(data stored in ACNUC7421 zone)

EMBL: CP000524

ID   CP000524; SV 1; circular; genomic DNA; STD; PRO; 1445021 BP.
XX
AC   CP000524; AANF01000000-AANF01000044;
XX
PR   Project:PRJNA16249;
XX
DT   05-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Bartonella bacilliformis KC583, complete genome.
XX
KW   .
XX
OS   Bartonella bacilliformis KC583
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Bartonellaceae;
OC   Bartonella.
XX
RN   [1]
RP   1-1445021
RA   Hendrix L., Mohamoud Y., Radune D., Shvartsbeyn A., Daugherty S.,
RA   Dodson R., Durkin A.S., Harkins D., Huot H., Kothari S.P., Madupu R.,
RA   Li J., Nelson W.C., Shrivastava S., Giglio M.G., Haft D., Selengut J.,
RA   Fraser-Ligget C., Seshadri R.;
RT   ;
RL   Submitted (18-DEC-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Dr, Rockville, MD
RL   20850, USA
XX
DR   MD5; 3e606165cdad723bf30974aecc9dd1fe.
DR   BioSample; SAMN02604047.
DR   EnsemblGenomes-Gn; BARBAKC583_0046.
DR   EnsemblGenomes-Gn; BARBAKC583_0184.
DR   EnsemblGenomes-Gn; BARBAKC583_0198.
DR   EnsemblGenomes-Gn; BARBAKC583_0258.
DR   EnsemblGenomes-Gn; BARBAKC583_0259.
DR   EnsemblGenomes-Gn; BARBAKC583_0260.
DR   EnsemblGenomes-Gn; BARBAKC583_0261.
DR   EnsemblGenomes-Gn; BARBAKC583_0262.
DR   EnsemblGenomes-Gn; BARBAKC583_0263.
DR   EnsemblGenomes-Gn; BARBAKC583_0269.
DR   EnsemblGenomes-Gn; BARBAKC583_0294.
DR   EnsemblGenomes-Gn; BARBAKC583_0303.
DR   EnsemblGenomes-Gn; BARBAKC583_0308.
DR   EnsemblGenomes-Gn; BARBAKC583_0419.
DR   EnsemblGenomes-Gn; BARBAKC583_0448.
DR   EnsemblGenomes-Gn; BARBAKC583_0552.
DR   EnsemblGenomes-Gn; BARBAKC583_0560.
DR   EnsemblGenomes-Gn; BARBAKC583_0561.
DR   EnsemblGenomes-Gn; BARBAKC583_0564.
DR   EnsemblGenomes-Gn; BARBAKC583_0610.
DR   EnsemblGenomes-Gn; BARBAKC583_0611.
DR   EnsemblGenomes-Gn; BARBAKC583_0615.
DR   EnsemblGenomes-Gn; BARBAKC583_0645.
DR   EnsemblGenomes-Gn; BARBAKC583_0649.
DR   EnsemblGenomes-Gn; BARBAKC583_0650.
DR   EnsemblGenomes-Gn; BARBAKC583_0682.
DR   EnsemblGenomes-Gn; BARBAKC583_0683.
DR   EnsemblGenomes-Gn; BARBAKC583_0745.
DR   EnsemblGenomes-Gn; BARBAKC583_0760.
DR   EnsemblGenomes-Gn; BARBAKC583_0768.
DR   EnsemblGenomes-Gn; BARBAKC583_0770.
DR   EnsemblGenomes-Gn; BARBAKC583_0776.
DR   EnsemblGenomes-Gn; BARBAKC583_0777.
DR   EnsemblGenomes-Gn; BARBAKC583_0815.
DR   EnsemblGenomes-Gn; BARBAKC583_0824.
DR   EnsemblGenomes-Gn; BARBAKC583_0876.
DR   EnsemblGenomes-Gn; BARBAKC583_0882.
DR   EnsemblGenomes-Gn; BARBAKC583_0911.
DR   EnsemblGenomes-Gn; BARBAKC583_0964.
DR   EnsemblGenomes-Gn; BARBAKC583_1025.
DR   EnsemblGenomes-Gn; BARBAKC583_1053.
DR   EnsemblGenomes-Gn; BARBAKC583_1081.
DR   EnsemblGenomes-Gn; BARBAKC583_1082.
DR   EnsemblGenomes-Gn; BARBAKC583_1083.
DR   EnsemblGenomes-Gn; BARBAKC583_1084.
DR   EnsemblGenomes-Gn; BARBAKC583_1085.
DR   EnsemblGenomes-Gn; BARBAKC583_1086.
DR   EnsemblGenomes-Gn; BARBAKC583_1115.
DR   EnsemblGenomes-Gn; BARBAKC583_1198.
DR   EnsemblGenomes-Gn; BARBAKC583_1301.
DR   EnsemblGenomes-Gn; EBG00001118747.
DR   EnsemblGenomes-Gn; EBG00001118748.
DR   EnsemblGenomes-Gn; EBG00001118749.
DR   EnsemblGenomes-Gn; EBG00001118750.
DR   EnsemblGenomes-Gn; EBG00001118751.
DR   EnsemblGenomes-Gn; EBG00001118752.
DR   EnsemblGenomes-Gn; EBG00001118753.
DR   EnsemblGenomes-Gn; EBG00001118754.
DR   EnsemblGenomes-Gn; EBG00001118755.
DR   EnsemblGenomes-Gn; EBG00001118756.
DR   EnsemblGenomes-Gn; EBG00001118757.
DR   EnsemblGenomes-Gn; EBG00001118758.
DR   EnsemblGenomes-Gn; EBG00001118759.
DR   EnsemblGenomes-Gn; EBG00001118760.
DR   EnsemblGenomes-Gn; EBG00001118761.
DR   EnsemblGenomes-Gn; EBG00001118762.
DR   EnsemblGenomes-Gn; EBG00001118763.
DR   EnsemblGenomes-Gn; EBG00001118764.
DR   EnsemblGenomes-Gn; EBG00001118765.
DR   EnsemblGenomes-Gn; EBG00001118766.
DR   EnsemblGenomes-Gn; EBG00001118767.
DR   EnsemblGenomes-Gn; EBG00001118768.
DR   EnsemblGenomes-Gn; EBG00001118769.
DR   EnsemblGenomes-Gn; EBG00001118770.
DR   EnsemblGenomes-Gn; EBG00001118771.
DR   EnsemblGenomes-Gn; EBG00001118772.
DR   EnsemblGenomes-Gn; EBG00001118773.
DR   EnsemblGenomes-Gn; EBG00001118774.
DR   EnsemblGenomes-Gn; EBG00001118775.
DR   EnsemblGenomes-Gn; EBG00001118776.
DR   EnsemblGenomes-Gn; EBG00001118777.
DR   EnsemblGenomes-Gn; EBG00001118778.
DR   EnsemblGenomes-Gn; EBG00001118779.
DR   EnsemblGenomes-Gn; EBG00001118780.
DR   EnsemblGenomes-Gn; EBG00001118781.
DR   EnsemblGenomes-Gn; EBG00001118782.
DR   EnsemblGenomes-Gn; EBG00001118783.
DR   EnsemblGenomes-Gn; EBG00001118784.
DR   EnsemblGenomes-Gn; EBG00001118785.
DR   EnsemblGenomes-Gn; EBG00001118786.
DR   EnsemblGenomes-Gn; EBG00001118787.
DR   EnsemblGenomes-Gn; EBG00001118788.
DR   EnsemblGenomes-Gn; EBG00001118789.
DR   EnsemblGenomes-Gn; EBG00001118790.
DR   EnsemblGenomes-Gn; EBG00001118791.
DR   EnsemblGenomes-Gn; EBG00001118792.
DR   EnsemblGenomes-Gn; EBG00001118793.
DR   EnsemblGenomes-Gn; EBG00001118794.
DR   EnsemblGenomes-Gn; EBG00001118795.
DR   EnsemblGenomes-Gn; EBG00001118796.
DR   EnsemblGenomes-Gn; EBG00001118797.
DR   EnsemblGenomes-Gn; EBG00001118798.
DR   EnsemblGenomes-Gn; EBG00001118799.
DR   EnsemblGenomes-Gn; EBG00001118800.
DR   EnsemblGenomes-Gn; EBG00001118801.
DR   EnsemblGenomes-Gn; EBG00001118802.
DR   EnsemblGenomes-Gn; EBG00001118803.
DR   EnsemblGenomes-Gn; EBG00001118804.
DR   EnsemblGenomes-Tr; BARBAKC583_0046-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0184-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0198-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0258-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0259-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0260-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0261-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0262-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0263-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0269-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0294-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0303-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0308-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0419-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0448-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0552-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0560-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0561-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0564-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0610-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0611-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0615-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0645-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0649-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0650-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0682-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0683-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0745-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0760-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0768-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0770-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0776-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0777-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0815-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0824-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0876-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0882-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0911-1.
DR   EnsemblGenomes-Tr; BARBAKC583_0964-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1025-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1053-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1081-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1082-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1083-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1084-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1085-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1086-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1115-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1198-1.
DR   EnsemblGenomes-Tr; BARBAKC583_1301-1.
DR   EnsemblGenomes-Tr; EBT00001710165.
DR   EnsemblGenomes-Tr; EBT00001710166.
DR   EnsemblGenomes-Tr; EBT00001710167.
DR   EnsemblGenomes-Tr; EBT00001710168.
DR   EnsemblGenomes-Tr; EBT00001710169.
DR   EnsemblGenomes-Tr; EBT00001710170.
DR   EnsemblGenomes-Tr; EBT00001710171.
DR   EnsemblGenomes-Tr; EBT00001710172.
DR   EnsemblGenomes-Tr; EBT00001710173.
DR   EnsemblGenomes-Tr; EBT00001710174.
DR   EnsemblGenomes-Tr; EBT00001710175.
DR   EnsemblGenomes-Tr; EBT00001710176.
DR   EnsemblGenomes-Tr; EBT00001710177.
DR   EnsemblGenomes-Tr; EBT00001710178.
DR   EnsemblGenomes-Tr; EBT00001710179.
DR   EnsemblGenomes-Tr; EBT00001710180.
DR   EnsemblGenomes-Tr; EBT00001710181.
DR   EnsemblGenomes-Tr; EBT00001710182.
DR   EnsemblGenomes-Tr; EBT00001710183.
DR   EnsemblGenomes-Tr; EBT00001710184.
DR   EnsemblGenomes-Tr; EBT00001710185.
DR   EnsemblGenomes-Tr; EBT00001710186.
DR   EnsemblGenomes-Tr; EBT00001710187.
DR   EnsemblGenomes-Tr; EBT00001710188.
DR   EnsemblGenomes-Tr; EBT00001710189.
DR   EnsemblGenomes-Tr; EBT00001710190.
DR   EnsemblGenomes-Tr; EBT00001710191.
DR   EnsemblGenomes-Tr; EBT00001710192.
DR   EnsemblGenomes-Tr; EBT00001710193.
DR   EnsemblGenomes-Tr; EBT00001710194.
DR   EnsemblGenomes-Tr; EBT00001710195.
DR   EnsemblGenomes-Tr; EBT00001710196.
DR   EnsemblGenomes-Tr; EBT00001710197.
DR   EnsemblGenomes-Tr; EBT00001710198.
DR   EnsemblGenomes-Tr; EBT00001710199.
DR   EnsemblGenomes-Tr; EBT00001710200.
DR   EnsemblGenomes-Tr; EBT00001710201.
DR   EnsemblGenomes-Tr; EBT00001710202.
DR   EnsemblGenomes-Tr; EBT00001710203.
DR   EnsemblGenomes-Tr; EBT00001710204.
DR   EnsemblGenomes-Tr; EBT00001710205.
DR   EnsemblGenomes-Tr; EBT00001710206.
DR   EnsemblGenomes-Tr; EBT00001710207.
DR   EnsemblGenomes-Tr; EBT00001710208.
DR   EnsemblGenomes-Tr; EBT00001710209.
DR   EnsemblGenomes-Tr; EBT00001710210.
DR   EnsemblGenomes-Tr; EBT00001710211.
DR   EnsemblGenomes-Tr; EBT00001710212.
DR   EnsemblGenomes-Tr; EBT00001710213.
DR   EnsemblGenomes-Tr; EBT00001710214.
DR   EnsemblGenomes-Tr; EBT00001710215.
DR   EnsemblGenomes-Tr; EBT00001710216.
DR   EnsemblGenomes-Tr; EBT00001710217.
DR   EnsemblGenomes-Tr; EBT00001710218.
DR   EnsemblGenomes-Tr; EBT00001710219.
DR   EnsemblGenomes-Tr; EBT00001710220.
DR   EnsemblGenomes-Tr; EBT00001710221.
DR   EnsemblGenomes-Tr; EBT00001710222.
DR   EuropePMC; PMC2519523; 18606739.
DR   EuropePMC; PMC2883598; 20548954.
DR   EuropePMC; PMC3139668; 21811647.
DR   EuropePMC; PMC3754576; 23749981.
DR   EuropePMC; PMC3820349; 24043691.
DR   EuropePMC; PMC5271407; 28095503.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00518; speF.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP000524.
DR   SILVA-SSU; CP000524.
DR   StrainInfo; 111064; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1445021
FT                   /organism="Bartonella bacilliformis KC583"
FT                   /strain="KC583; ATCC 35685"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:360095"
FT   gene            213..986
FT                   /locus_tag="BARBAKC583_0001"
FT   CDS_pept        213..986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0001"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45158"
FT                   /db_xref="GOA:A1UQT7"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQT7"
FT                   /protein_id="ABM45158.1"
FT                   /translation="MADFKNLRSASVSHADASIDQGLRSYMLSVYNTMAIGLLVTAAAA
FT                   YAIASLTTTTDMNLAAAQINSSVYLTSFGVAFYTSPLSYVIMFSPLIAVLFLSFKINTL
FT                   STSAARSLFYGYAMLVGLSLSSIILRYTPESIVQTFVITAAAFGSLSLYGYTTKRDLTA
FT                   MGSFLFIGMIGLMLSMIINIFLGSDALQFAISVIGVLIFAGLTAYNTQTIKTMYYEGDE
FT                   DDTRGRKIIMGALNLYLDFINMFVFLLQFLGSNRD"
FT   gene            1105..2004
FT                   /locus_tag="BARBAKC583_0003"
FT   CDS_pept        1105..2004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0003"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44974"
FT                   /db_xref="GOA:A1UQT8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQT8"
FT                   /protein_id="ABM44974.1"
FT                   /translation="MTKKPNKLRFHWPTKFIENKFYNPFLSALHKRCGYQSNTTNHQAS
FT                   YDLVAASYNVHKCVGVDKVFNPTRIVRVIAELQADILALQEVDKRFEERIGFIDLEFLK
FT                   SETDLTLVPLNTKSPHGHGWHGNALFLRQGHVRDILQINLPGIEPRGAVIAELEMNMGA
FT                   IRVIAAHFSLLRHSRNKQVKMLLALLQKRPFMPTLIIGDLNEWRVGKRSSLHHFSLYFD
FT                   TTLGVVPSFPSRFPFLALDRVFAFPHQLITGVESHLSPLARIASDHLPIKAYLDLGNTI
FT                   TSLKNKEANALHPNFEQP"
FT   gene            complement(1970..4876)
FT                   /gene="polA"
FT                   /locus_tag="BARBAKC583_0002"
FT   CDS_pept        complement(1970..4876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="BARBAKC583_0002"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44570"
FT                   /db_xref="GOA:A1UQT9"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQT9"
FT                   /protein_id="ABM44570.1"
FT                   /translation="MKINDHLFLVDGSSYIFRAYHALPPLKRKKDGLPVGAVSGFCNML
FT                   WRLLCDARNTAVGLTPTHFAVIFDHSSHTFRKQIYPEYKANRATPPDDLIPQFSLIRQA
FT                   TKAFNVPCIEKEGFEADDLIATYAHLATQVGAKTTIISSDKDLMQLVNAHVSLYDGMKD
FT                   KHIGVAEVVEKWGVTPDKMVDLQALTGDPVDNIPGIPGIGPKTAAQLLNQFGSLDLLLQ
FT                   HVSEIKQTKRRENIQTYGKQTEISRVLVKLKTDVPIDNDLDSFILEPQDGPRLIAFLKA
FT                   MEFTTLTRRVAEATECDATIIEACDVETEWTETVHGPDLDVQKADAALSHTSSENCPQF
FT                   LAQKRKEQAFTQVITRDAYETLLDEDILKKWLLEAEEQGYFSFDTETTSLDPMQAKLVG
FT                   FSLALQPNKAAYIPLEHIEGGNDLFGGERIVGQIETQRALALLKPILENQAVLKIGQNM
FT                   KYDWLVMRQYDITIRSFDDTMLLSYVLDAGISTHGMDVLSERWLGHTPIAYKNLTCDGK
FT                   KIVSFAQVDLKQATLYAAEDADITLRLWQVLKPQLVAQGMTKIYERLDRPLIEVLARME
FT                   ERGILVDRQILSCLSGELAQAALSLEEEIYQLAGEQFNIASPKQLGDILFSKIGLPGGA
FT                   KTKGGQWSTSAQILEELAAEGHMLPRKIVDWRQIAKLKSTYTDALPSYISPKTGRVHTN
FT                   YSLATTSTGRLSSSEPNLQNIPIRTIEGRKIRTAFIASEGCLLLSADYSQIELRLLAHI
FT                   ADITALKEAFAQGQDIHAMTASQMFGVAIERMSSDVRRRAKAINFGIIYGISAFGLANQ
FT                   LGISREEASHYIRVYFERFPGIQSYMEATKIFARQHGYVETIFGRRIHYPEIKARDRQV
FT                   RAFNERAAINAPIQGSAADIIRRAMIQMEGALEKEGLSAKMLLQVHDELIFEIPKAESE
FT                   KTKAIVKKVMENATMPALSLSVPLEVKVMVAQNWDEAH"
FT   gene            complement(5177..5881)
FT                   /gene="dnaQ"
FT                   /locus_tag="BARBAKC583_0004"
FT   CDS_pept        complement(5177..5881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="BARBAKC583_0004"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573; match to protein
FT                   family HMM TIGR01406"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45410"
FT                   /db_xref="GOA:A1UQU0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQU0"
FT                   /protein_id="ABM45410.1"
FT                   /translation="MREIIFDTETTGLDKDNDRIIEIGCVEMVDRYLTGRQFHVYLNPQ
FT                   GVIIPDEVVAIHGLTNERLKGEKKFDDIADELLEFIDGAMMIAHNANFDISFLNAELKR
FT                   VNKPLISIDNVIDTLAMARRKFPMGPNSLDVLCKRFGIDNSHRILHGALLDAEILADVY
FT                   IELIGGKQGTLGFYNSNGRHLNTENGSNISYVFKIRPQALPPRLSEQEKSMHADLVNQI
FT                   GKKALWNQFKIP"
FT   gene            complement(5886..6488)
FT                   /gene="coaE"
FT                   /locus_tag="BARBAKC583_0005"
FT   CDS_pept        complement(5886..6488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaE"
FT                   /locus_tag="BARBAKC583_0005"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="identified by match to protein family HMM PF01121;
FT                   match to protein family HMM TIGR00152"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44825"
FT                   /db_xref="GOA:A1UQU1"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQU1"
FT                   /protein_id="ABM44825.1"
FT                   /translation="MKIIGLTGSIAMGKSTTASFFKQAGIPVFSADEAVQQLYKSNPTV
FT                   SLIARIFPDVVENGRVNNQELSKILAKDHEKLQILEKTIHPLVRKKEQKFIEKARQQGK
FT                   ELVVLDIPLLFETKSESRVDSVVVVSAPPEIQKKRAMSRPNMSEEKFAILNNRQMSDEE
FT                   KKERADFVIDTGKDLEDTRKQVLHVIKKLSKDPSLKN"
FT   gene            complement(6485..7360)
FT                   /gene="aroE"
FT                   /locus_tag="BARBAKC583_0006"
FT   CDS_pept        complement(6485..7360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="BARBAKC583_0006"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM PF08501; match to protein
FT                   family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45309"
FT                   /db_xref="GOA:A1UQU2"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQU2"
FT                   /protein_id="ABM45309.1"
FT                   /translation="MVDLVDHKKICSRVFVVGYPIHHSKSPKIHKFWLKYYGLQGESVS
FT                   EEVTVREFSNFIASIKKGNFLGGNVTSPHKQEAFRLADYKDGIATAIGAANTLWIEGKK
FT                   LLATNSDAYGFSANLDDFVPGWAGETALVFGAGGAARAIIYALKKRKFERIFLFNRTKK
FT                   NADDLAEYFGKSTIKVYDWCSSCEKARQADLIVNTTSMDMINFSERENGAFFDFHKTKP
FT                   TALVTDVVYTPLITPFLQQAKAHGLKTVNGLGMLLHQAVPGFEKWFGVRPSVTKELRAA
FT                   ILEDMGENRG"
FT   gene            complement(7353..7949)
FT                   /gene="maf1"
FT                   /locus_tag="BARBAKC583_0007"
FT   CDS_pept        complement(7353..7949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf1"
FT                   /locus_tag="BARBAKC583_0007"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44616"
FT                   /db_xref="GOA:A1UQU3"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQU3"
FT                   /protein_id="ABM44616.1"
FT                   /translation="MKKNTLILASRSFHRAQLLKNAGLNFSVEGASFDEREVEKKIGTK
FT                   TPKELSRFLAIAKAKNVSDRFPNTLIIGCDQVLDLEGQVFHKVTNRKEAHQRLHSLSGK
FT                   THSLHSAVALVQNGQEIWSEVFSVHMTMRFLSSKFIERYLEHVGMDVLKSLGIYQIEGE
FT                   GIHLFEKIEGDYFTIIGLPLLPLLAKLRHLGVIDG"
FT   gene            complement(7946..8785)
FT                   /locus_tag="BARBAKC583_0008"
FT   CDS_pept        complement(7946..8785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q92TF2; match to
FT                   protein family HMM PF03618"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44519"
FT                   /db_xref="GOA:A1UQU4"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQU4"
FT                   /protein_id="ABM44519.1"
FT                   /translation="MKKEKNFFHLYMVSDATGETLISAGKAVASQYPTIQPIEHIYPMI
FT                   RNKTQLQRVLDEIQREPGIVLYTIIDQEIKQLLSRECTKIGVPCAAVLDPVLNVFQSYL
FT                   GTPKNLRVSAQHDLNTDYFRRIEALDFTIEHDDGQSSDDLFNADVILVGISRTSKTPTS
FT                   IYLANRGIKTANVPLIPGIDLPKALLEEKNSLIIGLIASAERISHVRQNRELGKDVSIE
FT                   RYTDRVNIAEELTYAKRICERFGWPIIDVTRRSIEETAAAVFELLSRFREEKLREIL"
FT   gene            9401..10666
FT                   /gene="rho"
FT                   /locus_tag="BARBAKC583_0009"
FT   CDS_pept        9401..10666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="BARBAKC583_0009"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM PF08206;
FT                   match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45342"
FT                   /db_xref="GOA:A1UQU5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQU5"
FT                   /protein_id="ABM45342.1"
FT                   /translation="MQEMKLQELKSKSPVELISFAETLEVENASLMRKQELMFAILKKL
FT                   ALQDVEIIGEGVVEVLQDGFGFLRSADANYLPGPDDIYILPSQIQSFSLKTGDTVEGPI
FT                   RGPKEGEHYFALLKVNKINFEDPEKIRYKIHFDNLTPLYPNEPFRMEIQDPTEKDISSR
FT                   IVDLISPLGKGQRGLIVAPPRTGKTVLLQNIAHSITTNHPECYLIVLLIDERPEEVTDM
FT                   QRSVKGEVVSSTFDEPAIRHVRVAEMVIEKAKRLVEYGRDVVILLDSITRLGRAYNTVV
FT                   PSSGKVLTGGVDANALQRPKRFFGAARNIEEGGSLTIIATALIDTGSRMDEVIFEEFKG
FT                   TGNSEIVLDRKVSDKRIFPAMDVLKSGTRKEDLLVARQDLHKIFVLRRILAPMNITDAM
FT                   EFLIDKLKHTKNNSEFFDSMNT"
FT   gene            10700..12007
FT                   /gene="trmE"
FT                   /locus_tag="BARBAKC583_0010"
FT   CDS_pept        10700..12007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="BARBAKC583_0010"
FT                   /product="tRNA modification GTPase TrmE"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00450; match to protein family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45692"
FT                   /db_xref="GOA:A1UQU6"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQU6"
FT                   /protein_id="ABM45692.1"
FT                   /translation="MDTIFAVSSGLLPSGVAVIRVSGPRVVDIVKTLCGCLPKARFMHH
FT                   GDLIARDGSFLDSALTVFFPRPHSFTGEDCAEFHLHGGKAVVNRFLDELSTFTGCRLAE
FT                   AGEFSRRAFIEGKIDLVQAEGLADLIEAETESQRRLAVMGANGHLTELYRHWRNKLMTA
FT                   RALIEAELDFSDEADVSNFSSDKVWQNMQELSDSLCEHIAEGERANILRDGIKVVIVGV
FT                   PNSGKSSIINRLAGRPVAIVTEEEGTTRDALEVRLILGGLPVLVMDTAGFRETESKIEQ
FT                   LGIDIAKQHVLDADLVILVDDMKNPQKISLPNTSAEIWRVGNKLDICEGDKTRWPIQFS
FT                   ALNGLNFDYFLKEIESFCLHRIAEIGNIFPARKRQIQLLKEAVKEIDSSINYTFLDLSL
FT                   RAEHLRRASDALGRITGDIDVEDLLDIIFSQFCIGK"
FT   gene            12116..13984
FT                   /gene="gidA"
