_id="ABS89980.2"
FT                   /translation="MNVKPLDYLATIEHIFEHVKRTFYQTVADTKSINKGRLNAPITEY
FT                   KWHPCVFLPTNLWQEVLRPTIMAKLYEQVQINKTKDPFVIDAYFANFVAAFTWRYTKSI
FT                   YRFDEYTFECLIKHSAGKYLDHQLLTNLPEGCIYIDLATPLNIADHKVYGVYAILDLSS
FT                   NSIDTLKNTLPDQLIITLDTHNPFEENNFALLKPLPTIVFDIKRSGKVSQQIKFKWGIN
FT                   LESPEELNEHIAPVISLISSICTDEIAIDNFTKNSTRQNVTKKPSFKDLEAAYWQKGEY
FT                   RVNAPANHKMWRIGVKYGVDYRAFVARQQKYESKTEYRITGVHWTAYIQDYEIRLKFMP
FT                   PRMNSPVEIDEQINNFFDELNASNSLK"
FT   gene            770543..772804
FT                   /locus_tag="A1S_0651"
FT   CDS_pept        770543..772804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0651"
FT                   /product="TraB protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11100"
FT                   /protein_id="ABO11100.2"
FT                   /translation="MTDLVIVESSNKVDSIQGYLDSLFGRGKFKVSFSKGHIRDLPKDS
FT                   LGLTAEYTPNYVFNDSGASRVRELKALVEKSQKVYLATDPDREGEAIAWHLKTVLRLNE
FT                   NYGRVTFQEITKTAVAQAMGNERKLNMQVVQAQETRRILDRIIGYIGTPAFTLICGEKQ
FT                   IAGRVQSSIVWYLVDLENKIKQFSSVLHFGVTFNFGSVDESWEAKWDTSNFITKLDPFV
FT                   IDRKLAEEVSKLREFTVETFEEKPEKSSPPAPFTTPTYLRAAHVQLKLKTKRAMEIAQK
FT                   LFEDGHITYIRTDSPNLSDDAIQAIREFALKNKLPIPATPRKFKSKALAQEGHEAIRPT
FT                   DFNQLKVSDDSTIQAVYQMIWLRSVACQLDDATFTARIVRMKGRQLVQGREVFVKARGR
FT                   KLIDQGWLRLTAKLNFSEDENEDIPEDAAQELNNPVPLLQKAGNLVALKSDLNEKRTEP
FT                   PRRHSEASLIKFMEDVGIGRPSTFVSIVSKIIDHGYVHLDSKNKIHATDLAQRLVGKIS
FT                   NQFEFCNLKYTAELEGKLDLIAHGENIGKRLLKETHLKIETQAKESIKNLDQGGPKQYC
FT                   SKCSEQLVNMTSANGKPYFKCTNLKCGHMMMNQDGIAIDRESLTSEFKCIVCESGLISR
FT                   SGQNGEFFGCSGFFKKRNKCTASYQKKPDGTPDYQAFLAKRELKESKQEQGEKPVPKNT
FT                   EKKEKEFNCPECKALLQQRTGKSKTTNKKWEIWSCSSPNCKNEYWGERNKPIFDKKIVK
FT                   "
FT   gene            773871..775658
FT                   /locus_tag="A1S_3557"
FT                   /old_locus_tag="AS1_3557"
FT   CDS_pept        773871..775658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3557"
FT                   /old_locus_tag="AS1_3557"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3557"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89982"
FT                   /protein_id="ABS89982.2"
FT                   /translation="MPVNNDKITTIDCFPNDNISRVVYRYGGLVRNEDNDSTNPFVEVL
FT                   LIEIRKSDQWLFLDKCSTFLVPVLDLDAVQHGSIWDGNVLTNYTYRFSGKLITKRFSFD
FT                   FSNNKPRNIKLSDKIPDTSEYYIPLKNYFLPNKVDYVLQGYPFTKYTNDSYRKVNHCLM
FT                   HSNDGTQVITSSIHILHSLFVNRKDIRGLLLSTSGQSIINRFLESYTTEVENDNIEYKI
FT                   KIRKPYEDIGETAIIFLANLALNPYVQTIVDKIQRSMEVTEFHHLQHGTGIRYPIVYPP
FT                   HPTKLFLEAEGIWLDDNKTRFFITRVKKFDPINDHMIDVNKDLTNTVSKTDEKNPRPRE
FT                   KSQNKNEHINTQKPPSRTSGEYRKRSDVETGNTQNILKYSFNEPANDPIEVGTSNHPYS
FT                   DKSEDVETSSDEPYGNKNTKTKKSETTDNPPSRDERFDIQYIIQSLNHLTLDTTSPLER
FT                   VYSIDILGNEIHGFNLLQIKKLVPQPKHPSWIDAEFGRKLLFLKLELKDQHDQYYLIDI
FT                   HKNKSHEAFCAFIIVSPHKLTREQIKNICIELENAKGIKKWTLRCESFTKKIISIKHSS
FT                   ATPDEWKNRFKNLFSTLIN"
FT   gene            complement(775285..775446)
FT                   /locus_tag="A1S_3556"
FT                   /old_locus_tag="AS1_3556"
FT   CDS_pept        complement(775285..775446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3556"
FT                   /old_locus_tag="AS1_3556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3556"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89981"
FT                   /protein_id="ABS89981.1"
FT                   /translation="MLHGFYFYVYQLNNIDHADLSIPVLKITISFQILHQSKMDALVEE
FT                   RVSLFEVS"
FT   gene            775999..776232
FT                   /locus_tag="A1S_0652"
FT   CDS_pept        775999..776232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0652"
FT                   /product="putative ferrous iron transport protein A"
FT                   /note="FeoA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11101"
FT                   /protein_id="ABO11101.1"
FT                   /translation="MYLSDLNAQQRAIVTKVQASLILSNRLETLGFIPQAEVRVITKGI
FT                   FGGDPILVQIGFTRFALRKSEAKCIYVEGLNS"
FT   gene            776229..778076
FT                   /locus_tag="A1S_0653"
FT   CDS_pept        776229..778076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0653"
FT                   /product="putative ferrous iron transport protein B"
FT                   /note="FeoB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11102"
FT                   /protein_id="ABO11102.1"
FT                   /translation="MTTDLRIALVGNPNCGKTSLFNHLTGTRQKVANYAGVTVEKKVGH
FT                   FTLPSSNKVRILDLPGTYSLSATSPDEAITRDVCNGLTEEAQQDAFICVVDATNLKLHL
FT                   GLVLEVLALGRPVLVVLNMMDEARRRGIQINIEKLSQHLGVPVVETVAVKSSGLTQLID
FT                   ALDKEVFHTPHTDFTAKIDSPQKHIEYVLATTITDQGKVDTRTEFLDKILLHPIAGLLI
FT                   LAITMFIVFQAVFAWANPFIEMLENLFSFIGEFLGSIITQPLLNSLVVDGIIGGVGSII
FT                   VYLPQILILFFFIFVLEESGYLPRASFLLDKLMVSAGLSGRAFIPLLSSFACAIPGIMA
FT                   TRTITDRTDRIATIMVAPLMTCSARLPVYALLIAAFIPNQTVAGIFNLQGVVLFGLYIA
FT                   GIVSALVVSLVMKLFRKNKENSLFLMELPAYRMPNWRSVFLGVYERAWIFIRRVGGIIF
FT                   ALTILLWFLCTFPTPPENATLPAIDYSFAGMLGHLLQPIFAPIGFNWQITIALIPGLAA
FT                   REVVVAALGTVYALSGSEDAQAETLVNLITADGTGWSLATGLSLLVWFIYAPNCLATLA
FT                   TIRRETGSMRTVTIMVVYMFALAYLMAFFTYQLASYYWG"
FT   gene            778319..778627
FT                   /locus_tag="A1S_0654"
FT   CDS_pept        778319..778627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0654"
FT                   /product="regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11103"
FT                   /protein_id="ABO11103.2"
FT                   /translation="MRLLVVAGAEGMASGQIAEALDGAAPSRISFHLSHLENAGLIYSR
FT                   REGRQIIYCAIWSTLADLVAFLMHDCCQGHCEYCDKAIELFAKCTGEPTEGYIKIGE"
FT   gene            778665..779627
FT                   /locus_tag="A1S_0655"
FT   CDS_pept        778665..779627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0655"
FT                   /product="putative efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11104"
FT                   /protein_id="ABO11104.2"
FT                   /translation="MENLRSLLEDHQVKIYFITIFIGTIFGLTISGVSSLESAINPALA
FT                   LMLFATFLQVPIAEIGKAFKNLKFISALLITNFIALPAITAGLIQFLPENPLIRLAVLF
FT                   VLLAPCIDYVITFTHVGKGNARLLLAMTPILLLIQMILLPVYLGTLLGDEVSQLVEMEP
FT                   FLHAFIWFIIVPLTLAGIVQFISNKSESLATLSAPLNLLPVPATALVLFIVLASVTPQI
FT                   GLAQSAALQALPIYIAFAIIAPFIGWAIASLFKLESSSARAVSFSASYRNSLVILPLAL
FT                   VVPGSMPIIPAVILTQTIVELCFLPIYTRLIPRMFPSKD"
FT   gene            complement(779873..780802)
FT                   /locus_tag="A1S_0656"
FT   CDS_pept        complement(779873..780802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0656"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11105"
FT                   /protein_id="ABO11105.1"
FT                   /translation="MSCHRMIAAGCADLCADCYWHKSLWNKFDQNQNAFEFTYLKQQYE
FT                   SYIDWLEKKVGSHKATLYINKHTHFFLKTEVNWNQSVPTPMQLLAVLRSSGLRKFELVM
FT                   QWLEEMHGIQVDTDNKKGCSERDQMEKLVQSILQPSLAYDVVFGYKNKLEEKIKRGDTS
FT                   IRSARLAVKPAVALMLSIGSESTQLPNLEHIKAYLADYSGQAAALTGFINFLNENYGTS
FT                   IDYLKLKKSDFLRIKQKQKLEKAIVALAQTDLSNREELIGWVRNGLRYFHQLSYIDSLK
FT                   VKVEMITEVNNGFAVRFNEQSYWLPNNQ"
FT   gene            781094..781411
FT                   /locus_tag="A1S_0657"
FT   CDS_pept        781094..781411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0657"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11106"
FT                   /protein_id="ABO11106.2"
FT                   /translation="MTKLKYTPEIRERAVQLVIESEKDYPSNWAAVSAIAPKIGCTPET
FT                   LRVWYQKYLDQQNPIKVQQFSDQERIKQLERENKELQRANEILRKAAAFFAQAELDRPY
FT                   K"
FT   gene            781411..782313
FT                   /locus_tag="A1S_0658"
FT   CDS_pept        781411..782313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0658"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11107"
FT                   /protein_id="ABO11107.2"
FT                   /translation="MVDFIHNNKALYGVDAICRILPIAASTYYRTLDLVNNPEFRAKRA
FT                   LHDLHHAEQIKRIWKESLGRYGIRKVWQQLRREGYVIARCTVVRLMRKLNIQGVWRGKN
FT                   KQTTRSRDDQKRADDLVKRNFKADHPNHLWVADFTYIQTNSGWVYTAFIIDVFSRAIVG
FT                   WKVSTRMNTDMVLDALEQALHDRGMPKNVIHHSDRGVQYLSIRYTNRLEAANLRASVGT
FT                   TGDSYDNALAETVNGLYKTEVIEYLKADWQGLADVQLATLNWVDWFNKKRIHSALGYVS
FT                   PFDFEAMYYDKINPLGQVA"
FT   gene            complement(782608..783618)
FT                   /locus_tag="A1S_0659"
FT   CDS_pept        complement(782608..783618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0659"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11108"
FT                   /protein_id="ABO11108.1"
FT                   /translation="MVLVEALWGKWRALTIDLDKGVDAEKFDALLSHSIETRQNIQQSM
FT                   LSSFVSEIQPNYDPKQTIPWVLSLGTRNRSNTSGRQVCVECLKSRENPPYFRLMWRMGW
FT                   HCSCDRHQVSLIDHCPECGVTLQAFKTDLEHGCLAICTACGFDLRHCKQSQNINLNSLN
FT                   FQNKADQVLKQKVGFYNQSIITSQEWFEIARVWLSEIRFLINTSNKNVIQLFESFDVNL
FT                   HLSHPVTPLAFEYLNTQERIVLLSILDQIMDIPCDLLVQRSNEYGISHANFWDKRKKLP
FT                   VQLQQMKDLMIKPTRRYPVSRAAITVTKPKSKASVQRQWLNLLRRSNNSGARLID"
FT   gene            complement(783750..784472)
FT                   /locus_tag="A1S_0660"
FT   CDS_pept        complement(783750..784472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0660"
FT                   /product="Transposition Helper"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11109"
FT                   /protein_id="ABO11109.1"
FT                   /translation="MGKTTIIHEFARQYYTKTVSDADMDLLSVTKPVLPILAPAKANVK
FT                   ELYINILNHFFVPFRASDPEAKLRNQAVHLMRKYETKMLIIDEIHNCLTGSAKLLPEVM
FT                   NTLKNLSNELSLNVIGVGTREAITILHTDSQYASRFDVVNLPKWELNQDFLRLLMSYVR
FT                   LLPLKKQSNLASKEIATLIFEVSGGNLGDLNRLLVECAKEAILQGEEEITYDIVHKFKW
FT                   LKPTEGLRNIRNINLSVL"
FT   gene            784605..784781
FT                   /locus_tag="A1S_3558"
FT                   /old_locus_tag="AS1_3558"
FT   CDS_pept        784605..784781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3558"
FT                   /old_locus_tag="AS1_3558"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3558"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89983"
FT                   /protein_id="ABS89983.1"
FT                   /translation="MPLSPRNCGLFFVCVWHDLATGGSAKHRLSMALKLVLWFGDAMID
FT                   ADTMLRSFVCSWY"
FT   gene            784871..786073
FT                   /locus_tag="A1S_0661"
FT   CDS_pept        784871..786073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0661"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11110"
FT                   /protein_id="ABO11110.1"
FT                   /translation="MLTDTKLRNLKPRDKLYKVNDREGLYVAVTPAGSISFRYNYSING
FT                   RQETITFGRYGVGGITLAEARELLGDAKKMVAAGKSPAKEKARDKARVKDAETFGAWAE
FT                   KWLRGYQMADSTRDMRRSVYERELKPKFSNQKLVEITHEDLRALADAIVERGAPATAVH
FT                   VREIVLQVFRWAIERGQKVENPAELVRPTSIARFEPRDRALTPEEIGLMYQYMERVGTS
FT                   PTNRAAAKLLLLTMVRKSELTNATWSEINFSEALWTIPKERMKRRNPHLVFLSQQALDI
FT                   FIAMKTFAGGSDFVLPSRYDSDAPMSAATLNQVLTLTYKAAQKDGKSLTKFGPHDLRRT
FT                   ASTLLHEAGYNTDWIEKCLAHEQKGVRAVYNKAEYREQRAAMLQDWADMIDEWTSGGSK
FT                   G"
FT   gene            complement(785564..785680)
FT                   /locus_tag="A1S_0662"
FT   CDS_pept        complement(785564..785680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0662"
FT                   /product="phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11111"
FT                   /protein_id="ABO11111.1"
FT                   /translation="MRVTAFHPLLWNRPQRFAEIDLAPGRIGQLALAHHRQQ"
FT   gene            786447..787274
FT                   /locus_tag="A1S_0663"
FT   CDS_pept        786447..787274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0663"
FT                   /product="putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11112"
FT                   /protein_id="ABO11112.2"
FT                   /translation="MALDLMAAFTELPPPIDYVLPNMVAGTVGALVSPGGAGKSMLALQ
FT                   LAAQIAGGPDLLEIGEFPTGQVVYLPAEDPPAAIHHRLHALGAHLSAAERQAVADGLLI
FT                   EPLIGKCPNIMAASWFDALKRAAEGRRLMILDTLRRFHIEEENASGPMAQVVGHMEAIA
FT                   ADTGCSIVFLHHASKSAAMMGSGDQQQASRGSSVLVDNIRWQSYLSGMTQGEAEILGVD
FT                   DCQRGYFVRFGVSKANYGAPFQELWFRRHDGGVLKPAVLERQCKVKRRQREEA"
FT   gene            787261..788142
FT                   /locus_tag="A1S_0664"
FT   CDS_pept        787261..788142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0664"
FT                   /product="replication C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11113"
FT                   /protein_id="ABO11113.2"
FT                   /translation="MKKPKHDLTHVRHDPAHCLAPGLFRSLKRGDRKRCKLDVTYTFGE
FT                   DESMRFVGFEPLGADDMRLLQGIVALGGPNGILLTPEPTSETGRQLRLFLEPRFEAIEQ
FT                   DGLVVRESLTKLLSETGMTDSGDNIKALKASLLRMSNVTILVTKGRRQAAFHLMSHAFD
FT                   ETDGRLWVALNPRIAEAILGHRPYARIDMAEVRVLQTDPARLMHQRLCGWIDPGKSGRV
FT                   ELDTLCGYVWPDEANAEAMKKRRQTARKALAELAAVGWVVNEYAKGKWEIKRPGPTATA
FT                   PVYRRNVPLLPS"
FT   gene            788861..788968
FT                   /locus_tag="A1S_3559"
FT                   /old_locus_tag="AS1_3559"
FT   CDS_pept        788861..788968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3559"
FT                   /old_locus_tag="AS1_3559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3559"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89984"
FT                   /protein_id="ABS89984.1"
FT                   /translation="MSIAGRFGDDYGYVAKNRCLFDDKTLYVRYALDFQ"
FT   gene            789504..790283
FT                   /locus_tag="A1S_0665"
FT   CDS_pept        789504..790283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0665"
FT                   /product="putative mating pair formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11114"
FT                   /protein_id="ABO11114.1"
FT                   /translation="MKSKILAAKKTALAVALATGFITTTTAPVQAGIPVIDGGNLAQNI
FT                   MTAIESVAQTLKQIEQYQTQLQQYENQLQNTMAPAAYIWDQAQTTINRLIAAQNTLAYY
FT                   ENQLGSLDRYLAKFQDVAYYRSSPCFNGSGGCTPAEKAAMEENRRLASESQKKANDALF
FT                   QTVADQQKALKDDARTLERLQGAAQGATGQLQAIGYANQLASQQANQLLQIRTMLTAQH
FT                   NAEAARIAAELDAEARGDARAEQMRTWTFRPSPADNY"
FT   gene            790522..791967
FT                   /locus_tag="A1S_0666"
FT   CDS_pept        790522..791967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0666"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11115"
FT                   /protein_id="ABO11115.1"
FT                   /translation="MIIEVVAMRKKIALGGLMMVATMVLAEPAMAQELSSSGVMNDVLK