FT                   /locus_tag="BARBAKC583_0011"
FT   CDS_pept        12116..13984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="BARBAKC583_0011"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00136"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45137"
FT                   /db_xref="GOA:A1UQU7"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQU7"
FT                   /protein_id="ABM45137.1"
FT                   /translation="MQSYDVIIVGGGHAGCEAASASARTGARTALVTYRLSDMGTMSCN
FT                   PAIGGLGKGHLVREIDALDGLMGRAADFAGIQFRLLNRRKGPAVRGPRTQADRQLYKKA
FT                   IQKLLREQDNLFIIEDEVVDIIVKNNRVSGVFLKNQGNIFSGAVVLTTGTFLNGLIHIG
FT                   DKTWPAGRMGEQASVQLAERLKNYGISFGRLKTGTPARLSKKTIRWDVLPKQQADEDPV
FT                   PFSFLTEKIKQPQIECAITRTNAQTHHIISENIHRSALYSGAIEGVGPRYCPSIEDKII
FT                   KFGERDGHQIFLEPEGLEDDVIYPNGISTSLPEDVQISLLKTIEGLENVNVLQPGYAIE
FT                   YDFINPQYLSKTLELRSLPGLFLAGQINGTTGYEEAAAQGLLAGLNAARQVGGLDEIIL
FT                   SRSTAYIGVMIDDLISRGVCEPYRMFTSRAEFRLSLRADNADARLTPLAQEWGIVSHKR
FT                   WTCYQNKQQRLDHARSICQKLFLTPNEASAHGLQINNDGVRRSAYSLLSYPNMNVARLT
FT                   DFWPQLHSIDAKTVESLEIEAQYAVYLERQKQDIAALQRDESLEIPSSLNIQAIYGLSN
FT                   ELKTKIQKISPRSIADAQKIDGMTPAALSLIITYIQRQRREKGKLA"
FT   gene            13984..14631
FT                   /gene="gidB"
FT                   /locus_tag="BARBAKC583_0012"
FT   CDS_pept        13984..14631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="BARBAKC583_0012"
FT                   /product="methyltransferase GidB"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF02527;
FT                   match to protein family HMM TIGR00138"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45326"
FT                   /db_xref="GOA:A1UQU8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQU8"
FT                   /protein_id="ABM45326.1"
FT                   /translation="MVVLVEQKYQELLNMLPSVSRETMENLIQFESLIIQWNAHINLIS
FT                   AATVPFLWTRHILDSAQIYPLYSQCLHWCDLGSGGGFPAIVIAIFLKEKQKGHIDLIES
FT                   NGKKVAFLRTVIAQLNLPATVYHCRIEDVYQKINAPEIITARGLASLNTLLQLTFPWLK
FT                   QKTIALLQKGRDYAIEVENAYANWRFNLLKHQSKIDENSVILEISHVRSCQG"
FT   gene            14637..15434
FT                   /gene="parA"
FT                   /locus_tag="BARBAKC583_0013"
FT   CDS_pept        14637..15434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="BARBAKC583_0013"
FT                   /product="chromosome partitioning protein ParA"
FT                   /note="identified by similarity to SP:O05189; match to
FT                   protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44588"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQU9"
FT                   /protein_id="ABM44588.1"
FT                   /translation="MNETRIIAVANQKGGVGKTTTTINLATALAAIGKNVLIMDIDPQG
FT                   NASTALGIDRNNRPLSSYDVLVSGVSIAKAALKTVVPNLHIVPSTLDLLGVEMEIASSL
FT                   DRIKRLRKALCDDQKVAKKFNYILIDCPPSLNLLTLNAMGAADSVLVPMQCEFLALEGL
FT                   SQLLETVKQVRYALNPSLEIQGIVLTMYDGRNNLSNQVVEDVRSFMGEKVYRTVIPRNV
FT                   RVSEAPSFGKPALLYDLKCAGSQAYLRLASEVIQREKQAEAAA"
FT   gene            15486..16397
FT                   /gene="parB"
FT                   /locus_tag="BARBAKC583_0014"
FT   CDS_pept        15486..16397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="BARBAKC583_0014"
FT                   /product="chromosome partitioning protein ParB"
FT                   /note="identified by similarity to SP:O05190; match to
FT                   protein family HMM PF02195; match to protein family HMM
FT                   TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45522"
FT                   /db_xref="GOA:A1UQV0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV0"
FT                   /protein_id="ABM45522.1"
FT                   /translation="MNEDQSKKRLGRGLAALIGDINLDGNSVYQSEYQPDFSGLSVKSE
FT                   IAFEKIVSIELISPNPCNPRRYFTDLELDDLAQSIRQHGVIQPIVVRPSRNYPNRFELI
FT                   AGERRWRAAQRANLSQLPVIIRDVDDKTALELAIIENIQRTDLNSIEEGKGYELLLNEH
FT                   GYTQVELAQIIGKSRSHIANTLRLLKLPPEVQQFVIEGQLSAGHARCLITVDNPRDLAN
FT                   KIIREGLSVRQAEMLANERMDSENKKKIVKEKDAETESLEKLLSDIIGMKVIIQHSKKG
FT                   GNLKIHYSSLEQLDDICRRLQD"
FT   gene            complement(16398..16931)
FT                   /locus_tag="BARBAKC583_0015"
FT   CDS_pept        complement(16398..16931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44800"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV1"
FT                   /protein_id="ABM44800.1"
FT                   /translation="MDKRFLPSPTKKKRLFLAMLKITLHVFFILLFPFATYAQETIKNE
FT                   PDGHFILTPTNNPKIVANYPLTENFLEKMEKAKQKIINLPPELQTSHTENDHSIEGLIA
FT                   FVSSRPHLKEILDNNGLTPKDYVIGFIALQATLIAVTALEDTDAFFDETTTVFQDNLKF
FT                   GQKHINRIRAFLDY"
FT   gene            complement(17303..17968)
FT                   /gene="ispZ"
FT                   /locus_tag="BARBAKC583_0016"
FT   CDS_pept        complement(17303..17968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispZ"
FT                   /locus_tag="BARBAKC583_0016"
FT                   /product="intracellular septation protein A"
FT                   /note="identified by match to protein family HMM PF04279;
FT                   match to protein family HMM TIGR00997"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44973"
FT                   /db_xref="GOA:A1UQV2"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV2"
FT                   /protein_id="ABM44973.1"
FT                   /translation="MKHSLFKSNSQNTKNNQKVSPTFKFFLEMGPLVIFFLANYKGRWL
FT                   INNVELFKHFDKPIYPATFIFMVAIVITLSLSWIIVRTIPIIPLISGLLVIVFGFLTLW
FT                   LKDDTFIKVKPTIINSLFSLMLLGSLLLKKQLLRYVFDSAFKITDEGWQILTYCWALFF
FT                   AFLALLNEIIWRNFSNDFWATFKVFGVVPITILFVMIHLPIIIKYSDFSPIEDDESNS"
FT   gene            complement(17965..19128)
FT                   /gene="ftsY"
FT                   /locus_tag="BARBAKC583_0017"
FT   CDS_pept        complement(17965..19128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="BARBAKC583_0017"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM TIGR00064"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45479"
FT                   /db_xref="GOA:A1UQV3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV3"
FT                   /protein_id="ABM45479.1"
FT                   /translation="MTKFFIKKIFSFNKSKNETTKNDHPSIKLEKEKQREEYNINPTTH
FT                   SEEIQSSESNLKKVVITDTIIEKEEAPLPTPPVEQKEVAWFERLKHGLSRSSQQLGGSI
FT                   GALFTKRKLNADTLQELEDILIQADLGVETASHITDILSSGRYGKNLSLDDIHTIVADE
FT                   IKKVLEPVAIPLELDLSYKPHVILFVGVNGTGKTTTIGKLAAKLTSNGLKVMLAAGDTF
FT                   RAAAIEQLHIWGERTGAPVVSTQSGADAASLAFEAYEKAKKANNDVLIIDTAGRLQNKT
FT                   ELMDELAKIIRVLRKHDPQAPHTILQTLDATTGQNALNQVDIFRNIAGVNGLVMTKLDG
FT                   TARGGILVALAAKYKLPVYFIGIGENTEDLEPFSASDFAQAITGKYS"
FT   gene            complement(19143..20426)
FT                   /locus_tag="BARBAKC583_0018"
FT   CDS_pept        complement(19143..20426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0018"
FT                   /product="tRNA modification enzyme, MiaB family"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF04055; match to protein
FT                   family HMM TIGR00089; match to protein family HMM
FT                   TIGR01579"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44615"
FT                   /db_xref="GOA:A1UQV4"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV4"
FT                   /protein_id="ABM44615.1"
FT                   /translation="MSVKIVTFGCRLNSYESEVIRQKSSSAGLDQLKDGAIIFNTCAVT
FT                   SEAVRQAKQAIRKARRENPHTRIIVTGCAAQTETDNFSLMTEVDLILGNEDKLHAHSYR
FT                   QLPDFGINHDEKIRVNDIMEVRKNAPHMINSIEGRTRAFVQIQNGCDHRCTFCIIPYGR
FT                   GPSRSVPMGTIIEQIKRLIDNGIQEVVLTGVDLTSYGSNLPGKATLGKLVSAILHHIPD
FT                   LPRLHLSSIDSIEADQELIDLLAYEERIMPHLHLSLQAGDNMILKRMKRRHLREHAIQF
FT                   CQDLRAKRPSMVYGADLIAGFPTETEKMFQNSLNLINDCGLIHLHVFPFSPRKGTPAAR
FT                   MPQVNRETIKMRAEKLRKAGEKAYQKHLSYLQNTKQKILVERDEIGRTEDYTLTHIKGA
FT                   KAGTIVKALIIDHDGNKLIARHLESHAA"
FT   gene            complement(20426..21274)
FT                   /gene="dapF"
FT                   /locus_tag="BARBAKC583_0019"
FT   CDS_pept        complement(20426..21274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="BARBAKC583_0019"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="identified by match to protein family HMM PF01678;
FT                   match to protein family HMM TIGR00652"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45151"
FT                   /db_xref="GOA:A1UQV5"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQV5"
FT                   /protein_id="ABM45151.1"
FT                   /translation="MKTPFSKMNGLGNKIIVADLRKAIHNITPQAIQALASNPQTHFDQ
FT                   IMAIHPPTQDADFRIEIWNADGSMAKACGNGTRCVIEWLANHNLGNNFRLETSTGIVEG
FT                   KRQTDGLISVDMGRPYLNAKDMPVSREIIDTNHVDITAGPLQDACLVSVGNLHAIFFIE
FT                   SNIQNIPLEKYGPKLEHDPLFPERCNISIAQITSKKSLTLRTWERGAGLTQACGSAACA
FT                   SAVAAYRRGLTERHIDVNLPKGILSILYRDDEHIIMTGPTEHEFSGLFNPLTGTYKKDH
FT                   L"
FT   gene            21533..22066
FT                   /locus_tag="BARBAKC583_0020"
FT   CDS_pept        21533..22066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0020"
FT                   /product="bacterial outer membrane lipoprotein, omp19
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45499"
FT                   /db_xref="GOA:A1UQV6"
FT                   /db_xref="InterPro:IPR010571"
FT                   /db_xref="InterPro:IPR016085"
FT                   /db_xref="InterPro:IPR021140"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV6"
FT                   /protein_id="ABM45499.1"
FT                   /translation="MTCSKISSFIILSLIVILSGCSTPQFKSDSSTPDIFYPFYSAETV
FT                   SDSIITSDLPESGEFTSVDEKESPDDSSQMANFEPPSYAINLSPASIAGVWNLSVDNTV
FT                   CRVATPQTKFGQGYSARPLSCSKIFSEVRSWAVKGKKLYFYDGSGRVVAVFYSFNGGRF
FT                   EGYMFNNQPAILTR"
FT   gene            22159..23370
FT                   /locus_tag="BARBAKC583_0021"
FT   CDS_pept        22159..23370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0021"
FT                   /product="ATPase, AFG1 family"
FT                   /note="identified by match to protein family HMM PF03969"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44762"
FT                   /db_xref="GOA:A1UQV7"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQV7"
FT                   /protein_id="ABM44762.1"
FT                   /translation="MALVSTRYKKLVSEGEISFDPAQLALTEHFDYLLHKILTQNTSQF
FT                   GAFWHRFRKKIKAYFCVSKQVNTDSHVQGHIQGLYIYGEVGRGKTMLMDLFFSCLPQGN
FT                   KKRSHFNDFMADVHERVNVHRQGLKSEKTKQNDSILAIAEDLAREARVLCFDEFSVTDI
FT                   ADAMILGRLVTALFDKGVILVATSNVAPDNLYYNGLNRALFLPFIQVLKTYVHVINLDA
FT                   KTDYRLEKSNSQHMYVTPLGLSANQCMDNAWMSILQGQEERSEDISVKGRLIHIMRSGA
FT                   GGARFDYQDLCVKPLAAAEYLALGERYHTIFIDNVPIMDDDVHRNETKRFILLIDVLYE
FT                   RHIRLFMSAAAELESLYRGRLSTTEGFEFQRTQSRLFEMQSQDYLTVWAERFFAGKSDL
FT                   FTFT"
FT   gene            23638..24603
FT                   /gene="mdh"
FT                   /locus_tag="BARBAKC583_0022"
FT   CDS_pept        23638..24603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="BARBAKC583_0022"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF00899; match to protein
FT                   family HMM PF02866; match to protein family HMM TIGR01763"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44647"
FT                   /db_xref="GOA:A1UQV8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQV8"
FT                   /protein_id="ABM44647.1"
FT                   /translation="MKRKKIALIGSGMIGGTLAHMIGLKELGDIVLFDVAEGLPQGKAL
FT                   DIAESSPVDGFDINLTGANAYEAIEGADVIIVTAGVARKPGMSRDDLLGINLKVMEQVG
FT                   AGIKKYAPSAFVICITNPLDAMVWALQKFSGLPAQKVVGMAGVLDSARFRYFLSQEFNI
FT                   SIKDITAFVLGGHGDSMVPLVRYSTVSGIPLPDLVKMGWTTHEKIDQIVQRTRDGGAEI
FT                   VSLLKTGSAFYAPASSAVAMAEAYLKDTRRVLPVAARLSGEYGIKDMYVGVPVVIGAGG
FT                   VERVIEIDLNDNEKSAFEKSVNAVKELCKTCSALAPNLKE"
FT   gene            24684..25880
FT                   /gene="sucC"
FT                   /locus_tag="BARBAKC583_0023"
FT   CDS_pept        24684..25880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="BARBAKC583_0023"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:P80886; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF08442; match to protein family HMM TIGR01016"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45552"
FT                   /db_xref="GOA:A1UQV9"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQV9"
FT                   /protein_id="ABM45552.1"
FT                   /translation="MNIHEYQAKRLLHEYGAPVANGVAVYSVEQAEKWAKKLPGPLYVV
FT                   KSQIHAGGRGKGNFKELDSDAKGGVRLAKSVEEVVANVKEMLGKTLVTKQTGPEGKQVN
FT                   RLYIEDGANIERELYLSLLIDRTTGRVAFVVSTEGGMDIETVAAETPEKICTLSIDPAE
FT                   GVTDADCVKLCDELNLSGNAREDGEKLFPILYKAFCEKDMSLLEINPLIVMDDGRLRVL
FT                   DAKVSFDNNALFRHPDILGLRDISEEDPKEIEASKHDLAYIALDGMIGCMVNGAGLAMA
FT                   TMDIIKLYGAEPANFLDVGGGASKEKVTHAFKIITADPNVKGILVNIFGGIMRCDVIAE
FT                   GVIAAVKEVGLKVPLVVRLEGTNVEQGKAIINDSGLNVISANDLDDAAQKIVAAVKGA"
FT   gene            25884..26786
FT                   /gene="sucD"
FT                   /locus_tag="BARBAKC583_0024"
FT   CDS_pept        25884..26786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="BARBAKC583_0024"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by similarity to SP:O08371; match to
FT                   protein family HMM PF00549; match to protein family HMM
FT                   PF02629; match to protein family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45074"
FT                   /db_xref="GOA:A1UQW0"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW0"
FT                   /protein_id="ABM45074.1"
FT                   /translation="MSILINKDTKVLVQGLTGKTGTFHTEQALAYHGTQMVGGINPKKG
FT                   GETWTGAKGETLPIFASVTEGKEKTGANASVIYVPPAGAADAIIEAIKAEIDLIVCITE
FT                   GIPVMDMVRVKAKLEKSKSRLIGPNCPGILTPDECKIGIMPGSIFKKGSVGVVSRSGTL
FT                   TYEAVFQTSHEGLGQTTAIGIGGDPVKGTEFIDVLEMFLADDETESIVMIGEIGGSAEE
FT                   EAAQFLKDEAKKGRKKPMVGFIAGRTAPPGRTMGHAGAVISGGKGGAEDKIAAMESAGI
FT                   RVSPSPSQVGKTLVSVLKG"
FT   gene            26939..29938
FT                   /gene="sucA"
FT                   /locus_tag="BARBAKC583_0025"
FT   CDS_pept        26939..29938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="BARBAKC583_0025"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM TIGR00239"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44563"
FT                   /db_xref="GOA:A1UQW1"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW1"
FT                   /protein_id="ABM44563.1"
FT                   /translation="MAKQHKINDVFAQTSFLYGGNANYIDQLYAEYEKNPDSVDLQWRA
FT                   FFENLQDNKEDVLKNAEGASWQRNHWPLKESGELVSALDGDWSALEKHLGDKLKEKAAT
FT                   GAAQKGETPNQQDMARAIRDSFNALMMIRAFRTRGHLLAQLDPLRLIKNPEECKELSPE
FT                   AYGFSPADYERPIFIDNVLGLEYATIPQILEILKRTYCSTIGVEYMHIADPAQKAWIQE
FT                   RIEGSNKQSAFTQEDKKTILDKLIEAEGFEQFLDTKYKGTKRFGLDGGEALIPALEQVI
FT                   KTGGNLGVQEVVFGMAHRGRLNVLSQILAKSHRAIFYEFKGGSYKPDDVAGSGDVKYHL
FT                   GASTDREFNGKKIHLSLLPNPSHLEIVDPVVIGKARAKQDQLVGSTRMDVIPLAERSKV
FT                   MPVLIHGDAAFAGQGVLQETFGLSGLKGYHVAGSIHVIINNQIGFTTSPNFSRSSPYSS
FT                   DVAKMIDAPVFHVNGDDPEAVVFVAKVATEFRQIFHKPVIIDMVCYRRYGHNEGDEPSF
FT                   TQPVMYKAIRNHQTTVQIYSDRLISEQLINSEEVEHKKKIWRDKLEVEFEASTSYKPNK
FT                   ADWLDGVWTGLKTANHADEQRRGITGIELKALIEIGRKLVEIPSDFHVHKTIQRFLSNR
FT                   AKMFETGEGIDWATAEALAFGSLCCEGIPVRLSGEDVERGTFSQRHSVLYDQENEARYI
FT                   PLNNLQKGQAIYEVVNSMLSEEAVLGFEYGYSLASPLGLTLWEAQFGDFANGAQVIFDQ
FT                   FISSAEHKWLRMSGLVCLLPHGFEGQGPEHSSARLERYLQLCAEDNMQVAYCTTPANYF
FT                   HILRRQIKRDFRKPLILMTPKSLLRHRRAVSSLSDMGLQTNFHRLLLDDAECLRDSVIK
FT                   LQKDSKIRRVVLCTGKVYYDLYEEREKRGIDDVYLLRIEQLYPFPAKTLVEVLSRFVKA
FT                   EIVWCQEEPKNMGAWSFIEPYLEWVLVHIKAKYSRARYAGRPASASPATGLMSKHLEQL
FT                   AAFLEDALGS"
FT   gene            29972..31177
FT                   /gene="sucB"
FT                   /locus_tag="BARBAKC583_0026"
FT   CDS_pept        29972..31177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="BARBAKC583_0026"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by similarity to SP:Q8GCY1; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45275"
FT                   /db_xref="GOA:A1UQW2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW2"
FT                   /protein_id="ABM45275.1"
FT                   /translation="MATEIRVPTLGESVTEATIGKWFKQFGETVAVDEPLVELETDKVT
FT                   VEVPSPVAGKLSEIVAKEGDTVEVGALLGMVEAGAVGTISSPSPAVAPSSVVTSAPAPQ
FT                   FSGHSMPPAPSAAKLMAENNIEKIDISGSGKHGQILKEDVLNALTQKVAAPASVESSSS
FT                   AMSANSVREERVRMTKLRQTIARRLKDAQNIAAMLTTFNEVDMSAVMDLRKRYKDVFEK
FT                   KHGAKLGFMGFFTKAVCHALKELPAVNAEIDGTDIVYKNYVNAGIAVGTDKGLVVPVIR
FT                   DADQKSIAEIEKEIVHLGRLARDGKLAVTDMQGGTFTITNGGVYGSLMSTPILNAPQSG
FT                   ILGMHAIKERAVVVGGQIVIRPMMYLALSYDHRIVDGQEAVTFLVRVKESLENPERLVL
FT                   DL"
FT   gene            31210..32616
FT                   /gene="lpdA1"
FT                   /locus_tag="BARBAKC583_0027"
FT   CDS_pept        31210..32616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA1"
FT                   /locus_tag="BARBAKC583_0027"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF00890; match to protein
FT                   family HMM PF01134; match to protein family HMM PF02852;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44701"
FT                   /db_xref="GOA:A1UQW3"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW3"
FT                   /protein_id="ABM44701.1"
FT                   /translation="MSYDVVIIGAGPGGYVAAIKAAQLGLKTAIIEKRETLGGTCLNVG
FT                   CIPSKALLHASEVFAEAQHGFDTLGVSVSKPQLNLEKMMAHKKSVVAANTSGISFLMRK
FT                   NKIDAFFGTAKILGAGQVAIFAKDGNQQTIVTKNIVIATGSDISGIPGVNVEIDEKVIV
FT                   SSTGALALEKVPTHMVVIGAGVIGSELGSVWSRLGAKVTVIEFLDKVLGSIDGEVSRHF
FT                   QKIMEKQGIEYKLGTKVTAVAKSGSRAKISFEAVKGGASETLETDVVLIATGRRPYVDG
FT                   LGLAEAGVQLDERGFIAINEHWQTNIPGIYAIGDVVKGPMLAHKAEEEGVAVAEILAGQ
FT                   KGHVNFDVIPSVVYTQPEIASVGKTEEELKAAGIAYNVGKFPFMANGRARAMQKDDGFV
FT                   KILADKNTDRVLGGHILGFGAGEMIHEIAVLMEFGGSSEDLSRCCHAHPTLSEAVREAA
FT                   LATFFKPLHI"
FT   gene            complement(32755..33993)
FT                   /gene="lys1"
FT                   /locus_tag="BARBAKC583_0028"
FT   CDS_pept        complement(32755..33993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lys1"
FT                   /locus_tag="BARBAKC583_0028"
FT                   /product="saccharopine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /note="identified by match to protein family HMM PF03435"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44794"
FT                   /db_xref="GOA:A1UQW4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW4"
FT                   /protein_id="ABM44794.1"
FT                   /translation="MKKNVLIIGAGGVAQVVAHKCAQNNDILGEIHIASRTPKKCDTII
FT                   ASIKDKKAMKVENIIKGYALNALDREETIKLIQKTKCEIVINVGAPFLNMSVLSACIET
FT                   KCAYIDTAIHEDPLKICETPPWYGNYEWPQREKCEKAGITAILGAGFDPGVVNAYAALA
FT                   RDNYFDTITDIDIVDINAGNHGRWFSTNFDPETNFREFTGCVWSWQNKQWVANQMFEIS
FT                   NEWDLPVVGKQKAYMTGHDEIHSLSKNLDVQNIRFWMGFGERYITVFTVLKNLGLLSEQ
FT                   PIKTAEGQEVVPLKIVKAVLPDPASLAPDYTGKTCIGDFVKGKKDGNPREVFIYNVADH
FT                   KDAFNETGAQAISYTAGVPAAAAALLIATGEWDVKTMVNVEELPPQPFLKNLDQMGLST
FT                   YIREGKKDKKLQF"
FT   gene            complement(34049..35146)
FT                   /gene="nspC"
FT                   /locus_tag="BARBAKC583_0029"
FT   CDS_pept        complement(34049..35146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nspC"
FT                   /locus_tag="BARBAKC583_0029"
FT                   /product="carboxynorspermidine decarboxylase"
FT                   /note="identified by similarity to GB:BAA06561.1; match to
FT                   protein family HMM PF00278"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45569"
FT                   /db_xref="GOA:A1UQW5"
FT                   /db_xref="InterPro:IPR005730"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW5"
FT                   /protein_id="ABM45569.1"
FT                   /translation="MIKTPYYLIDKSKLIKNMEIIARLREMSGVKTLLALKCFATWSLF
FT                   DLMSEYMDGTTSSSLYELRLGKEKFGKETHAYSVAWADHEIDEACGYADKIIFNSIQQL
FT                   LRFSDATQMIPKGLRLNPGISASNFDLANPSRPFSRLGESDQNSIEEVLPLINGLMIHN
FT                   NCENADFHLFEQMLNFMEEKFKKLFFAVDWISLGGGIHFTAENYPLKTFAELLKRFSQT
FT                   YGVTVFLEPGEAAITKSTTLEVSVLDTLYNEKNLAIVDSSIEAHMLDLLIYRENAKLEP
FT                   NQGPYEVMICGKSCLAGDIFGTFHFPHPPKIGDRLSFQDAAGYTMVKKNWFNGIAMPAI
FT                   VIKECDGTLTLQRQFNYNDYQESLS"
FT   gene            35897..38818
FT                   /gene="phaAB"