FT                   RFHDAAATWGPAIESAASRLFWTLVVISMVWTFGMMALRKADIGEFFAEFVRFTIFTGF
FT                   FWWLLTNANQGMNIAGTIVQSLQTLGAQAGGLSNSNLGPSSILDLGFELYNRTVQATSE
FT                   LGWRQMATALVMELMALAVLFVLALIAVNLLLLLASAWILLYAGVFFLGFGGSRWTSDM
FT                   AINYYKTVLGLAAQLMAMVLLVAIGKEFINHYYTQISENMASQELAVMLVISVTCLCCQ
FT                   KVPPMISGLVSGGGIGAAGGIGNFGAGAAVGAAVTAASMATGGAALAGKAVMGAAAGAA
FT                   GGASALQAAFQKASASMETGGDMSSMGSVVSSGGNGGGEAGTAGSSPFAQAAGFGDSGS
FT                   SSSGGGFAKAAKLATGTASELAKGVGSQVKQGFQERVSETTGGKLAASIRESMEPKEAS
FT                   QSGQFEGNSLGADSGPDSNEVRS"
FT   gene            792284..792508
FT                   /locus_tag="A1S_0667"
FT   CDS_pept        792284..792508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11116"
FT                   /protein_id="ABO11116.2"
FT                   /translation="MTTQHIIEPGQAVHQAAAILSSLEYINQAEARSLGPLAEAVANAF
FT                   MVVYYQAETGRATQADFQEAMNALRQACS"
FT   gene            complement(793093..793614)
FT                   /locus_tag="A1S_0669"
FT   CDS_pept        complement(793093..793614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0669"
FT                   /product="Bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11117"
FT                   /protein_id="ABO11117.1"
FT                   /translation="MALLGWLFIRQVFAPFLPADQLDSYIAGLILLAAAPCTAMVFVWS
FT                   RLTNGDPLFTLSQVALNDAIMIVAFAPIVGLLLGMSSISVPWDTLLISVVLYIIVPVIL
FT                   AQLLRRHLLKQGQAAFERAMQKIGPWSMAALLLTLVLLFAFQGEAIIRQPLVIAMLAVP
FT                   ILIQVFFNPG"
FT   gene            complement(793984..794433)
FT                   /locus_tag="A1S_0671"
FT   CDS_pept        complement(793984..794433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0671"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11119"
FT                   /protein_id="ABO11119.2"
FT                   /translation="MTERIYNVLILCTGNSARSIMAEALINTMGQGRFRAYSAGSHPTG
FT                   KVNPFAVEKVESVNYPTENLRSKSWDEYATPDAPKMDFIITVCDNAAGEMCPVWPGQPI
FT                   SAHWGFEDPAAVEGTDAEKRRGLRTNLPAHDEPRPPVRESASQNA"
FT   gene            794032..794532
FT                   /locus_tag="A1S_0670"
FT   CDS_pept        794032..794532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0670"
FT                   /product="protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11118"
FT                   /protein_id="ABO11118.1"
FT                   /translation="MCRKVCSKAPALLGVSAFDGGRVFKSPMRRDRLTRPHRTHFAGGV
FT                   VADGDDEVHLRCVGRGVLVPALAAQILGRVIHRLHLFDGEGIDLAGWVTAGAVGAEAPL
FT                   PHRVDESFGHDAARRIAGAEDEDVIDSFGHDVSLSGSGWGAMAMDERSVASSMTWPAAF
FT                   RSE"
FT   gene            795674..796411
FT                   /locus_tag="A1S_0672"
FT   CDS_pept        795674..796411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0672"
FT                   /product="Resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11120"
FT                   /protein_id="ABO11120.2"
FT                   /translation="MRRTKPVAAPMVARVYLRVSTDAQDLERQEAITTAAKAAGYYVAG
FT                   IYREKASGARADRPELLRMIGDLQPGEVVIAEKIDRISRLPLPEAERLVASIQAKGARL
FT                   AVPGVVDLSDLAAEAQGVAKIVLEAVQIMLFRLALQMARDDYEDRRERQRQGIELARQA
FT                   GRYKGRRADPKRRAQVVALRKSGYSINKTAELAGYSAAQVKRIWAEVSQAEAKQHGAFV
FT                   EDALTEADALAAVGQDERQEERA"
FT   gene            796969..797619
FT                   /locus_tag="A1S_0673"
FT   CDS_pept        796969..797619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0673"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11121"
FT                   /protein_id="ABO11121.1"
FT                   /translation="MAEQGKELPGYVQREFEEFLQCGRLEHGFLRVRCESCHAEHLVAF
FT                   SCKRRGFCPSCGARRMAESAALLVDEVLPEQPMRQWVLSFPFQLRFLFASRPEIMGWVL
FT                   GIVYRVIATHLVKKAGHTHQVAKTGAVTLIQRFGSALNLNVHFHMLFLDGVYVEQSHGS
FT                   ARFRWVKAPTSPELTQLTHTIAHRVGPIWNGKACWNGMSKTAIWPRMRWMTTR"
FT   gene            797682..798335
FT                   /locus_tag="A1S_0674"
FT   CDS_pept        797682..798335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0674"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11122"
FT                   /protein_id="ABO11122.1"
FT                   /translation="MFTLQTLPTSGDPFGDGIGKVAGSSLHAGVAARADERKKLERLCR
FT                   YISRPAVSEKRLSLTRGGNVRYQLKTPYRDGTTHVIFEPLDFIARLAALVPKPRVNLTR
FT                   FHGVFAPNSRHRALVTPAKRGRGNKVRVADEPATPAQRRASMTWAQRLKRVFNIDIETC
FT                   SGCGGAMKVIACIEDPIVIKQILDHLKHKAETSGTRALPESRAPPAELLLGLFD"
FT   gene            complement(798900..799715)
FT                   /locus_tag="A1S_0675"
FT   CDS_pept        complement(798900..799715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0675"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11123"
FT                   /protein_id="ABO11123.2"
FT                   /translation="MNKSLIIFGIVNITSDSFSDGGRYLAPDAAIAQARKLMAEGADVI
FT                   DLGPASSNPDAAPVSSDTEIARIAPVLDALKADGIPVSLDSYQPATQAYALSRGVAYLN
FT                   DIRGFPDAAFYPQLAKSSAKLVVMHSVQDGQADRREAPAGDIMDHIAAFFDARIAALTG
FT                   AGIKRNRLVLDPGMGFFLGAAPETSLSVLARFDELRLRFDLPVLLSVSRKSFLRALTGR
FT                   GPGDVGAATLAAELAAAAGGADFIRTHEPRPLRDGLAVLAALKETARIR"
FT   gene            799892..800377
FT                   /locus_tag="A1S_0676"
FT   CDS_pept        799892..800377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0676"
FT                   /product="putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11124"
FT                   /protein_id="ABO11124.1"
FT                   /translation="MLVIILKQTCNLSSASKALPIKCLPQSFYRRMQRFFAGQYFDYRQ
FT                   ISQLIFNMFSFDQVQLTLDRTNWKWGKRNINILMLAIVYRGIAIPILWTLLNKRGNSDT
FT                   KERIALIQRFIAIFGKDRIVNVFADREFIGEQWFTWLIEQDINFCIRVKKTSLSPII"
FT   gene            800464..800631
FT                   /locus_tag="A1S_0677"
FT   CDS_pept        800464..800631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0677"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11125"
FT                   /protein_id="ABO11125.1"
FT                   /translation="MKLYISALQLENGELLLVVSPQFNANAIQDYALRWEIETLFSCLK
FT                   GRGFNLEIRA"
FT   gene            complement(801009..801142)
FT                   /locus_tag="A1S_r04"
FT   rRNA            complement(801009..801142)
FT                   /locus_tag="A1S_r04"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(801307..804209)
FT                   /locus_tag="A1S_r05"
FT   rRNA            complement(801307..804209)
FT                   /locus_tag="A1S_r05"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(804551..804626)
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0678"
FT   tRNA            complement(804551..804626)
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0678"
FT                   /product="tRNA-Ala"
FT   gene            complement(804682..804758)
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0679"
FT   tRNA            complement(804682..804758)
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0679"
FT                   /product="tRNA-Ile"
FT   gene            complement(804818..806346)
FT                   /locus_tag="A1S_r06"
FT   rRNA            complement(804818..806346)
FT                   /locus_tag="A1S_r06"
FT                   /product="16S ribosomal RNA"
FT   gene            complement(806834..806967)
FT                   /locus_tag="A1S_r07"
FT   rRNA            complement(806834..806967)
FT                   /locus_tag="A1S_r07"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(807132..810033)
FT                   /locus_tag="A1S_r08"
FT   rRNA            complement(807132..810033)
FT                   /locus_tag="A1S_r08"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(810375..810450)
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0680"
FT   tRNA            complement(810375..810450)
FT                   /gene="trnA"
FT                   /locus_tag="A1S_0680"
FT                   /product="tRNA-Ala"
FT   gene            complement(810506..810582)
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0681"
FT   tRNA            complement(810506..810582)
FT                   /gene="trnI"
FT                   /locus_tag="A1S_0681"
FT                   /product="tRNA-Ile"
FT   gene            complement(810642..812170)
FT                   /locus_tag="A1S_r09"
FT   rRNA            complement(810642..812170)
FT                   /locus_tag="A1S_r09"
FT                   /product="16S ribosomal RNA"
FT   gene            812666..814114
FT                   /locus_tag="A1S_0682"
FT   CDS_pept        812666..814114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0682"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11126"
FT                   /protein_id="ABO11126.2"
FT                   /translation="MKLSVGLKVANSLSLTPQLQQAIRLLQLSSLELEQEIQIQLDSNP
FT                   LLEKVEDESLAESLSTLEHKETDDLTTELNADHLPDDLPVDTEWDDIYTHQSTALGTPE
FT                   FEEREDNRQVHLTLKEHILEQVNLLHFSKIDQLIAYCIVDALDDKGFLDAELEEIILAV
FT                   QHLLSEMDIDEEVEEDEVLVVLKHIQRLDPIGIGARNLAECLKVQLEFLPRETEYLKEA
FT                   RSLLQYYELLIANDLNKLLKQTGLSKEQLKFAVDLLKTLKPYPGMDFEKQESEYQIPDV
FT                   VVAKKDLHWQVQLNPDVMPKLRINSFYSSMIRRADQSDDNLYLRNQMLEAKNFIKSIDE
FT                   RHKTLLKVATCIVEHQKAFLEIGPEAMKPLVLRDVAEEVELHESTVSRVTTNKYMLTPR
FT                   GLFELKYFFSSHVGTTTGGEASSTAIRAMIKKLVSNENPRKPLSDNAIAALLKEEGIEV
FT                   ARRTVAKYRESLHIPSSSERKVLI"
FT   gene            814283..814621
FT                   /locus_tag="A1S_0683"
FT   CDS_pept        814283..814621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0683"
FT                   /product="putative sigma(54) modulation protein RpoX"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11127"
FT                   /protein_id="ABO11127.2"
FT                   /translation="MQITIRGHHLAITPAIEENIKAKFNQLTKHLDQVNSMQIKLTKDH
FT                   QIDKRSHKGSSNHVAEAIVRLPGIELFAQATADDMYTSIKKLTEKLKKQLLKYRKMQCT
FT                   YSQVAVSI"
FT   gene            814760..815011
FT                   /locus_tag="A1S_0684"
FT   CDS_pept        814760..815011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0684"
FT                   /product="putative toluene tolerance protein Ttg2F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11128"
FT                   /protein_id="ABO11128.1"
FT                   /translation="MNSEQLTQILKEAFPEAEVVVSGQAGKFDLRIVDDQFEGKRTVAR
FT                   QQAVYAPLNTYIASGEVHAVTIRAMTKDEWRKASLFGA"
FT   gene            815018..816274
FT                   /locus_tag="A1S_0685"
FT   CDS_pept        815018..816274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0685"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="Enoylpyruvate transferase; UDP-N-acetylglucosamine
FT                   enolpyruvyl transferase; EPT"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11129"
FT                   /protein_id="ABO11129.2"
FT                   /translation="MDKFLITGGVKLEGEVRISGAKNAALPLLAAMILADSPITLTNVP
FT                   NLKDVNTLVKLIGGLGVTISYENDTVKADTSTLDNQFAPYELVKTMRASILVLGPLLAR
FT                   YGNAKVSLPGGCAIGSRPVDQHLKALEALGAHIEVENGYVHATVDGRLKGGEVVFDMVT
FT                   VGGTENILMAAALADGVTTIRNAAREPEITDLAQMLIKMGAKIEGLDTDTLVVTGVESL
FT                   HGCEYAVVADRIETGSYLAAAAITGGRVKTTHTDPSLLEAVLDKFEEMGAEVTRGDDWI
FT                   ELDMLGKRPKAVSFRTLPHPEFPTDMQAQIMAVNAIGRGFATISETIFENRFMHVPELS
FT                   RMGANIQVEGHDAVVTGVEKLQAAPVMATDLRASFSLVLAALVAEGDTLIDRIYHIDRG
FT                   YEHVEEKLQGLGAKIKRVS"
FT   gene            816274..816957
FT                   /locus_tag="A1S_0686"
FT   CDS_pept        816274..816957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0686"
FT                   /product="ATP-phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11130"
FT                   /protein_id="ABO11130.2"
FT                   /translation="MNDVRNDDPNFNVMGNFDHGLTLALSKGRILKETLPLLATAGINL
FT                   LEDPEKSRKLIFPTTHKQVRILILRASDVPTYVENGAADLGVAGKDVLMEHGAQHVYEL
FT                   LDLQIAKCKLMTAGKVGMERPKGRLKIATKYVNLTRQYYASLGEQVDVIKLYGSMELAP
FT                   LVGLGDYIVDVVDTGNTLRANGLEPLEEICKVSSRLIVNKASFKRKQVLLNPIISQLEQ
FT                   AVQSR"
FT   gene            817063..818352
FT                   /locus_tag="A1S_0687"
FT   CDS_pept        817063..818352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0687"
FT                   /product="histidinol dehydrogenase"
FT                   /note="histidinol dehydrogenase activity"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11131"
FT                   /protein_id="ABO11131.2"
FT                   /translation="MRRLSTQDQNFKQVFAELLAFETVNDPNLVQTVDQIIADVRQHGD
FT                   DHVLKLTQQFDRHPAHQFSDLELSQQQLKAAFDGLNQEIREALQLAADRIRTFHEAQKQ
FT                   DSWTYVDDLGNTLGQKVTPLDRVGIYVPGGLASYPSSVLMNAVPAHVAGVPEIIMVVPA
FT                   PNGELNPLVLAAAYLAGVSRVFTIGGAQAVAALAYGTQTVPRVDKITGPGNRFVAAAKR
FT                   AVFGQVGIDMIAGPSEILVYAEGVNNAEWLAMDVLSQAEHDTVAQAIFITPDEALLEAV
FT                   ESAIEKHLNELPKAEIARTSIENRGALVLVKDRAEAVDLINQVAPEHLELCLDDAEAMS
FT                   QDIRHAGAIFMGRYTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIMCSKD
FT                   GVKTLAKTADVLAVQENLDAHARSARYRYQ"
FT   gene            818422..819507
FT                   /locus_tag="A1S_0688"
FT   CDS_pept        818422..819507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0688"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11132"
FT                   /db_xref="GOA:A3M2I8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2I8"
FT                   /protein_id="ABO11132.2"
FT                   /translation="MTVSTAQMRFWSPEVRELEPYVPGEQPKIQNLLKLNTNENPYPPS
FT                   PKVVEAVQAVLHEQADVLRLYPDPDATALKQAIAKQQNIDVSQVFVGNGSDEVLAHIFK
FT                   AFFLQDEPILYPDITYSFYPVYSQFFGTKTKEIPLNENFEIDVRDYTQPNGGVIITNPN
FT                   APTSIALSLAEIEQVLQANPDRVVVIDEAYVDFGAESAVSLINRYENLVVCQTTSKSRS
FT                   LAGLRVGFAIAQSHLIAALETVKNSFNSYPIDRFAIAAAVASFEDQVYFEEQCQKVITS
FT                   REKLVRDLTVLGFNVLPSKANFIFATHSQHDAGQLAQKLREQGIIVRYFNKPRINQFLR
FT                   ITVGTDEQNARLVQTLKQDIL"
FT   gene            complement(819511..820899)
FT                   /locus_tag="A1S_0689"
FT   CDS_pept        complement(819511..820899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0689"
FT                   /product="p-aminobenzoate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11133"
FT                   /protein_id="ABO11133.2"
FT                   /translation="MPPLPNSHMFKMSHLKKKISLESYYSAADILKKLEELTGLVYLQD
FT                   DNNPVIGFLPKNYLIVRNNQNFLFTKTDLNKYKFSSYIENLLDFTQFQSQELKNSNREK
FT                   ISFKGGYIGFISYDFSAHQFINNQSHKQPSLFIGSYYSFIKKINNEWYFFSDENNAFEI
FT                   FNYLSALLNKPSSKLQKNNFKLEQNIHPRWSKNTYLTAFHKIQEYIKAGDCYQINLTQE
FT                   FKANFTGSLLNKADELWNLTNAPYSGYLKLTEFELLSCSPELFIEFNVDKQIKTRPIKG
FT                   TMPRYENKKQDLLSKQTLKNSKKDQAENVMIVDLLRNDLSIYANTGSVKTTKLFEIESF
FT                   NQVHHMVSEITATLKNDINPMQMLLTALPGGSITGAPKIRAMQIIEELEGAPRGAYCGT