FT                   /locus_tag="BARBAKC583_0030"
FT   CDS_pept        35897..38818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaAB"
FT                   /locus_tag="BARBAKC583_0030"
FT                   /product="pH adaptation potassium efflux system protein
FT                   A/B"
FT                   /note="identified by similarity to GB:CAA63734.1; match to
FT                   protein family HMM PF00361; match to protein family HMM
FT                   PF04039"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45169"
FT                   /db_xref="GOA:A1UQW6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW6"
FT                   /protein_id="ABM45169.1"
FT                   /translation="MTTREAMLILLVLLPFGGSFIIGFFRSTAKNNEAWFAGAIALFSL
FT                   LFTIMLYPTIRGNGVVRLDISWLPEWGVDLTLRMDGLSWLFCLLITGIGLLVVVYARYY
FT                   MNPADPVPRFFSFFLAFMGSMTGIVLSGNLVFLVIFWELTSIFSFLLIGYWYHNASARD
FT                   GARMALTITGFGGFALLVGVLLIGHIVGSFDLDKVLQSGDLIRSSPLYNLVLICVLLGG
FT                   LTKSAQFPFHFWLPNAMAAPTPVSSYLHSATMVKAGLFLLIRLWPVLSGTESWFFLVGF
FT                   AGLTTLLLGSYFSMFQHDLKGLLAYSTISHLGLITTLLSLGSPLACVAAIFHMANHATF
FT                   KASLFMAAGIIDHETGTRDMRKLTGLFHYMPITGTLALVASAAMAGVPLLNGFLSKEMF
FT                   FAEAVETHMESWLDWIAPYIATLASLFSVTYSIRFIHGVFFGSKPTDLPKTPHEPPHFM
FT                   RFPMEFLVFICLAVGIFPHLTIGSILDNAVVAVLGSATPSYSLAVWHGLNTPLIMSFMA
FT                   LFGGILLYILGSRYFLSCDEGPPFFRYFKGQRIFEQILVIISWKWARTAESFLSTRRLQ
FT                   AQLHWVLLVCFVFVGLLLWRDGWISAGSLPIFPLEVSFMAIWVVGGVCALLVAWKAKFH
FT                   RFTSLMLLGGAGLVTCATFLWLSAPDLAVTQLVVEVVTTVLLLLGLRWLPKRLYNTAPL
FT                   PIGFSVYMRRGFDFAIALLGGASMAWFSFAVMTRPQGETISDFFLTHAYSEAGGRNVVN
FT                   VLLVDFRGFDTIGEIVVLGIVSLTVFALLRRFRPSPESVDAPFQQRVQMVFDTTQPNRE
FT                   AGDTLSDYLAVPSVIMRWLFPIIIAFAIYLFMRGHDLPGGGFAGGVTLAIGFILQYLAA
FT                   NIRWVENHLRVLPLRWMGFGLLLSVMTGVGSWFFEFPFLTSFFQYMNLPSIGAVPMASA
FT                   FLFDLGVFALVVGATVLILIAIAHQSIRIYRIKKKSVMKEKEN"
FT   gene            38818..39156
FT                   /gene="phaC"
FT                   /locus_tag="BARBAKC583_0031"
FT   CDS_pept        38818..39156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaC"
FT                   /locus_tag="BARBAKC583_0031"
FT                   /product="pH adaptation potassium efflux system protein
FT                   PhaC"
FT                   /note="identified by similarity to GB:CAA63736.1; match to
FT                   protein family HMM PF00420"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45105"
FT                   /db_xref="GOA:A1UQW7"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW7"
FT                   /protein_id="ABM45105.1"
FT                   /translation="MEIVLSLGIGVFIGSGIWLILRPRTFQVILGLSLISYGVNLFMFS
FT                   MGRPRSNVAPIVNSSDMVNPANYADPLPQALVLTAIVIGFATTALFLVILLVSRGLTGS
FT                   DHVDGREV"
FT   gene            39159..40781
FT                   /gene="phaD"
FT                   /locus_tag="BARBAKC583_0032"
FT   CDS_pept        39159..40781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaD"
FT                   /locus_tag="BARBAKC583_0032"
FT                   /product="pH adaptation potassium efflux system protein
FT                   PhaD"
FT                   /note="identified by similarity to GB:CAA63737.1; match to
FT                   protein family HMM PF00361"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45101"
FT                   /db_xref="GOA:A1UQW8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW8"
FT                   /protein_id="ABM45101.1"
FT                   /translation="MEAWLHHLLIVPILLPLTIGAVLLFYDERRSKLKALISLVSAGLL
FT                   IVVSVLFLARTLEIAPASDVYRLGNWFPPFGIVLVLDRLSAMMLVLSSLLTTAVLVFSR
FT                   AHWYKKGPHFQSLMQFFIMGVNGTFLTGDLFNLFVFFEVVLTASYGLAFHGSGQSRVRA
FT                   GMHYVVINLVASLFFLIGAALIYGVVGTLNMADLAVKIRHIASEDIVLFEVGAAFLGIV
FT                   FLLKVGMWPLNFWLTPVYSTAAAPVSAAFAILSKMGIYVILRLTFLWFSPESGYFAHFG
FT                   HMILFYGGLATLIFGIIGILASQVLGRLAAYSVLVSSGILLTVIGMGNTALMAGALFYI
FT                   VSSTLALGALFLLIELVECNQDMAANVLAVTMEVYGDEEEEEDDEVGTYLPATLAILGC
FT                   CFVICTILIVGLPPFSGFVAKFIMLMAIFNQNEGDSSANLSVMHDWLFVFFVIISGFAA
FT                   LIAMTRKGIRVFWTPLECRDPRAQVIEFAPIAALLALCLMMTIMAGPISHYMSETVKTL
FT                   RDPKNYIESVLTSSTLKTMEKKP"
FT   gene            40778..41263
FT                   /gene="phaE"
FT                   /locus_tag="BARBAKC583_0033"
FT   CDS_pept        40778..41263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaE"
FT                   /locus_tag="BARBAKC583_0033"
FT                   /product="pH adaptation potassium efflux system protein E"
FT                   /note="identified by similarity to SP:Q52982"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44522"
FT                   /db_xref="GOA:A1UQW9"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQW9"
FT                   /protein_id="ABM44522.1"
FT                   /translation="MSRFLPYPFLSSAIVFMWLILSGFSLGQLLLGMMVALFCGWMMRL
FT                   LEPEKITIKNWRAVFQLIYRVFIDSIAGNISVAWFTLKNGHKKQQSGFVVVPLFIKSHT
FT                   ALAVLACILSATPGTVWVSYNSKESKLLIHVLNLKDGNDYQQLIKQRYEGLLLEIFS"
FT   gene            41260..41541
FT                   /gene="phaF"
FT                   /locus_tag="BARBAKC583_0034"
FT   CDS_pept        41260..41541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaF"
FT                   /locus_tag="BARBAKC583_0034"
FT                   /product="pH adaptation potassium efflux system protein F"
FT                   /note="identified by similarity to SP:Q52983; match to
FT                   protein family HMM PF04066"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44933"
FT                   /db_xref="GOA:A1UQX0"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX0"
FT                   /protein_id="ABM44933.1"
FT                   /translation="MSTIILYWAFFISQIFLSLAIVLAIFRLIRGPRAQDRVVGLDALY
FT                   MTAILLFILFDLRSGTIIYFEAALIIGLLGPISSIALAKFLMRGEIIE"
FT   gene            41538..41930
FT                   /gene="phaG"
FT                   /locus_tag="BARBAKC583_0035"
FT   CDS_pept        41538..41930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phaG"
FT                   /locus_tag="BARBAKC583_0035"
FT                   /product="monovalent cation/proton antiporter PhaG"
FT                   /note="identified by match to protein family HMM PF03334;
FT                   match to protein family HMM TIGR01300"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45680"
FT                   /db_xref="GOA:A1UQX1"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX1"
FT                   /protein_id="ABM45680.1"
FT                   /translation="MKDDISLWVAILIAVFLLLGSSLTLIGTIGLIRFSTFYERLHMPS
FT                   LSASWGGSSIIIASLLYSIFVDHHWVFHEVLLVVFLFVTTPVTSMLLSQAAAHRDHPEN
FT                   WLEKPPAFLLRHKEEKSPTLKEKESG"
FT   gene            complement(41962..42354)
FT                   /locus_tag="BARBAKC583_0036"
FT   CDS_pept        complement(41962..42354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032843.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45533"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX2"
FT                   /protein_id="ABM45533.1"
FT                   /translation="MKKVLLILGSLAILGVLLFKQIGVSVGSLIIEVPEDPNPTKTTVV
FT                   YQCDTETDKEQISVTYLNADTISLVDFTWKGQRVIGANVITASGVKFAGAQYIWWIKKD
FT                   DAILYNLIDDPTEENPIRCEKIQDIR"
FT   gene            complement(42771..43904)
FT                   /gene="aroB"
FT                   /locus_tag="BARBAKC583_0037"
FT   CDS_pept        complement(42771..43904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="BARBAKC583_0037"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="identified by match to protein family HMM PF01761;
FT                   match to protein family HMM TIGR01357"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44620"
FT                   /db_xref="GOA:A1UQX3"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQX3"
FT                   /protein_id="ABM44620.1"
FT                   /translation="MKAKTITVKLDKCCYDIIIGSDLIAQAALQIKSFFHQKGPHQKRL
FT                   AIVTDTNVAALHLETLQAGLSANQIHTIPIIVEAGEQSKSFPVLQTIIDKILAARLERG
FT                   DSIIAFGGGVIGDLGGFAASIIRRGMHFIQMPTTLLAQIDSSIGGKTGINSQYGKNLIG
FT                   SFYQPQCVITDTCVLDTLPLREFRAGYAEMVKYGLINQPHFFEWLEKNQKEIFSSGPTR
FT                   VEAIARSCQFKADIVARDEYEAGERALLNLGHTFGHMLETATAYNANRLIHGEAVAIGM
FT                   ILAYQFSAQLNLISPMLVQRVETHLKAAGLPTQLQDIPGELPNAEMLMTFIAQDKKVSN
FT                   NRLTFILTHGLGQSFIAKDVASDAVLTFLKQKFTKTH"
FT   gene            complement(43873..44418)
FT                   /gene="aroK"
FT                   /locus_tag="BARBAKC583_0038"
FT   CDS_pept        complement(43873..44418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="BARBAKC583_0038"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45384"
FT                   /db_xref="GOA:A1UQX4"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX4"
FT                   /protein_id="ABM45384.1"
FT                   /translation="MFVGFMGSGKSAIGKRVATMLDLPFYDSDQEIEKAAQMTISDLFE
FT                   IYGESEFRLLEQRVILNILKNGPLVLATGGGAYINENIRKAIHHKGISIWLKTDFNLLI
FT                   KRVSQRLTRPLLQTDNPQETVRTLMEQRYPIYATANLMVKNHKESRNMVAKKVIKRVQN
FT                   YINDRNKRHESQNHHGQT"
FT   gene            44758..45696
FT                   /gene="xerD"
FT                   /locus_tag="BARBAKC583_0039"
FT   CDS_pept        44758..45696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="BARBAKC583_0039"
FT                   /product="tyrosine recombinase XerD"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44662"
FT                   /db_xref="GOA:A1UQX5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX5"
FT                   /protein_id="ABM44662.1"
FT                   /translation="MKNNVIIDRFLEMMSAERGASAHTLAAYQHDLQWAQDKLSSCSVS
FT                   LFSARKEDLISLLSLMHKAGFAATSQARRLSTLRQFYQFLYAEKLREDDPSGDIDAPRQ
FT                   GHPLPKIMSEDVVTKLLDFAQLETNQAEYGSKNYFRALRLQVLIEMLYATGLRISELVS
FT                   LPVQTVRGKEQYILVRGKGGKERMVLLSAKARQVLSEWLVLRDQGKDATSPYLFPAHSS
FT                   TGYIARQFIARGLKDLAKRAGIRGDCFSPHVLRHAFASHLLQNGADLRAVQHLLGHCDI
FT                   STTQIYTHVLETGLYHLVNEHHPLADQDKAK"
FT   gene            45772..46728
FT                   /gene="accA"
FT                   /locus_tag="BARBAKC583_0040"
FT   CDS_pept        45772..46728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="BARBAKC583_0040"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44730"
FT                   /db_xref="GOA:A1UQX6"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQX6"
FT                   /protein_id="ABM44730.1"
FT                   /translation="MYNYLDFEKPVADLDVQILELKKIAQEKGSLDMSDEIARLEMRSQ
FT                   TALRDLYKKLSPWQKTQVARHPDRPHFMDYSAQLLRDVTPLAGDRKFAEDEAIQAGFAR
FT                   FKGEAIAYIGQEKGHDTQTRLRYNFGSARPEGYRKAVRIMELADRFGLPLLTFVDTAGA
FT                   YPGVSAEERGQAEAIAQSTAATLRLRVPVVSVIIGEGGSGGAIAIAAANKVYMLEHSIY
FT                   SVISPEGAASILWRDPARAKDAATNMQITAQDLYRLKIIDGIIPEPLGGAHRQKEAAIE
FT                   AAGDGIAAALKSMIGKDGETIKQERWDKYLQIGRSLA"
FT   gene            46764..47507
FT                   /locus_tag="BARBAKC583_0041"
FT   CDS_pept        46764..47507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0041"
FT                   /product="putative lipoprotein"
FT                   /note="identified by match to protein family HMM PF06104"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45127"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX7"
FT                   /protein_id="ABM45127.1"
FT                   /translation="MMLNRCFLVFLLLVTGILAACQGKFARHHKSEQPLPKNILNKMAK
FT                   FNIDQYAPIMMRFFKEENIAEIWKQNREGRFVLITHYSICKWSGKLGPKYREGDYQAPE
FT                   GFYMVRPNQMNPRSNYYLSFNIGFPNLYDQVNGRTGSYLMVHGGCASAGCYSMNDKNMA
FT                   QIYAFARDAFRGGQRGFSLHAFPFHMTDANMARHRASPHYPFWKMLKEGYDFFEKYRKL
FT                   PVIEVYEKRYIFRHPTRRDLVSVMQ"
FT   gene            complement(48142..49230)
FT                   /locus_tag="BARBAKC583_0042"
FT   CDS_pept        complement(48142..49230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0042"
FT                   /product="D-alanyl-D-alanine carboxypeptidase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44940"
FT                   /db_xref="GOA:A1UQX8"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX8"
FT                   /protein_id="ABM44940.1"
FT                   /translation="MRKLFYKFFLFLVLSMMSRLALAHPFISVDLANGRILEHNQAFER
FT                   WYPASLTKLMMAYIVFRAMSTGEISPNTSITISKAAAQAPPHRSSYKTGYTITLDAALS
FT                   ITLVKSANDLAIAISEAIAGSQKAFVKQMNAHAQRLGMFGTHFANASGLPDLNNYSTAR
FT                   DIALLAVQIRREFPQYTHYFSIPAIDFGDNQKIQYNSNKLIGRFDGIDGMKTGFICASG
FT                   FNIVASATRNNRTIIAVILGAENIDEREAKAAELLHEGFTKKGSPTSTLATLEPYGTKI
FT                   TQITDMRQQICTPEAGNIRRSSYDTEGNITLNSPLIAASPSSVSPLLIHPMTLPKTSKM
FT                   KIRTLRTIPIPQKRPHHSQPRK"
FT   gene            complement(49321..50127)
FT                   /locus_tag="BARBAKC583_0043"
FT   CDS_pept        complement(49321..50127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0043"
FT                   /product="acyltransferase family protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45188"
FT                   /db_xref="GOA:A1UQX9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQX9"
FT                   /protein_id="ABM45188.1"
FT                   /translation="MVLVLRSLLFTFFFYIATFVQMILYAPFYFLTPRKKAQIFLKTWA
FT                   RITLFLQKHIAGTTYEIEGLENLPNGAYIVAPNHQSAWETVSLFLYFDDPVFILKRELM
FT                   WLPILGWYIAKMQMIPINRTTPIKALKIVINNAKQKAKQGRQIIIFPEGTRQQPGQKPD
FT                   YKSGILALYNELGLQVIPIAHNAGLYWPRNNFRRYPGTIRVRILPPIETGLRKHDFLKK
FT                   LTQKTEKACDELLLLAAQDHTPPPMPSSAVKKLQTLGHTWKGSVCD"
FT   gene            50162..50293
FT                   /locus_tag="BARBAKC583_0044"
FT   CDS_pept        50162..50293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0044"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45652"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY0"
FT                   /protein_id="ABM45652.1"
FT                   /translation="MYDSVCTKKYFINLLMYFKMQEKRLGILKLAKINFIILGSGWV"
FT   gene            50598..50780
FT                   /locus_tag="BARBAKC583_0045"
FT   CDS_pept        50598..50780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44950"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY1"
FT                   /protein_id="ABM44950.1"
FT                   /translation="MVKALFLGEGFCFFEYFVNKEKTKAQLIIFAHDGAVNKKAISCKR
FT                   NSKIKQDFSKSLKIK"
FT   gene            complement(50798..50872)
FT                   /locus_tag="BARBAKC583_0046"
FT   tRNA            complement(50798..50872)
FT                   /locus_tag="BARBAKC583_0046"
FT                   /product="tRNA-Gly"
FT   gene            51054..52037
FT                   /locus_tag="BARBAKC583_0047"
FT   CDS_pept        51054..52037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0047"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF04392"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45520"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY2"
FT                   /protein_id="ABM45520.1"
FT                   /translation="MVIVKKVLSLCIAMVAVFTGGSFAQEAQAAQRVKIAITQIVSHPA
FT                   LDKVRKGVEDVLEENGYKNGDNLELTFLSAQGNISTATQIARKFAGDKPDVIVAISTPS
FT                   AQTILAATKEIPIVFSAISDPVEAKLVSSLVKPGGNVTGVSDRADVAENLKLLREIKPN
FT                   LKKLGYLYNASEANSVSTLKVLKELANKMGIEVISSSAPKSSDVQAATRALINKVDVIF
FT                   VPTDNTIIAVLEGATKIALETKIPLFTLDSNSIGRGPFITQGVSYYSVGVDTGKLVLRI
FT                   LNGEKPGDLDVVQADNKNIQVDRKIIEKLGIVLPQTVLERITEVEE"
FT   gene            52089..52982
FT                   /locus_tag="BARBAKC583_0048"
FT   CDS_pept        52089..52982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0048"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44784"
FT                   /db_xref="GOA:A1UQY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY3"
FT                   /protein_id="ABM44784.1"
FT                   /translation="MNIFAFWGAVELGLIYAFVAIGVYLSFRVLDFPDLTVDGSFLLGS
FT                   CVCGVLILLGVNAWVAMLCAFGAGMVAGLLTALLNVQFGILNLLASILTMSALYTINLR
FT                   IMGIMGGANINLALADTALTPFYGLFGLPDLFIRPLFVGCVLLIVTFLIWRFLTSEVGL
FT                   AMRATGVNPCMAKAQGIHTAALIYLGMGLANACVAFGGALYIQTAIATDITGGVGTIVF
FT                   GLAAVIIGETLFRTRNIFWIMVSCIMGSVFYRVAVQFAFEASGIGIDTSTDLQLITALL
FT                   VMLALIVPRYLGRAST"
FT   gene            52979..53773
FT                   /locus_tag="BARBAKC583_0049"
FT   CDS_pept        52979..53773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0049"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44640"
FT                   /db_xref="GOA:A1UQY4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY4"
FT                   /protein_id="ABM44640.1"
FT                   /translation="MIELSHVGVVFKPKTPLEKRALIDINLKINQGSFVTVIGSNGAGK
FT                   STLLSVVSGALLPTEGQMMINGHDVSCQSIRERAGRVACVFQDSLMGSCGSLTIEENLA
FT                   LAALRGRHRGFYSALRREKRQFFREKIAQLGLGLEDYLHNRMDSLSGGQRQAVCLIMAT
FT                   LAHADVLLLDEHTSALDPGMADFVMGLTKKIVEENQLTTIMITHSIRQALDYGDRTLML
FT                   HGGEVVLDIHQEERKGLKMSDVMGMFQKVRGTVLDDDKLLME"
FT   gene            53777..54820
FT                   /gene="holA"
FT                   /locus_tag="BARBAKC583_0050"
FT   CDS_pept        53777..54820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="BARBAKC583_0050"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF06144;
FT                   match to protein family HMM TIGR01128"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45332"
FT                   /db_xref="GOA:A1UQY5"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY5"
FT                   /protein_id="ABM45332.1"
FT                   /translation="MAQKKAHEVDHFLTHFSRSFPIVLIYGPDRGLVCERVQRFIKLTQ
FT                   IATDDPFATVRLDAAEIDKDPARLGDEARTLSLFGSDRLVWVSNGANQKNFLEALKLLI
FT                   AEPPEKSFILIEAGDLKKGIGLRNIVETASVAMALPCYADDVRSLDTLIDEVLESFKMT
FT                   LSLEARKGLYESLGGDHLVSRRELEKLCLYASEKRHITLEDVKAVVSDVSAFSSDEVID
FT                   AILLGDGKEFEVHFSRYVAMHNTPFLVLSTAQRHFQQLQILRYQVEIEQKTAFAVMSQA
FT                   RPPIFFQRKKTVEKALKYWTLEKISYAMEKIQCALLESRKNPLLGEAIIHRVLLELVFM
FT                   IRRQMSS"
FT   gene            54956..55813
FT                   /locus_tag="BARBAKC583_0051"
FT   CDS_pept        54956..55813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0051"
FT                   /product="YihY family protein"
FT                   /note="identified by match to protein family HMM PF03631"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44417"
FT                   /db_xref="GOA:A1UQY6"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY6"
FT                   /protein_id="ABM44417.1"
FT                   /translation="MIRNISLCYHILINAISHYWRGDGSAFASHVALSGLLAFFPFFIF
FT                   GTFFAGFIGAFTYTPQKIAALVQLLPDAITKPLMKEIINVLTIQRRDVLTLSVFGAAYF
FT                   ASNGIEALRTALNKAYRVVDYRSFIFCRFQSLFFVIIGAIGLVVISFSLVLAPVLVKMM
FT                   QQHSPFITEYVGVIRLWRYTIAIVISLISLLIVHKWLPAGKRKLIDILPGIVVTMFAWF
FT                   LASMAFAHYLNLTMLNYVSTYAGLASIMVAIIFLYMLSAIFILGGEINAAIMLYRDRLQ
FT                   HPNE"
FT   gene            55832..56329
FT                   /locus_tag="BARBAKC583_0052"
FT   CDS_pept        55832..56329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02639"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45149"
FT                   /db_xref="InterPro:IPR003791"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY7"
FT                   /protein_id="ABM45149.1"
FT                   /translation="MLIKNQEQDTQTKPAIILLVDADACPVKSEIYRVMNRYQLKTFIV
FT                   ANHFLSLPNEALLERVIVSQGPDCADNWIVDHVHQASIVITNDILLAARVVQRGGVCLS
FT                   PTGRVFDISSIGQALAMRNLMEDLREQGCVTGGPRPFCRKDRSTFLSALDLAIQRLKRR
FT                   GY"
FT   gene            complement(56331..57029)
FT                   /locus_tag="BARBAKC583_0053"
FT   CDS_pept        complement(56331..57029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0053"
FT                   /product="antioxidant, AhpC/TSA family"
FT                   /EC_number="1.11.1.15"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF00578; match to protein
FT                   family HMM PF08534"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44759"
FT                   /db_xref="GOA:A1UQY8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQY8"
FT                   /protein_id="ABM44759.1"
FT                   /translation="MISQIFISRKNKNKKMQFFIASFIIALSLYTTINHNSTRGTFVAN
FT                   FISKAKAQEINSNTTHMKEIAAIKKAAQGFFSHIRFADKLYDMNQLSFKDIQGKDHKLL
FT                   EFNGKPILINLWAIWCTPCRMEMPELAQLKHDMGGDNFDVIAINVDTTASPEKIQKFLH
FT                   EIQADHLVYYRDKTMNIFRNIRKQGLAMGLPVTLLIDKKGRLIASLNGSAPWANDDAKA
FT                   LIKAVIEEIK"
FT   gene            57063..58463
FT                   /gene="argH"
FT                   /locus_tag="BARBAKC583_0054"
FT   CDS_pept        57063..58463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="BARBAKC583_0054"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45432"
FT                   /db_xref="GOA:A1UQY9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQY9"
FT                   /protein_id="ABM45432.1"
FT                   /translation="MTGDKLSNQMWGGRFAAGPAAIMEEINASIDFDQKLYRQDIEGSL
FT                   SHAAMLAQTKIISHSDYEKIVHGLQLIRQEIETGSFTFSRKLEDIHMNIEARLSELIGP
FT                   VAGRLHTARSRNDQVAVDFRLWVREAAQKIAQALKDLMEQLLMRAEQHADTLMPGFTHL
FT                   QTAQPVTFGHYMMAYVEMFGRDLSRMRDAIERMNESPLGAAALAGTGFPIDRFMTAQAL
FT                   GFREPTRNSIDSVSDRDFALEFLSAGALCAMHLSRLAEEIILWSSAQFHFIRLSDAFST
FT                   GSSIMPQKRNPDAAELVRAKAGRLNAALMGLLTVMKGLPLAYSKDMQEDKEYVFDGVLN
FT                   LELSLAAMMGIISDLEVNKEAMKQAAGSGYAIATDLADWCVRELGLPFREAHHITGRAV
FT                   ALAEQKKCSLDELSLDEFQTLHPDINAAVFDVLTIEKSVESRNSFGGTAPSEVLRQVAY
FT                   WKQHLVTA"
FT   gene            58522..58701
FT                   /locus_tag="BARBAKC583_0055"
FT   CDS_pept        58522..58701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0055"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to RF:NP_539003.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44629"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ0"
FT                   /protein_id="ABM44629.1"
FT                   /translation="MKTFVRTVIITLFCPIIFIGCGRKGALERPPASVMESSQEEFVSK
FT                   NKADKAFILDRLIK"
FT   gene            58710..59984
FT                   /gene="lysA"
FT                   /locus_tag="BARBAKC583_0056"
FT   CDS_pept        58710..59984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="BARBAKC583_0056"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45236"
FT                   /db_xref="GOA:A1UQZ1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ1"
FT                   /protein_id="ABM45236.1"
FT                   /translation="MNFFSYHQGELHAEGLSLSTLAKDVGTPFYCYSSGALVAHFKEYQ
FT                   EAFHDMPSLIAYAVKANSNQAVLRILAAKGAGADVVSEGELRRALAVGITPQRIVYSGV
FT                   GKTVREIDFALSQDIFCFNVESEPELEQLSARAVALSKTARISLRINPDVDAKTHKKIT
FT                   TGRFDNKFGIPLSLACSAYKKAAQLPGLQVRGMDMHIGSQICDLKPFEDAFLIAADFVR
FT                   HLWREGYAITHIDIGGGLGISYHPEQNMVPSPADYAALVRKHIAPLGINIILEPGRSIA
FT                   GHAGVLVTSVIYLKRGEGRNFVVVDGAMNDFLRPTLYDAWQTVVPVKKAPEDAPLIMAD
FT                   IVGPVCETGDYLGLNRSLPMVAAGDLLAITGAGAYGAVMASTYNSRLLVPEILVQNTRY
FT                   DVIRPRLDYEQLMGLDHIPDWIENF"
FT   gene            60099..62516
FT                   /locus_tag="BARBAKC583_0057"
FT   CDS_pept        60099..62516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0057"
FT                   /product="conserved hypothetical protein TIGR02302"
FT                   /note="identified by match to protein family HMM TIGR02302"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45067"
FT                   /db_xref="GOA:A1UQZ2"
FT                   /db_xref="InterPro:IPR012683"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ2"
FT                   /protein_id="ABM45067.1"
FT                   /translation="MSDENIKRCVMIRLWGVRFLAWCILCFERIWPRLLPFFLALSFLC
FT                   SLSWFGIFNVLPYGWHLFFLSLILFVAVGSLFLLAGFRFPTAKEVDRHIEQKSGLKNQP
FT                   LSVQTDRLCSEDDKDFSAVIWREHQRRMAEDLRYVRSGFAYPNSANHDPMALRFVFVLL
FT                   CVCAFSFSFGSLGGRLQDAFDLRSMVNESSMRVDAWVTPPSYTGVAPIYLTRSEMTNFS
FT                   IPEGSEVVVRVVDGSGVKVKAVSEEDGRKVLLSQKREKTALNDSIVRFETRLERSINLF
FT                   FSSRYQQQQWHLDMMKDQIPTIRWLEKPERISAGALELQYEMDDDYGVTNAFAAIESLV
FT                   DFDKNAVPLYQAPQIKLLLARGGKGKMRMVQDLSSHPWAGTEVKITLVVEDGAGQKGRS
FT                   KTFVMTLPQRVFANPVARAVNEQRRLLALNAAARERVLDMLAALLVRPENGIQNSINIL
FT                   ALQSAWTRLSMAQTEDELRDVVHYLWQIAIAIEGDQSESAQQRLKQAQTALRDALRRGA
FT                   SGAEIERLMADLRQAMHDYIRALAEKAPENSDSNNKANLSEDSLHKKLDSIEQMAQIGS
FT                   SSSAEQLLDEIEQTLDHLRVQKSNRDQEQKNTQTTKMKKTIDKLGDVMRRQQEILNDTH
FT                   RLETEKRRGETVTQEQSEALVERQAQLQSELSVLEKELSEQGFEKGGVLKEAEEKMNSA
FT                   KAALGHGNHETSVKNQSDVLESLRQGAQNILQKMREALKQSEDMQNAAESQDPLGRPLS
FT                   SDSDQGQNGKTMSQEGDKAQARQILEEIRRRLNKDHLSEEEKNYLERLLHFH"
FT   gene            62798..63532
FT                   /locus_tag="BARBAKC583_0058"
FT   CDS_pept        62798..63532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0058"
FT                   /product="putative SAM-dependent methyltransferase protein"
FT                   /note="identified by match to protein family HMM PF08241"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44627"
FT                   /db_xref="GOA:A1UQZ3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ3"
FT                   /protein_id="ABM44627.1"
FT                   /translation="MDIITLRDFYASPLGTRVQTTLCEQLNIKWPNLDDKRVLGFGYSL
FT                   PYLAALHARAQQCFAFMPANQGVTPWPCADKVATALVFEEDLPLPDASVDCILLIHALE
FT                   YSENARETLNEIWRVLAPNGHLIVIVPNRCGLWARNDRTPFGYGQPYSRQQIVRLFEET
FT                   NFIVRSVQEIVHYMPFSGRVSRLFSLFYEPLARYLFPYFGGLLMCQVQKRVYQGLFVQR
FT                   RQSRRVFIPVLSPQAREKCTPS"
FT   gene            complement(63674..64360)
FT                   /locus_tag="BARBAKC583_0059"
FT   CDS_pept        complement(63674..64360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0059"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44876"
FT                   /db_xref="GOA:A1UQZ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ4"
FT                   /protein_id="ABM44876.1"
FT                   /translation="MSDYNLLIIEEDDNLRHILVEQLQIYKEFEILQAKTAEAGITVAQ
FT                   EKRINLIIIDAEFSDLDDRTTVTKLRQQGFRAPIIMITRDDTNCDSLLNLEVGINDYVT
FT                   KPFRFAVLLARIRAQLRQYEHNEDAVFHIGPYNFKPGQKLLIDQQNNHIRLTEKEAAIL
FT                   KYLYCTRKNQVISRETLLEQIWGYNEQIVTHTLETHIYRLRKKIEKDPANAQILITDQN
FT                   GYRLNL"
FT   gene            64391..64999
FT                   /locus_tag="BARBAKC583_0061"
FT   CDS_pept        64391..64999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0061"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45049"
FT                   /db_xref="GOA:A1UQZ5"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ5"
FT                   /protein_id="ABM45049.1"
FT                   /translation="MILKVVSRKMRFHASRIKKETVKKKTCVTLITVRRQVRMAGRHTQ
FT                   GILCIGQHRLFCALGRSGVSAFKHEGDGATPLAKMRCLRGFRGNFYRSLPRSALSFRRI
FT                   RAHDGWCNASGDANYNRFVRLPYSKSAEKMQREDNLYAIGLILDWNITERKMAKGSAIF
FT                   MHLARDNYQPTEGCIALSRRDMERLLPYISQRTKIAVLA"
FT   gene            complement(64996..65424)
FT                   /locus_tag="BARBAKC583_0060"
FT   CDS_pept        complement(64996..65424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_222541.1; match to
FT                   protein family HMM PF01878"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44683"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ6"
FT                   /protein_id="ABM44683.1"
FT                   /translation="MAYWLFKSEPDKWSWTMQKKKGLDGEQWDGVRNYQARNNMRAMKY
FT                   GDKGFFYHSNKGLEIVGIVEICAETHPDSTTSDPRWECVDIRAICDMPNPVSLKQIKAN
FT                   PKLNTMTLVKAMRLSVQPVTEEEWKEICAMGGLQPEML"
FT   gene            complement(65516..66610)
FT                   /locus_tag="BARBAKC583_0062"
FT   CDS_pept        complement(65516..66610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0062"
FT                   /product="glycoprotease family protein"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45612"
FT                   /db_xref="GOA:A1UQZ7"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UQZ7"
FT                   /protein_id="ABM45612.1"
FT                   /translation="MRLLGIETSCDETATAVIEHNLKGKSHILSNIVWSQIEDHAPYGG
FT                   VVPEIAARAHVEILDTLILEALAKAKTTLKEIDAIAVTGGPGLIGGLLVGLMSAKALAF
FT                   ATGKPFIAVNHLEGHALTAVLTHQVTFPYLLLLVSGGHTQMILVHGVGNYQRLGTTFDD
FT                   ALGEAFDKTAKLLGLPYPGGPALEKAALLGDKNRIPLPRPLKGNKQLNFSFSGLKTAVR
FT                   QAATAMAPLSEQDVSDIAASFQAAVIDTLQDRVHLALQYFTSQYPSSHNQEHRPPAFVV
FT                   AGGVAANQAIRLTLQNLAHQHSFEFIAPPPSLCTDNAAMIAFAGAERIARGQTSPLDIA
FT                   PRSRWPLDENALPLIGTGRRGAKV"
FT   gene            66916..68352
FT                   /locus_tag="BARBAKC583_0063"
FT   CDS_pept        66916..68352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44518"
FT                   /db_xref="GOA:A1UQZ8"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ8"
FT                   /protein_id="ABM44518.1"
FT                   /translation="MGSVWLLKFLSFYYFIISNEREKETVMVDSSKPKENPHYKGVKRK
FT                   ASVIEHEEMRDDSEQKTQNLAESSALQESAVVKKQSKEKQKEKSRCSFSVALICLLISG
FT                   IVSVLTTLSLLIGFQRDGSLFPFLSRHNSATEQALQMAKTAQNQSEATERQLTHLLQEL
FT                   DLLKTDVSSVSQSVSLFEKEMSFKEEVGKNVADLERQVAVLEDKVQALVETSKDMEAVL
FT                   SSQNFEETQSNKILQEENKKTLTNLEQKVMLFEEHVKNSAEMSKDRSTSLTENNIENDV
FT                   MELKKQLNTLQENMATKSGEEKSVNMQMLTAVSALKNAVMRGGPFIDELKAVQKFFPEL
FT                   PGLDILQKKARTGFSNSRKLAHDFAAVADIIVGLQNIVAPEAGFFAQILTWMKGLFVTR
FT                   PIGDIAGTTMEAIVARMEAAIQEGNYEKALEEWEALPKNAQDASADFAKQLKQKLSVRN
FT                   ILQDLLTSIQQGRFETRKSK"
FT   gene            68364..69959
FT                   /locus_tag="BARBAKC583_0064"
FT   CDS_pept        68364..69959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032822.1; match to
FT                   protein family HMM PF07219"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45077"
FT                   /db_xref="GOA:A1UQZ9"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A1UQZ9"
FT                   /protein_id="ABM45077.1"
FT                   /translation="MIRVVVYSFAVCVLGALFGWVANHNSIVVITFLQTRFAISLLTLL
FT                   SVSIVLLVMLALVWWLLRGLFFAPNALRRYFSTRRQKKGREALSQGLLAVFSGDYVTAK
FT                   KMETCALKYLANNHEPLMKLLQAQTLFLQKDSIRAIGFYEEMRQETPTKLAGLYGLYRE
FT                   AVAMKEDEAAQHYAEEALALSPALLWAHQAVIDRLSAEGQWDKALDVFEKAQKALPRAD
FT                   RWTAERNYTYALLLSGQALQLFKTHPVKARTAILKAHKLLPDFVPITVITADILYKSNE
FT                   VRKADKIIFNAWKKEPHPDLGACYLKNEERAVERLKKAKKLASYNEDTFESAFLVAKAA
FT                   LDAGEVEFAREQAQKALQLHPRESVYLLLADIEEAQGNDQLLVRQWLSLALRAERDPTW
FT                   MCDGTLFSSWSAVSPISGRLGCFEWKAPPRSLPLTLEIDPIEPKDVGDVGPMVLKNVDP
FT                   VMAEKEEKEDVVTEITFVNDELLNEISPIKDGFLPQNSAKKKISNQTRLNVDDPGVKIA
FT                   ERDILSSKEQFRAL"
FT   gene            70042..70809
FT                   /locus_tag="BARBAKC583_0065"
FT   CDS_pept        70042..70809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0065"
FT                   /product="class I glutamine amidotransferase family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00117"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44559"
FT                   /db_xref="GOA:A1UR00"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR00"
FT                   /protein_id="ABM44559.1"
FT                   /translation="MFSVEQYLDHKQRGNKPKIAIVLHRPSGGIGHVGSFLQQSGFSLD
FT                   IYCPILGQKLPDTLEHHAGVVILGGPMSVNDRDAYIGEEIDWISLSLKENKPFLGICLG
FT                   AQMLARNLGGRIEARRDGYVEMGWYPLQVMPQGETMMDWPKMVYHFHNEGIYDLPKDVI
FT                   LLATGQTYPVQAFRYGDKAWGLQFHPELTRMMIRNLVVHLAKNLTQKGAQPASMHFEGY
FT                   SMYGQALHEWFKNVLQQIFSASSAFYTEAESHN"
FT   gene            complement(71085..75794)
FT                   /locus_tag="BARBAKC583_0066"
FT   CDS_pept        complement(71085..75794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0066"
FT                   /product="glutamate dehydrogenase, NAD-specific"
FT                   /note="identified by match to protein family HMM PF05088"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45117"
FT                   /db_xref="GOA:A1UR01"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR01"
FT                   /protein_id="ABM45117.1"
FT                   /translation="MSKQEILDIKKDPNEIESILFAHADEEDRARYKSSELQKAAKVAT
FT                   EALHQYRRGESTVCFEHTLTCNDKPITIVTLVNDNKPFLLDSILNVFNQQINKIYLIAH
FT                   PVLDCASEQRISLIQIHVEALNQQQTQKLKDEITLVLGQVNAAVQDWQPMLEQVKKCIH
FT                   AYQTNLPLNYQKEGAKTIEFLQWLMNNNFIFLGLRTYDFTEGQNPDKALNAGDIELGIL
FT                   TDASIRIIENAHMGESPQELLSFMESDALFTVTKANSRSKIHRFVRLDYIGLKIFNKAG
FT                   LLCGEMRIVGLFTSSAYTHSILTIPFLKEKAETIIQRLGYNRADHSGKALISVLETYPR
FT                   DEMFHSDVDTLTENAKLILQLDERPRLRVLAHADSFGRFVSVLVYVPRDQYGSSKREKI
FT                   GAYLVDIYEGDFFESYPLFLESTLIRIHYIVYRKSNQSAPVIERTTLEHAVREITRNWE
FT                   ETVQAVALAHKATDQQTHLASQFPNSYRDLFSAEDAINDAAHILNLNDQHPLFVTFYHT
FT                   HHKEKHTIALRLFHRHEALALSKRVPLLENMGFRVIAEQTLELPDSNGKYVYLHDMQLE
FT                   SSFQICVNLDENGLKLAETFEAVWAQNADDDAFNALTQTAQLDWREIVILRHYGRYIQQ
FT                   AGIPYSQERVAKTLNAYPHITQDLYALFHLKFHQSHTAEERQKNETIIQQRIEEKLQHV
FT                   PSLDDDLILRRYRNLIAASLRTNAFTPLADGSPRRILATKLDPRQIEGLPEPRPYREIF
FT                   VYGPEVEGVHLRFGPIARGGIRWSDRALDYRTEVLDLVKAQQVKNAVIVPVGAKGGFYP
FT                   HCLPQTDNRSVVVEAARQAYISYIAALLSITDNLVDGKVKAAPNVIRHDGDDPYFVVAA
FT                   DKGTATFSDTANAISQENHFWLDDAFASGGSAGYDHKAIGITAKGAWEAVKRHFRESFD
FT                   HDIQTKPFTCVGVGDMSGDVFGNGLLLSQQTKLIAAFDHRDIFIDPDPNAAESYAERMR
FT                   LFQLPRSSWQDYDQGKLSKGGGVFSRTAKTITLSREAAQAIGFEKQTGTPFEIITAILK
FT                   APVDLLWFGGIGTYVRATTETNAQVGDRTNDAVRITGEQVRAKVIGEGANLGLTQRGRI
FT                   EYILNGGRCNTDAIDNSAGVNCSDVEVNIKIVLASALQAKKLTRDARDALLKEMTPQVE
FT                   QLVLRNNYLQPLALSLAEKRGVLDLPYQARFINDLEKKNLLDRRVEILPDEQILRQRLA
FT                   QNQGLTRPELAVILAYAKLTLQEEIANNPIVDHHYFDSTLLGYFPTQLQTQFEQEIINH
FT                   QLRRHIIATLIANDIVNRGGPTFVNRLQDKTGQKVENIIRVFIAIRDGFEIPQLSNQID
FT                   NLDNKIPGLIQNKLYASITSMLFEATNWGLRHMDLSTPLEDLVKTIKQARTVIEEQLTH
FT                   SNGRDIHQKIAKKAASYCKEGAPKALAQHLALLEVASIICDISLIAKQNKSDLIQTAQI
FT                   YFSLAQIIHINRIDEASRAIPIFDYYDGMALSQAKENIAESLRQIVTKILQNYGEQNDP
FT                   LAVWIKTEENQIYTVTNRIGTLIEGDLNISRFTFAASMIAQLKNTTFQS"
FT   gene            76074..76730
FT                   /locus_tag="BARBAKC583_0067"
FT   CDS_pept        76074..76730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0067"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by similarity to SP:P42737; match to
FT                   protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44704"
FT                   /db_xref="GOA:A1UR02"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR02"
FT                   /protein_id="ABM44704.1"
FT                   /translation="MTLPEKLLKGHRSFMDNRFSHERGRYQQLAKEGQRPETLIIACCD
FT                   SRAAPETIFDACPGEIFVLRNVANLVPPFSPDDQYHATSAAIEFAVQFLEVKHIVILGH
FT                   GHCGGIRTVLDETCKPLSSDDFISRWMSLLAPAGKAVASNPWMTAKEQQTALEHISIRY
FT                   SLENLETFPWLKARKDEGLLKLHGAWFDISSGELWSMEQETGNFTRVESELLAQS"
FT   gene            76976..78523
FT                   /gene="ffh"
FT                   /locus_tag="BARBAKC583_0068"
FT   CDS_pept        76976..78523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="BARBAKC583_0068"
FT                   /product="signal recognition particle protein"
FT                   /note="identified by match to protein family HMM PF00448;
FT                   match to protein family HMM PF02881; match to protein
FT                   family HMM PF02978; match to protein family HMM TIGR00959"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45267"
FT                   /db_xref="GOA:A1UR03"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR03"
FT                   /protein_id="ABM45267.1"
FT                   /translation="MFESLQERLGSILSNLTGRGALSEQDVATALREIRRALLEADVAL
FT                   DVVRSFTDKVREKAVGSAIVKSIKPGQMVVKIVHDELVNMLGDESVLGDFNAPAPVVVM
FT                   LIGLQGSGKTTTTAKLAKRLTDKHNKKVLMASLDTRRPAAQEQLRQLGEQGKLASLPIV
FT                   PGQSAVDIAVRAVQAAKLGGYDVVLFDTAGRNHIDEALMLELAQIKASSLPHEILLVAD
FT                   SLTGQDAVHLARSFDERVGLTGIILTRMDSDGRGGAALSMRAVTGKPIKAIGIGEKMDA
FT                   LEEFHPSRIADRILGMGDIVSLVEKAAETLDHEKAMALAKKMQAGKFDLNDLADQLQKM
FT                   KQLGGMGGIMGMMPGLGKVKDQITAAGLNDGLLDRQLAIIGSMTREERLKPEILKHSRK
FT                   QRIAKGSGTSAADINKLLKMYRQMADMMKAMGGKGKSGLMGKMLGGLGSKMGLGGLGGT
FT                   GALPDFSGFDPKQLSALQKQVQNNSLSGGLPGFPGQGSEIPGLPKGKGIVPPSLKKK"
FT   gene            78953..79315
FT                   /gene="rpsP"
FT                   /locus_tag="BARBAKC583_0069"
FT   CDS_pept        78953..79315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="BARBAKC583_0069"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44631"
FT                   /db_xref="GOA:A1UR04"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR04"
FT                   /protein_id="ABM44631.1"
FT                   /translation="MALKIRLSRGGSKKRPYYHIVVADARSPRDGRFLERVGAWDPMLP
FT                   KDKPRVKLNEDRIQHWLNQGAQPTDRVLRFLDAAGLKKRPARNNPHKGEPGKKAQERIA
FT                   AAKQAAEDAKAAEASA"
FT   gene            complement(79464..79670)
FT                   /locus_tag="BARBAKC583_0070"
FT   CDS_pept        complement(79464..79670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_034294.1; match to
FT                   protein family HMM PF07896"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45177"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR05"
FT                   /protein_id="ABM45177.1"
FT                   /translation="MDNKISNDTACSRPNSSLSPAAQRALQEAAERRKREIHEKKPLES
FT                   GGRGGKDPARYGDWEIKGRAIDF"
FT   gene            79755..80786
FT                   /locus_tag="BARBAKC583_0071"
FT   CDS_pept        79755..80786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0071"
FT                   /product="peptidase, M48 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44460"
FT                   /db_xref="GOA:A1UR06"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR06"
FT                   /protein_id="ABM44460.1"
FT                   /translation="MNIMRTTMLLAFMTALFMGVGYLVGGGSGMVVALFIAGGLNFFSY
FT                   WNSDKIVLRMYGAREVDEHSSPVYYRIVTKLAQRASLPQPKVYIINNAQPNAFATGRDP
FT                   QNAAVAASTGLLKQLSAEEISGVMAHELAHIEHRDTLTMTLTATIAGAISMLGNFALLM
FT                   GMGRQRNSSGNSQGAGMLGTVIALFVAPFAAMLVQMAISRTREYAADRRGAEICGNPLW
FT                   LASALSKISGGGQTFYNEEAEHNPATAHMFIVNPLRGEGADSLFSTHPATENRIAALHK
FT                   QAEKMAKEGNKGTKFAVENGLYRKHGNLEDEDLNPEAQNGFTHNQKKKTVRRGKDRPTW
FT                   LRH"
FT   gene            80897..82267
FT                   /locus_tag="BARBAKC583_0072"
FT   CDS_pept        80897..82267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0072"
FT                   /product="putative ribosomal RNA small subunit
FT                   methyltransferase B"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM PF01189"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45685"
FT                   /db_xref="GOA:A1UR07"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR07"
FT                   /protein_id="ABM45685.1"
FT                   /translation="MFEKNVQGLAVRQVCVRLLGAVLDKHTSLSGLTDHEHGHPLYLKL
FT                   SYRDRLLCRAILIAALRHRGQIQAALSRFLTRPLPSKAFALQHLFHISAAQILYLDIPD
FT                   YAAIDLAVRAAKIDPRTRCFSGLVNAILRNFARDAMVLKRQALTFNEVPDWFWQLLVST
FT                   YGEEKAQRILAMQSETPPLDLTVKSDSEGWAKRLGGVVLSNGSVRLKALESSVVDLPGY
FT                   AEGAWWVQDVAAALPARFLGDIHGKRVADLCASPGGKTAQLALQGADVTAVDLSANRLK
FT                   RLTANMHRLNFSVSYWNGDVRNFHPEKLFDAVLLDAPCSSLGTIRRHPDILWIKSREDI
FT                   MKLAAVQYDLLLAAIAVVKKGGHIVFSNCSLAREEGEDLIEKVLATRDDVVLEPILENE
FT                   LGDMKHVLTVEGIVRTTPADFCGSVEFADFKSENFYAENKLLFGMDGFYAARLRKIA"
FT   gene            82335..84044
FT                   /locus_tag="BARBAKC583_0073"
FT   CDS_pept        82335..84044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0073"
FT                   /product="heparinase II/III-like family protein"
FT                   /note="identified by match to protein family HMM PF07940"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44945"
FT                   /db_xref="GOA:A1UR08"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR08"
FT                   /protein_id="ABM44945.1"
FT                   /translation="MAIAVRYPQLKAGAFFCRMLQVFWRLWVGPLFHWRFSRFRPQKIL
FT                   ARPIDLHVADPMMAHEFYHGRFSFAGRIVQSGSVSPFALTSPTLEWEAALHDFHWLRHM
FT                   TAARSQLAAAHARFLLEDWLNHSGKKIKGLPWSGGVVARRLIAWICHAHTLLEGASEQF
FT                   EKRFLNALGFQFRYLRVTICSMEHNDQRLQAAIALAFASLALPFSATMKKKVQTYLSRE
FT                   LAYQILVDGGHISRNPAIVFNLLPDLLSLRHLYMHSNETAPRILIDSVERMLPALRFFI
FT                   HEDQTLAHFNGVGPIAPECLSTILDFDETAGNLFSHARYSGFQRLNAHATTVIADTGEF
FT                   PPRSVAEHACSGCLSFEMSSERHRFIINAGVDPYGREEYRYFGRITAAHSTATLNDSSV
FT                   GVFRKIKNKTSSLLLKGPKNIQMQRIEDAKKIGFIACHDGYVRPFNLLHERGLILTTNG
FT                   TIIEGFDRFFMPNNDESKKYKSVHNESHNVAVRFHLHPKVEVSREDHFVYLAVGGRSVW
FT                   RFMSPDADIYIEDSIDFAELTGPQHTQQIVLYFRPAVQEKVRWRFTRIESKK"
FT   gene            84215..85831
FT                   /gene="purH"
FT                   /locus_tag="BARBAKC583_0074"
FT   CDS_pept        84215..85831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="BARBAKC583_0074"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="identified by match to protein family HMM PF01808;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM TIGR00355"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45521"
FT                   /db_xref="GOA:A1UR09"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR09"