FT                   LGYFNFDGTGRWNILIRSFQQYQNQLSIWAGGGITIASEAEAEYQESLDKISAMLNLMN
FT                   STAE"
FT   gene            821218..822057
FT                   /locus_tag="A1S_0690"
FT   CDS_pept        821218..822057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0690"
FT                   /product="FilA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11134"
FT                   /protein_id="ABO11134.2"
FT                   /translation="MKMFTKLALVSSLAISANAMAMQSMDDAALSAATGQDGINIGIAL
FT                   GADGITIDKLYLHDNDGLATATGITGASGTAGAISIGGVTLKQTGTDPLLNLAIDTNGA
FT                   SGTNGAFLNVAATVGAVDVHVGSIGVGTSGTVNETTATRGITETSPTEIITGLDLSLGK
FT                   ITANVQLGAAPQGAMIKVNSSLQGGLNISNLGIKDAAGGGTIKLDKIMVRGANATGDLD
FT                   VNAGISVKTTGLEVKNNSTQAMNVYLQGVHLGTAASIGDVEVQGLNIANSTITISGH"
FT   gene            822354..823187
FT                   /locus_tag="A1S_0691"
FT   CDS_pept        822354..823187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0691"
FT                   /product="FilB"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11135"
FT                   /protein_id="ABO11135.2"
FT                   /translation="MLEIALGSALIYYFATEAFEIEKKPPGTVYYTETADSRNLSFHRN
FT                   HIEPVTIKPAVEDQFRGIVRQAYDYSCGSAALTTLLNGYVGTSLTEQQTMSGLLQYGEY
FT                   QRIIERRSFSLLDMKRFVTAIGLESGGYRGEFSDLVKLGQPAIVPISYAGFKHFVVYKA
FT                   YKDGRVYVADPALGNISFDEGRFKEIWDNNTLFVISVPESQRKDLLALKEADMRHVEDA
FT                   TVNKYAFVDIQYPTFNYERLANKASTMRRVLDDDNKSPTYGKPIETYMRLYYKRK"
FT   gene            823656..824423
FT                   /locus_tag="A1S_0692"
FT   CDS_pept        823656..824423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0692"
FT                   /product="FilC"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11136"
FT                   /protein_id="ABO11136.1"
FT                   /translation="MALGDDNSRISRLRIREDAQHTLTNSFTAQYGVLDNLTFSATLPL
FT                   VAKSDIASDSTTAGLGDISFGARWEPFPLKQGRLPLVLFGNVSTKTGDSPYEIGLDELS
FT                   TGKGYYSVGVGASTRKYIDPVVLFASVSANYGFKESGLNQARGSRILESFDPGISGGFS
FT                   FGFAYSFNYDVSLTMSYQQSFNFNSEFQFNNGESYKSPDQSSAMMAFALGVRVSPDTIV
FT                   NGTVGFGLTEDAPDVSLGLSFPLDILGFNKKQK"
FT   gene            824430..826100
FT                   /locus_tag="A1S_0693"
FT   CDS_pept        824430..826100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0693"
FT                   /product="FilD"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0693"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11137"
FT                   /protein_id="ABO11137.2"
FT                   /translation="MQVKYPKLCPLTAAIVISGFSSFANAQLGQNLAVDIRSLSMGNAV
FT                   TADPPGISAIHFNPAALAKIDGLQTDVQGILANFDIQREFSAPPGYNVFGYSDDPIVCN
FT                   DGPEVSVGICTDFKGPVRGDVEYASLYVPILKKMVDLGAGYPLVAPTAGIAYKPPGSKV
FT                   TYATAMYAPLVAGFGAENGNPGNYMGQQVAVERITYLSPSFGYQVNDHLSIGASFGMSY
FT                   NAIALNTDLRFPNEMVGVLRMIDDVVCRPFKNNKEFFTDLILLGICNTQEGMNPFNKMG
FT                   ALQVSLEQSLSPSYNLGLLWEPTDNFSFGMVYQSSAKMRLKGKYLINNAKAPQQLIAGL
FT                   NSSTTGSVASGVLQLPGYIPNVESGLVAMDLEYPAHFQAGIKYKLLPDLQVNFDVGWTD
FT                   YSAWNKFKFEFDRQISLLQVARLLSNDVTPASLALPLKFTSPWSWGIGLEYSATDRLKL
FT                   RAGYEPRASSIPDDKRNTMVPINNAQLFGLGVGYRFDTDTDLDLSVGFLRSRDNIPACT
FT                   STLSNKCGVDNILLNPYAGLDVKTNTKVTVLGLSYRTKW"
FT   gene            826094..827320
FT                   /locus_tag="A1S_0694"
FT   CDS_pept        826094..827320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0694"
FT                   /product="FilE"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0694"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11138"
FT                   /protein_id="ABO11138.2"
FT                   /translation="MVKQYKRMFRPKFAIAALCIAIANISLSYADGFYTIIGPDGRPMI
FT                   VPSKKVETRNSNSKLEITKPVIESRSVNTPIQEIPQGNIQNSKGNKKVEQEATKILNTA
FT                   PTAPTAPTAPTAPQKNTKTVSVVNDDLKTSTEKNKIIEGGNVPSVSNNEGQKKLVLVPP
FT                   PIKSTSQAAPSSGSSVDKSKFTIIDGVEYVNNEYLEGQEFNIEGKKRFYLMPDGLGRTE
FT                   SVERKKGVSRSTLEQLFKRHTQDQDSTVVLAPTYMRLSSQELEEAFEQDKCFIKGYKKS
FT                   IKTLSTNKEVNLWPRKPLKEKFEYELVQLNPSVQHLKVMSFASSNEKPLYYWPLVVFLD
FT                   DKGCILEGASGFKSKSYPSTMLQHASIQGVLKVPPSAHYIMMTPLSSAVDVTEKELTNQ
FT                   GQIQISVLR"
FT   gene            827340..829271
FT                   /locus_tag="A1S_0695"
FT   CDS_pept        827340..829271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0695"
FT                   /product="FilF"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11139"
FT                   /protein_id="ABO11139.2"
FT                   /translation="MNKRILWPFALTAIALMLNGCGGGSSNINEDPNSGGDGNLTSGSC
FT                   KPSVSGNSSRDSNCLEFALDYPVEGINFDCSTALGQHFVTTLSQGTVTGTCKVGDTARF
FT                   YLQGKGDKQIFLGSVKLDTIGKYTSFVNNGDQKTSLPIYLRLLDLASGITGKAPITLDK
FT                   NDETIKVAIALVKIFQSIGLENDDNLIGDIQPTEITDEKKELLSKLSQSITAADFQSGA
FT                   YASLLKPWLDVSQISDEEAYKLVVQTTNLSNAGTYQALDVRNIFLFRGCNLNSYEECEK
FT                   NTSTALRDNVNSMYLLSDRQGYSFGYGLQWSGIRKDLTDPLDLRRKVKPVKMNINAQNA
FT                   WLHPISREIQSNTPLRLSTLDNPNEDMQIYQGKLFNDYAIAGSEVAYKSLTNLSTGNPQ
FT                   HYGRWRQNLGGESYNGGVDIYKGNKISFLESSVFKTSGNVKTGESYIFPLYATLTFNFE
FT                   QTGAQPVNLGIVIDEHGDIRTDIKPNATITDMSGQCATVADSNLIDSLGVQQYRIGSTA
FT                   ATINNPINSDRSVYIRMILANPKFANIDGAIVGLSFIGVSAGTAKLNLYNLLANKIDNN
FT                   SINLNNGAKGLASWYNPHAATQASYNALENVTPTDEEKALAQRIAGTVTIKLADQSIPA
FT                   CKAIKIKS"
FT   gene            complement(829327..829875)
FT                   /locus_tag="A1S_0696"
FT   CDS_pept        complement(829327..829875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0696"
FT                   /product="putative MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11140"
FT                   /protein_id="ABO11140.2"
FT                   /translation="MSFCVACGHKTEQKIPLGDHKVRRVCTHCGNIHYENPKVICGALA
FT                   LWEDKVLLCRRAIEPRYGLWTLPAGYMELFETMEQGAARETREEAEAEIEIEQLYCMYN
FT                   IPRIGQIYVLFKAQLKDGLFGAGEESIECRLFEEHEIPWGELAFPSVEHTLRHYFEDRK
FT                   QQVFPTHLETLGTRLDHTG"
FT   gene            829999..830616
FT                   /locus_tag="A1S_0697"
FT   CDS_pept        829999..830616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0697"
FT                   /product="putative MutT/nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0697"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11141"
FT                   /protein_id="ABO11141.2"
FT                   /translation="MEEHLLTQKLQQRLRFSTRIQEAQAAVLIAITNENNPKVLLTRRS
FT                   IHMNNHAGEVSFPGGKRDPSDTSNIVVALREAQEETALNPFDVQLLGDLPMQRARSGLS
FT                   VKPIVGLIPPEVTLIPQPTEIDRIFFVPLQQLIETRPTPYEVRYAHQSLYFPSLQIDNE
FT                   IIWGLTARMLIALFKYGLGYQKEWPFLLNAPTFGMPKFSHKK"
FT   gene            830636..831166
FT                   /locus_tag="A1S_0698"
FT   CDS_pept        830636..831166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0698"
FT                   /product="putative anhydratase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11142"
FT                   /protein_id="ABO11142.2"
FT                   /translation="MMYSYQGHHPKALHEPWDGWIAPTATLIGQVELGRQVSIWFGAVV
FT                   RADNCVVRIGNFSNIQENSVLHTDAGLELNIGEYVTVGHKVMLHGCTIGDNSLIGMNAV
FT                   ILNRAVIGKNCIIGANALIPEGKVIPDNSVVMGSPGKIVKTLDEEGAAKIRLSALHYAE
FT                   HFKSYADLKEFHF"
FT   gene            831299..831964
FT                   /locus_tag="A1S_0699"
FT   CDS_pept        831299..831964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0699"
FT                   /product="putative glycoprotein endopeptidase
FT                   metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11143"
FT                   /protein_id="ABO11143.2"
FT                   /translation="MKLLALETANEQCSISLIDETQELFFQLDTRAKAQTQTILPMIEQ
FT                   GLQQTGLDVAGLDAIAFSRGPGSFSGVRINAAVAQALAWSQDLPVIPVSTLQALAQAAY
FT                   RLKGLEQVTAVLDARMNEVYIASFVLDEQGIMQCIDEEKLMNYEQAAAYAKHCLIGSGA
FT                   KLLQTDAEYQTITATAQDIASIARVYAAQKQWVDAEHALPVYLRDDAWKKIADQGKAN"
FT   gene            831976..832767
FT                   /locus_tag="A1S_0700"
FT   CDS_pept        831976..832767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0700"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11144"
FT                   /db_xref="GOA:A3M2K0"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2K0"
FT                   /protein_id="ABO11144.2"
FT                   /translation="MHIYFEVDFQEQAQHYQAVLYSRGVTVDLQPIEKLNARFLRLNPD
FT                   LALCVDENGLWLSANGMKMQPDWKAEIPRLKRATLKSEMIARACQLGEKPVLVDATAGL
FT                   GHDSLLMAYLGAQIQLVERHPILFTLLEDSKAQAQHDPFLSQFMDRIQLIFADSASYLQ
FT                   QLDQEEKTVDVVYLDPMFPQRDQNQQAIKKQAQVKKQMQLLHLLLPEDGEMDLGDHLLE
FT                   LAKKVAKRVIVKRPRHAIFLANQEPAHQWQGDACRFDAYFQ"
FT   gene            832967..834010
FT                   /locus_tag="A1S_0701"
FT   CDS_pept        832967..834010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0701"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11145"
FT                   /protein_id="ABO11145.1"
FT                   /translation="MWLFLGSRRSLQIVHPSILQLIVWGVLGGCTNSLYSWLVAGQIGD
FT                   FNSQGLIGYALWPFIALIVGIFLSQRINQPRLMLVPALLWLVLDTNILLIQCLIQYLGS
FT                   NGYLNFIPDAIYNGILPGLFVALFVWQSLAVIWVFSRELKWPWWERALVMVATIATMVV
FT                   WQLSVKDQPIWKVEDSPPTFAEDAFYAQSKLLHDALEQVQYGELAKSHWYFLGVAGDSY
FT                   QDVFKSEVVRIKEQFDTRFGTVGRSMMLVNNPDTRTEIPIASKTSIELALRRMGQQMNR
FT                   DSDVLFLYMTSHGEQNHFEIENAPLDLGQVDPKWLRETLDKAGIRWRVIVISACYSGKF
FT                   YSGVTVT"
FT   gene            834129..834356
FT                   /locus_tag="A1S_0702"
FT   CDS_pept        834129..834356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0702"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11146"
FT                   /protein_id="ABO11146.1"
FT                   /translation="MKDSFNAAKQTVTKWEVAQGIEPSEPQWMIGKNMELMLPQLEKYL
FT                   FPQPNTGSVNIAQTQTEAKNDATPAKKPLL"
FT   gene            834325..835176
FT                   /locus_tag="A1S_0703"
FT   CDS_pept        834325..835176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0703"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11147"
FT                   /protein_id="ABO11147.2"
FT                   /translation="MQLLQKNRCFEGEQRIYQFDSQLLKGSTKFGVYLPPAALEGKPCS
FT                   TLFYLAGLTCTEETFAIKAHAQHMAAQLSLILITPDTSPRGEQVAVGDHWDLGQGAGFY
FT                   INATQAPWSEHYQMESYLIDELYPLILKSFPVNAQQVGIFGHSMGGHGALTLAFKYPEK
FT                   FKSVSAFAPICAPTECAWGEKAFSHYLGTDRDSWLAHDATALVSKNGAVFNEILVDQGL
FT                   DDQFYEQLHPEKFKQACLKAGQPLTLRQHAGYDHGYYFIQTFMDEHLQFHAIQLEKSLA
FT                   NN"
FT   gene            complement(835173..835445)
FT                   /locus_tag="A1S_0704"
FT   CDS_pept        complement(835173..835445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0704"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11148"
FT                   /protein_id="ABO11148.2"
FT                   /translation="MKSTTHLLTNDGKRIAKRLVNHWKHKFEVQETEQDFKILMPTATI
FT                   TLAPETEQLNVAIDSQLDDHNHLEKVVLDHLNRMAQQEFQVEWQH"
FT   gene            835630..836316
FT                   /locus_tag="A1S_0705"
FT   CDS_pept        835630..836316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0705"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11149"
FT                   /protein_id="ABO11149.2"
FT                   /translation="MSKPYLIAPSILSADFARLGEDVDKVLAAGADVVHFDVMDNHYVP
FT                   NLTFGAGVCKALKNYGITAPVDVHLMVSPVDRIIGDFLEAGADIITFHPEASHHIDRSL
FT                   QLIKSGGAKAGLVFNPATPLHYLDYVLDKVDQILLMSVNPGFGGQKFIPMTLEKLREAR
FT                   KIIDASGRDIRLEVDGGVGPANIREIAEAGADMFVAGSAIFGQPDYKAVIDQMRAELAK
FT                   VGSVDA"
FT   gene            836673..837494
FT                   /locus_tag="A1S_0706"
FT   CDS_pept        836673..837494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0706"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11150"
FT                   /protein_id="ABO11150.1"
FT                   /translation="MTVKILAVDMDGTFLNSKKQYNKARFLKQYEQLKQNNIRFVVASG
FT                   NQLAKLVTYFPEINHEIAFIAENGAHVVDAGQELAFAHLSKEQFIEILNAIDPVYTSKM
FT                   VICGKQSAYVHSSMNAEDYAKVARYFEKLTVIDDFYALDDLVCKITFTAQENESFTIFE
FT                   HFQKQSFVKDKVLVPVSSGFNFIDLILPDQHKAHGLKLLLQKWQVQPDQVVAIGDNNND
FT                   IQMIKAVGYGFAVENAVEALKAVAPYTTANNEQEGALQVIDLVLQHQPPFA"
FT   gene            837595..837990
FT                   /locus_tag="A1S_3560"
FT                   /old_locus_tag="AS1_3560"
FT   CDS_pept        837595..837990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3560"
FT                   /old_locus_tag="AS1_3560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3560"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89985"
FT                   /protein_id="ABS89985.2"
FT                   /translation="MTLQHLRKYAWFVFLMTLVIGWSGVSIAQTPMQHDLHTMPCHSEQ
FT                   MKHHSMHIQADEQTTCHQSMAQVSHQHGEHCQDCNPVHCQMVNLALQQAVPDIESSFIP
FT                   IPSQFSSIYQAQHLAGYWQEILRPPKA"
FT   gene            838031..839965
FT                   /locus_tag="A1S_0707"
FT   CDS_pept        838031..839965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0707"
FT                   /product="copper resistance protein A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11151"
FT                   /protein_id="ABO11151.2"
FT                   /translation="MSHKTISSLVAVFGLLVSPWTLAAIKEYHLNINEQQVNVTGKPLK
FT                   RITVNGKFTAPLLEFEEGDEAVIHVHNQLKNQDTSLHWHGLLLPGLMDGVPAFNNFKGI
FT                   APNGDFVYRFKVKQNGTYWYHAHSKGQEQDGLYGPLVIYPKGKIPVVAHEKTDRDYVVM
FT                   LSDFHDSSSDSIMKNLKKSAEYYQNRRETVSDILKQVKTQGLKATWQDRSMWNQMRMLK
FT                   TDMSDVTGYTFLVNGKTPQQNWTGNFKAGDKVRLRFINASAMSFFDVRIPNLKMTVVSA
FT                   DGQPVKPVAIDEFRIGTAETYDVIVEPKQPNYQIEAESIDRSGFAIGTLHNENTQAVGP
FT                   VQMPTPRPRALLTMDDMGMSHGGGSNEHAGHQMNMQHDMSAMPEMKKETTQANHDHTMM
FT                   NMDHDMKNMSSDGHDHSMMHMTHDMSAMSEMNHDMQAMSASEHDHAMMNMNHEMPAQSE
FT                   NKPKKDEPVYGWANASTPAGMKALQYSDLQSLTPQPDTRAPERELVIRLGGNMERYIWT
FT                   INGKKFSDTTPLQVKYGERIRLKFVNDSMMAHPMHLHGMFMQLENGQQAENLPNKHTII
FT                   VPPGKTVTALLTADALGEWAIHCHLLYHMSAGMMNKLIVAQVNDGQQPAQSQPTVQSEN
FT                   EKGASHAHH"
FT   gene            839952..840707
FT                   /locus_tag="A1S_0708"
FT   CDS_pept        839952..840707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0708"
FT                   /product="copper resistance protein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11152"
FT                   /protein_id="ABO11152.1"
FT                   /translation="MRITKLFSQMICCGAFSGISVFAFAQEPLTHDHLREHGGQIYQAT
FT                   KIDTGWTQNEEGEGSFSSELETWVGTDENKLFIKAHVEKAESEDANYGGSVLYSRNVAD
FT                   YWDVQAGVNYERLQREDEKQDRWAGVVGLHGMAPYFFETDAYLYVGEDQLWKLSLETER
FT                   DLLFTQKLIGKPYLKADVVLQDESRYASKTGLSSLQAGFQTRYEINKKVMPFVDVGYGY
FT                   EKGLKQTAWQTGTDSEHGWYYGAGLTLKF"
FT   gene            840736..841731
FT                   /locus_tag="A1S_0709"
FT   CDS_pept        840736..841731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0709"
FT                   /product="putative cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11153"
FT                   /protein_id="ABO11153.2"
FT                   /translation="MPLVYTDGIVFCVSYGAKMALEKQENQINVNKSCSGCGCSNVAAQ
FT                   DFSVASEPRVNKTQWVSYYHIPRMDCAAEEQMVRMALASYAEHIQELYFDLPARHLAVY
FT                   HSTQDEKITQCLQRLGLGAELQQTQPHYEPVEKPKKVRPSSSTNAAQKQVLQWLLLING
FT                   VMFVIELMAGIIASSTGLIADSLDMFADAAIYGIALFVVGKNLDAQLKAAHLSGWFQFG
FT                   LAIIVLIDVLRRFIYGSEPVSILMILIGGLALAANISCLYLMSDHKESGAHMKASYIFS
FT                   ANDVIVNLGVIVAGILVAMTGSRYPDLIIGLIIVLFVLNGARKILQLKNE"
FT   gene            841881..842201
FT                   /locus_tag="A1S_0710"
FT   CDS_pept        841881..842201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0710"
FT                   /product="putative SMR family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11154"
FT                   /protein_id="ABO11154.2"
FT                   /translation="MAWAILILAGVFEVIWAYSMKMSEGFTRLTPSIITVVFMILSVVL
FT                   LSISMKTLPLGTAYTVWTGIGAIGSFLVGIFFLHEPIGAMRMIAAVLIVSGLVLMKISS
FT                   PS"
FT   gene            842213..842692
FT                   /locus_tag="A1S_0711"
FT   CDS_pept        842213..842692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0711"
FT                   /product="Methylated-DNA-(protein)-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0711"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11155"
FT                   /protein_id="ABO11155.2"
FT                   /translation="MLLSYKYINSPVGQLKLVANENALVAVLWDNENPKRVRLAELVEQ
FT                   LEHPVLLKTEQQLQEYFEGKRREFTLPLDFEGTAFQKQVWAALLTIPYGETRSYKDIAV
FT                   QIGNEKAVRAVGAANGKNPISIIAPCHRVIGAGGALVGFAGGLDKKDILLRLEQK"
FT   gene            842829..844049
FT                   /locus_tag="A1S_0712"
FT   CDS_pept        842829..844049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0712"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11156"
FT                   /protein_id="ABO11156.2"
FT                   /translation="MAVGDVTMPQMHVVKGVKIGSTEAYVRYPNRRDLVIFEFAEGSNV
FT                   AGVFTQNAFCAAPVHVSKAHLAEGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAELA
FT                   GVNSFEVLPFSTGVIGEQLPMERLLAGLQPALNSVQDSAWSDAASGIMTTDTVPKGASE
FT                   QFELDGITYTMTGISKGAGMIRPNMATMLSFVATDAPIRRDLVQKLLKTTVEHSFNRIT
FT                   IDGDTSTNDSCIFVATGQAGGAEITSESDVRYAKVLEVLARVMNRLAQLIVRDGEGATK
FT                   FITVAVEGGANTQECCDIAYSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKI
FT                   QVWLDDVQICKDGGAAEDYTEEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVK
FT                   INADYRS"
FT   gene            844196..845260
FT                   /locus_tag="A1S_0713"
FT   CDS_pept        844196..845260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0713"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11157"
FT                   /protein_id="ABO11157.2"
FT                   /translation="MSDATLIANDAKNIVQAHLDRLGEPKDNRLSEEAKQQKFAQIEAE
FT                   LKKRDAVLVAHYYCDPDVQELAEKTGGCVSDSLEMARFGRDHAASTLVVAGVKFMGETA
FT                   KILSPEKTILMPTLEATCSLDLGCPVDEFTAFCDQHPDHTVVVYANTSAAVKARADWVV
FT                   TSSCAVEIVEHLDSLGEKIIWAPDQHLGRYIQKKTGADMLLWDGACIVHEEFRARGIAN
FT                   MKALYPDAAVLVHPESPESVVEIADAVGSTSQLIKAAQTLPNERLIVATDRGIFYKMQQ
FT                   AVPDKILVEAPTAGEGATCRSCAHCPWMAMNELDGILEVLQKGDQEIHVDLALAERAKM
FT                   PLDRMLAFSASLKR"
FT   gene            845404..845480
FT                   /gene="trnP"
FT                   /locus_tag="A1S_0714"
FT   tRNA            845404..845480
FT                   /gene="trnP"
FT                   /locus_tag="A1S_0714"
FT                   /product="tRNA-Pro"
FT   gene            845537..845613
FT                   /gene="trnR"
FT                   /locus_tag="A1S_0715"
FT   tRNA            845537..845613
FT                   /gene="trnR"
FT                   /locus_tag="A1S_0715"
FT                   /product="tRNA-Arg"
FT   gene            845647..845722
FT                   /gene="trnH"
FT                   /locus_tag="A1S_0716"
FT   tRNA            845647..845722
FT                   /gene="trnH"
FT                   /locus_tag="A1S_0716"
FT                   /product="tRNA-His"
FT   gene            845727..845803
FT                   /gene="trnP"
FT                   /locus_tag="A1S_0717"
FT   tRNA            845727..845803
FT                   /gene="trnP"
FT                   /locus_tag="A1S_0717"
FT                   /product="tRNA-Pro"
FT   gene            complement(845958..846953)
FT                   /locus_tag="A1S_0718"
FT   CDS_pept        complement(845958..846953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0718"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0718"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11158"
FT                   /protein_id="ABO11158.2"
FT                   /translation="MITKTLPLTDIHRHLDGNIRIQTILELGQQYHLDLPAYDIESLRP
FT                   HVQVMDNQPDLLSFLSKLDWGVKVLASLDACKRIAFENMQDAAQQGLDYVELRFSPGYM
FT                   GMTHQLPLEGVVEAVIAGVKEGSQAYGVKANLIGIMSRTFGQEACEKELNALLAHKNDI
FT                   KALDLAGDELGFPGNLFIDHFKKARDAGWHITVHAGEAAGPESIWQAIEELGAERIGHG
FT                   VKAVQDLKLLDYLAKHQIGIESCLTSNIQTNTVPSLAEHPLKTFLEHGVLATINTDDPA
FT                   VEGIEIQHEYLTAAPLAGLSPEQIYTAQENGLKIAFLSEQEKDELRQKYQ"
FT   gene            847355..848530
FT                   /locus_tag="A1S_0719"
FT   CDS_pept        847355..848530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0719"
FT                   /product="zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0719"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11159"
FT                   /protein_id="ABO11159.2"
FT                   /translation="MKSVLCHQATLQVVDQPNLTPAKGQVLLEVVRCGICGSDLHMQHH
FT                   CDHMHDLAARVGFNGLAKSTDPFVLGHEFCGKVLDYGPKTRHKFKADTLVCAMPLLNVD
FT                   QHGYLSTGLSPNASGGYAEQVLAQSSLMFEVPNGLDADSAAMTEPMAVALHAVRRSRVK
FT                   TSEPAIVIGCGPVGLGVILMLKAAGVKTVVASDFSPNRRKLAEQCGADIVVDPKETSPF
FT                   ANWKEFGLLGNVSDAINMGMGLFDKLQATRLPWWHGWRMIDKLGALPKRPVIFECVGVP
FT                   GVLQQIIEGAPLFSRIVGVGVCMQSDKIEPALAINKELEIQFVLGYTPLEFRDALHMIA
FT                   EGKVNCSPLITGVVGLEGVTNAFEALRDPEQHAKILIDPKRSGSDIQLMSH"
FT   gene            complement(848624..849571)
FT                   /locus_tag="A1S_0720"
FT   CDS_pept        complement(848624..849571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0720"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /note="putative glycine cleavage system transcriptional
FT                   activator Gcv operon activatorGcvA"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0720"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11160"
FT                   /protein_id="ABO11160.2"
FT                   /translation="MRRSIPSIQGLICFESAAKHLSYTYAAQELCITQSAVSRQIQQLE
FT                   DFLGVELFIRTRHGVELTIAGQQYFKSIKPYLLGLEKCTADVISHKGLGGTLKLGVVPT
FT                   FATRWLLPKLHLLNQKHPEITVHLETSTKPFLFNDNIFDAAIFAGTQQQIDHWPGIQAH
FT                   YLMDEEIVPVCSPRLIEKYFPDAVMINENTYDLSPEDLLKIPLLQQTTRPSIWQEWFLT
FT                   HHMQHPKPFDGQRHELFSMLAVAASHDMGMALIPQMLIESELQKKELVIVSNKKLKGSR
FT                   KYYLIHSSQDISPTIQKFVEWIYQELEQLKTNTN"
FT   gene            849826..851037
FT                   /locus_tag="A1S_0721"
FT   CDS_pept        849826..851037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0721"
FT                   /product="glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0721"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11161"
FT                   /protein_id="ABO11161.2"
FT                   /translation="MVTTKKAKVQFNWQDPFLIEQQLSPDERMIRDAAHAYCQERLQPR
FT                   VLEQFRHETTDPSIFREMGELGLLGPTIPEQYGGAGLNYVSYGLVAREIEYVDSGYRSM
FT                   ASVQSSLVMVPIHEFGTEEQKQKYLPKLATGEYIGCFGLTEPDHGSDPGSMITRAKKVE
FT                   GGYRLTGAKMWITNSPIADVFVVWAKEVSAEGNVGDIRGFILEKGWEGLSAPAIHGKVG
FT                   LRASITGEIVMDNVFVPEENAFPEIRGLKGPFTCLNSARYGIAWGAMGAAEFCWHTAHQ
FT                   YTMDRKQFGRPLAANQLIQKKLADMQTEIALGLQAALRFGRMKDEGIASVEGTSLIKRN
FT                   NCGKALDIARMARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDVHALILGRAQTGIA
FT                   AFSN"
FT   gene            851259..852581
FT                   /locus_tag="A1S_0722"
FT   CDS_pept        851259..852581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0722"
FT                   /product="ciscis-muconate transport protein (MFS
FT                   superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0722"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11162"
FT                   /protein_id="ABO11162.2"
FT                   /translation="MNNDVQVISKELRNTFPSNLGTYERIGPHTWKWALLFAYFAMVVD
FT                   GIDIMLLSYSLTSLKAEFGLTTFQAGALGSASLAGMGIGGILGGWACDKFGRVRTIANS
FT                   VTFFSVATCLLGFTQSFEQFMALRFIGALGIGALYMACNTLMAEYVPTTYRTTVLGTLQ
FT                   TGQTVGYIAATLLAGAIIPDHGWRVLFFLTVVPAFVNIFLQRFVPEPKSWQLTKIESLQ
FT                   GNRQPKERVVAEKPKSSSIYKQIFNNFKHRKMFLLWMTTAFFLQFGYYGINNWMPSYLE
FT                   TEVHMNFKNLTSYMVGSYTAMILGKILAGYLADKFNRRAVFVFGTIASAVFLPIIIFFN
FT                   TPDNILYLLITFGFLYGIPYGVNATYMAESFSTDVRGTAIGGAYNIGRVGAAIAPATIG
FT                   FLASGGTFTMAFIVMGAAYFVAGVLPGLFIKDRQYDPQRQS"
FT   gene            852634..853863
FT                   /locus_tag="A1S_0723"
FT   CDS_pept        852634..853863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0723"
FT                   /product="L-carnitine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11163"
FT                   /protein_id="ABO11163.2"
FT                   /translation="MGALQGIRVLDLSRVLAGPWCGQILADLGAEVIKIERPRVGDDTR
FT                   MWGPPWMPDQDGNMTRESGYFQCTNRNKYSVAVDITTPEGQALIYEIAKTADVVIENYK
FT                   TGSLAKYGLDYASLSELNPNIVYCSITGFGQDGPRAEEPGYDFIIQGMSGLMSITGEPD
FT                   DVAGGGAQKVGVAVVDIQTGLYSTIAIQAALIARSHTGRGQYIDMSLLDVQVAALANQG
FT                   MNYLASGKAPQRMGNQHPSIVPYQTFKAKDKEFIIACGNDKQFKDLCIAIGYPELLENE
FT                   KFVRNQDRVKYRNELIPLLSEHFLRKTAKEWVDMIHALKVPVGVINSIEDALAEPQIVY
FT                   RNLVVNIPHRLNENFQTIGSPIKLSDTPVEYHHAPPELGEHTAQILSRFKTAEELAALK
FT                   EKGIIDGKIA"
FT   gene            complement(853968..855101)
FT                   /locus_tag="A1S_0724"
FT   CDS_pept        complement(853968..855101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0724"
FT                   /product="citrate utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0724"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11164"
FT                   /protein_id="ABO11164.2"
FT                   /translation="MNASTKALIPVVQLSDHEQEVQRALQICNACRYCESFCAVFAAMT
FT                   KRLEFNQADIHYMANLCHNCGACLHACQYAPPHEFGVNIPKAMAQVRLETYQEFATPQP
FT                   LGRLYKSVGIPFVSTLTLIFFFCMLAVVWWKGTNLFAGYQGNFYAIFPHNFLALLFGAT
FT                   FTVAIVLLGIGVSKFWRQTSKVIHGKVEKPDLVQATQNVLTLKYLDGGHGKGCNEQDDR
FT                   YTQIRRVFHHLTFYGFMLCFAATGVATLYHYFLDLHAPYPIFSLPVILGTLGGIGLVIG
FT                   PSGLLYLNLKRHPLHGDREQRPVDRGFIFLLLIVSASGLVLMAFRNTPYMALLLIFHLA
FT                   TVMTFFITMPFGKFAHGFYRSASLLKFAIEERISKKS"
FT   gene            complement(855091..856497)
FT                   /locus_tag="A1S_0725"
FT   CDS_pept        complement(855091..856497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0725"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11165"
FT                   /protein_id="ABO11165.2"
FT                   /translation="MHDVIVIGGGNAALCAALTARESGASVLVIEAAPKEWRGGNSQHT
FT                   RNLRCMHDAPQDVLVDAYPEEEYWQDLLKVTAGKTNEHLARLVIRSTATCRDWMRKHGV
FT                   NFQPPLSGALHVARTNAFFMGGGKALINAYYRSAEKLGIEILYNTKIKDLKLNQGHFEA
FT                   AIAEDGRVFKAKSCVLAAGGFESNLEWLREAWGQNENGEWPADNFIIRGTRFNQGNLLK
FT                   FMIDQGADIIGDPSQSHCVAVDARAPLYDGGICTRIDCVSLGIVVNNKAERFYDEGEDF
FT                   WPKRYAIWGRLVAKQPQQIAYSIIDSKAIGRFMPPVFAGVKANSIQELAEKIGLDAKTL
FT                   CHTVEEFNQACVQGTFNHTVLDDCTTENIIPNKTHWAVPLDQPPFYAYALKPGITFTYL
FT                   GLKVEDDAAVRFNNKASRNLFVAGEMMAGNVLGQGYTAGVGMSIGTTFGRIAGKNAAHY
FT                   ALSQGVEHEC"
FT   gene            complement(856601..857530)
FT                   /locus_tag="A1S_0726"
FT   CDS_pept        complement(856601..857530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0726"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0726"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11166"
FT                   /protein_id="ABO11166.2"
FT                   /translation="MELKQLKYFIAVIESGSLGKAAKNLDIGTSALSQQISKLESELSI
FT                   RLLQRTALGTVPTPAGLAFFQQVQLALRHLDHAVDSAHSSRLSGHVTVGFSPSVAAVIG
FT                   THFLKLMRNRYPDIKVRLIEGLSGDLKALVNARQLDVAIIFSDDVDPQWAIQPLVKEQM
FT                   FLISPKEVLNQYHLESCIDNQTITHSQLKELPLILPSQRHGLRLLLEQKIHQLKVAYEI
FT                   DGLHLLMESISQLEMATIQPAGASLNSRQDLCLLRVVEPAIERINYLISLSEEELSPAT
FT                   LATKVVIRACVANLINEKRWPGAELINT"
FT   gene            complement(857662..858456)
FT                   /locus_tag="A1S_0727"
FT   CDS_pept        complement(857662..858456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0727"
FT                   /product="putative substrate-binding protein"
FT                   /note="ABC superfamily peri-bind"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0727"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11167"
FT                   /protein_id="ABO11167.2"
FT                   /translation="MKKSPIFITICLAGAGLGSTFANADTLEVISSGGFYSSMEKLIPI
FT                   FEKQTGHTVHLSSGSSMGESPTAIPNRLNRGERFDIVVLAGPELSKLAEKGYVDPNSQS
FT                   ALVNSSIGMAVPKGAPKPDISSAAKFEKVLLNAKHIGYSASASGTHLEKDVFPSFPPVE
FT                   YKVISSKAEKVVGDRVAKRIAEGQFDIGFQQISEIKPFTGKYGQVELVGPIPAPYQKVT
FT                   VFAAGIGKNSEHAKVAKELIKFVKSPQATQIIEEQGLEQVKQ"
FT   gene            complement(858550..859860)
FT                   /locus_tag="A1S_0728"
FT   CDS_pept        complement(858550..859860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0728"
FT                   /product="citrate-proton symporter (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0728"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11168"
FT                   /protein_id="ABO11168.2"
FT                   /translation="MDVVNNRRATFKKILNVTSGNFLEQYDFFLFGFYATYIAAKFFHS
FT                   DNEYVSLMMTFTVFAAGFLMRPLGAIFLGAYVDKVGRRKGLIVTLSLMAIGTILITFVP
FT                   GYETIGIIAPILVVIGRLLQGFSAGVESGGVSIYLAEIATDKNRGFITSWQSGSQQIAV
FT                   VFAALLGYWLNTILTHAQVGEWGWRIPFLIGCLIIPLIFLFRRTLEETEDFKAQKTHPS
FT                   SKEIFSTLVSNWRIVLAGMMMSAMTTTTFYFITVYTTVYAKRTLEMSVTDSLLATVFVG
FT                   LSNFFWLPMGGLLSDKIGRRPVLVGITTLAIFTSYPVLSWLVSDISFSNLLITLAYFSF
FT                   FFGMYNGTMVATLAEVMPKRVRTVGFSLAFSLAAAIFGGMTPMACTFLVENTGNASTPA