FT                   /protein_id="ABM45521.1"
FT                   /translation="MVVVSQNYPTPDLHRVRRALLSVFDKTGLVEFAQELHAYGIELIS
FT                   TGGTSESLIAAGLPVKDVSEVTGFPQIMDGRVKTLHPLIHGGLLGVRDDPSHKAAMEKH
FT                   GICGIDLVVVNLYPFEKTWQSGADSQTIIENIDIGGPAMIRAAAKNHAYTGVVTAVSDY
FT                   DVVLAELKQHNGCLSFSLRRQLAARAYEHTAAYDAAIAAWFAQDLEVEMPSWQNFSGHF
FT                   ESMMRYGENPHQRAAFYRTRDTRFGVATAKVLQGKELSYNNMNDADAAFELVAEFDPQR
FT                   TAAVALIKHANPCGVAEGQSLKEAYLKALMCDSVSAFGGIVALNQPLDEECAAEIVKLF
FT                   TEVIIAPDATEAACNIIAQKKNLRLLITGGVPDPRCGGLTVKTLAGGVLVQSRDNAVVD
FT                   DFDLQIVTKRAPSQDEMRDLQFAFRVVKHVKSNAIVYAKNSATVGIGAGQMSRLDSARI
FT                   AVHKAEDNAKRMGLTESLTRGSVVASDAFFPFADGLISAAEAGVTAVIQPGGSIRDQEV
FT                   IEAADARGLAMVFTGVRHFRH"
FT   gene            85996..86148
FT                   /locus_tag="BARBAKC583_0075"
FT   CDS_pept        85996..86148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06568"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45335"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR10"
FT                   /protein_id="ABM45335.1"
FT                   /translation="MGILRSFKSWCRYRRTVKALNSLSTYDLNDVGINRGDIRSVAKRF
FT                   SRESF"
FT   gene            complement(86488..87294)
FT                   /locus_tag="BARBAKC583_0076"
FT   CDS_pept        complement(86488..87294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0076"
FT                   /product="SurF1 family protein"
FT                   /note="identified by match to protein family HMM PF02104"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44656"
FT                   /db_xref="GOA:A1UR11"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR11"
FT                   /protein_id="ABM44656.1"
FT                   /translation="MINRDHSIPKIPHKKVSLSSIFGGIFCAFFFLVFSALGIWQVQRL
FT                   NWKTNLIAHVNQRAHLPPVAAPSQDQWTDVTFDKDEYRPVIVTGKFLTDKNILVTAVSQ
FT                   NTTGYWVLTPLQTADNTLTFVNRGFIPMNARPQFDPEKLPQNNDLTPNSLALNNEQTTV
FT                   IGFLRMSERGGFFPRKNNPDQNLWYTRQLPAMAQKLDLSHVAPYFIDATQKIASQGNLP
FT                   IVGLTVIHFYNNHLIYAITWFTLAIGTLGIPFFLLRYKKTNSIPHK"
FT   gene            87569..87865
FT                   /gene="rpmB"
FT                   /locus_tag="BARBAKC583_0077"
FT   CDS_pept        87569..87865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="BARBAKC583_0077"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45210"
FT                   /db_xref="GOA:A1UR12"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR12"
FT                   /protein_id="ABM45210.1"
FT                   /translation="MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVMQQ
FT                   SYRLRISANAVRSVEHRGGLDNFLTKADDKELSQRARLLKRQIVKKKAEQAAA"
FT   gene            87990..88652
FT                   /locus_tag="BARBAKC583_0078"
FT   CDS_pept        87990..88652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0078"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF02592;
FT                   match to protein family HMM TIGR00697"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44956"
FT                   /db_xref="GOA:A1UR13"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR13"
FT                   /protein_id="ABM44956.1"
FT                   /translation="MSSSKRFLAKQHKSRHIIFASLAMCFAVTISNFLVQYPVYWFDLD
FT                   ELLTYGAFTYPLAFLINDLTNRFYGPTAARRVVYAGFIVGFFVSWVLVTPRLAIASSAA
FT                   FLFGQLLDIIVFTPLRRQTWWKAPLAAAITGSALDTVLFFAIAFASSFSFIDQTTGYVD
FT                   SSIIDHTMFFGFDIPVWLSLAFGDFSVKILMSLLMLVPYGTVISYFRTLPLSKEQEG"
FT   gene            complement(88851..90746)
FT                   /gene="cobT"
FT                   /locus_tag="BARBAKC583_0079"
FT   CDS_pept        complement(88851..90746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobT"
FT                   /locus_tag="BARBAKC583_0079"
FT                   /product="cobaltochelatase, CobT subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="identified by match to protein family HMM PF06213;
FT                   match to protein family HMM TIGR01651"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44581"
FT                   /db_xref="GOA:A1UR14"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR14"
FT                   /protein_id="ABM44581.1"
FT                   /translation="MASKASDNNSQNLKHHLPNSPLDSEAFKLDAEAFKRATSACMRAI
FT                   AGTPTLQTIFGHYKPSMSHTHARLPEIPPKATHKDVAVTRGLSDSMGLRKAWHDPHIHI
FT                   QFTPQEPKARAVFDALEQTRIEAIGTLTMEGMAQNLEIMLADKYQRAHYQRISTQDEAP
FT                   IEEAIALLLREKITKRSPPKEAGPVLDLWRHAIEQQAAAELQELTHHLHNQKAFARVVR
FT                   HMLFALKISSALDDVSDDTNVKKQIKEGDTHAQIDEEYNEKAKYAQSEEQKTTEQTNDV
FT                   QDEGKAHATQSSTDESIEQEQTSIWQKKPSELKHTLHTSESMQKLADYKIFTQQFDEVL
FT                   EATDFCSESELNHLRHLLDQQLNHLQNIVGRLANRLQRRLMAQQNRAWHFDLEEGYLDT
FT                   ARLPRLIIDPMYPLSFKKEYETQFRDTVVSLLIDNSGSMRGNPITVAASCTDILAQTLE
FT                   RCGVKIEILGFTTKAWKGGQSREEWEKQNKPPHPGRLNDLRHIIYKSADTPWRRARRNL
FT                   GLMMQEGLLKENIDGEALIWAHQRLLSRHEHRRILMVISDGAPVDDSTLSVNPGNYLEK
FT                   HLCAVIQEIQTYSPIELTAIGIGHDVTRHYKRAITIPNAEELANAIIQQLATLFD"
FT   gene            complement(90761..91747)
FT                   /gene="cobS"
FT                   /locus_tag="BARBAKC583_0080"
FT   CDS_pept        complement(90761..91747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobS"
FT                   /locus_tag="BARBAKC583_0080"
FT                   /product="cobaltochelatase, CobS subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="identified by match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01650"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45467"
FT                   /db_xref="GOA:A1UR15"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR013615"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR15"
FT                   /protein_id="ABM45467.1"
FT                   /translation="MTQTNLANKNMPDITLCVRDIFKIDTDMQVPAFSQKSPHVPDVDP
FT                   DYLFDPQTTLAILAGFAFNRRVMVSGYHGTGKSTHIEQVAARLCWPCIRVNLDSHVSRI
FT                   DLVGKDAIVIKDGLQITEFQEGILPWAYQNNVALVFDEYDAGRPDVMFVIQRVLETSGR
FT                   LSLLDQSRVITPHPAFRLFATANTIGLGDMTGLYHGTQQINQAQMDRWSIVTLLNYLSH
FT                   DHEVDIISAKVKSFQTAEGKKIISKMVHVAHMVRQAFMNGDLSTVMSPRTVITWAENTE
FT                   IFQNVGFAFRLTFLNKCDELERATVAEFYQRAFGEELPESLIHTVLP"
FT   gene            complement(92015..92635)
FT                   /locus_tag="BARBAKC583_0081"
FT   CDS_pept        complement(92015..92635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0081"
FT                   /product="DnaJ domain protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45018"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR16"
FT                   /protein_id="ABM45018.1"
FT                   /translation="MTITSKLFDSIRISSNKKRQAELETQKCQWESCEKTGTHKAPAGR
FT                   NREGQYLFFCIDHVRAYNKNFNYFSGLSDKDIAQFQKDALTGHRPTWSSGLNNSTSKKA
FT                   AAHYATIRSGTAAYQNRIRDPFSLFNKRHAAKTNTRKLKPLEAKAFETLGLQADASAQD
FT                   IKVKYKELVKKHHPDTNGGNRSSEERFSDVLNAYNLLKKSGLC"
FT   gene            92751..93029
FT                   /locus_tag="BARBAKC583_0082"
FT   CDS_pept        92751..93029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0082"
FT                   /product="BolA family protein"
FT                   /note="identified by match to protein family HMM PF01722"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45557"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR17"
FT                   /protein_id="ABM45557.1"
FT                   /translation="MSTEVQKRIETKLCEAFCPQKLEVINESHLHAGHHHGNHAFDGQG
FT                   ETHFRVKILSSSFANMTRVEIHRAIYKVLQKELTENIHALALEVEGM"
FT   gene            complement(93072..94040)
FT                   /gene="xerC"
FT                   /locus_tag="BARBAKC583_0083"
FT   CDS_pept        complement(93072..94040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="BARBAKC583_0083"
FT                   /product="tyrosine recombinase xerC"
FT                   /note="identified by match to protein family HMM PF00589;
FT                   match to protein family HMM PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45212"
FT                   /db_xref="GOA:A1UR18"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR18"
FT                   /protein_id="ABM45212.1"
FT                   /translation="MPPKNDSRKGQNISLVPADDAVLAARQSWLESLLHIHRMATRTVE
FT                   AYERDTRQFLFFLCQHLGRKPTYHDLADLQVADLRSYMAYRRKQMVSTRSLSRNMASMR
FT                   SFFNYLSRENLVDVPAAKLVRTPKYAKSLPKTLTMKAALTIVKQGNQQEDEPWIAARNA
FT                   AVLTLLYGCGMRISEALALTPKQFSDPNVTSLSIVGKGGKTRLVPLIKTVYESVETYLK
FT                   CCPYPLGDNQPMFRGARGGPLQPAIIQRAVQNLRASLGLPKTATPHALRHSFATHLLSR
FT                   GGNLRIIQELLGHASLSTTQVYTEIDSDRLLDIYQKAHPRA"
FT   gene            complement(94043..94864)
FT                   /locus_tag="BARBAKC583_0084"
FT   CDS_pept        complement(94043..94864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0084"
FT                   /product="SapC family protein"
FT                   /note="identified by match to protein family HMM PF07277"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44478"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR19"
FT                   /protein_id="ABM44478.1"
FT                   /translation="MANVMLFYKNIIPLNKVTHKNLKFNNLNNMSFAKNTHWLPLASSE
FT                   YFQAALDYPILFMSAQDEQQKRHYTSIALVGLSNEENDFITADKTWQQNMYIPAFVRRY
FT                   PFILAQIHNEKELSVCFDQQPGTFNEVEGTNLFNSDGSLSPFMEERIHFLESFKIAMEK
FT                   TAEFTDALVEMNLFSQKTIHIKNDKGVSAQLEDFWIVDEEKLNKLSAHQLAKLHKNGFL
FT                   GLIFAHLMSMNNLVKILSRKIENQTSHPVQQNKQDDHAYDTKSEQNRKILN"
FT   gene            94994..95569
FT                   /gene="rimM"
FT                   /locus_tag="BARBAKC583_0085"
FT   CDS_pept        94994..95569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="BARBAKC583_0085"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45319"
FT                   /db_xref="GOA:A1UR20"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR20"
FT                   /protein_id="ABM45319.1"
FT                   /translation="MEHNKKELNKAVLLAVIRAAHGIRGDVVVNLLGAEPQRLKTYGVL
FT                   YDDKGRLYEIVSMRVHKNNVIVRFKGVDDRSTAEALKGVQLYIERDQFADDLDTDEFYQ
FT                   IDLIGLRVYDNTNQLLGEVSGFFNFGAGDLLEVRLISHKTELIPFSKAAVPEICVASGF
FT                   LVVDPVAAGLFSDPHSFNDLALNDLEKG"
FT   gene            95619..96317
FT                   /gene="trmD"
FT                   /locus_tag="BARBAKC583_0086"
FT   CDS_pept        95619..96317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="BARBAKC583_0086"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44575"
FT                   /db_xref="GOA:A1UR21"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR21"
FT                   /protein_id="ABM44575.1"
FT                   /translation="MTFQAHVVTLYPEMFPGVLGHSLAGRALERGIWSLNTVQIRDFAL
FT                   DKHHSVDDTPAGGGAGMVMRADVLVAAIDHCPPDLPRILLSPRGRPFNQAHARSLASDR
FT                   GVVLVCGRFEGVDERVLQARKLEEISIGDYILSGGETAALVLLDALVRLLPGVMGNQAS
FT                   GECESFENGLLEHPHYTRPPVFEGLEIPLVLTSGHHKAIADWRQEQAEMLTQKRRPDLY
FT                   AIYNKNRRKT"
FT   gene            96523..96963
FT                   /gene="rplS"
FT                   /locus_tag="BARBAKC583_0087"
FT   CDS_pept        96523..96963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="BARBAKC583_0087"
FT                   /product="ribosomal protein L19"
FT                   /note="identified by match to protein family HMM PF01245;
FT                   match to protein family HMM TIGR01024"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45565"
FT                   /db_xref="GOA:A1UR22"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR22"
FT                   /protein_id="ABM45565.1"
FT                   /translation="MNIIAQLEAEQCAKIAEKRQLPAFQVGDTVRVMVRVTEGTRTRVQ
FT                   AYEGVCIARSGYGFNENFTVRKISYGEGVERVFPFYSPLIEGVELVRRGKVRRAKLYYL
FT                   RALRGKAARIAEKRDYRKKNVQIVEEEVAPAVEANVETTTAE"
FT   gene            97559..97960
FT                   /gene="sdhC"
FT                   /locus_tag="BARBAKC583_0088"
FT   CDS_pept        97559..97960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="BARBAKC583_0088"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="identified by match to protein family HMM PF01127;
FT                   match to protein family HMM TIGR02970"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45036"
FT                   /db_xref="GOA:A1UR23"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR23"
FT                   /protein_id="ABM45036.1"
FT                   /translation="MTEIITMKDRPRSPHVTIYRWSITMAMSIAHRITGIAIYFGISLL
FT                   AIWLMAIACGESAFKTVNEIYGSFFGLCVLFLCTFAGVHHMVGDIRHLIGELKPCLLDK
FT                   KQANFIAWANIFISFSATVVIWVIGYSVA"
FT   gene            97979..98365
FT                   /gene="sdhD"
FT                   /locus_tag="BARBAKC583_0089"
FT   CDS_pept        97979..98365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="BARBAKC583_0089"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="identified by similarity to GB:AAC17941.1; match to
FT                   protein family HMM PF01127; match to protein family HMM
FT                   TIGR02968"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45589"
FT                   /db_xref="GOA:A1UR24"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR24"
FT                   /protein_id="ABM45589.1"
FT                   /translation="MKKNLRTELGKVRGLGSAHKGTEHFWVQNLTSWINIPLLIFFIIL
FT                   MISLAGEDYSTIHARLSHPVILVFMVLTVFSNLYHMKLEMQVVIEDYIPHKIIRMFFLI
FT                   LNISYCCLIGSLIIFALLKIALGV"
FT   gene            98370..100217
FT                   /gene="sdhA"
FT                   /locus_tag="BARBAKC583_0090"
FT   CDS_pept        98370..100217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="BARBAKC583_0090"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by similarity to SP:P31038; match to
FT                   protein family HMM PF00890; match to protein family HMM
FT                   PF02910; match to protein family HMM TIGR01812; match to
FT                   protein family HMM TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44799"
FT                   /db_xref="GOA:A1UR25"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR25"
FT                   /protein_id="ABM44799.1"
FT                   /translation="MASKKASSRGTKAKNAPYRYVDHEFDVVVVGAGGAGLRATLGMAE
FT                   QGLKTACITKVFPTRSHTVAAQGGIAASLGNMGPDNWQWHLYDTVKGSDWLGDTDAMEY
FT                   LVRNAPAAVYELEHYGVPFSRTQEGKIYQRPFGGHTTEFGEGPPVQRTCAAADRTGHAI
FT                   LHTLYGQSLKHNAQFFIEYFALDLIMTDGVCTGVVAWNLDDGTIHRFAAKMVVLATGGY
FT                   GRAYFSATSAHTCTGDGGGMVARAGLPLQDMEFVQFHPTGIYGSGCLITEGARGEGGYL
FT                   INSEGERFMERYAPSFKDLASRDLVSRCITLEIREGRGVGAKKDHIHLVLHHIDPAILH
FT                   ERLPGISESARIFAGVDVTKDPIPILPTVHYNMGGIPTNYHGEVLNPTPDSPDHVQPGL
FT                   MAVGEAGCASVHGANRLGSNSLIDLVVFGRAAAIRAGEVIDRDAKIPPINEEAVDKIMA
FT                   RFDKLRFANGHIPTAELREKMQRTMQEDAAVFRTSDSLKQGCQRISKVWEQLFDLKVTD
FT                   RSMIWNSDLVETLELENLMANAVTTVYSAEARLESRGAHAREDYPERDDKEWRRHTLAH
FT                   LSKDGKVTLSYRPVHVDPLTAEEDGGIDLKRIVPKKRVY"
FT   gene            100233..101012
FT                   /gene="sdhB"
FT                   /locus_tag="BARBAKC583_0091"
FT   CDS_pept        100233..101012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="BARBAKC583_0091"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="identified by similarity to SP:Q59662; match to
FT                   protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44437"
FT                   /db_xref="GOA:A1UR26"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR26"
FT                   /protein_id="ABM44437.1"
FT                   /translation="MVQIKLPKNSQVKAGKVWPRPEGAKQLTEFQIYRWSPDDDENPRL
FT                   DTYYVDRSACGPMVLDGLLFIKNHIDPTLTLRRSCREGICGSCAMNIDGTNTLACTKGM
FT                   DDVKHPIKVYPLPSMPVVKDLVPDLKHFYAQHRVIEPWLQTVSPEPAKEWLQSHADRQK
FT                   IDGLYECILCACCQTSCPSYWWNGDRYLGPAILLQAYRWIADSRDEMRGERLDNLEDPF
FT                   RLYRCHTIMNCMQTCPKGLNPAKAITEIKKLMLERRL"
FT   gene            complement(101601..102848)
FT                   /locus_tag="BARBAKC583_0092"
FT   CDS_pept        complement(101601..102848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0092"
FT                   /product="ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /EC_number="1.14.13.-"
FT                   /note="identified by match to protein family HMM PF01494;
FT                   match to protein family HMM TIGR01984; match to protein
FT                   family HMM TIGR01988"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44941"
FT                   /db_xref="GOA:A1UR27"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR27"
FT                   /protein_id="ABM44941.1"
FT                   /translation="MISSDVNENTQYCDLLIAGGATVGLTLAVALKQTAPELRINIVDA
FT                   LSQKNTSSKNIQALAITASSIRMFEQLRCWKSIKPHAQPIHSMIITDAHPNDPIKQSFL
FT                   TFEGDVAPNEAFAAVIEHEKLINSLRKRAKDLQIPFIENVSVVDFHLKDQHMAVTLSNG
FT                   DIWQTQLLIAADGARSKLREKAGLKSFSHLYQQTAILCTVDHEKPHHGQAIQHFFPAGP
FT                   FALLPLQGNRSAIVWTEDHQTAQYYLKAEAPLFVVELEKRMGSYFGKISWDGERQGFPL
FT                   ALSLARDCITPRFALIGDAAHTIHPLAGQGLNLGLHDSAALAQIIIETARLGLDIGSIV
FT                   ALERYQSWRRPKIVRMAFSNDWLNKLFSNDTFVLRTFRDIGLGLVNQMPKIKQKIIQEA
FT                   AGLTPNMPRLLQGLPL"
FT   gene            103019..105439
FT                   /locus_tag="BARBAKC583_0093"
FT   CDS_pept        103019..105439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0093"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44650"
FT                   /db_xref="GOA:A1UR28"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR28"
FT                   /protein_id="ABM44650.1"
FT                   /translation="MHQDSSSHDLSANQYGQSSRLVKILLYQIGAFIGLVLFSLIIFCV
FT                   VSLATWNVADPSLTRANMHKITNLMGRPGAVFSDLFMQFFGLASLCVLLPPFFWSLLLM
FT                   VYKDIQNFMVRLCWWVVSIICLSAFFSLMTPLASWTHWPLPIGLGGVVGDKVIQITFSL
FT                   FPALPSFLQYVLWGCFFVFSGFLTAVLAGNVVWRNKNNKRKKTPRVKAVEPIFDMPEEV
FT                   EHTANETRLNFFATIFGAILHLFYYLQACCSRLFLLSRKSDKKNKILNRVEPVFYDEDK
FT                   EPDHKKVPVSASKSSVKSIKVSSKGNFTLPLLDYLAISPPAEKSAKPSAKALKENSREL
FT                   EAILLDFGVKGKIIDVRPGPVVTLYEFEPAAGIKSSRIIGLADDIARSMRAISARVAVV
FT                   PGRNVIGIELPNATREMVYLRDILQSQEFLHSKAKLVLALGKTIGGETVIADLAKMPHL
FT                   LVAGTTGAGKSVAINTMILSLLYRMTPEQCRLIMVDPKMLELSVYDGIPHLLTPVVTDP
FT                   KKAVIALKWAVREMEERYSKMSKMGVRNIDSFNARLKEAENQGETLTRTIQVGFDHDTG
FT                   QPLHETETLHLSPMPYIVIIIDEMADLMLVAGKEIEGAVQRLAQMARAAGIHVIMATQR
FT                   PSVDVITGTIKANFPTRISFFVSSKIDSRTILGEQGAEQLLGQGDMLFMMGGGRIQRVH
FT                   GPFVADNEVEQVVAHLKTQAQPDYLETITQETTDQNTNVTLDSSSENDPYTQAVAVVLR
FT                   DRKASTSYIQRRLGIGYNRAASLIERMEEEGIISPANHAGKREILVPPEQEIL"
FT   gene            105736..106368
FT                   /locus_tag="BARBAKC583_0094"
FT   CDS_pept        105736..106368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0094"
FT                   /product="LolA family protein"
FT                   /note="identified by match to protein family HMM PF03548"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45261"
FT                   /db_xref="GOA:A1UR29"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR29"
FT                   /protein_id="ABM45261.1"
FT                   /translation="MKVPCLSLNRILVVSGILYFVLLLFPAFSQSAHQVARAQVIANHF
FT                   AAIKTMTGDFVQFSPKGKKTKGTFYLERPGKVRFTYQGVPLQIMADGQSVGIQNRALNT
FT                   WDLYQLSQTPMKLLLGDTIDISSENLLAFRQDSRAIEIILRDKSLGKGQIKMIFDANTY
FT                   ALLQWTIVDQQNLETTVQVMNVRTGVRFAEDMFTIPYQNIAMSRHRN"
FT   gene            106374..107189
FT                   /gene="xth1"
FT                   /locus_tag="BARBAKC583_0095"
FT   CDS_pept        106374..107189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth1"
FT                   /locus_tag="BARBAKC583_0095"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44889"
FT                   /db_xref="GOA:A1UR30"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR30"
FT                   /protein_id="ABM44889.1"
FT                   /translation="MFFRIATWNINSIRFRFEQVLRYLELCAPDILCLQETKCLDNLFP
FT                   REVFLSAGYKHIALNGQKAYHGVAILSRLPFVSVEKRFFCQKEECRYLSVVVKPYQQAI
FT                   RIHNFYVPAGGDEPDVQVNEKFRHKLDFLEEMSSIRADQGDGLSSLLMGDLNIAPLEDD
FT                   VWSHKQLLNVVSHTPIETERLKALCHEGGWVDLMRMKFPVPIKLYTWWSYRARDWALAD
FT                   RGRRLDHIWSSPDLAPFVEDLSIFREARGWSKPSDHVPVQSVFNFSRKV"
FT   gene            107648..108847
FT                   /locus_tag="BARBAKC583_0096"
FT   CDS_pept        107648..108847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0096"
FT                   /product="putative macrolide-specific efflux protein MacA"
FT                   /note="identified by similarity to GB:AAV85981.1; match to
FT                   protein family HMM PF00529; match to protein family HMM
FT                   TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45448"
FT                   /db_xref="GOA:A1UR31"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR31"
FT                   /protein_id="ABM45448.1"
FT                   /translation="MRFSSIIQSIIKLIKKRKKLSFFGGVFLFIIFISTINSFFSTDTP
FT                   IYMTAVVKRGDIEDTVLASGLVRPYRLVAVGARVTGRVVAMHVTPGAIVQEGDLLAEID
FT                   STDQENDLKRKKSVLSNSQARLAEQESYLQQAQETLKRQEGMIKEHAISRVNFDDAVVQ
FT                   VKIREAQVAQLQEQVAQARIDVDSAEVNLSYTRVTAPAKGTVLATVVEEGQNINASQSA
FT                   PTIVILGDLSKMTIKAQISEADILKVRAGQPLYFKVLGNPQRRYEGKLETVEPAPESIR
FT                   MDESINPGMGTSSALSSSAVYYNALVHVDNEDNFLRTYMTAQMHIILDSAKDVLLVPSD
FT                   ALHDETQEREAWVQVLVGANKVVKKQVVVGINNRVMAEIVSGLDEGDIVIIGSRDGLQA
FT                   "
FT   gene            108876..110882
FT                   /gene="macB"
FT                   /locus_tag="BARBAKC583_0097"
FT   CDS_pept        108876..110882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="macB"
FT                   /locus_tag="BARBAKC583_0097"
FT                   /product="macrolide-specific ABC-type efflux carrier MacB"
FT                   /note="identified by similarity to SP:P75831; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44873"
FT                   /db_xref="GOA:A1UR32"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR32"
FT                   /protein_id="ABM44873.1"
FT                   /translation="MRTEGVDAVLVLEDVMREFQAGETSVPVLKNINLTIRRGEMVAIV
FT                   GASGSGKSTLMNILGCLDRPTSGRYWVSGKEIASLSVDELSALRRNHFGFIFQRYHLLG
FT                   ALTALGNVEMPAIYARCAPGVRKIRAQSLLTRLGMSDRMEHYPNQLSGGQQQRVSIARA
FT                   LMNNADIILADEPTGALDSQSGEEVLRILGELHREGHTIIIVTHDMRVAERAERIIEIR
FT                   DGEIIADNVSSVQKIQKEEDKITDDAQFFNTVDSVHTNKQLGFVRFFVDLFREAFMMAL
FT                   LAMNAHRMRTFLTMLGVIIGIFSVVTMVALGTGTQQQLLETFKGMGTNTLTIMPGKDIS
FT                   DKQSGKITSLVEADAEALSQLPYVAGVTPQIAANSTVNYDSIEVNSMVMGVGEQFFLTQ
FT                   GFKLVEGQIFDRQSVHDRAVDLVIEKEAIALLFPHSDESPIGKIVLVGRVPARIIGVVK
FT                   PAQESHSVSNTIQIYMPYTALQTRFLGTTEVRAIMLKIADHVDTKLAEEAVERFLTGRH
FT                   GQKDFFIRNSASFIEQIMTGTRIVTALITSIATISLIVGGIGVMNIMLVTVAERISEIG
FT                   VRMAVGARQSDILHQFLIEAILVCAVGGGIGISLGLFLGGLFTFFNSPIHFMYTPSSII
FT                   IAFVFSAFIGICFGFFPARKASQLDPIVALARD"
FT   gene            complement(111411..112019)
FT                   /locus_tag="BARBAKC583_0098"
FT   CDS_pept        complement(111411..112019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0098"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02698"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45464"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR33"
FT                   /protein_id="ABM45464.1"
FT                   /translation="MKFFKHLFRYCPPVAFCLLSLFLIMGTHFVIFSEKVEQLYPPVSL
FT                   SKADAIIVLTGGERRIETGLRLLKQGLGSRLLISGVNATFHPKRLLRNMHIDPQLFECC
FT                   VDLGYQATNTKSNAEESAVWIKKHHYKTLYIVTHDYHIARSLLELRYLMPDINFIAYPI
FT                   KENVTQNKVKQLNKIRMLASEYIKNIGFQIRSVFQSAQN"
FT   gene            complement(112169..113143)
FT                   /locus_tag="BARBAKC583_0099"
FT   CDS_pept        complement(112169..113143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0099"
FT                   /product="FtsX family protein"
FT                   /note="identified by similarity to SP:P44872"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44557"
FT                   /db_xref="GOA:A1UR34"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR34"
FT                   /protein_id="ABM44557.1"
FT                   /translation="MNKSLRTFGLQKAIFKHDKATRSPIVPNSDISGQALVAVIAIMTF
FT                   LSSLTLNCVDLVQRTAHNWSNQISHEATIQIHPVDTIDIEQNLRNAVQLVKTFHGVQNA
FT                   IIMGQAATEKLLEPWFGTDLALDQLPLPRLIIVTLKNNENIDFHAISEAIKTKIPGGRF
FT                   NDHRSWVHHFTKMAHTTVFIGFVLLTLVLGSLMLTIIFATRNALAENSHIIHVLYFIGA
FT                   EPHFIAKQFDRHFFKTALRGAFHGGVASLVLFHIFSFWTHHNLGTAESEQITALFGYVS
FT                   ITFTTYGKIFSLILVVSLLTMLTSRITILTQLKKINQSENSLF"
FT   gene            complement(113136..113795)
FT                   /gene="ftsE"
FT                   /locus_tag="BARBAKC583_0100"
FT   CDS_pept        complement(113136..113795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="BARBAKC583_0100"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to GB:AAK20881.1; match to
FT                   protein family HMM PF00005; match to protein family HMM
FT                   TIGR02673"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44943"
FT                   /db_xref="GOA:A1UR35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR35"
FT                   /protein_id="ABM44943.1"
FT                   /translation="MIRFENVGLRYGMGPEILRDMSFHIPRGSFQFLTGASGAGKTSLM
FT                   RLMFFAIKPTRGHIDLFGKDTALLKEKELPALRKRIGVVFQDFHLLNHLTAYENVSLPL
FT                   RIKGQEEATYRSEVEDLLKWVGLSNQIHVLPPVLSGGEKQRVAIARAIIDQPEILLADE
FT                   PTGNVDLPIAKRLLRLFIELNRFGTAVIIATHDVSLMEQVEARRMILHEGRMTIHE"
FT   gene            complement(113949..115907)
FT                   /gene="acsA"
FT                   /locus_tag="BARBAKC583_0101"
FT   CDS_pept        complement(113949..115907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="BARBAKC583_0101"
FT                   /product="acetate--CoA ligase"
FT                   /EC_number="6.2.1.1"
FT                   /note="identified by match to protein family HMM PF00501;
FT                   match to protein family HMM TIGR02188"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44660"
FT                   /db_xref="GOA:A1UR36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR36"
FT                   /protein_id="ABM44660.1"
FT                   /translation="MSERIYPIPVDIEKNALIDQDTYQKWYQKSIEDPTSFWGEHGQRI
FT                   EWFKPYTKVKNASFNDNVSIKWYEDGITNVAYNCIDRHLKDRGNEIALIWESDNPYSDK
FT                   KITYNELYEHVCRFANILKNHGVKKGDRVSIYLPMIPEAAYAMLACARIGAIHSVIFAG
FT                   FSSEAIAGRLIDGQSTFIITADHALRGDKTIPLKDNVDRAIHIAACQNVNVTQVMVIRR
FT                   TSKIIHWVNGRDFWYHEEMPHATPDCPPEHMNAEDPLFILYTSGSTGKPKGVLHTTGGY
FT                   LVYASMTHQYVFDYHPGEIYWCTADIGWITGHSYLVYGPLCNGATTLMFEGSPTFPDEG
FT                   RFWEIVDKHKVNIFYTAPTAIRALMGAGDSFVKRSQRTSLRLLGTVGEPINPEAWKWFY
FT                   HTVGDSRCPILDTWWQTETGGHIITPLPGATKLKAGSATHPFFGIQVQLVDPQGNILKG
FT                   EAEGNLCIVDSWPGQMRTLYNNHQRFVETYFSTYKGKYFTGDGCKRDKDSYYWITGRVD
FT                   DILNISGHRLGTAEIESALISHPAVSEAAVVGYPHPIKGQGIYSFVTLMAGTQPSATLH
FT                   QNLIQHVRQEIGSIATLDKIQFAPHLPKTRSGKIMRRILRKIAANNFDNLGDISTLAEP
FT                   QIVDNLIANRQNIEEAA"
FT   gene            complement(116070..116750)
FT                   /locus_tag="BARBAKC583_0102"
FT   CDS_pept        complement(116070..116750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0102"
FT                   /product="conserved hypothetical protein TIGR00044"
FT                   /note="identified by match to protein family HMM PF01168;
FT                   match to protein family HMM TIGR00044"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45124"
FT                   /db_xref="GOA:A1UR37"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR37"
FT                   /protein_id="ABM45124.1"
FT                   /translation="MSEMHATSIEAWKNTKQEIANSCKEYQRSLDSVELIAVSKTVPAD
FT                   KIIPLLQAGQSCFAENRVQEAAEKWPYLRQQFSPIELHLIGPLQSNKTAEAVKIFDVIQ
FT                   TVDREKIAKSLSEEMHKQKKHFPCYVQVNIGLEPQKSGLAPEDVVDFVAHCKNHYGLDI
FT                   VGLMAIPPIEDNPGPYFALLAKLAKKSGLTKLSMGMSNDFQTALQFGSNVLRIGSALFG
FT                   QRPS"
FT   gene            complement(116767..116898)
FT                   /locus_tag="BARBAKC583_0103"
FT   CDS_pept        complement(116767..116898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0103"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44926"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR38"
FT                   /protein_id="ABM44926.1"
FT                   /translation="MREIHATSIEAWKNINKRLLRAVKISKIPSCKDKLNSLDLEKN"
FT   gene            117102..119729
FT                   /gene="leuS"
FT                   /locus_tag="BARBAKC583_0104"
FT   CDS_pept        117102..119729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="BARBAKC583_0104"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00396"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45658"
FT                   /db_xref="GOA:A1UR39"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR39"
FT                   /protein_id="ABM45658.1"
FT                   /translation="MTIERYNPRAQEQKWQAIWDEKKIFQTSHEDEGEKYYVLEMFPYP
FT                   SGRIHMGHVRNYTMGDVVARYKRAKGMNVLHPMGWDAFGMPAENAAMQNKVHPKAWTYQ
FT                   NIAAMRKQLQKLGLSIDWSREFATCDVDYYHRQQMIFLDLYQKGLVVRKVAKVNWDPVD
FT                   QTVLANEQVIDGRGWRSGALVEQRELTQWFFKITEFGEGLLARLDDLTEWPDKVRVMQK
FT                   NWIGKSQGLYIRWALDKTQLPHNDGCEGFDEITCYSTRPDTLFGASFLALSVDHPVAQA
FT                   LARNDEELRAFIEMCRCGSTTTEALETAEKQGFRTGVLAVHPLNPAVRLPVYIANFVLM
FT                   DYGTGAIFGCPAHDQRDLDFARKYDLPVQIVVAPKEAEEQDFTLSDTAYTGDGVMINSD
FT                   FLNGLTPKDAFEVVAQHLEKQVLNGQPQGQKTVQFRLRDWGVSRQRYWGCPIPMIHCAA
FT                   CGVVPVPRADLPVVLPEDVTFDRPGNPLARHETWQTVACPSCGQPAKRETDTMDTFVDS
FT                   SWYYARFTAPWAQEPTDQDIAAQWLPVQQYIGGIEHAILHLLYARFFMRAMKLAGHVNA
FT                   DEPFTGLFTQGMVVHETYRDAQGWVAPDEVSIVEQDGKRRAYKLTDQSEVTIGSIEKMS
FT                   KSKKNVVDPDDIISSYGADTARWFMLSDSPPERDVIWSESGIEGAHRFVQRVWRCVALS
FT                   APILSTIEPCAGHQGEALELSKAAHRTLCAVEDDLEKLAFNRAVARLYEFLNIMAPLLN
FT                   TVADLDDEMKSALRQAMDFFCAMIAPMMPHLAEECHAALGGKTLMSECAWPVYDKALIV
FT                   EDSVTLPVQINGKKRGDVTVPVTADQAEIEQAVLALSFVQAQLAGKSVKKMIIVPKRIV
FT                   NVVL"
FT   gene            119758..120294
FT                   /locus_tag="BARBAKC583_0105"
FT   CDS_pept        119758..120294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45386"
FT                   /db_xref="GOA:A1UR40"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR40"
FT                   /protein_id="ABM45386.1"
FT                   /translation="MLALLCGCTIEPLYRQAPQSSTVMGSGFAGRAEEVPAGLAAKLAM
FT                   IVVDEPSDRFSQMVRNHLLFLMHGGGGKPATPKYQLSLYTSVMTRTSLPVESDPRTGRT
FT                   WRFSVGTVVGRASYSLKDMKDNVIAQGKGTLRASFDRPHQEYATLQAEKDAEKRVATEL
FT                   AEQIFMRLAKDLAKL"
FT   gene            complement(120668..121321)
FT                   /locus_tag="BARBAKC583_0106"
FT   CDS_pept        complement(120668..121321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0106"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00875"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45436"
FT                   /db_xref="GOA:A1UR41"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR41"
FT                   /protein_id="ABM45436.1"
FT                   /translation="MKFFVDSANCEDIQELQNLGLVDGVTTNPSLILQSGRNILDVIQE
FT                   ICSLVEGPVSAEVAATDFDTMMKEAAVLAKIANNICIKLPITLDGLKACKALSEQELKT
FT                   NLTLCFSATQALLAAKAGATFVSPFIGRIDDCGTNGIDLLHEIRTIYDNYGFATQILAA
FT                   SIRTTTHVKEAALSGADVATVPPKVLKSLAAHPLTDKGLQTFLTDWAKTGQKIA"
FT   gene            121399..121563
FT                   /locus_tag="BARBAKC583_0107"
FT   CDS_pept        121399..121563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0107"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44817"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR42"
FT                   /protein_id="ABM44817.1"
FT                   /translation="MLPAKTRDESIIIGGKVYEIDLKGSVGKSLLSRIAQRLLKDHVGS
FT                   LKGIAPRVV"
FT   gene            121855..124092
FT                   /gene="priA"
FT                   /locus_tag="BARBAKC583_0108"
FT   CDS_pept        121855..124092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="BARBAKC583_0108"
FT                   /product="primosomal protein N'"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851; match to protein family HMM TIGR00595"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44545"
FT                   /db_xref="GOA:A1UR43"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR43"
FT                   /protein_id="ABM44545.1"
FT                   /translation="MQEQKVKSNGPEIKSVSVLVPLPVSHAYHYRVPSSMTVEVGSFVR
FT                   VPVGGRTLCGFVVSLDEQTCENEQEGCPVSPDKLRFIECVFDCPPLKAEMIAFLRFVSS
FT                   YTMTPFGLAARLVLRVPAALEREEPMMGLRYCGGEVHRLTPARSRVLELARKGMVWTRS
FT                   GLAHAAGTSVSVVEGLKELGVFEEAPIPVSPLVATPNPNYCLPVLEDAQKSAADLLQQG
FT                   VLLAKFQVFLLDGVTGSGKTEVYFEAVAQALKGGKQILILLPEIALTQQFLDRFYARFG
FT                   AAAAEWHSDLAPRRRERVWRQVAEGQIRVVAGARSALFLPFSDLGLIVVDEEHDGAYKQ
FT                   EERIFYHARDMAVARGSFEQCPVILSSATPSIESQVNVLWGRYQRVHLPSRFRAAALPQ
FT                   LRVVDMRQGGVEKGRFISSALEHALKQTLEKGEQALLFLNRRGYAPLTLCRICGYRFHC
FT                   TECSSWLVEHRLQGRLKCHHCGYHQPIPEACHECGTLDHLVACGPGVERIAEETQGLFP
FT                   QARLMILSTDLKGGISQLRSELEAIANRDVDIIIGTQLVSKGHHFPGLSLVGVVDADLG
FT                   LANGDLRAGERTFQLLSQVTGRAGRMGLESLGLLQTYQPDHPVIKALLSQQREDFYTRE
FT                   LAMREQHHLPPYGRFASLIVSSKNRQAAENYARVLRQAAPAVHDASLGVSLMGPAEAPL
FT                   ALVRGHYRFRLLLHGKRSFDVQGFIRAMLARAAKMPSSVRVQIDIDPQSFL"
FT   gene            124190..124855
FT                   /locus_tag="BARBAKC583_0109"
FT   CDS_pept        124190..124855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0109"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45098"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR44"
FT                   /protein_id="ABM45098.1"
FT                   /translation="MRIGCFAGGRFVKKIIIYFILGGAWLLGARAYASVTDIIKHDERK
FT                   EIHSIDATVFAFTYQLMRKTEKIFQPMIAAPQETMQSLCGFPVPYARQVIYDYAVFHDD
FT                   KLAQDVMIFSRALSLHGTQIIGPLTKQILQHLRAHRDLMERVHRLDLSADVVQALLMDE
FT                   TFKVDLLLSKVGAEITAAVFDTFHTGDTGKLDNLPDEIKIGLQKRCVSVSSFEDFRDQ"
FT   gene            124862..125056
FT                   /locus_tag="BARBAKC583_0110"
FT   CDS_pept        124862..125056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45662"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR45"
FT                   /protein_id="ABM45662.1"
FT                   /translation="MYKFPNIYDVEKAIKVREIMMLKKGVRGDLKKNFKEFTIICLKFS
FT                   KALLRVSYVYARDEKVFSF"
FT   gene            125149..125733
FT                   /gene="atpH"
FT                   /locus_tag="BARBAKC583_0111"
FT   CDS_pept        125149..125733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="BARBAKC583_0111"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44925"
FT                   /db_xref="GOA:A1UR46"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR46"
FT                   /protein_id="ABM44925.1"
FT                   /translation="MSDSFSLLPLPLVSQRYAHALFDLVQKEGYVGDVEKALASFQVIL
FT                   EQDKALKHLVQSPFLSVKEQVKAVCAVCENLGLAHKKAGQILRNFLCVVAANRRLSALS
FT                   GILQAFQRRVALSRGEVSAQVISAHPLDADQKKELCVALESVVGGKVTLRLSVDPAILG
FT                   GLIVRLGLYQIDTSLATQLSSLKLALKKEVS"
FT   gene            125733..127268
FT                   /gene="atpA"
FT                   /locus_tag="BARBAKC583_0112"
FT   CDS_pept        125733..127268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="BARBAKC583_0112"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45491"
FT                   /db_xref="GOA:A1UR47"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR47"
FT                   /protein_id="ABM45491.1"
FT                   /translation="MDIRPSEISKILKEQIKNFDQEAEFSEIGWVLSVGDGIARVYGLD
FT                   NVQAGEMVSFSNGVQGMALNLEMDNVGVVIFGSDRDIREGDTVKRLGSIVDVPVGPELL
FT                   GRVVDALGNPIDGKGPLNAKNRRRVDVKAPGIIPRQSVHEPMSTGLKAIDALIPIGRGQ
FT                   RELVIGDRQTGKTAILLDTFLNQKPFHENEAGSDQDKVYCIYVAIGQKRSTVAQFVKVL
FT                   EERGALDYSIIVAATASDPAPMQFIAPLAGCAMGEYFRDNGQHALIGYDDLSKQAVAYR
FT                   QMSLLLRRPPGREAYPGDVFYLHSRLLERAAKLNADNGSGSLTALPVIETQANDVSAYI
FT                   PTNVISITDGQIFLETNLFYQGIRPAVNVGLSVSRVGSAAQIKAMKQVAGSIKGELAQY
FT                   REMAAFAQFGSDLDASTQRLLNRGARLTELLKQPQFSPLKTEEQVVTIFAGVNGYLDAL
FT                   AVSDVGRFERGLLALLRSDHQELLNAIASQKQITDELKGKLVAILDRYAKNFS"
FT   gene            127285..128193
FT                   /gene="atpG"
FT                   /locus_tag="BARBAKC583_0113"
FT   CDS_pept        127285..128193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="BARBAKC583_0113"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44710"
FT                   /db_xref="GOA:A1UR48"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR48"
FT                   /protein_id="ABM44710.1"
FT                   /translation="MASLKDLRDRIASVKATQKITKAMQMVAAAKLHRAQEAVEAGRSY
FT                   TQRMDALVTNISKDVDLVDAPLLMRGTGNDHVHLLVVCTAERGLCGAFNTQIARLAREH
FT                   IQKLHAAGKTVKILTVGKKGADILLRDFKSLMIDHVDLRSVKKIGFAEAAKISKQLIDL
FT                   FNEGAFDVCTLFYSRFVSVITQRPMALSLIPAGQNPVDEGQDFVDQAKSREVSQSAVYE
FT                   YEPDVASLLNDLIPRHISVQIFQALLENVAGEMGAKMSAMDNASRNAGEMINKLTVTYN
FT                   RQRQAQITTELIEIIAGAEAL"
FT   gene            128216..129829
FT                   /gene="atpD"
FT                   /locus_tag="BARBAKC583_0114"
FT   CDS_pept        128216..129829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="BARBAKC583_0114"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45035"
FT                   /db_xref="GOA:A1UR49"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR49"
FT                   /protein_id="ABM45035.1"
FT                   /translation="MAKAATSKKEASKVEAKKPAARLGAKKTVSKSEESVKTSQSVKNS
FT                   PSRTGSSSPQKGGKKGAVGEIKQVIGAIVDVQFEGALPNILNALETDRLGSRLILEVAQ
FT                   HLGENTVRTIAMDTTDGLVRGQKVFDTGTQICVPVGEATLGRIMNVIGEPVDEVGPIVT
FT                   TKTRSIHQKAPEYIEQSTESEILVTGIKVVDLLAPYSKGGKVGLFGGAGVGKTVLIMEL
FT                   INNIAKAHGGYSVFAGVGERTREGNDLYYEMIESRVNVNPKENDGSTKGSKCALVYGQM
FT                   NEPPGARARVALSGLTIAENFRDEGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQ
FT                   PTLATDMGALQERITSTKTGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRSIAE
FT                   KGIYPAVDPLDSFSRMLDPLVVGEEHYAVACQVQTILQRYKALQDIIAILGMDELSEED
FT                   KLLVGRARRIERFLSQPFHVAEAFTGSPGKLVSLEDTIKGFKGLCAGDYDDLPEAAFYM
FT                   VGSIDEAIEKGKRLMAEASS"
FT   gene            129877..130293
FT                   /gene="atpC"
FT                   /locus_tag="BARBAKC583_0115"
FT   CDS_pept        129877..130293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="BARBAKC583_0115"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44459"
FT                   /db_xref="GOA:A1UR50"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR50"
FT                   /protein_id="ABM44459.1"
FT                   /translation="MEDKRAEHFLFELVSPEKIVFSEEIVSVVLPSASGYLTVMANHAP
FT                   LVVSLIPGSVRVVSSSREWLFAVGGGVVEITPSRCSLLAEAVLSVDHLSFEELEQHIMN
FT                   VRATLENTLGDRIGHTAEDFLHQLTRVCGVSASA"
FT   gene            130318..131937
FT                   /locus_tag="BARBAKC583_0116"
FT   CDS_pept        130318..131937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0116"
FT                   /product="transporter, major facilitator family"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45160"
FT                   /db_xref="GOA:A1UR51"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR51"
FT                   /protein_id="ABM45160.1"
FT                   /translation="MHGKGSAVVSEGTKSSSRPGAVFAEPLPKGLVYIFASFILQWACG
FT                   LGANMIQSNIGQLAGDFHATLPEMTWLVAVYMAPNVSVTIMLVKIRYQFGLRAFAELSI
FT                   LGFVLVCALQLLVTDLRSALIIRFFSGIAAAPMASLAFIYMMEVFVPEKKFTIGLSLNY
FT                   MNAALAVPLSRLISPHLVENGGFSGLSAMEMGLVLISLGCIYFLPLKPVACSKEIRKLD
FT                   WVSYIFIALGLGLNAIIMSVGKLYWWYETSWIGWGLALAVLFLSIAAILELNRNNPLID
FT                   LRWLVSKEMLQVVLVLLVFRIFLLEQSTLAADFFNLFGLLNRDMASMYVAITIGTLLGG
FT                   AVCVFFLRAGREDYFYLVSVSCLALGSYLDSSVNELTRPVDMMVSQGLIGFGYALFLPP
FT                   ALFNGFVTANARGPRYVLSFIAVFLLTQVTGGLMSAAFFGSLQFLFAHKHFEFLTQNIM
FT                   ITDPLIANEIDNNIRSMGDIQSVSSLIEHLKLTANILAYDDVFRLYFYIATVVLFIFIV
FT                   KIFYRSRFFALWGKIRKARQYP"
FT   gene            131954..132955
FT                   /locus_tag="BARBAKC583_0117"
FT   CDS_pept        131954..132955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0117"
FT                   /product="auxiliary transport protein, membrane fusion
FT                   protein (MFP) family"
FT                   /note="identified by match to protein family HMM PF00529"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44503"
FT                   /db_xref="GOA:A1UR52"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR52"
FT                   /protein_id="ABM44503.1"
FT                   /translation="MIRALRSKSTIVAFISGIVGILLILWAWQLPPFVSAIQVTNNAAI
FT                   KGNVTPISSQISGVIARVHVQDYQRVERGQVLFELDDAVFQQQLVRAKANLDSKNTKLA
FT                   YILLKVEALQGEIKIAEAELAHLQEISASKSQIPGTNKPFHAVPSLSQSLATLEMKYQL
FT                   QKQLDFEQQSLQFDIMGARAGVELAELNLSHAKIISPDTGYIGLVGVKVGQYVMPGTQL
FT                   VFVISDDIWILAHYKETQLSRMRVGQPVVFSVDALNDQKLTGHVVSFAPATGSEFSFLK
FT                   TDKAIGNFIKVAQRISVRIALDPEQSRIDRLIPGMSVVTYVDTAAQATSLEE"
FT   gene            complement(133242..133370)
FT                   /locus_tag="BARBAKC583_0118"