FT                   FWLMLAAVCSLISSLYLCRGSKQKDPDAIAEPAKVSA"
FT   gene            complement(860139..861068)
FT                   /locus_tag="A1S_0729"
FT   CDS_pept        complement(860139..861068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0729"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11169"
FT                   /protein_id="ABO11169.2"
FT                   /translation="MEIKQIKYFLTVVESGSIGKAAQKLDVGASAISQQISKLEQELSI
FT                   RLLQRNAFGVTPTPAGLAFLKHSQLILRQVNFAIDAAHSARLSGHVSLGFPPTITALIG
FT                   IPLMKLMSERYPDIRLEIVETLSGNLIQSINSRQLDIAIIFTNEIDKQWSIQPLVREQM
FT                   YLMARKEVLEKYGLSECIKSGIIQSQQIGDIPLVLPRQRHSLRKLLEHKIGQLNVVYEI
FT                   DGLHLLMDSLIHLDLASVRPGSACLQEYKHKLQLLKVVDPEVERINYLVSLAEEELSPA
FT                   ALAAKSAIKACVKELIQNQIWPCSEIIL"
FT   gene            861368..862753
FT                   /locus_tag="A1S_0730"
FT   CDS_pept        861368..862753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0730"
FT                   /product="putative long-chain fatty acid transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0730"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11170"
FT                   /protein_id="ABO11170.2"
FT                   /translation="MNFVVNKKIFILGIASICTSTLHAAAFDKTGQSVAAFLQPGNYFE
FT                   ASLGITDADLSGVESGTNPSHHSILDIANTDYRPTAALKLQLAPQYSFGLLYDQPFGAD
FT                   TEYSGVNGFVATPKDTVMLPGITTTGLASATLGHAPTGNAKSEFDIQNLSFILGYQPTK
FT                   NWNLYAGPVYQTFKSQVELRGNVFSLYNGYDFHTKTVSDLGWLAGLAYQIPEKAVKVSL
FT                   TYRSAITHKVNATENAPLIDMLSTQQGRDLVNQHLDFMISIGQMTPQKKAYLNQIIANL
FT                   PEQEDTGTTKFKSPDSVNLEFQTGLRQGTLLFGSLRWVNWSDLALQPYRFGEISKVVGV
FT                   LSTPSRPEGFNLVRYYDDQWSLNLGLGQRFSPKWLGSVSVGWDSGAGDKVSTGGPTKGY
FT                   YNLGVGAQYSPTSRYFISGGVKYYWLGDAKAQLGAQAGSDYYVGEFKDNHSVSYGLKIG
FT                   YKF"
FT   gene            862787..864154
FT                   /locus_tag="A1S_0731"
FT   CDS_pept        862787..864154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0731"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0731"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11171"
FT                   /protein_id="ABO11171.2"
FT                   /translation="MNKIIKNGMFLGLSTLISGYGTLLHAEASPTNLPAVSQKALTIID
FT                   GQTEWLNKVYKDIHEHPELGFMEKRTSAIVAKELKSLGFDVKTGIAKTGVVGILKNGEG
FT                   LTVMYRADMDANTVEEATGLPYASKVRVKLDDGTETPVAHMCGHDAHVTWMLSMAKTLV
FT                   ALKKEWSGTIILVAQPAEEPITGAKAMVTDGLWTKYNLPKPDYFFAVHTTPAPVGVVIN
FT                   APGPRMAGTDQLDVLFKGVGGHGSLPMLTKNPISMAANALNQYQTIMGNAVDPQQAAVL
FT                   SIGSIQAGNSNNVIPSTALVKMNLRWFDPKVRETMLNNIKSMSEGAAQMQGMGKDQMPT
FT                   FTFKGSSTPVINNKEFSARLNGPLKALLGDKHVLTEYPAVMGSEDVHHLLGEQKDIPFN
FT                   FMFIGVADPVVFANAVKQGKPVPYIPHSPNYIVDLKALPVGAKVTTVSMLELLTKK"
FT   gene            complement(864213..865220)
FT                   /locus_tag="A1S_0732"
FT   CDS_pept        complement(864213..865220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0732"
FT                   /product="Transcriptional Regulator (AraC family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0732"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11172"
FT                   /protein_id="ABO11172.2"
FT                   /translation="MPQTATALASWVKAIQKALEKAGVDSQPLLEQAGLDIQALSNPDA
FT                   RYSLKQTANLWKLAVQKTQDSCFGLKVASQVNQNTFHVLGHSLITSTTLKEMFLRIIRY
FT                   FRVVTDIPELEFYGQGNNHYFVIHVPDEVQPESIDAFISVFIRSSRALQGSVFSPLRIE
FT                   LRRSEPEDLETFQSILKAPIVFNAPKDMIVFDTATIEQPLEGANPTLTQEYDEIINRYL
FT                   ARFDKENILARVKVKLIEKLSTGDFQQQDVAKSLGLSIRSLQRKLSAENTSYSELLDQT
FT                   RHELALSYIKNSSHNITEIAYILGFTDVSSFTRAFRRWTDLSPIHYREKYLACS"
FT   gene            865406..866461
FT                   /locus_tag="A1S_0733"
FT   CDS_pept        865406..866461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0733"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0733"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11173"
FT                   /protein_id="ABO11173.2"
FT                   /translation="MTYIYKNPAGMTDSEKTEHIKKIVTAEGVALRKRYPILNHQNAIG
FT                   AVILFFSLAGMITTAVLYINHQLSAWFAIPIIAFFASLTHELEHDLIHWMYFRKKPWAH
FT                   HLMMGLVWLARPSTINPWKRRELHFNHHKNSGTEVDLEERALTNGEQWSIRRLIAIGDN
FT                   GLAVLFRIISASNWTVRKVIFKRAFMAYFPLGIIHWSLWYIFLGFHAVDAVLSWANAPI
FT                   AWSATTLNIMHVVNILTVVWVAPNVLRTFCLHFVTSNMHYYGDVELGNVIQQTQVLKPW
FT                   WMMPFQLFCFNFGSTHAIHHFVVKEPFYIRQMTAPVAHKVMRDMGVRFNDVGTFKRANR
FT                   WNINDLSESKS"
FT   gene            complement(866563..867171)
FT                   /locus_tag="A1S_0734"
FT   CDS_pept        complement(866563..867171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0734"
FT                   /product="transporter (LysE family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0734"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11174"
FT                   /protein_id="ABO11174.2"
FT                   /translation="MAEFIAVILITILAVISPGADFAIVTKNSYLYGRKIGVFTSLGIS
FT                   LGVLVHVTYTLVAVAFVMTYTPQILNIVKYIGALYLIYIGYKTFTQKPVLGSAALTAIG
FT                   TFQAIKYGFFTNALNPKTTLFVISIYTQIVSLTTPKTILLAYGFFMSFAHFVWFSLVAI
FT                   LFSSMLLRQKMLAKQVQINRVIGSILCVLGVILLFTKFQ"
FT   gene            867490..868299
FT                   /locus_tag="A1S_0735"
FT   CDS_pept        867490..868299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0735"
FT                   /product="transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11175"
FT                   /protein_id="ABO11175.2"
FT                   /translation="MTLAAKKLFVTQSAVSKQIYNLEEALNTTLFDRKNKTLVMTKQGE
FT                   ILLSCCHQVFGQLDECLIQLSQPKTENKQLVLSCEPTLSMKWLIPRLSKFKKLGHDFEV
FT                   VLLTAGGVVDFEKDNIDIAIRRNDFDWGEHIYSEKIADEYIALVQATNPSETNDVLIST
FT                   SRPNFFKNMSRIAELKQSLKGYTKVELEHFYLCLEGCLAGLGATVISIYMIEKELEWNL
FT                   LKKNSPVVRDNSAYFLLSHSAFEEDPRKTLFLEWLKAEMNESQHKLL"
FT   gene            868666..869652
FT                   /locus_tag="A1S_0736"
FT   CDS_pept        868666..869652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0736"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11176"
FT                   /protein_id="ABO11176.1"
FT                   /translation="MSKEFTFTIKSICFDENYRPADNTRITTNFANLARGMSREENLRN
FT                   TLRMIDNRFNALAHWDNPKGDRYGVELEIISVEMNIDAENRTSGLPLIEILKTNIVDKK
FT                   TNERIEGIVGNNFSSYVRDYDFSVLLLDHNKNKSTFSTPEKFGELHGNLFKSFINSETY
FT                   KANFKKAPVICLSVSTSKVYHRTENEHPVLGVEYKQEDYSLTDEYFQKMGLKVRYFMPP
FT                   HSVAPLAFYFTGDLLSDYTNLELISTISTMETFQKIYRPEIYNANSVAGKSYQPSLKHQ
FT                   DYSLTRIVYDREERSRLAIEQGKFVEEQFIKPYQAILEQWSANYAPN"
FT   gene            869674..870717
FT                   /locus_tag="A1S_0737"
FT   CDS_pept        869674..870717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0737"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11177"
FT                   /protein_id="ABO11177.2"
FT                   /translation="MKKLLPTSTAGSLPKPSWLAEPEKLWSPWKLENEGLVEGKKDALR
FT                   LALHEQKLAGIDIVSDGEQTRQHFVTTFIEHLNGVDFEKRETVRIRDRYDASVPSVVGT
FT                   VSRQKPVFVEDAKFLRQQTDQPIKWALPGPMTMIDTLYDGHYKSREKLAWEFAKILNQE
FT                   AKELEAAGVDIIQFDEPAFNVFFDEVNDWGIATLERAIEGLKCETAVHICYGYGIKANT
FT                   DWKKTLGSEWRQYEEAFPKLQTSNIDIISLECHNSRVPIDLLELIRGKKVMVGAIDVAT
FT                   NQIETPEEVANTLRKALQFVDSDKLYPCTNCGMAPLSREVARGKLNALSAGAEIVRREL
FT                   TGFDLTA"
FT   gene            870903..871394
FT                   /locus_tag="A1S_0738"
FT   CDS_pept        870903..871394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0738"
FT                   /product="putative flavoprotein oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0738"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11178"
FT                   /protein_id="ABO11178.2"
FT                   /translation="MVQATDFRNAMSLLTSAVSVVTTAGMSGRFGFTASAVCSVTDTPP
FT                   TLLVCMNQAASSHAHFLDNKILTVNVLGAHHEHISKAFSSKLTPEERFKHGEWIELETG
FT                   APVLEDALVSFDCEIEQIQQVGTHTIFICPIVAIKQSQHDQSLVYFNRAYHQVGQTETV
FT                   "
FT   gene            872488..873039
FT                   /locus_tag="A1S_0739"
FT   CDS_pept        872488..873039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0739"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0739"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11179"
FT                   /protein_id="ABO11179.1"
FT                   /translation="MPTLEISSKKLQVVQTAIQLFTTHGFHNAGVDLIIKEAKIPKATF
FT                   YNYFHSKERLIEMCIAFQKSLLKEEVLSIIYSSRYYTQKDKLKEIIVLHTNLNSLYHLL
FT                   LKAVFEIKRLYPQAYRMAVEYRKWLHRELFDLIFSCETRAFKFDADMVLNLIDGLLLQV
FT                   LSSNSVDERDVVLERFWGRA"
FT   gene            complement(873036..874331)
FT                   /locus_tag="A1S_0740"
FT   CDS_pept        complement(873036..874331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0740"
FT                   /product="putative phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0740"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11180"
FT                   /protein_id="ABO11180.2"
FT                   /translation="MDTKKKGDIFENFVFDYFSALIQKGYMGLNPSHTKIYKQKKYYSK
FT                   DREDYIIFDVAIEVFLFDQKEPYLVILIECKNYEKNVPVDDIEEFSTKVSQVGKHYTKA
FT                   ICITKNGFQKGALNVAKNRKIGLWRITANDNHEVIFNRTINRIKNNDEIISNALTSENL
FT                   QDISATNIFIQTPLRFTSIPKDLIYDFLSLQKDVSPKEFFTQHRVNSYSKTIPYKSKKE
FT                   LSILAENLFDKFYKNDEIDLNEIINTLGYKLIEIDTPEHPNIIGKLETKLKTITIFGVG
FT                   FYSQHQINFAKAHEIAHIFLNHSKYIISENFSPAMESHSIDIEITQNIDRLEFQANYFA
FT                   GCLLLPENRLKATLNYYLRLYGIRNRGFSPLYIDSQPCNFENYSRIILPMTGIFNVSQE
FT                   TMKIRLTELGLAQFAFQPTSTHKVTRSYIDRF"
FT   gene            complement(874446..874718)
FT                   /locus_tag="A1S_0741"
FT   CDS_pept        complement(874446..874718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0741"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11181"
FT                   /db_xref="InterPro:IPR031409"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2N7"
FT                   /protein_id="ABO11181.1"
FT                   /translation="MALAREKRAEFSAQKLEPIFEKYPSVKVRWYDVEAFSTKASDIAV
FT                   FETTSLQDYYFVIDAIRDSEFCTVPYFEFVEIIPAIEDGYVEYES"
FT   gene            875353..878292
FT                   /locus_tag="A1S_0742"
FT   CDS_pept        875353..878292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0742"
FT                   /product="iron-regulated protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0742"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11182"
FT                   /protein_id="ABO11182.2"
FT                   /translation="MGSSLIIQANELYSTVNDLNSAISQGDGKGIDQQIAQLSLISTGL
FT                   GFTIEFAKIAKSPEAVAGLTGLKYQVDATLTGAALTQAMINIDQGNYSGAIANTLAAMS
FT                   TATGLVALAVDKPGLSTALNGLSGFLGASSNVAEKGPQIADALANALSEIQKMQHDGTF
FT                   PELDPGLMAGFAGEVLEGWSKEFYSWFPDDWNPWKNIDRNSDGVKKYHIYDPVVLDLDG
FT                   DGIETIAANKWAGVLFDHDNDGIRTSTGWVGSDDGILVLDRNGDGVINDGSELFGDSVT
FT                   LKDGSQASNGYAALAEFDSNGDGKVNAEDTNFEQLKVWRDLNQDGVSQTNELFGLTELG
FT                   IQSLNLNHTNTDTALGNDNILAQTGSFETLDGQSHIMGDVNFSFNSIYSSFNNAIELTA
FT                   EQQQAANLQGAGRVRDLREAAALSPELAETLKNYSNAETKAEQYDLLDQLILNWAKTDP
FT                   DFKEANEVRMVSWVKTANEGIALTPGQAAIVTLAAPLSKESQAMLDKIHHILPILDAFS
FT                   GSKPSQIYYENEADIKNVFNIINNAYVSLKEGIYTGLLYQTRLDDYLAEIELNLQATDP
FT                   TELFNYSGIQEKLEQIFIINPEKAFTDLSDLVNYHPDILTNWLPEGKTLLIQFLNEVIE
FT                   QGLWDDLASKVDLKILEQSGFIIGTKLDDTLNGTKNNDTLNGGWGNDKLNGGAGQDTLI
FT                   GGSGNAVMTGGDYEKDIYIFQSGHGQDIINDKSYDWTNLQYFNDVKFEGANFTDAQFLR
FT                   VGNDLVIKAFGTDDSVSFKNYLNDNDSYSRDFNFIFADKTLTTADVMNIVIPLNGTDGN
FT                   DVQNGWKGKDNLLGSLGDDTLNGLAGDDWLEGGAGNDILNGGEGNDLLEGGAGNDTLTG
FT                   GIGADTAIFKILAGFGNDATGGNGVDTWSDFNISQGDKINISELIIGPASKENLNQFVS
FT                   FEKSGSTVTLSLDRDGNDINYSATKLLILNNQTNVNSLNDLIKADVFIV"
FT   gene            complement(878374..878703)
FT                   /locus_tag="A1S_0743"
FT   CDS_pept        complement(878374..878703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0743"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11183"
FT                   /db_xref="InterPro:IPR031409"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2N9"
FT                   /protein_id="ABO11183.2"
FT                   /translation="MSRTYTFFIHLRALPAWLALARQKRAEFSAQKLEPIFEKYPTVKV
FT                   RWYDVEAFSTKASDIAVFETTSLQDYYFVIDAIRDSEFCTVPYFEFVEIIPAIEDGYVE
FT                   YESSL"
FT   gene            878825..879424
FT                   /locus_tag="A1S_0744"
FT   CDS_pept        878825..879424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0744"
FT                   /product="transcriptional regulator (TetR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0744"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11184"
FT                   /protein_id="ABO11184.2"
FT                   /translation="MSETLPDPRKRPRQARSVATFEAILEAAARILESLGFAGFNTNAV
FT                   AELAGVSIGSLYQYFPSKDALIVELIRRERAKLSNHIVEVIQQSDAADLKDKLKLIIQA
FT                   AVQHQLSRPQLARTLEFASELIGKDIEESEHQHELETIISDLFKRSGVSHAQTAAQDVI
FT                   ALSKGMINAAGIVGESDLNHLQQRVEKAVFGYLDLD"
FT   gene            complement(879534..882155)
FT                   /locus_tag="A1S_0745"
FT   CDS_pept        complement(879534..882155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0745"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11185"
FT                   /protein_id="ABO11185.1"
FT                   /translation="MNSSPTTTSNNVNDNDVTNNGNGSTSGSGTGNGSGDGLLNGAASG
FT                   NGEHNYGIGNGIADDASITAPLSIPINLAGNSITLIGDSSSSSVNNSATNTSNTVNDND
FT                   TTYNGNGSGTGNGSGDGLLNGIGSGNGEQNYGIGNGIADDASITAPITLPINLSGNSIT
FT                   LIGNSSASSVNSSPTTTSNTVNDNDTTYNGNGTGDSGVSALGGSGNGSGDGAGNGIASG
FT                   NGEHNYGIGNGNGDDVDITAPITGVLNISGNSFTLIGNSSSSSVNTAPTTTSNTVNDND
FT                   TIDNGNSGGTGSGSGNGSGDGLLNGAASGNGEHNYGIGNGNGDDVDITAPITGVFNFSG
FT                   NSFSLIGNSSSSSINTAPTTTTNTVNDNDVTDNGNDGGGLVGGSSGNGSGDGLLNGAAS
FT                   GNGEHNYGIGNGNGDDADFTFPLTGVLNFSGNSLSGFGSSSSDSVNVAPTTATNTVNDN
FT                   DTIDNANTGGLGGGSGNGSGDGLLNGAASGNGEHNYGIGNGNGDDADFTLPFTGGLNIL
FT                   GNALSGIGGSSTDSINISPTTTSNTVNDNDTTNNGNTSGGVIGSSDSGNGSGDGLLNGI
FT                   SSGNGEHNYGIGNGNGDDVDVVAPITTPLNVLGNSFSFIGGEGTGDILGPITGVIGGIG
FT                   GDGDILSPITGIIGGIGGIGGDLGDNPLTGIIQSGIDVLQNLESLKTGLINTGIDTIAG
FT                   TIIGVFPDAEHPVGDFADLGKLLFETSRDSVNGTLEAISDLAGADLEGASGSITGVIDT
FT                   LITNGSTASTIIQHIVGDDLVTENGGLLGSITTIIGGVDSGDGGLLGGLDGLININYGD
FT                   SDNSNSVDVEDILGNILGSVGSNQGIAVGEPDPTGGSLIHTISLNTVNQLTDQLLHALP
FT                   TV"
FT   gene            complement(882515..882616)