FT   CDS_pept        complement(133242..133370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0118"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45528"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR53"
FT                   /protein_id="ABM45528.1"
FT                   /translation="MTHSLFMTFMQQPKLGTREATHLFYTLDARKPKLRMHRTLKQ"
FT   gene            133498..134754
FT                   /gene="ispG"
FT                   /locus_tag="BARBAKC583_0119"
FT   CDS_pept        133498..134754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="BARBAKC583_0119"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /EC_number="1.17.7.1"
FT                   /note="identified by match to protein family HMM PF04551;
FT                   match to protein family HMM TIGR00612"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44797"
FT                   /db_xref="GOA:A1UR54"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR54"
FT                   /protein_id="ABM44797.1"
FT                   /translation="MSTAYYLSKLSERRRSVAVMVGDVGVGGDHPIVVQSMTNTDTADI
FT                   DATVMQVSALWRAGSQLVRITVDRDEAAAAVPKIRERLERLGIFVPLVGDFHYIGHKLL
FT                   VQHPACAQALAKYRINPGNVGFGAKKDLQFSQIIEIACQYNKPIRIGVNWGSLDEALLT
FT                   QLMDENAQQEKPLSMAEVMREAVIQSALHSAFAAEKMGLGRDKIILSAKVSDVQDLIAV
FT                   YTLLAKRSDHALHVGLTEAGMGTKGVVASSAALGILLQQGIGDTIRISLTPEPGGDRTR
FT                   EVKVCQELLQVMGFRQFVPVVAACPGCGRTTSTVFQTLAQKIEANLCKNMPIWREKYPG
FT                   IERLKVAVMGCIVNGPGESKHADIGISLPGTGELPAAPVFIEGKKVKVLRGHHIAEEFE
FT                   EILSDYIRTRFGQHEQKRA"
FT   gene            complement(135152..136054)
FT                   /locus_tag="BARBAKC583_0120"
FT   CDS_pept        complement(135152..136054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0120"
FT                   /product="polyprenyl synthetase"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44695"
FT                   /db_xref="GOA:A1UR55"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR55"
FT                   /protein_id="ABM44695.1"
FT                   /translation="MHEFTTLLAKHADAVKQRLNMLLNNHVQEGEIARPELLLQAMRYG
FT                   VLNGGKCLRPFFVIQSAALFDVPPEHALDVGVALECIHCYSLIHDDLPAMDNDILRRGK
FT                   PTVHKAFDEATAILAGNALLTFAFEIIAHKACALLPQTRLNLITALAQAAGLGGMIGGQ
FT                   ILDLEAEKKPQDRTKILTLQRMKTAALISFSCQAGAIMGNASASITQQFADFGTQIGLA
FT                   FQLTDDLLDVTSSTEILGKTAGKDKAANKATLVNIDGIAETQKKRDTLIHDAVKLLNPF
FT                   GDKALALQQAAHFIAIRRH"
FT   gene            136133..136849
FT                   /gene="mtgA"
FT                   /locus_tag="BARBAKC583_0121"
FT   CDS_pept        136133..136849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="BARBAKC583_0121"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00912;
FT                   match to protein family HMM TIGR02070"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45396"
FT                   /db_xref="GOA:A1UR56"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR56"
FT                   /protein_id="ABM45396.1"
FT                   /translation="MVLSFLKKRQDDSQKRWCCKIRTFVVYSFLCLLFLPIILLLIYRL
FT                   TFVHPVSTLMMRDVLTRDSYQREWVALSDVSFAGPAGIIVSEDGNFCRHYGVDWNALLT
FT                   ILRDETKPWRGGSTITMQVVKNLFLWSHRSYVRKGLEIFYSLMADFLLSKKRIMEIYIN
FT                   IAEWGPGIYGIEAAAFYYYKKSARALTIQQAAALVASLPNPYVRNPHQPTDHFLTLSRM
FT                   IEQRIIFSGAYTHCLR"
FT   gene            137075..137260
FT                   /gene="rpmF"
FT                   /locus_tag="BARBAKC583_0122"
FT   CDS_pept        137075..137260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="BARBAKC583_0122"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44470"
FT                   /db_xref="GOA:A1UR57"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR57"
FT                   /protein_id="ABM44470.1"
FT                   /translation="MAVPKRKTSPSKRGMRRSADALKAPTYVEDKDSGELRRPHHIDLK
FT                   TGMYRGRSVLTPKNSG"
FT   gene            complement(137770..138348)
FT                   /locus_tag="BARBAKC583_0123"
FT   CDS_pept        complement(137770..138348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0123"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="identified by match to protein family HMM PF02559"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44903"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR58"
FT                   /protein_id="ABM44903.1"
FT                   /translation="MASQQKKTSHGFSTSEYIVYPTHGVGQIMVIEEQEVAGHKLELFV
FT                   IHFAKDKMDVKVPIAKALSTGMRKLSEPASVEKALKILQGKARIKRIMWSRRAQEYDTK
FT                   INSGNFMFIAEVVRDLFRSDLQPEQSYSERQLYAAALDRMSREISVINNLSETEAVNLI
FT                   EKHLNEGQKSSFEAKIDEADEDSKAVCAA"
FT   gene            complement(138644..138982)
FT                   /gene="fdxA"
FT                   /locus_tag="BARBAKC583_0124"
FT   CDS_pept        complement(138644..138982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="BARBAKC583_0124"
FT                   /product="ferredoxin"
FT                   /note="identified by similarity to GB:AAA85787.1; match to
FT                   protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45480"
FT                   /db_xref="GOA:A1UR59"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR59"
FT                   /protein_id="ABM45480.1"
FT                   /translation="MTYVVTDNCIACKYTDCVEVCPVDCFYEGENMLVIHPDECIDCGV
FT                   CEPECPAEAIKPDTEPGLEQWLELNLNYATKWPNLSTQKPPLPEAKEMDGIPNKLEKYF
FT                   SENPGGDQ"
FT   gene            complement(139004..140632)
FT                   /locus_tag="BARBAKC583_0125"
FT   CDS_pept        complement(139004..140632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0125"
FT                   /product="MgpS"
FT                   /note="identified by similarity to GB:CAA90562.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44878"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR60"
FT                   /protein_id="ABM44878.1"
FT                   /translation="MLKATFCLKALRKKTLMNNEITQKNNVLTEKHENGRFEGFRFYTH
FT                   PSATQQSQSEQEHNPVSDEDLVLAFSQRATRFCASANGDFTISSDGIVRWIGQTVGKLA
FT                   PTEDILKPKVILLADTQLNGENRDKVFARLERFVIFHFESTLKPLFDLRNAETLTDSTR
FT                   DIATQLANSLGILPRWKVAERVKNLDQQSRAVLRQFGVRFGAFHIYVTAILKPAPVQAM
FT                   ALLWTLKNDIRDPIGFSEILAALAAGRTSLVVDPTYNPRLYALAGYKILKQRAVRIDIL
FT                   ERLASLIRLALKWKPGTGPRPEGAYDGKSFFVTPTMMSILGANGTDMEEILQGLSYQSY
FT                   PCSPDMLEKVLSSSDNAPLTTQSCPEAEFVGDQWQIIEISDTPQNNEKNADKPSCAVEA
FT                   LPEAEPVGNFAHYKHTAESNKVILLWRYNHQRTHHAQNNHNKFGQKRQDQYKKAFKIKS
FT                   NTTDKIFHKDASHPQKDAFSIHKDASHKKRSYENNNFQGDFSKKKLSHGRNHPDPDSPF
FT                   AKLAVLRNQLTSNKKANNAPFFKDD"
FT   gene            141073..141984
FT                   /gene="rpoH1"
FT                   /locus_tag="BARBAKC583_0126"
FT   CDS_pept        141073..141984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH1"
FT                   /locus_tag="BARBAKC583_0126"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45362"
FT                   /db_xref="GOA:A1UR61"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR61"
FT                   /protein_id="ABM45362.1"
FT                   /translation="MNNLSNAGYRNNKNYNDTDGSLGRDMVRSAMQAPYLERKKEYDLA
FT                   LRWKDKRDDEAMHQIAAAHMRLVISIASRFKRFKMPLGDLVQEGYVGLLEAAARFEPDR
FT                   EVRFSTYATWWIRASIQDYILRNWSIVRGGTSSSQKALFFNLRRLRAQLVQEDSTLTKQ
FT                   DIFRSIAEKLSVPVSDVERMDFRFSGADNSLSVSISENEESPVTKIDNLVDEHPLPDIL
FT                   IEKAIDGQRRTQWLYDALQILNEREMEIIRFRRLNDESATLESLGERLGISKERVRQIE
FT                   VRALQKLRRALLTVNSEEAYDL"
FT   gene            complement(142085..143500)
FT                   /locus_tag="BARBAKC583_0127"
FT   CDS_pept        complement(142085..143500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0127"
FT                   /product="peptidase, M48 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF01435"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44652"
FT                   /db_xref="GOA:A1UR62"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR62"
FT                   /protein_id="ABM44652.1"
FT                   /translation="MLFLPACYSNFHVNNLFDFSESSSRKTTNEEDTYATLAAAHHPRI
FT                   LQAHGGAYRNPKLERMLANIISKLAAVSHDPDQTYRITILDSTNINAFALPGGYIYVTR
FT                   GMLTLANDSSEVAAVLAHEIAHITANHGILRFQKEAELRRADRLPRHILPSANTKPHNT
FT                   LNDQQKLAQFSRNQELQADSIGIEMLAQAGYDPFASPRFLKSMEAYNAFRNLLGNTQSS
FT                   LDFLATHPTTPKRINLAIEKARTFKTAKIASTDRSAFLKSIDGIIFGGSLHEGYVRGQN
FT                   FIHPQLRITFSVPDTFTIETNTNTVVASGPNKIAFRFDAVSLTENISASDYLKSGWMTG
FT                   LDESSVHPITIHGLKAAHAYASNENWQFDVVVIPMNNQVFRLITAAPHQSSNFHSIAHN
FT                   ITHSFRSLSWEDLQKLKPLKIRVTRVKQGDSIASLSYQMQETPHQEELFRIINGLSSEE
FT                   ILHVGSFVKIIAE"
FT   gene            143768..144403
FT                   /gene="thiN"
FT                   /locus_tag="BARBAKC583_0128"
FT   CDS_pept        143768..144403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiN"
FT                   /locus_tag="BARBAKC583_0128"
FT                   /product="thiamine pyrophosphokinase"
FT                   /EC_number="2.7.6.2"
FT                   /note="identified by match to protein family HMM PF04263;
FT                   match to protein family HMM TIGR01378"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44471"
FT                   /db_xref="GOA:A1UR63"
FT                   /db_xref="InterPro:IPR006282"
FT                   /db_xref="InterPro:IPR007371"
FT                   /db_xref="InterPro:IPR007373"
FT                   /db_xref="InterPro:IPR036371"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR63"
FT                   /protein_id="ABM44471.1"
FT                   /translation="MKTFTILLDGDIAPTDRLRTQIRDSRVIAADGGMRHAAPLNVQPE
FT                   LWVGDFDSTNQALLQQYCDVPREVFSVEKDATDGDLACKKALSQGAQRIILCGAFGGAR
FT                   SDHSLSHMTQAIAMAEKGLSVLLTSGDEEGWPIVPQPSSCDLPDGCLFSLIGFSDLQGL
FT                   TMSGVQWPLSEYTVSFGSSLTLSNRVCGTFSCQLRSGKAILLASLPVS"
FT   gene            144855..145235
FT                   /locus_tag="BARBAKC583_0129"
FT   CDS_pept        144855..145235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0129"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45022"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR64"
FT                   /protein_id="ABM45022.1"
FT                   /translation="MLKPILTMTVVSLVGLSSVACTIAERRTAKYGTGGAALGAIAGSA
FT                   LTGTAEGTVVGAALGTLVGTTAGVARNEQKKKRNAQKAPPMCTYQNSQGRQYQAPCPQS
FT                   QSIQLCQYSDGRGRLYQAPCPQ"
FT   gene            145305..147134
FT                   /locus_tag="BARBAKC583_0131"
FT   CDS_pept        145305..147134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0131"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44971"
FT                   /db_xref="GOA:A1UR65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR65"
FT                   /protein_id="ABM44971.1"
FT                   /translation="MVPLLRLDRIVLTFGTTPLLDQACLSVGKGERIALVGRNGCGKST
FT                   LLKIAAGLLEPSEGEIFRHPRAKVHYVSQNPDCSGFDDVNAYVHAGLNEAHDVSFVQTL
FT                   LRDLGFSGSEKLATLSGGEKRRVSLLRAIAEQPDVLLLDEPTNHLDLATIEWLEGTLCS
FT                   LNSALVVISHDRRFLETVTQCVVWLDRGRTKKLEKRFSEFETWRDKALEEEALDQHKLS
FT                   RQIAREEQWVRYGVSARRKRNVRRLAELKELRQQQKNYQAVPGKALFSAADSHDSGQLV
FT                   LEAKKITKSYGERVIVKDFSLRIQRGNRIGFVGPNGVGKTTLLSLLIGHEKPDSGMIKH
FT                   GHNLAMALLDQQRIVNEEETVAHYLTGGRGDSLVINGQERHVVSYMKDFLFAPEQMRTP
FT                   LKELSGGERARLMLARLLSQPANFLILDEPTNDLDMETLDLLQEFIADFPGTVMVVSHD
FT                   RDFLDRTVTHTIAPQGDGQWILYAGGYSDMIAQKKQAEFVRRQDQQKPVTAPRERTKQP
FT                   LPREGTSLRKLSYKQVYALETLPKSIDILVHEIQILEKELSDPTLYCSDKARFEHLSAA
FT                   LEEKKNLCAQQEEKWLNLELLREEIEKELCSSD"
FT   gene            complement(147131..147388)
FT                   /locus_tag="BARBAKC583_0130"
FT   CDS_pept        complement(147131..147388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:Q8YIZ8"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45395"
FT                   /db_xref="InterPro:IPR018753"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR66"
FT                   /protein_id="ABM45395.1"
FT                   /translation="MNTASDQTHAISVNQLRSFIERIERLEEEKKAIADDIKDVYTELK
FT                   GSGFDSKAVRKIVGLRKQEDHKRMEEEAVIQLYKNALGMT"
FT   gene            147458..147592
FT                   /locus_tag="BARBAKC583_0132"
FT   CDS_pept        147458..147592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0132"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45175"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR67"
FT                   /protein_id="ABM45175.1"
FT                   /translation="MLGMHEEQGESQVFRFSLHINIKKISVNKSNAKIAKKIIRENYD"
FT   gene            147667..147861
FT                   /locus_tag="BARBAKC583_0133"
FT   CDS_pept        147667..147861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0133"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45253"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR68"
FT                   /protein_id="ABM45253.1"
FT                   /translation="MQKTSQNLKEREGIYGLLYRLLSQKWREGYKGATWGIAKYFSKEN
FT                   KRNIGEYFSFILMFGLCTS"
FT   gene            147893..148258
FT                   /locus_tag="BARBAKC583_0134"
FT   CDS_pept        147893..148258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06282"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44688"
FT                   /db_xref="InterPro:IPR009380"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR69"
FT                   /protein_id="ABM44688.1"
FT                   /translation="MGVALGYRAPSGWVSEGWWVVPTAECKTLIDGQLISRFYYMHAED
FT                   AERKNGWNGPVTMCVKDSSFLIEGVHDCFARGFQKAYFEEIDTGNQINWTVQLTESSLF
FT                   DNPALNRPQVKKDPSSP"
FT   gene            complement(148633..149016)
FT                   /locus_tag="BARBAKC583_0135"
FT   CDS_pept        complement(148633..149016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0135"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05164"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45091"
FT                   /db_xref="GOA:A1UR70"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR70"
FT                   /protein_id="ABM45091.1"
FT                   /translation="METISVTIDGKVYRMACDKGQEDYLTKLAAQLDQYITHLKNNFGE
FT                   IGDHRLSVMAGIMILDEREEIKQEYQKLQESYATLLQQSQEQDHHIIQIIQETTKRIEK
FT                   LTQELRKDAHPLNLQQESEPTDR"
FT   gene            complement(149030..149347)
FT                   /locus_tag="BARBAKC583_0136"
FT   CDS_pept        complement(149030..149347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44554"
FT                   /db_xref="InterPro:IPR025310"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR71"
FT                   /protein_id="ABM44554.1"
FT                   /translation="MICFCEKMIKGEIVMNQETTALPEVLKKLDNALKTLETTIINHNI
FT                   LMDKHNEWEEEIQYMNADRNRLAQELDNSEARAERLKEANKEVSRRLITAMEAIRTLLD
FT                   R"
FT   gene            149603..151603
FT                   /gene="tkt"
FT                   /locus_tag="BARBAKC583_0137"
FT   CDS_pept        149603..151603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tkt"
FT                   /locus_tag="BARBAKC583_0137"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /note="identified by match to protein family HMM PF00456;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM PF02780; match to protein family HMM TIGR00232"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45691"
FT                   /db_xref="GOA:A1UR72"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR72"
FT                   /protein_id="ABM45691.1"
FT                   /translation="MMNTKQQTQMANAVRFLAIDAIEKAKSGHPGLPMGAADIATVLYT
FT                   QFLVHDPKNPHWVNRDRFVLSAGHGSMLLYAVLYLSGYEDISLEEIRNFRQMGSKVAGH
FT                   PEYGHAAGIETTTGPLGQGLANAVGMALGERLLNARFGDLINHYTYALVGDGCLMEGIS
FT                   QETIALAGHLKLHKLIVLWDDNNISIDGEISLTDSTNQEMRFKACGWNVIKVDGHNQTA
FT                   IAHALTAAKKSNRPTLIACKTTIGFGAPKKAGTNKVHGAPLGEEEVAATREVLGWEFEP
FT                   FMVPADILDCWRLAGLNAAKKRQEWEEKLAALPIEERVRFECFVRGDLVSNFDEVLEAY
FT                   KEKLVAECPTVATRKASEMVLDVINEVVLGTIGGSADLTGSNLTKSSQMSKITADDFSG
FT                   RYLHYGIREHAMGAIMNGLALYGGFIPYGGTFLCFADYMRPAMRLSSLMGLRVVYVMTH
FT                   DSIGLGEDGPTHQPVEHLAALRALPNHYVFRPADAIETVECWQLALKSLKTPSTLALSR
FT                   QNLPLVRREHTGNNLCLLGAYELLTDGDDAQVTLFASGSEVEIIVQAHALLEAEGIASR
FT                   VVSVPCFELFFEQSVAYQNALIGNSPVKIAVEAAIRQGWERFIGQDGIFIGMEGFGASA
FT                   PMDELYKHFGITCENIVTVVKEKLQKINEES"
FT   gene            151605..152612
FT                   /gene="gap"
FT                   /locus_tag="BARBAKC583_0138"
FT   CDS_pept        151605..152612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap"
FT                   /locus_tag="BARBAKC583_0138"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by similarity to SP:P51009; match to
FT                   protein family HMM PF00044; match to protein family HMM
FT                   PF02800; match to protein family HMM TIGR01534"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44885"
FT                   /db_xref="GOA:A1UR73"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR73"
FT                   /protein_id="ABM44885.1"
FT                   /translation="MSVRVAINGFGRIGRGILRAVVENERQDIEVVAVNSLSPIELNAH
FT                   LLRYDSVHGRFPATVKVVGNALEVGGRLVQVTASSDPVQLPWKDLDIDIALECTGKFTA
FT                   RDQASAHLGAGAKRVLVSAPSEGADLTVVYGVNHRDLKKEHQVISNASCTTNCLAPVAQ
FT                   VLHETVGIEKGFMTTIHSYTGDQNLLDATHRDLYRARAAALSMIPTSTGAAKAVGLVLP
FT                   KLKGLLDGVSMRVPTPNVSVVDLTFTSQRSTSVEEINAALCAASKGVLKGILGYTEEKL
FT                   VSCDFNHDPHSAIVQSDQTKVIDHRLCRVLAWYDNEWGFSNRMIDTAVAVAKTL"
FT   gene            152695..152808
FT                   /locus_tag="BARBAKC583_0139"
FT   CDS_pept        152695..152808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45152"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR74"
FT                   /protein_id="ABM45152.1"
FT                   /translation="MSMRLSKMKEPIVSLIMKCLIHYSRDNAVSMGQEKTV"
FT   gene            152911..154113
FT                   /gene="pgk"
FT                   /locus_tag="BARBAKC583_0140"
FT   CDS_pept        152911..154113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="BARBAKC583_0140"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="identified by match to protein family HMM PF00162"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45059"
FT                   /db_xref="GOA:A1UR75"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR75"
FT                   /protein_id="ABM45059.1"
FT                   /translation="MKFRTINEANVSGKRVLVRVDFNVPMSQGKVCDNTRLERHKETIC
FT                   ALQKRGAKIILLSHCSRPRGKIVPELSLRPVAKALETIMGQQIFFVEECIGAPVQTAVE
FT                   ALQEGQILLLENLRFYKEEEDNNADFAEALAQQGDLYVNDAFSVSHRAHASVEAITHYL
FT                   PSYAGMALQRELQALEKGLDNPKKPVTAIVGGAKVSSKLFVLNHLVTKVDYLVIGGGMA
FT                   NNFLMAQGHNVGKSLCEPMLMDMVKDVIEKARESHCTLVLPVDAVVGLQCETGTPHHHC
FT                   MIEAIPDEGMILDIGEHSIARINTVIDASATLVWNGPLGVFEVSPFDHGTIAVARYAAA
FT                   RSQKGHCVSIAGGGDTVFALNHAGVADDFTYLSTAGGAFLEWMEGKTLPGVLALMQDLK
FT                   N"
FT   gene            154252..155280
FT                   /gene="fbaB"
FT                   /locus_tag="BARBAKC583_0141"
FT   CDS_pept        154252..155280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaB"
FT                   /locus_tag="BARBAKC583_0141"
FT                   /product="fructose-bisphosphate aldolase, class I"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF00274"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45305"
FT                   /db_xref="GOA:A1UR76"
FT                   /db_xref="InterPro:IPR000741"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR76"
FT                   /protein_id="ABM45305.1"
FT                   /translation="MKERLEDIALALVDGGKGILAADESTATIGKRFEAIGIESSEDNR
FT                   RAYREMFFTAKDAMKSAISGVILFDETIRQKASTGRMLTDLIHETGALSGIKVDTGAKP
FT                   LAAFAHETITEGLDGLRERLKEYYVLGARFAKWRGVIAIDNQTLPTRGAIRQNAQALAR
FT                   YAALCQEVGLVPIVEPEVLMDGPFRQHSITRCFDVTYAVLQAVFEELFEARVMCEGMIL
FT                   KPNMVIDGKDARSASVEEVAEKTVRVLKQIVPTAVPGIAFLSGGQSDEEATAHLSAMNA
FT                   LGTMPWKLTFSYGRALQAAALKVWGGKQENVPAAQKAFYHRARMNHLAALGQWTKAQEQ
FT                   SA"
FT   gene            complement(155412..155525)
FT                   /locus_tag="BARBAKC583_0142"
FT   CDS_pept        complement(155412..155525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0142"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44414"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR77"
FT                   /protein_id="ABM44414.1"
FT                   /translation="MLLSIAPTLQDDSSMHGDKRLFPYMPSTRPHTMITGS"
FT   gene            155866..155991
FT                   /locus_tag="BARBAKC583_0143"
FT   CDS_pept        155866..155991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0143"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45457"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR78"
FT                   /protein_id="ABM45457.1"
FT                   /translation="MGHLVRYEPSDDREYEGGSDREHVGESIEEGERAECWFCIF"