FT                   /locus_tag="A1S_3562"
FT                   /old_locus_tag="AS1_3562"
FT   CDS_pept        complement(882515..882616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3562"
FT                   /old_locus_tag="AS1_3562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3562"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89987"
FT                   /protein_id="ABS89987.1"
FT                   /translation="MFKNVIKNNRIFYFVDFEYIYKPAVPAVTNYTT"
FT   gene            complement(883242..884525)
FT                   /locus_tag="A1S_0746"
FT   CDS_pept        complement(883242..884525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0746"
FT                   /product="ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0746"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11186"
FT                   /protein_id="ABO11186.2"
FT                   /translation="MSILSWDDFEDDSQKPAAPEHKSAPVNPEKTPDSQNVSAAQPSSQ
FT                   SVAAPQSAGTHSVRSTNPTDSMARASEALEHLDVAPGLEELEMGAQRVQVDDKAMINCR
FT                   ADLNQLVPFKYEWAWQKYLDGCANHWMPQEVNMNHDIALWKSENGLTEDERTIVMRSLG
FT                   FFSTADSLVANNLVLAIYRHITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEVF
FT                   NMYREIPSVARKAAWGLKYTQSLSDPTFHTGTPENDQRLLRNLIAFYCVLEGIFFYCGF
FT                   TQILSMGRRNKMNGVAEQFQYILRDESMHLNFGIDMINQIKIENPHLWTAEFQQEVIQM
FT                   ILEGTMLEIEYARDTMPRGVLGMNASMMEEYLKFICNRRLSQLGLPEQFAGVTNPFAWM
FT                   SEMMDLRKEKNFFETRVTDYQTGGALSW"
FT   gene            complement(884663..884797)
FT                   /locus_tag="A1S_3563"
FT                   /old_locus_tag="AS1_3563"
FT   CDS_pept        complement(884663..884797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3563"
FT                   /old_locus_tag="AS1_3563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3563"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89988"
FT                   /protein_id="ABS89988.1"
FT                   /translation="MFFHLSHNYMLGVGILIFAFIFFYTPMVYAFFKIRKQQRKQNKL"
FT   gene            complement(884853..887687)
FT                   /locus_tag="A1S_0747"
FT   CDS_pept        complement(884853..887687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0747"
FT                   /product="ribonucleoside diphosphate reductase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0747"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11187"
FT                   /protein_id="ABO11187.2"
FT                   /translation="MSVITSTPGQIQVIKRTGDVAAFDAEKISVAIGKAFLAVEGQQSA
FT                   DSSRIHDRITQLTEMVLNTFTRRLPSGGTIHIEEIQDQVELALMRTGEHKVARAYVIYR
FT                   DQRASARKDTNSNHHPTLQVTDANGQLQPLDLSALQATVNRAAEGLEGIDVQAIIDETV
FT                   KNLYNGVKESDIATTMMMATRTRIEQEPNYTYVTARLLRDELVSTGLAFLGLPADTAEN
FT                   NALEAFLKKGVELDLLSPDLLKFDLEKLAAAIQPERSNQFTYLGLQTLFDRYFIHSNGV
FT                   RFELPQLFFMRVSMGLALNEQDKEERAIEFYNLLSSFDYMASTPTLFNSGTLRPQLSSC
FT                   YLTTIGDDLYDIYGAMRDNAMLSKWAGGLGNDWTPVRALNSYIKGTNGKSQGVVPFLKV
FT                   ANDTAVAVNQGGKRKGAVCAYLETWHLDIEEFLELRKNTGDDRRRTHDMNTANWVPDLF
FT                   MQRVFEDGEWTLFTPSETPDLHDLTGAEFAERYAYYESVAKEQNMLHKKVRAKDLWRKM
FT                   LSMLFETGHPWITFKDVCNLRSPQQHVGVVHSSNLCTEITLNTNQDEIAVCNLGSINLV
FT                   QHVKGGVLDREKLARTVKTAVRMLDNVIDINYYAVPQAKNSNLKHRPVGMGIMGFQDAL
FT                   YEMGMAYGSDEAVNFADESMEVISYYAIQTSSDLAVERGAYSTFKGSLWDQGILPIDSL
FT                   EIVAKSRPERMFEVDRTQRLDWDSLRAKVQKDGMRNSNVMAIAPTATISNICGVSQSIE
FT                   PTFQNLYVKSNLSGEFTVINPYLVRALKERGLWDTVMVNDLKHFEGSVQKIARIPEELK
FT                   AIFATAFEVEPRWIVDAASRRQKWIDQAQSLNLYISGANGKKLDITYKMAWLRGLKTTY
FT                   YLRALGATSAEKSTINTGALNAVKPATVEAAAPAAAPVVEAKKPEAVEEDGFTQAAPVP
FT                   MACSIDNPDCEACQ"
FT   gene            888220..888936
FT                   /locus_tag="A1S_0748"
FT   CDS_pept        888220..888936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0748"
FT                   /product="two-component regulatory activator (OmpR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11188"
FT                   /protein_id="ABO11188.2"
FT                   /translation="MSQEEKLPKILIVEDDERLARLTQEYLIRNGLEVGVETDGNRAIR
FT                   RIISEQPDLVVLDVMLPGADGLTVCREVRPHYHQPILMLTARTEDMDQVLGLEMGADDY
FT                   VAKPVQPRVLLARIRALLRRTDKTVEDEVAQRIEFDDLVIDNGGRSVTLNGELVDFTSA
FT                   EYDLLWLLASNAGRILSREDIFERLRGIEYDGQDRSIDVRISRIRPKIGDDPENPKRIK
FT                   TVRSKGYLFVKETNGL"
FT   gene            889026..890618
FT                   /locus_tag="A1S_0749"
FT   CDS_pept        889026..890618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0749"
FT                   /product="BfmS"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0749"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11189"
FT                   /protein_id="ABO11189.2"
FT                   /translation="MVAVFGYLLVQIINYQRAQEYRESLTDGISYVISEGVARQPGKQQ
FT                   KIDWISDASDLLELPIYYTDASKVELSRTEKKRIEAQKSVVRYDASNSIAYVIIGLRDD
FT                   PQHYLSIKVDKITERQMKALPIFVLDYLMFYPGQEQEYLAKIQKHFSYPINIQNIQDVN
FT                   LDSEQIGRLRQDQSVMLYKDSATVRGTTISIVSPIPNHPAQVLVLGPVPMFNWMPLQLS
FT                   AGITLFSLFLLSLGVYGLILPLERKIRQVRYALNRMKSGDLSLRVPIEGSDEMANLASS
FT                   YNNMSDHIQRLIEAQRELMRAVSHELRTPVARIRFGTEMLAEEDDYNHRMHQVDMIDKD
FT                   IEALNTLIDEIMTYAKLEQGTPSLDFAEIVLFEVLDQVAVETEALKTQKEIELIPPPLY
FT                   VKVDAERRYLHRVVQNLVGNAVRYCDNKVRITGGIHNDGMAFVCVEDDGPGIPEQDRKR
FT                   VFEAFARLDDSRTRASGGYGLGLSIVSRIAYWFGGEIKVDESPSLGGARFIMTWPAHRF
FT                   KQPPLKTNKKAPA"
FT   gene            complement(890641..890994)
FT                   /locus_tag="A1S_0750"
FT   CDS_pept        complement(890641..890994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0750"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11190"
FT                   /protein_id="ABO11190.2"
FT                   /translation="MNLEYTHKPDYYLFAQLLVRHIESYIHKHPDADNAIFDLRDVYEI
FT                   FRQDFASTTTNLEGILHIADSYRVETLNGDQPLIQKYQIDAKNNSLLIDFNTDALNSLR
FT                   SGKPILEPDATQL"
FT   gene            complement(891087..892058)
FT                   /locus_tag="A1S_0751"
FT   CDS_pept        complement(891087..892058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0751"
FT                   /product="diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0751"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11191"
FT                   /protein_id="ABO11191.1"
FT                   /translation="MIGSFWAEFGYWVTSELQNALLLLPIILNIPPYLKIKNHLKGNRI
FT                   YIKAIDFLPLFAVLISIGVSYYDSGPGSLLYPIAALIWCAIRYKPIIVALITSFTSAYI
FT                   IYHVSGHYLLLYPQDYLGNTISIRIGLIMMTVAPLTVSSISALHSELIQKLQHAIAHDE
FT                   LTSSLTRRQFLQSVRLLQEKVQKENKTSAFFMLDVDHFKKVNDSYGHLIGDRALQTCVT
FT                   TIQNILHPHDLLGRFGGEEFAIFIPDTTREAAFELAERIRIQISQQPIYVYGKLPIFVQ
FT                   VSIGISLYSPSYHRSIESLFKEADDALYQAKRQGRNRVFISL"
FT   gene            892935..893486
FT                   /locus_tag="A1S_0752"
FT   CDS_pept        892935..893486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0752"
FT                   /product="NADH dehydrogenase I chain A"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0752"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11192"
FT                   /db_xref="GOA:A3M2P8"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2P8"
FT                   /protein_id="ABO11192.1"
FT                   /translation="MSAITPYDWAIIAFVIGVTFLCVFMLTVPLLLGGKSWGRAKQEQF
FT                   ESGVVSAGGARIRLSAKFYLVAIFFVVFDLEALYLYAWSTSVREVGWLGYTTVVIFVVD
FT                   LLIALVYAFSVGALSWAPADRRKLAGEKIKVGSPTMNIAEITRFNSIEELVTDPTGQIP
FT                   AQSSGRVKSKTTPALSSEKE"
FT   gene            893493..894170
FT                   /locus_tag="A1S_0753"
FT   CDS_pept        893493..894170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0753"
FT                   /product="NADH dehydrogenase I chain B"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0753"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11193"
FT                   /db_xref="GOA:A3M2P9"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2P9"
FT                   /protein_id="ABO11193.2"
FT                   /translation="MKYTLTRANPDADQYPLQDRQIVTDPLEEEVNKNVFMTRLEDVLH
FT                   TAVNWGRKNSLWPFNFGTSCCYVEYATTLTGVHDLSRFGAEVIRASPRQADLMIVAGTC
FT                   FVKMAPVIQRLYEQMLEPKWVISMGACANSGGMYDIYSVVQGVDKIIPVDVYVPGCPPR
FT                   PEALIQALMLLQDQIQLERRPLSAVIGDDLQPVYKPKMMPERDRKNAQRIAVKNLRSMD
FT                   EIK"
FT   gene            894254..896041
FT                   /locus_tag="A1S_0754"
FT   CDS_pept        894254..896041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0754"
FT                   /product="NADH dehydrogenase I chain CD"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0754"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11194"
FT                   /db_xref="GOA:A3M2Q0"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR023062"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2Q0"
FT                   /protein_id="ABO11194.2"
FT                   /translation="MAETDIAMPESTPVDSRPAFAIVEELKTKFGENFYVQATFEEFPT
FT                   VWVERARVQEVLMFLRKVERPYVMLFDLSAMDERLRQHRDGLPASDFTVFYHLLSLERN
FT                   SDIRIKVALNENDLNLPTATNIWPNANWYEREAYDMFGINFEGHPMLRRILLPTYWEGH
FT                   PLRKEYSARATEYTPYMQDKAKQDFEQEHLRFVPEDWGLKRGNADEDFMFLNLGPNHPS
FT                   AHGAFRIVLQLDGEEVKDCVPDIGYHHRGVEKMAERQTWHSFIPYTDRVDYLGGCAQNM
FT                   PYVMAVEQLAGIKVPERAQVIRVMLNELFRINNHLLYCGTAIQDAGGMTPVFYMFADRQ
FT                   KVYDIVEAITGYRMHPAWFRIGGTAHDLPNNWQKLVKELLDWMPKRLNEYYTAAFKNSV
FT                   FIGRTRNVAQYDAKSALAWGVTGTGLRATGIDFDVRKYRPYSGYENFDFEVPVEYEGDA
FT                   YARVLVHFREIEQSLKIIKQCLDNMPSGPYKADHPLAVPPPKDKTLQDIETLITHFLSV
FT                   SWGPVMPAGEASFMTEVVKGASTYYLTSDKATMSYRTRIRTPTFTHLQQIPSVINGSLV
FT                   SDLIIYLATIDVVMADVDR"
FT   gene            896055..896564
FT                   /locus_tag="A1S_0755"
FT   CDS_pept        896055..896564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0755"
FT                   /product="NADH dehydrogenase I chain E"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0755"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11195"
FT                   /protein_id="ABO11195.2"
FT                   /translation="MMILTDKKPRVNVEGILTAEEIHEIEHHIGHYPYPRAASLDALKC
FT                   VQRRNGWVDDAQMNAIAQLLTISVADLEGVATFYNRIYRQPVGRHVILLCDSIACFLMG
FT                   AETLAEAFQRELGIQFGQTTQDGRFTLLPICCLGNCDKGPTLMIDEDTHGLVEVTSIKQ
FT                   LLEKYV"
FT   gene            896561..897895
FT                   /locus_tag="A1S_0756"
FT   CDS_pept        896561..897895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0756"
FT                   /product="NADH dehydrogenase I chain F"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0756"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11196"
FT                   /protein_id="ABO11196.2"
FT                   /translation="MNTEPKPIYGDGNPETHPLTWRLSKQESVRSADDYEALEGYAGFK
FT                   KALGMKPAEVLEVIKAATVKGRGGAGFPAGIKWSLMAPNDGGPRYLICNADEMEPGTFK
FT                   DRLLMEKLPHQLIEGMLIAGYTLEATQGYIFIRGEYIEAAQYLNEALEQIRAKGYLGDN
FT                   ILGSGWNFELHVHTGAGRYICGEETALINSLEGRRANPRTKPPFPQVAGAWGRPTIVNN
FT                   VETYNNLPAIMLRGPEWYIGLSAGKSKDPGTKIYGASGKVKFPGLWELPFGTTAREVIE
FT                   EHAGGMRDGLKLKAWLPGGASTDFLPADTIDLPMDAETIMKAGSRLGTCLLMVVDETQC
FT                   MVSLTRNLEEFFARESCGWCTPCRDGLPWAVKALKALETGEGKKEDIDHLQELTRKLWI
FT                   GKTFCAHATRCEWSRLWVALKHFRSEFEAKVTDRPVVQTSNVEQA"
FT   gene            897907..900591
FT                   /locus_tag="A1S_0757"
FT   CDS_pept        897907..900591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0757"
FT                   /product="NADH dehydrogenase I chain G"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0757"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11197"
FT                   /protein_id="ABO11197.2"
FT                   /translation="MATIHVDGKSYEVNGSENLLQACLSLGIDIPYFCWHPSLGSVGSC
FT                   RQCAVTQYANPEDTRGRLVMSCMTPASDNTYISIEDKEAVDFRESIVEFLMTNHPHDCP
FT                   VCEEGGHCHLQDMTVMTGHDRRRYRFTKRTHYNQELGSFIAHEMNRCIACYRCVRYYKD
FT                   YAGGTDFGVYANASRVYFGRPESGTLESEFSGNLTEVCPTGVFTDKTHSERYNRKWDMQ
FT                   YAPSVCHGCSSGCNISPGERYGEIRRVENRFNGSVNQYFLCDKGRFGTGYVNRADRPRQ
FT                   PQFRNGETVATVSVDQALDQTIAKLEGKKVLGIGSPRASLESNYALRELVGQANYSTGV
FT                   AQKEQSLVELAASIMQTEGIYNPNMREIESYDAVLILGEDLTQTAPRMALSVRQAAKNK
FT                   AREMAAKTRTPDWLAEPVQRIGQEAKSPIYILAATQTRLADVATGEVVASPNDIARLGF
FT                   AVAAAVKGETVNGLDEDAKAFAQTIADTLKAANKPLIIAGTSLQDASIMEAAAELTQNL
FT                   GSKAGLSLVVPEVNSMGLALFGGLSLEQAFAQDYDTLVIVENDLFRRLPAAQVKAALDK
FT                   AETVIVLDHSETETVKQADIVLSAASFAEGDGTVVSQEGRAQRFYQVYDPSYYKPEYAI
FT                   KESWRWLHAIETGLKGKPIDWTVLDDVIETIVKNVPVLEAIQDVAPDAGYRVHGLKIAR
FT                   EPRRYSGRTAMRAPLSVHEPKQPTDPDSALTFSMEGYVGPQKASSLVPFAWAPGWNSPQ
FT                   SWNKYQDEVGGHLKGGDSGVRLFDRLAKRPARSYVAPTAVVANPESFRLVPMHHIFGSG
FT                   EFTIKTPAMETRIPEAVFAVGEQDATRLNLQEGQRITVKAGETTVSLPVQVIEYLPTGY
FT                   IGYPVGLAPTVSLAEPVSVALGV"
FT   gene            900595..901611
FT                   /locus_tag="A1S_0758"
FT   CDS_pept        900595..901611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0758"
FT                   /product="NADH dehydrogenase I chain H"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0758"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11198"
FT                   /db_xref="GOA:A3M2Q4"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2Q4"
FT                   /protein_id="ABO11198.2"
FT                   /translation="MNQEIIRQTPLWAENWPIAYAVVQAVVILLVVVLVAALMSFIERR
FT                   LLAWWQDRYGPNRVGPGGMFQIVADMLKIMFKEDWTPKFADKLTFRLAPAVAMATAVLS
FT                   FMVIPVSPALGVADMSIGLLFFMAMAGIAVYAVLFGGWSSNNKYSLLGGLRSAAQTISY
FT                   EVFLGISLMGVVAIAGSFNLREIVEAQRDVWFIIPQFLGFLIFVVAGVAVTHRHPFDQP
FT                   EAEQELAEGYHVEYGGMKWGMFFVAEYVNVVLISALIVTLFFGGWLAPFNLEIPFVPPV
FT                   FWFVIKTAFFVMMFVLARGSLMRPRYDQVMNFGWKICLPLALVNLLVTGAVILMNQA"
FT   gene            901630..902172
FT                   /locus_tag="A1S_0759"
FT   CDS_pept        901630..902172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0759"
FT                   /product="NADH dehydrogenase I chain I 2Fe-2S
FT                   ferredoxin-related"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0759"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11199"
FT                   /db_xref="GOA:A3M2Q5"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2Q5"
FT                   /protein_id="ABO11199.2"
FT                   /translation="MYKILAGVGSIVRTLFMVFTHGFRKRDTILYPEVPAEEIVPPRYR
FT                   GRIILTRDPDGEERCVACNLCAVACPVGCISLQKAEKEDGRWYPEFFRINFSRCIFCGM
FT                   CEEACPTTAIQLTPDFELGEYVRQDLVYEKENLLISGPGKYPDYNFYRVTGMAINGKEK
FT                   GQAQKESAPIDVRSLLP"
FT   gene            902169..902690
FT                   /locus_tag="A1S_0760"
FT   CDS_pept        902169..902690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0760"
FT                   /product="NADH dehydrogenase I chain J"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0760"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11200"
FT                   /protein_id="ABO11200.2"
FT                   /translation="MMWPFYLMALVAIVSTVRVVTNTNPVHALLSLIVSLLAVAGIFMI
FT                   VGAPFAGALEIIVYAGAIMVLFVFVVMMLNLGQHTVEQERKWLSSDAWAYPALMSFLLG
FT                   LLLVWMLGGEYTTISAPLGAQVIGPKVVGQALFTHYLLLVEVAAMLLLAALVAAYHLGK
FT                   REPGAEEEKE"
FT   gene            902690..902998
FT                   /locus_tag="A1S_0761"
FT   CDS_pept        902690..902998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0761"
FT                   /product="NADH dehydrogenase I chain K"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0761"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11201"
FT                   /db_xref="GOA:A3M2Q7"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2Q7"
FT                   /protein_id="ABO11201.2"
FT                   /translation="MGQIPLEHGLIVATILFALGFYGVMVRRNLLFMLMSLEIMMNAAA
FT                   LAFVLAGSVWAQPDGQVMFILILTLAAAEACIGLAIVLQFYHRFHHLDVDAASEMRG"
FT   gene            902995..904884
FT                   /locus_tag="A1S_0762"
FT   CDS_pept        902995..904884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0762"
FT                   /product="NADH dehydrogenase I chain L"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0762"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11202"
FT                   /protein_id="ABO11202.2"
FT                   /translation="MSYLYLTVLFPLIGFILLAAGRDKLSENVAAIIGVGSVGLSALFA
FT                   LIAGMAFTSSGQQVFVQNLWTWFNVGGFAPGISLHLDGLSLLMMGMITGVGFLIHIFAS
FT                   WYMRGEEGYARFFSYFNLFVASMLLLVLGDNLALLFLGWEGVGLCSYLLIGFYYANPAN
FT                   GWAAIKAFTVTRVGDVFLLIALFLLYQQFGTLNTQYIVEHAAEVMTKSSSLTIWTALML
FT                   FLGAAGKSAQIPLQTWLADAMAGPTPVSALIHAATMVTAGVYLCCRLFSVFELAPEVMQ
FT                   FISVTGAVTLLVAGFAALVQTDIKRILAYSTMSQLGYMFMAVGAEAYQAGLFHMLAHAF
FT                   FKALLFLSSGAVILAYHHEQNIFKMGGLFYKNKFLFACFAIGGGALAAIPFLTIGFFSK
FT                   DAILGEVWVQGQSIALYNSLYWAGVAGAFLTSIYTFRLIWVVFFGKENTHYHEIKGATY
FT                   WAPLGILAVLSTFVGAALKAPVANILNTAKIPEFHVAEQFVEGMHGAEHLAVGIALVGL
FT                   AVGIGLFAFAYGAVKSFAKTSLGAGLAHICRTAFGFDALYDIVFVKPYLFFAKLFGRDP
FT                   IDSLWLVLPALVKGGNSFTSSRQTGSLREYASSMSLGVVVLLMILIVIQVVGK"
FT   gene            904886..906484
FT                   /locus_tag="A1S_0763"
FT   CDS_pept        904886..906484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0763"
FT                   /product="NADH dehydrogenase I chain M membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0763"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11203"
FT                   /protein_id="ABO11203.2"
FT                   /translation="MENNLILPALILVPFIAGFTCWLVDKLDKTLPRWIALIGMLITLG
FT                   LGLALWQSGTYSYELGSKVPTWTAEFYLPWIQSLGIGIHLAVDGLSLLMVLLTALLGVL
FT                   AVGCSWGEIQKNVGFFHLNLLWSLGGVIGVFLAIDLFLFFFFWEMMLVPIYFLIALWGH
FT                   KGSNGRSRVYAATKFFLYTQIAGLVMLIGILGLVVYGYMMTGMIGFDYNYLLAVANRLP
FT                   AGFAYGFMICFFIGFAVKLPVFPLHGWLPDAHAQAPTAGSVDLAGILIKTAAYGLLRFV
FT                   IPFFPAASAQFADIAIIFGLIGIFYGAWCAYQQTDMKRLLAYTSISHMGFVLLAIYAGN
FT                   ILTFQGLMIMMLAHGLSSAALFIMSGQIYERLHTRDLRLMGGLRGQLQYLPFFLMFFVA
FT                   ALVGVPGLGNFIGEFLILMGSFNKYPVFTIIASISLVFAGLYGLILIHRALFGEPNSEQ
FT                   KQHYTSPLKDLSAREVSILMICAIGLVWLGIYPQTFLDVSHSSMQWLVNSYVPVQEVVE
FT                   TVQQTATQLDHVEIQ"
FT   gene            906487..907983
FT                   /locus_tag="A1S_0764"
FT   CDS_pept        906487..907983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0764"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0764"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11204"
FT                   /protein_id="ABO11204.2"
FT                   /translation="MNFTVSFSTLMPLAPVMIVALTAVVVMLLISIKRNHNLIATTSVV
FT                   GLNLAALYILLELFGGKFVPANVMGMFMVDPFTMFYQFMILVASLACCTLSHAYIETYK
FT                   DNREELYLLLLASVAGAMLMVASSHYASFFISLELMSIPVYGLLAYTYQRSQSLEAGIK
FT                   YLVLSATASAMLLMGMAYIYAYTGSLSFYDSVQALFGAIKQPMVLLGLALIIFAVAFKL
FT                   SLAPFHKWTPDVYAGAPAPMATFLATAAKVATIGLFVRYLLASGAIMVNSLVTVLTIIA
FT                   VLSILVGNLLAVRQVNLKRILGYSSIAHFGYLLIALISMTYASLGSVTVYVVTYVLTTI
FT                   GAFGAVALMSSPYNNVDEAQSLADYRGLFWRRPVLTATLTVMMLSLAGIPLTAGFIGKF
FT                   LVVMAAVTTQHWFLAAMIIVGSGIGLYYYLRVMVVMYMTPPETPRIDADAHWGQKVGGL
FT                   MVLAAAALVIILGVYPDPMINLALKAEILSPLHFMLSQQQ"
FT   gene            908084..908719
FT                   /locus_tag="A1S_0765"
FT   CDS_pept        908084..908719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0765"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0765"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11205"
FT                   /db_xref="GOA:A3M2R1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2R1"
FT                   /protein_id="ABO11205.2"
FT                   /translation="MAIQEIRHPLIRHKLGLLRRADISTKNFRELAQEVTMLLTYEATK
FT                   DLPVVDCEIEGWAGNVTTQRIAGKKITIVPILRAGIGMLDGVLNLIPSAKVSVLGLERD
FT                   EATLEVRTYYKKLVPDVANRIAMIIDPMLATGNSLVAAIDVLKASGCKDIRVMVLVAAP
FT                   EGIAKVETAHPDIQLYTASIDNGLNEHGYIVPGLGDAGDKIFGSVQKD"
FT   gene            908836..909129
FT                   /locus_tag="A1S_0766"
FT   CDS_pept        908836..909129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0766"
FT                   /product="putative cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0766"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11206"
FT                   /protein_id="ABO11206.1"
FT                   /translation="MKQEFYTGRVKQYNADKGFGFISTTEGDIFFHISDFPASEGEPKR
FT                   NEKVRFLAADNRGKFKAVKIERIDPNPAKTKKTKIADHNKAITSELLSNFRR"
FT   gene            909395..909742
FT                   /locus_tag="A1S_0767"
FT   CDS_pept        909395..909742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0767"
FT                   /product="Excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0767"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11207"
FT                   /protein_id="ABO11207.1"
FT                   /translation="MVLHYRQQAQQRASHEKVQLLIQQQKTIIEAQRAALGKLPDVQLS
FT                   EKTKKALALTSEKVPERVNDETSAFQCDGREYCTQMHSLEEARWFVRNCPNTKMDGDRD
FT                   GEPCENDSRWH"
FT   gene            complement(909754..910641)
FT                   /locus_tag="A1S_0768"
FT   CDS_pept        complement(909754..910641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0768"
FT                   /product="putative transcriptional regulator (LysR family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0768"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11208"
FT                   /protein_id="ABO11208.2"
FT                   /translation="MRMTLRQLAVFVAVAQEGTVTKASDAVRLTQSAASMALADLEDGL
FT                   GAPLFDRLGKRLQLNDLGRFLLPQALEILGRCEAFEQAAKGELQSIDLRIGATLTISDY
FT                   LMPDLMANFLQRHPQAHLQLQVGNTRQMIEAVNQFQLDLALIEGSCHLPQLQCIHWRDD
FT                   ELAVCCSPDHPLTRLNRPLTPQDFHDVEWILREEGSGTREVFDNAILQDLPDANIRLTL
FT                   GHNEAILKIVAGGLGMSCISKLAIEPLSEKGQLVILDTPFWQLTRPLYMLVHRQKYQGP
FT                   GLKAFLKFCDEDQA"
FT   gene            910728..911489
FT                   /locus_tag="A1S_0769"
FT   CDS_pept        910728..911489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0769"
FT                   /product="ferredoxin--NADP+ reductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0769"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11209"
FT                   /protein_id="ABO11209.2"
FT                   /translation="MSIEKFSVEKVLSVHRWTPTLFSFTMTRPSHFKFTAGQFARIGLK
FT                   VGDELVVRAYSVVSSPFDETLEFFSIVVPDGAFTSNLQHLKVGDELYLEKIPYGYLTLA
FT                   RYQQPLPHDLWLLATGTGLAPFLSMLQDFETWSNYQKINLVYSVRTAAELAYVDRIQEI
FT                   AETFGEGHSGFKFIPIITRDPSAPLHERLPVLIENGELEKVAGLELSPASSHVMLCGNP
FT                   QMVDDTKEALKCRGLTMNRRGEGNIAVENYW"
FT   gene            complement(911540..911962)
FT                   /locus_tag="A1S_0770"
FT   CDS_pept        complement(911540..911962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0770"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11210"
FT                   /protein_id="ABO11210.2"
FT                   /translation="MMYRQQSVTLDLDTDVTHQCYLHQTRDDHLIGIIEFNKPSYELKW
FT                   GDLEYFRRRTEEFSVMPFPECINAMIVDIRNINVFLDNEVPILPWRLLEEDCPVRLVVP
FT                   QDRLEHYAGLFEPTWLSTDVDSAIAEIREFMDMFVH"
FT   gene            912252..912479
FT                   /locus_tag="A1S_3564"
FT                   /old_locus_tag="AS1_3564"
FT   CDS_pept        912252..912479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3564"
FT                   /old_locus_tag="AS1_3564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3564"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89989"
FT                   /protein_id="ABS89989.2"
FT                   /translation="MHDFSKPPHVTSPEETAKKRRLPVYILIIVGLFLLALVVYMVADH
FT                   SKTPKEEAAFQHETIPQVISGTSDLKTYEG"
FT   gene            912707..914383
FT                   /locus_tag="A1S_0771"
FT   CDS_pept        912707..914383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0771"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0771"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11211"
FT                   /protein_id="ABO11211.2"
FT                   /translation="MNEFFNGPRGAQFDAMYYWDQFHPILAAIVILLVGWIIALLVAAG
FT                   VKKLLQKVNTNAKLSSATGRTPNIEGLISKVVFWFILILAVVAALNVLNISGVSGPFSN
FT                   MVNQVLVYIPNIIAAVVVGFIGWIVARLVRAGVTNVLSRTQLDDKLSSEVGVGGISQNI
FT                   GEILYWLVLLLFLPIVLSILGLTGLLIPVQNMVNDAVAFLPNIFIAGVIVFVGYILAKI
FT                   VRGIVEGLINSLGVQSQAEKIGLFKNSNVGKFLGSFVFAIIIITTLIVAFEALGIETIS
FT                   QPATAMLNEILQAIPNIIAAGLILLVAYIVSRFVGRLVAELIAGTGVDEIPAKLDVQRF
FT                   LGQTKVSNAVGWLIVFFTMLFAVSEAADRLGFDQISGLIAMFIHFGANILLGAVILVIG
FT                   FWLANVVANVVQRGEYNSSRWLGSLVRVLIIGLVLALGLRAMGIADSIVNLAFGLTLGA
FT                   VAVAFALAFGLGGRQPAERLLSDLLDKAKKEANQPNPLYQPPTNNKTTGSSSTVSTPST
FT                   TTTAPSTAVSSDAKPADSAQVNPSQPPVNKPFGSTGENDEI"
FT   gene            914512..914682
FT                   /locus_tag="A1S_3565"
FT                   /old_locus_tag="AS1_3565"
FT   CDS_pept        914512..914682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3565"
FT                   /old_locus_tag="AS1_3565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3565"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89990"
FT                   /protein_id="ABS89990.1"
FT                   /translation="MKKPGRFLAPVVIAGITVGFLASAYKFVFSKSESSKQTTSHKHDS
FT                   EKSSNDSKASN"
FT   gene            complement(914695..915894)
FT                   /locus_tag="A1S_0772"
FT   CDS_pept        complement(914695..915894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0772"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0772"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11212"
FT                   /protein_id="ABO11212.1"
FT                   /translation="MSNSHVDVIVLGAGASGLMLAAHAAKRGRSVLILEKANKIGKKIL
FT                   MSGGGKCNFTNLYVEPENYISHNPHFVISALSRYSNWDFIGLVCDYGIAYEERKHGQLF
FT                   TLNGAKEILEMLVSECNKTNKVEIQTHCEVGQVDPLEQGGFSVHTNQGRFSCESLVVAT
FT                   GGLSIPTLGGSGFGYELAQKFGHTVFPTRAGLVPFTFSDHIKEVTTRLSGNALDVTLTN
FT                   SKNSFTEALLFTHRGLSGPSSLQLSNYWNTGESFKIDFFPSQDLATYLKDKKKAQPKVL
FT                   LRTLLNEFTAKSIVQELQQLIWPEQSETPIGNISDAQLDHIAEQLHGFTVKPSGTEGYR
FT                   TAEVTLGGIDTTEVSSKTLESKKQKGLFFIGEVLDVTGHLGGYNFQWAWSSAYAAAQYV
FT                   "
FT   gene            complement(916012..916722)
FT                   /locus_tag="A1S_0773"
FT   CDS_pept        complement(916012..916722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0773"
FT                   /product="putative D-cysteine desulfhydrase (DcyD)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11213"
FT                   /protein_id="ABO11213.2"
FT                   /translation="MTFGGAYSNHIAATAYAAHLFGLKSIGIIRGEELAGKPLNPTLAK
FT                   AQSLGMQLHFVSRHEYRLRDDANYLQQLQQQFPQTYIIPEGGTNELAVQGCQEILSQYD
FT                   LDQYDVICCAVGTGGTISGLIERSAAHQKVLGFSALKGDFLQQAIRQWTKKQNWSLTDV
FT                   YCWGGYAKTSPELFAFIENFEEQYTVPLEPIYTGKMMFGLFDLIKNNYFPANTRILAIH
FT                   SGGLQADIRNKPHT"
FT   gene            complement(916767..916922)
FT                   /locus_tag="A1S_3566"
FT                   /old_locus_tag="AS1_3566"
FT   CDS_pept        complement(916767..916922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3566"
FT                   /old_locus_tag="AS1_3566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3566"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89991"
FT                   /protein_id="ABS89991.1"
FT                   /translation="MINHYFSQFLMFDHIAQPISYQHIELSFPVHLDIKRLDLVHPQIS
FT                   GNKFSN"
FT   gene            complement(916957..918084)
FT                   /locus_tag="A1S_0774"
FT   CDS_pept        complement(916957..918084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0774"
FT                   /product="Putative RND family drug transporter"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11214"
FT                   /protein_id="ABO11214.2"
FT                   /translation="MSDDQNKPEQTPAQTSNNEPAPAPAPAPASKLIPTKRSTLLWMLG
FT                   VLIIGILVILWAWRIGPFATSVQQTDNSYVKGKTTILSSQINGYVKDVLVKDFDHVKKG
FT                   QVLMHIDATTYDQKVAQAASGVEQAKNTLANQTQSIAQKQADIVAAQAKVEQVRAQYEL
FT                   SLAQLRRYQQLGNSGAASKSEQDKAAADAENNLAALKQAEANVLVAKEALKTAQVAEAG
FT                   LEAQVSSAKAQLDQAQTTKDYSVIVAPMDGQLGEVNPRVGQYVAAGSQLLYLIPQQTWV
FT                   IANFKETQIANMRIGQKAWFTVDAMKHKKFTGHVEQISPAAGSEFSVLKPDNATGNFTK
FT                   VVQRIAVRITIDPNQEGMEHLRPGMSVITSVDTSS"
FT   gene            complement(918125..919768)
FT                   /locus_tag="A1S_0775"
FT   CDS_pept        complement(918125..919768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0775"
FT                   /product="putative transporter (MFS superfamily)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11215"
FT                   /protein_id="ABO11215.2"
FT                   /translation="MSKTPRYLETPPDWTPEEQPTLPGSPAAIAHSVPKRFLYFFIGLF
FT                   VAISASLSNGFITANLPLIQGEYGLTPSEAAWLPAAYVMANVSSNLILFKARQQYGLRV
FT                   FSEIGLVIFIAVLVLHIFVHTYEMALFARVVAGLAGAPLSSLGMYYTMQAFKKADMAKG
FT                   IYIAFGFQQLGVPLAWIISPFLVSTDSWSVLYTFELGLALCCLAMVVSLKLPRSLRIYV
FT                   FEKQDFFTFALLAPGFACLCIVLTQGPILWWFNSEWLAYVLIAGFSLVVLGLLYEHYRA
FT                   NPLIMTRWLGASSTLRFIFGAFAIRLLMSEQSYAAVNFLKTMGMGPDQFVPLYVVILVG
FT                   ILSGTLFSALTFSRERIIFHLLFAEFLILIACGLDYHLTSDVRPSNFFASQFLVGFAGG
FT                   LFIGPLLLIGFAQTLAKGPSYVVTFIVLFSATQTFGGLVGSSFFSTYQQHRTQNYQVEI
FT                   IKDLEQADPLVAQRLSTYQRSAAITTNDPALQTAQSMRSLNQVVTREAQVRAYNDVIAL
FT                   NGIFAVALLLWGGFNIARSKYLQRRGISRP"
FT   gene            complement(919765..920334)
FT                   /locus_tag="A1S_0776"
FT   CDS_pept        complement(919765..920334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0776"
FT                   /product="putative transcriptional regulator (TetR-family)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0776"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11216"
FT                   /protein_id="ABO11216.2"
FT                   /translation="MSKRQKIAAHNRDELLNAAEECFRIHGINVPLQVVIDHAGVGRAT
FT                   FYRNFCDRKALISALLERAITQLEQKAAHFQQFEDGLFRLIEGHIAQLPKLAILQDFWR
FT                   VIDRQDPIMLKIYERRNNALKPLIENAIEQKLCRADLTADDYAMVTAMLGSSFQGHEPE
FT                   EQTRLAKRAIELLFHGIQVQKIRGIE"
FT   gene            920513..921136
FT                   /locus_tag="A1S_0777"
FT   CDS_pept        920513..921136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0777"
FT                   /product="putative threonine efflux protein (RhtC)"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0777"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11217"
FT                   /protein_id="ABO11217.2"
FT                   /translation="MFESLIPLFSIAMALMLGAISPGPSFIYVAQNSISKSRKHGLFTA
FT                   LGTGTGAALFGFLAVMGLQAVLLAVPSAYLILKIGGGLYLLWLAFKIIKHAKEPIAMEN
FT                   DAKSKMTYKQAYRYGLITQLSNPKIAVVLASVFTALLPKEIPNYYYVALPLICFMIDAG
FT                   WYSCVAMLLSSEKPRKMYLKAKTGVDRVAGSIVSVLGLKLIFFK"
FT   gene            complement(921119..921217)
FT                   /locus_tag="A1S_3567"
FT                   /old_locus_tag="AS1_3567"
FT   CDS_pept        complement(921119..921217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3567"
FT                   /old_locus_tag="AS1_3567"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3567"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89992"
FT                   /protein_id="ABS89992.1"
FT                   /translation="MYIFCAKIKPDYKELALYFLDILIKDLSFEED"
FT   gene            921310..921486
FT                   /locus_tag="A1S_3568"
FT                   /old_locus_tag="AS1_3568"
FT   CDS_pept        921310..921486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3568"
FT                   /old_locus_tag="AS1_3568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3568"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89993"
FT                   /protein_id="ABS89993.1"
FT                   /translation="MVSISVVFFILTTGCEMRTTSKQQPSNERAMSIAGSPVYEKDYKI
FT                   PDLQANNHEQSNY"
FT   gene            complement(921615..923678)
FT                   /locus_tag="A1S_0778"
FT   CDS_pept        complement(921615..923678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0778"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11218"
FT                   /protein_id="ABO11218.2"
FT                   /translation="MRKILVTNALPYANGPIHMGHLLGYIQADIWVRAMRAMGHDVTYV
FT                   CADDAHGTAIMLRAEANGISPEEQIANVQKEHIRDFDGFGVHFDHYDSTHSDANKARST
FT                   DIYIKNREAGNIAVRPVTQLFDPEKGMFLSDRFIKGTCPKCKSEDQYGDSCEVCGTTYN
FT                   ATELLNPRSTLSGATPVEKSSDHYFFKLPNFAEYLQKWTRDEGRLPLSIANKLDEWFEA
FT                   GLADWDISRDAPYFGFEIPDAPNKYFYVWVDAPIGYMSSFENYIKTKRPDLNFDDFWKK
FT                   DSQNEVYHFIGKDIVYFHALFWPAMLEGANYRTPTGLFVNGFLTVNGQKMSKSRGTFIK
FT                   AETYLQHLNPEYLRYYFASKLSDKVEDSDLNLDDFVQKVNSDLVGKVVNIASRCAKFIN
FT                   SSFNNTLSSTCAESDLVQSFIDAGDSIAAAYEAREFSTAIREIMALADRANQYIDEKKP
FT                   WALAKQEGQEQQVLDVCSVGINLFRQLAVYLAPVLPTLAQQVQDFLKLESFDFESRKQI
FT                   LVSHEIAQFQPLMQRVDPKAVAAMVDASKESLGTPAPQATKAAKKEKSAEKKAAPTPAV
FT                   GEAEIIGIEDFLKVDLRVAQVVEAGTVEGSDKLLQLTLDVGEAEPRNVFSGIRSQYAPE
FT                   DLKGKLVVMVANLAPRKMRFGISNGMVLAAGNGEGIFIISPDSGAKPGDKVS"
FT   gene            923964..924464
FT                   /locus_tag="A1S_0779"
FT   CDS_pept        923964..924464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0779"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11219"
FT                   /protein_id="ABO11219.2"
FT                   /translation="MTTENKLDELKAKAADAKVQGEKALDDLKENVKEKQTAGKEAVAD
FT                   KVDELKTKAADAKVQGEKALEDLKENVKEKQAAAKEAVEDKASDLKGKLDDAQHSLQDK
FT                   FDHLRTEAAHKLDDAKAKAAELKEEAATKFDELKTQATAKFDELKKTATEKLNKLKNHD
FT                   SAE"
FT   gene            924610..925839
FT                   /locus_tag="A1S_0780"
FT   CDS_pept        924610..925839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0780"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0780"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11220"
FT                   /protein_id="ABO11220.2"
FT                   /translation="MSWLSSLKSVFSPAQEVKEEEIQTVLQNYLLPDSKDALKERISQL
FT                   QVQGRVLQLTINTFPDEKEYLQQIHDDLAGALQKCGIEELNLHVVQQKRPTQESSGQGC
FT                   SSKAPKENSNLPPVLDASPKSEPDPNNPPIQKAAPQQRDVPLHPRIKNVILVSSGKGGV
FT                   GKSTTTVNLALALQKMGLKVGVLDADIYGPSIPTMLGNAGKTPLIESENFVPLDAYGMA
FT                   VLSIGHLTGDNNTPVAWRGPKATGALMQLFNQTLWPDLDVLMIDMPPGTGDIQLTLAQR
FT                   IPVTGSIIVTTPQNVALLDATKGIELFNKVGIPVLGVVENMSTHICSNCGHEEQIFGIG
FT                   GGDKLSEQYHIPLLGRLPLNAQIREHADQGKPSVIAMDDAADSYIDIAKAVWQQIEKIP
FT                   QRARDDKRIF"
FT   gene            925985..926857
FT                   /locus_tag="A1S_0781"
FT   CDS_pept        925985..926857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0781"
FT                   /product="putative MTA/SAH nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0781"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11221"
FT                   /protein_id="ABO11221.2"
FT                   /translation="MQFKYSLGVISLCSALFLVGCNDDNSSVSQTPTVQEQKQKLQPII
FT                   IQGALPVESERMASKLENKTVEKIGGWTFWKGTYNGYPMIISKTRMGMSNSAAATALAI
FT                   ERYKPIAIINQGTAGGHDPDLHVYDIVLGKYATNIGAFRTPKQPLGGGSNSLTWVEAFD
FT                   VLPTEESEPEPIAIRKFEGDQELLMAAHKVRYDKGEVVEGTIGSADVWNNELDRIQFFH
FT                   ERYGTSVEEMEAASVAQIASQLNVPFLGIRILSNNITNNGAYDPGTGEACQDYVLNVAE
FT                   EYMKSKLPK"
FT   gene            complement(926888..927454)
FT                   /locus_tag="A1S_0782"
FT   CDS_pept        complement(926888..927454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0782"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0782"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11222"
FT                   /protein_id="ABO11222.2"
FT                   /translation="MIMAKQFFQSWLPSPEKVSNMKFLRIFGQKTLNPVLWYVNRKSIT
FT                   RAIFVGTFFGLLPIPFHSVFIVMAVLLFEVNLPISLMLAWLSNPLTLAPILYIGFWFGA
FT                   HIYHVHMINKKMLLGVLHQISRWITHFGHGHIDLSLAKILISGLIVEAFVFATILYIVT
FT                   EVFWRWMVIRNWKNRTGHKKQEDAL"
FT   gene            927811..928404
FT                   /locus_tag="A1S_0783"
FT   CDS_pept        927811..928404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0783"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0783"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11223"
FT                   /protein_id="ABO11223.2"
FT                   /translation="MISWLFIGLVATILLTPGPTNTLLASSGVQVGLKKSAKLIPAEVL
FT                   GYVISISAWGMLIGKVSATLPLLPPILKLLSACYIIFLAIKLWHTANQQLELDQPTIRP
FT                   RELFCATLLNPKALLFASAIFPVAAWTNFHIYLIHMLAYLALITPIALFWIFLGSVLAA
FT                   NKVRWLNQSNLQRTASLVLVSFSIPISYSALLNL"
FT   gene            928519..929088
FT                   /locus_tag="A1S_0784"
FT   CDS_pept        928519..929088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0784"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0784"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11224"
FT                   /db_xref="GOA:A3M2T0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A3M2T0"
FT                   /protein_id="ABO11224.2"
FT                   /translation="MAIKSDRWIREMSEKHGMIEPYAENQVRFDKNGEKLISYGVSSYG
FT                   YDVRCAREFKVFTNVHSAIVDPKNFDEKSFIDIESDVCIIPPNSFALARTIEYFRIPRN
FT                   VLTVCLGKSTYARCGIIVNVTPLEPEWEGHVTLEFSNTTNLPARIYAGEGVAQMLFFES
FT                   DEICETSYKDRGGKYQGQTGVTLPKT"
FT   gene            929385..930725
FT                   /locus_tag="A1S_0785"
FT   CDS_pept        929385..930725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0785"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0785"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11225"
FT                   /protein_id="ABO11225.2"
FT                   /translation="MRQFTSLQVAILALGSLCFSSAYAGSTLVPMTDAELSATRGQALM
FT                   SMSYIAPNDSANLEKLRDSSSNVGFFKLSLDADIELNTNIRKLQLGCGGANGAGACDID
FT                   IDNLSLSGLSNTNDGRASSSAKITNPFIEFAIKNPNSTALREVTGLRVSAEAIEGLLTF
FT                   GTENSQTKNGINSLSGYMEVAQAGGTVKVNPVNGLRPADVNNTQISGEACGYLACVPFQ
FT                   TYDYTLNLTTDAAGTSTDKLTGTLFLPQQTITGKRISVAPLKATATVSGINVSGNIKAI
FT                   AAGLLNLDKSVTGSINNLAVNVDISEDLGFFHKANLNGSPVSLSLQGNDIRWPGTKSVA
FT                   ERGWWLELSNPIDIGDITPAESVSIANKTIEETLALVSQKLSTGTRGNTKVDCGDLGLL
FT                   SCIGGSTINIGNLNLAGATPVQMSLSNLVLKNQTFATNCHGADVKFC"
FT   gene            930944..932974
FT                   /locus_tag="A1S_0786"
FT   CDS_pept        930944..932974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0786"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0786"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11226"
FT                   /protein_id="ABO11226.2"
FT                   /translation="MTTLNYTVRFQKTVLASLIGLFISQSSFALEELSDAGLSETTGEG
FT                   IAILPQNTYMVFRGAGANETTNQILTDRTKDTGYINYVPVGPLSMTAADTNKNGTIDSG
FT                   DRAVGKADIFLYGLALSKSDNDTNTRLASTEAAAAISSWGTAVNPWIFKVATENSVPNF
FT                   SATNCSGAADPTCQVTYLALEAPLYEVGTRDTAGLDAYKLKLGLWSDIFVRNPNKINGA
FT                   TDQFNYGDSNGLIGTSTDASRANRLRLQAIWNNFSLNGSRLQLFQTLGGATSAGGMSPF
FT                   YNDTLGFAGVIRLNSGDASNLRATITANTPTSTVGPWVNRYSTQYTGAPSNNSPSSDWL
FT                   YRIRSQTTTITSTGSWTAPTDSTMNNVLRLSTRESGTGQGNLITPAINGGLAPTFDANE
FT                   GLYLYNPNINLVLGSLYQPLVLSSDGKNFSLELARIPNKPEIYKKIYTDYTGNDSSYLG
FT                   STCNVYQCGKNVTLGGRTYQGSSATHSSISIGSTVYNATTNTLEAFKGNNTQDAVGISF
FT                   GKLPTGTVAATTQTRNFYQLQNQERRVNSYTCSLIFTCYDWQYRTATGWTGNAGSGLRF
FT                   DSQGAWANIDSTAYYNPTTNTTGYTTTDAGNGAQFVVPNGTPLPDALYNNARWYTTTPN
FT                   ADINTYKLSGAQISSSVSNNMGSAVIDGVLIQHLKLTTKGL"
FT   gene            932990..933715
FT                   /locus_tag="A1S_0787"
FT   CDS_pept        932990..933715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0787"
FT                   /product="putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0787"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11227"
FT                   /protein_id="ABO11227.2"
FT                   /translation="MKKITALLFALCATVTHAELQTLDNDALQAINGQAGADLSLMLNL
FT                   NQTSNGIFDNGSGGVCENVEFCHIGLAINKRFVQADTTKPSGWAENSDSGNKLWLVFKG
FT                   VQGTLNIQKMGLDGADLKYLDKSNTEIIKPAIQLSFSAAQPILIRNFGFNALSIEQDNF
FT                   TSSTTTQGSSANMYDYAYFKKPTYAATANSANQQVATATPSAYDYGRETGFMGLMMSGN
FT                   MAIQGKVMVFSCDGSHPRC"
FT   gene            933748..936159
FT                   /locus_tag="A1S_0788"
FT   CDS_pept        933748..936159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0788"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11228"
FT                   /protein_id="ABO11228.2"
FT                   /translation="MNKNKESHGSKFILNTLTASMLLVSGQVFALEALTDADLSAVNGQ
FT                   DGISIQTTYNEINIDNAYWDDHAGTSNSADQVLRAQAGGIKVQKSNASTQTLGTNYRLD
FT                   VGSNPTTGKTGLDFSLQSNPSLITVNSFKVCNSSSICSPTMGQLAIQTSSPLSLALTTQ
FT                   DGLFNANSQSSMRLGLNNANIYLGQVDARTQLNQLILKNFNFNFVGKGAMLIDPNRGLV
FT                   LQTNTGSNTAAVGQTPNSTYGYVDFNRVADSASGLTAGTYVDSSGKVTNSGLNIEVMLS
FT                   SNVDKSNPYALDTTNSPQNSKGLIRLGASGRMVNSYLQVRGMDGSSDKTTLGTANTASG
FT                   TGSSNSILGNSGIAFRMKGEFTKDNDSMLGSDGKATTLEIGGAGLNAYGFEFGNLTGLN
FT                   SATRGYFDSGNIYLNLADTKTLLMPNNATLNAIRLGSGTLTTAADYQHNIHRDTVTNPF
FT                   SLILAMRGAEFQAFSRRGRFTTSANVAAANQFADNGLNNQWGLALPFYNLNANAAVYGV
FT                   DAPANSAYYYTKDANGKPIQNLVATSGTTSRLGFGIAVGTTGRDAGGTKTTSILLIDGS
FT                   PNANNAGNPTDYYMGLRNIDMFLKGNGTIGLENGSLNIGLKDMLLALSTEIAAGYLPGA
FT                   KYKTCPATGSCTSPIDNFAKNNDVLFGLKLRLGGDLNLSIVPNSSIADGSALTVLGDFT
FT                   MPATATGNTVQISDPIDGSAIGFDNITGKLAFNTALVVGKDTASGLGKVGVNTAVYFNP
FT                   DKSIDGALRVKDINFYPPSTGAGARLGELAITGGRLNSSFSIVPRNGAFN"
FT   gene            936321..937274
FT                   /locus_tag="A1S_3569"
FT                   /old_locus_tag="AS1_3569"
FT   CDS_pept        936321..937274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_3569"
FT                   /old_locus_tag="AS1_3569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_3569"
FT                   /db_xref="EnsemblGenomes-Tr:ABS89994"
FT                   /protein_id="ABS89994.2"
FT                   /translation="MKNKNIGCWLLLAGSSSVCAMQPLDDQSLAAATGQNGLTLGIQAD
FT                   QVKFNQVALIDTNGIASTSYNSKAGLIIAGNSTNPVPGIEFIKAAVSANPSFNIAIDTD
FT                   AGGGNPFLNLAVTMGSDVNGIRLLPFSVYLAPSTSLSSPSDYALTSYAPKSIFSSGTTV
FT                   NTGVKELIRSTGNLDINFVQTNKPRLNIQLGHAAQSVMVKFGGAIQSICSTASGCPITL
FT                   VSDNTGATFGFKFAGTNASTGFVLDGFYAGVDPTGLTIGNIGVSSKFDASLNNVTLGNL
FT                   GTQSTTTFNNLPNGSMGSFGVTGASVTDFKMKVSGF"
FT   gene            complement(937354..938277)
FT                   /locus_tag="A1S_0789"
FT   CDS_pept        complement(937354..938277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0789"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0789"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11229"
FT                   /protein_id="ABO11229.2"
FT                   /translation="MEGLTDPIMRDTLTSVGHFDWCVTEFIRVTDSILPDHIYYSFCPE
FT                   LKNDGKTAAGTPVHVQFLGNNPEMLAANAAKVVELGAPAIDLNFGCPAKTVNRHRGGSV
FT                   LLDEPDVVHMLIKAVRDAVPAHIPVSAKMRLGYLDENHTMENAYAVEDAGASWLTVHAR
FT                   TKADGYTPPAYWEKILPIKEALKINVIANGEIWTNADARACQQQSGCEDLMIGRGAVTT
FT                   PDLTQCIRQNMDEALFTWEQLVDLQIRFLNGQAKTEIGMVGRYKQWLGMMTKAYPQAKE
FT                   LWDQVKRIKALDEIVQQLEQTSSSRI"
FT   gene            complement(938383..939192)
FT                   /locus_tag="A1S_0790"
FT   CDS_pept        complement(938383..939192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="A1S_0790"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:A1S_0790"
FT                   /db_xref="EnsemblGenomes-Tr:ABO11230"
FT                   /protein_id="ABO11230.2"
FT                   /translation="MISLPLVYTILALIAYTTSFWYLFIRLMSKREPNPWLFAFVTTLA
FT                   LLLHGTVLCHAMLTPSGINYDVFNLVSFTSGLMLLLSLVFSTFRPIVPLNLLGIPVAAI
FT                   GLILGFAFSRPDQFIEQHSLGLDTHIILSLSAYAVLLMATIHAILIWFQNRELKKKQKK
FT                   R