FT   gene            complement(156268..157596)
FT                   /gene="tolB"
FT                   /locus_tag="BARBAKC583_0144"
FT   CDS_pept        complement(156268..157596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolB"
FT                   /locus_tag="BARBAKC583_0144"
FT                   /product="Tol-Pal system beta propeller repeat protein
FT                   TolB"
FT                   /note="identified by match to protein family HMM PF04052;
FT                   match to protein family HMM PF07676; match to protein
FT                   family HMM TIGR02800"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44596"
FT                   /db_xref="GOA:A1UR79"
FT                   /db_xref="InterPro:IPR007195"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR014167"
FT                   /db_xref="InterPro:IPR036752"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR79"
FT                   /protein_id="ABM44596.1"
FT                   /translation="MLAMIKQSLFSWFIISMSVCLFSGSFAHAQLKGTISKADFNPIPI
FT                   AITDFIAQDSIGQKIAAVIAADLERSGLFKTLDKDSFLEKITDPNGQPNFSNWQQLNAQ
FT                   GLVTGYIHSDSNGRLRIDFRLWDVFTHKQIKGRRFYTTTEHWRRVAHMISDEIYSKMTG
FT                   ESGYFDTRVVFVDETGPFNARIKRLAIMDQDGANLTYLSNGTELVLTPRFSPSRQEITY
FT                   MAYDKHKTAHVYLQQIETGQRELIGTFDNMTIAPRFSPDGQKVIMSLLKDNGSANLYTM
FT                   DLRTRTITRLTTTRAIDTSASYSPDGKQIVFSSDRDGKPQIYIMDADGSNPHRISANEG
FT                   SYSTPTWSPRGDYIAFTKQSQGQFSIGVMHPNGQGERLLTTGFHNEGPTWAPNGRVLMF
FT                   FRQNANQGAQIYTIDITGRNERRLPTPNNASDPAWSPLLGKTP"
FT   gene            complement(157638..159131)
FT                   /locus_tag="BARBAKC583_0145"
FT   CDS_pept        complement(157638..159131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0145"
FT                   /product="TolA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45594"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR80"
FT                   /protein_id="ABM45594.1"
FT                   /translation="MKWSLAFSFAAHILFLILGMMHFIHLPSLPSHQMEAVSITLAPLS
FT                   QELSLQQGSLSAPPDESPAPKPTTKPQEKEQARHVGDGKMDLAAPLKKREKPRQIDAAS
FT                   PTFGEKDAAELPVLPQKTQEERAQPELTQPESVQPKPAKPEPAQPEPTQPEPTQPESAQ
FT                   PKPAKPEPAQPEPTQPEPTQPESAQPKPAKPEPAQPEPTQPEPTQPESAQPKPAKPKPA
FT                   QPEPTQPEPTQPESAQPKPAKPKPAQPEPTQPEPTQPESAQPKPAKPKPAQPEPTQPEP
FT                   TQPESAQPKPAKPKPAQPEPIQPKPAPAIIPPPLKPLPETAPLPRVKAKAPSKRPQQTA
FT                   QALPPKGEQTIEDILALEKNDLINRARTQGGGAKRSQKPEATGAKKDVNASERMAQTLV
FT                   NLAGACIQNKLRLVAIGGNLQNRPIVRLQFQLDNNGMVRGTPIIDPLQGDESQKTIMTR
FT                   QVYAAVFACQPYADLPRDQYNLWGQGFDFNVDPLQGQAP"
FT   gene            complement(159281..159733)
FT                   /gene="tolR"
FT                   /locus_tag="BARBAKC583_0146"
FT   CDS_pept        complement(159281..159733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolR"
FT                   /locus_tag="BARBAKC583_0146"
FT                   /product="protein TolR"
FT                   /note="identified by match to protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44892"
FT                   /db_xref="GOA:A1UR81"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR81"
FT                   /protein_id="ABM44892.1"
FT                   /translation="MALSVSPLSQKGSRRKRRSRNHLISEINVTPFVDVILVLLIIFMV
FT                   SAPLVVNGVPLDLPKSQAGPVQVDRPPLTVSLDEKGRLAINNDYYNSVEELIAKLKSLL
FT                   ETDPTQNTQRIFVRAAQTVEYQKILALLASIQKAGFLQVALASLAQ"
FT   gene            complement(159746..160453)
FT                   /gene="tolQ"
FT                   /locus_tag="BARBAKC583_0147"
FT   CDS_pept        complement(159746..160453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tolQ"
FT                   /locus_tag="BARBAKC583_0147"
FT                   /product="protein TolQ"
FT                   /note="identified by match to protein family HMM PF01618;
FT                   match to protein family HMM TIGR02796"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45043"
FT                   /db_xref="GOA:A1UR82"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014163"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR82"
FT                   /protein_id="ABM45043.1"
FT                   /translation="MTHIDLASPETIGMWALFIQANWVVKAVMIGLVLASIWSWTIILH
FT                   KIFAYRKIRRDIRHFEKFFWSGKSLEELYTAYQNKPLNNISAVFIAAMTEWKKSLTKGI
FT                   HTSPSLQIRIEKAMDLAIGRESKKIESKLGYLATLGSAAPFIGLFGTVIGIMNSFLSIS
FT                   ASQNTSLAIVAPGIAEALLATAIGLMVAIPAVVFYNKFIGESAQIIAQIEDFADEFSTI
FT                   ISRRIDEKVTSNS"
FT   gene            complement(160943..161383)
FT                   /gene="ybgC"
FT                   /locus_tag="BARBAKC583_0148"
FT   CDS_pept        complement(160943..161383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybgC"
FT                   /locus_tag="BARBAKC583_0148"
FT                   /product="tol-pal system-associated acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="identified by match to protein family HMM PF03061;
FT                   match to protein family HMM TIGR00051"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45629"
FT                   /db_xref="GOA:A1UR83"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR014166"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR83"
FT                   /protein_id="ABM45629.1"
FT                   /translation="MTETTDIQASPFYSFHDLQARVYVADTDFSGIVYHARYLEFFERG
FT                   RSEFLRHIGLKNIDLASGQQGEKLFFVVRRIEISYSRPAHIDELLTIKTRINRAQGARL
FT                   FIDQVIMRDDTSLVEAKVEIAIINQEGRPRRLPKNLFSGTSY"
FT   gene            complement(161376..162485)
FT                   /gene="ruvB"
FT                   /locus_tag="BARBAKC583_0149"
FT   CDS_pept        complement(161376..162485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="BARBAKC583_0149"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P0A812; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF05491; match to protein family HMM PF05496; match to
FT                   protein family HMM PF07728; match to protein family HMM
FT                   TIGR00635"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45282"
FT                   /db_xref="GOA:A1UR84"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR84"
FT                   /protein_id="ABM45282.1"
FT                   /translation="MHKNENNRLLGSVSLPDDPDRSLRPQVLDDFIGQEAARANLKIFI
FT                   EAAKTRHEALDHVLFVGPPGLGKTTLSQIMAKELGVNFRSTSGPVIAKAGDLAALLTNL
FT                   EERDVLFIDEIHRLNPAIEEILYPAMEDYQLDLIIGEGPAARSVKIDLAKFTLVAATTR
FT                   LGLLTTPLRDRFGIPIRLNFYTIEELEYIVKRNARLFSVPISDDGAHEIARRARGTPRI
FT                   AGRLLRRVCDFALVKQAKTIDREIADTALSRLEVDHLGLDPLDRNYLMLIADVFLGGPV
FT                   GIETIAAALSEPRDAIEDIIEPYLLQQGFIQRTPRGRIITEKAWAHLGLRAPTQPAASA
FT                   TLSTPDLSTSSDVPVSSLIQKHLWEKDYD"
FT   gene            complement(162493..163146)
FT                   /gene="ruvA"
FT                   /locus_tag="BARBAKC583_0150"
FT   CDS_pept        complement(162493..163146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="BARBAKC583_0150"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44723"
FT                   /db_xref="GOA:A1UR85"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR85"
FT                   /protein_id="ABM44723.1"
FT                   /translation="MIGKLTGILDSVFEDHIILDVQGVGYVVFLSNRLLSSLPERGQAV
FT                   SLFIETHVREDAIRLFGFETKVEQDWFCLLQNVRGVGAKVALAILSTLPPPQLAQAITL
FT                   SDIAMISRSPGVGKMVSERIINELKNKALPSNAPHQSMPHFVSYSSETSSQAGTQHTGH
FT                   QHSMDALAALTKLGFERDQATHALQEAIKAFEGETPSSALLIRHSLKLLSSHLK"
FT   gene            complement(163151..163654)
FT                   /gene="ruvC"
FT                   /locus_tag="BARBAKC583_0151"
FT   CDS_pept        complement(163151..163654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvC"
FT                   /locus_tag="BARBAKC583_0151"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="identified by match to protein family HMM PF02075;
FT                   match to protein family HMM TIGR00228"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45441"
FT                   /db_xref="GOA:A1UR86"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR86"
FT                   /protein_id="ABM45441.1"
FT                   /translation="MVEKIRIIGIDPGLRRTGWGIIDFLGNHMHFVASGTLHSDAQLNL
FT                   ASRLHQLHKGLSEVVHQFMPHEAAVEHVFVNKDATATLKLGQARAIALLVPAQAGLPVF
FT                   EYAPNTIKKSVIGVGHGAKEQIHMMVKRLLPRAEFDGHDAADALALVICHSAHRTNFAH
FT                   RIKG"
FT   gene            163666..163800
FT                   /locus_tag="BARBAKC583_0152"
FT   CDS_pept        163666..163800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0152"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44871"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR87"
FT                   /protein_id="ABM44871.1"
FT                   /translation="MLFFCFWIDATRPYRMQEREQSAERMREEGRNERKGGARVQKRE"
FT   gene            complement(164316..164834)
FT                   /locus_tag="BARBAKC583_0153"
FT   CDS_pept        complement(164316..164834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45096"
FT                   /db_xref="InterPro:IPR010848"
FT                   /db_xref="InterPro:IPR038301"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR88"
FT                   /protein_id="ABM45096.1"
FT                   /translation="MSAHDHPHDKPIIMIEHDAFENAFNRLYEEAMNLIEETAAYIDQN
FT                   GKFATRDLSVETSALYVKEAMYLSTRLMQIASRLLLFRAGREGEMLPEQIEKEIAKISL
FT                   HTPSLGPDIAHWQELPEIFRSFVVRSLSLEKRVYHMRYDSNYVSSKSLEDKNPVNKQLE
FT                   LLKNAFRHF"
FT   gene            complement(165212..166318)
FT                   /locus_tag="BARBAKC583_0154"
FT   CDS_pept        complement(165212..166318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0154"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44542"
FT                   /db_xref="GOA:A1UR89"
FT                   /db_xref="InterPro:IPR014550"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR89"
FT                   /protein_id="ABM44542.1"
FT                   /translation="MALHNAFPHISTQSQRDTRIDVVRSLALLTIFINHIPGTIYEHIT
FT                   HKHFGFSDSTEIFVLLSGVSLALSFSSLPERMNFTKNLRKIWQRIVQLYTAYLFASLTT
FT                   LGLFLGAFLIWQCEKLTSMNNIGLFITQPVVAFFSMLSFGHQLGYNNILPLYIVFTLFA
FT                   PFILYFSYKQKGLLLFSSFILYLVCGFYKIGFPSYPLPGKWFLNPLSWQFLFVLGFTGS
FT                   LYFRQGGKIMFKPFLLIISISYLVIALFWVRLNWWGSFSWLNLPSPLASFNKSFLGLPR
FT                   LFHVLALSSVFLCLPWLNERFRLSIKHPLVILGKHGLPVFITGTIFAMIGQIYKIVMTS
FT                   TFLSDTLLIISGIAVQFAVAYFCEKRKS"
FT   gene            166422..167099
FT                   /locus_tag="BARBAKC583_0155"
FT   CDS_pept        166422..167099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0155"
FT                   /product="ThiE/TenI family protein"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44921"
FT                   /db_xref="GOA:A1UR90"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR90"
FT                   /protein_id="ABM44921.1"
FT                   /translation="MTKQKSKPIESCLYPQLVLTVDVRRTLNPSLLRTLLQTQSFTCVI
FT                   IYDSLIHQGDENFLQNKAQSYVDDVQHSGAALIIADHSQIVGRIKADGLHVEGNREALK
FT                   IFKDQTKENKIVGFGNLRDRHSAMTVAEAGVDYLFFGKLGADQKAQAHPRNLSLATWWA
FT                   EIMEIPAIIQAGNDYATVDEAFKTACEFIAVEDMLLSHEDPLPLLQEMVKKCKKFPLLM
FT                   GKA"
FT   gene            167102..168199
FT                   /locus_tag="BARBAKC583_0156"
FT   CDS_pept        167102..168199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF08238"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45659"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR91"
FT                   /protein_id="ABM45659.1"
FT                   /translation="MTKIAYGAYRVFWAFRLMLVVIGALAVSAAIGLAVSAAFAKDEEI
FT                   LNLEQSLNTVQDFSKNKRAQKIPQILRAGKYDEAYDYYVQGFYLKAFRAALRRAENNDP
FT                   KAQTLVGKMYMEGYAVTQDGARAALWFGRAAKQGDPHAQLRYGLMLFNGNFVKKNEEEG
FT                   EKLIHEAMQAGLKEAYFYCGQLLLYKTMREKENLKGVAAADDNDENSDKALAFFLKGAA
FT                   LGDAEAAFAAAQILAVGTMKYPRHDHYARRLMTIAAQKKHVMAQMMLAQWLLQGRGGEA
FT                   DFKEAFSLLYDNALKRVMPAQVNLARVYRDGLGVEGDIVTAAAWYLVVKSGKGQAADLE
FT                   MMLEGMSQAQLEQAHQKAYELMQLF"
FT   gene            168444..168557
FT                   /locus_tag="BARBAKC583_0157"
FT   CDS_pept        168444..168557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0157"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44633"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR92"
FT                   /protein_id="ABM44633.1"
FT                   /translation="MGDRGENEKDAEESYRALRKLPFSQDKLRENFIKMMF"
FT   gene            168871..169443
FT                   /gene="efp"
FT                   /locus_tag="BARBAKC583_0158"
FT   CDS_pept        168871..169443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="BARBAKC583_0158"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM PF09285; match to protein family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45176"
FT                   /db_xref="GOA:A1UR93"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR93"
FT                   /protein_id="ABM45176.1"
FT                   /translation="MKINGNEIRPGNVIEHQGSLWVAVKCNAVKPGKGGAFNQVELKNV
FT                   IDGTKLNERFRAAETVEKVRLEQKDFTFLYQQGEALVFMDTESYEQLELQRDFVGDRAA
FT                   FLQDGMTVTVELHEEKPLGISLPDQVTVTIAEADPAIKGQTVTSSYKPAILENGIRILV
FT                   PPFVQAGERIIVDTNELTYIRRVSEKG"
FT   gene            169447..170238
FT                   /locus_tag="BARBAKC583_0159"
FT   CDS_pept        169447..170238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0159"
FT                   /product="inositol monophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45241"
FT                   /db_xref="GOA:A1UR94"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR94"
FT                   /protein_id="ABM45241.1"
FT                   /translation="MARSAIMNVMVQAALRAGRSLVRDYGEIQNLQVSLKGPADYVSQA
FT                   DRKAEQIVFAELNKARPSFGFLMEETGNIVGEDPQHRFIVDPLDGTTNFLHGIPFFAVS
FT                   IALERQGQIVAGVIYNPILDELFTVERGQGAFFNDRRCRVAGRRKLSECVIATGMPHLG
FT                   RPQRGHYLVELRNVMAEVAGVRRFGAAALDLAYVAVGRTDGFWESHLRIWDVAAGILMV
FT                   REAGGFVSDQVDEGDSSRVKNIVAGNEIIHAELKKVLKKPV"
FT   gene            complement(170500..172320)
FT                   /locus_tag="BARBAKC583_0160"
FT   CDS_pept        complement(170500..172320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0160"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44685"
FT                   /db_xref="GOA:A1UR95"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR95"
FT                   /protein_id="ABM44685.1"
FT                   /translation="MKTPLHSTAPNHSAPSTQAFKIKNALSLYTHLLPYLIRHRWLIVG
FT                   SLTSLLAAAAITLALPIAIRQMLDHGFHASRHEGINSYFGTLFVLTLFLAAASASRYYC
FT                   VIILGERVVADLQRDIFTHILQLSPDFFDRSHSGDIVTQLATHTTQVKLAIGSKMSTAL
FT                   RQLIIVVGAIIMMVITNAKLSFLVLLAIPFVVIPLILLGRQVRTHARTAHNKLSETNSL
FT                   AVEQMSAIRTVQAYTAEPFIANRFSKLIEHSFQTAKISITVRSLFTGFAIFLIFSSIVA
FT                   VLWIGSHDVLYGTMSGGTLSQFIIYAIFGAATFAQLPEMGTELRQAANAAEELFNWLQE
FT                   KPTITTPASPLPLKQPIQGAILFDQVDFHYPSRPQKKILQNLSFSIKAGETVAFVGPSG
FT                   AGKSTIFSLILRFYDPTSGHIQFDGVDLNQLSLHDLRSSMAYVSQDVAIFEGTIRDNIA
FT                   FGAENASQEQIIAASQAANALEFIETLPDGFDSKVGERGVMLSGGQKQRISIARAILRN
FT                   APLLLLDEATSALDANNEHLVQKALENLMHNRTTLVIAHHLATVLKADRILVIDQGTLV
FT                   EEGTHAQLVAQNGIYAHWSNLQFSSGISSP"
FT   gene            172494..172715
FT                   /gene="rpmE"
FT                   /locus_tag="BARBAKC583_0161"
FT   CDS_pept        172494..172715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="BARBAKC583_0161"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44858"
FT                   /db_xref="GOA:A1UR96"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR96"
FT                   /protein_id="ABM44858.1"
FT                   /translation="MKPNIHPDYHQIYVVMTDGTKYTTRSTWGKEGDTLNLDIDPTTHP
FT                   AWIGGSQTLVDRGGRVSKFKNRFGNLGV"
FT   gene            complement(173006..173119)
FT                   /locus_tag="BARBAKC583_0162"
FT   CDS_pept        complement(173006..173119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0162"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45587"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR97"
FT                   /protein_id="ABM45587.1"
FT                   /translation="MGAFCPPFMGHFPVIIALSLAIPFMGPDPPATTCKTL"
FT   gene            complement(173273..174019)
FT                   /locus_tag="BARBAKC583_0163"
FT   CDS_pept        complement(173273..174019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0163"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01709;
FT                   match to protein family HMM TIGR01033"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45620"
FT                   /db_xref="GOA:A1UR98"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1UR98"
FT                   /protein_id="ABM45620.1"
FT                   /translation="MAGHSQFKNIMHRKGRQDAVRSKVFSKLAREITVAAKQGSPDPAM
FT                   NPRLRLAVQNAKSQSMPKDNIERAIKKASGGDVENYDEVRYEGYGPGGVAIIVEALTDN
FT                   RNRTASNVRAAFTKAGGALGETGSVGFMFNRIGEIIYKPEAGTAESVMEAAIEAGAEDV
FT                   QSEETGHHITCAFEDIGEVSKMLEATLGEAESIKTIWKPTTLAPVDEEKAMSILRLIST
FT                   LEEDDDVQNVYANFDVSDEVLAALSA"
FT   gene            174562..175263
FT                   /locus_tag="BARBAKC583_0164"
FT   CDS_pept        174562..175263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06242"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45058"
FT                   /db_xref="InterPro:IPR010421"
FT                   /db_xref="UniProtKB/TrEMBL:A1UR99"
FT                   /protein_id="ABM45058.1"
FT                   /translation="MATQLLMPKATAVWLVDNTALSFEQIADFCKLHVLEVKAIADGDS
FT                   SCSIKGLNPISSGQLTRSEITRVEADPTARLKLAESKVNIPLPKRKGARYIPLSRRQDR
FT                   PNGILWLVLNHPELKDAQIARLIGTTKSTIEQIRNRTHWNSSNLTPMDPVGLGLCSQID
FT                   FEIELRRAAKNRPQSEQRDETLLPASVTENALFDLMRKKGEDKSIKNQEFDADKVFAKL
FT                   NTQVRDAQDAE"
FT   gene            175581..176105
FT                   /gene="pal"
FT                   /locus_tag="BARBAKC583_0165"
FT   CDS_pept        175581..176105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pal"
FT                   /locus_tag="BARBAKC583_0165"
FT                   /product="peptidoglycan-associated lipoprotein"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR02802"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45100"
FT                   /db_xref="GOA:A1URA0"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA0"
FT                   /protein_id="ABM45100.1"
FT                   /translation="MGFVHRIIRCPLTMVFVCLLSVAGCGKKNINPTNGMGFFANNAEY
FT                   SYGNATPGSEQDFAITVGDRVFFSLDSSVIEADAQRILVRQAEWLLLYPHHTIMIEGHA
FT                   DDRGTREYNLALGQRRAIAVRDYLVSLGVSPQRMKTMSYGKERPVAVCDDISCWNQNRR
FT                   VVISITSGRGA"
FT   gene            complement(176115..176243)
FT                   /locus_tag="BARBAKC583_0166"
FT   CDS_pept        complement(176115..176243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0166"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44618"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA1"
FT                   /protein_id="ABM44618.1"
FT                   /translation="MRKKLAGLLLFYKNHPYALKQLTRPALFSAIKLSFSIGKIDF"
FT   gene            177161..179143
FT                   /gene="tilS"
FT                   /locus_tag="BARBAKC583_0167"
FT   CDS_pept        177161..179143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="BARBAKC583_0167"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /EC_number="6.3.4.-"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM TIGR02432"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45394"
FT                   /db_xref="GOA:A1URA2"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA2"
FT                   /protein_id="ABM45394.1"
FT                   /translation="MFVELAKNVFKESDFAQCQKLILAVSGGSDSLALLFLLRDYFKTW
FT                   SAADETVSSRSLSSGPLFSDIIPENNFQSTPKTMPDFSEAIPGTISEEMSEAISEITSS
FT                   EPFSSGSFSSGLLSAENIPVKKIPPEIIVVTVDHQLRAESALEAENVAALCRAYHIKHV
FT                   IVRWEGEKPKTNIAQQARIARYDLLFKEAEKQGATLIMTGHTLNDQVETYHMRRQRLHK
FT                   GAVVAEPEGEDDTKQEADTRQKIGAEKKAKPEIEVQPEVCLERGAEAQPETELALNVVP
FT                   QAESKAPKKAEKAAGRGAYQEFAAENVEQGLSGYDGESLSGYDKQSLSGCDGESVSGCD
FT                   GESLSDQNLSNQREESDLFYERGLACIPREALLRGKVRLIRPLLGVKRKILRAYLSLQG
FT                   TSWIDDPTNEDRKFERVRVRHSLHQQKLADIAKKVNHAAVQRRKQAQDIADLILALDIC
FT                   VEYGRCFIRKPAPFLQQHASFPFVVGLFVVLMGGNPYLLPSRKVAALGRKLSLQHPEKQ
FT                   RFTLAGSVIEYNHKGIVCWREARNIKEEILFPGQSLLWDGRYQITNHDDEAIRVGPADI
FT                   DHLKYFLKQGAMEGILNFERPHFPSLQSLLMISKSQGVDIPDLTPHLYSKRKVIIKRIM
FT                   APFDWLLSREDAAIVNVVEPLLNIE"
FT   gene            179267..181561
FT                   /gene="hflB"
FT                   /locus_tag="BARBAKC583_0168"
FT   CDS_pept        179267..181561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflB"
FT                   /locus_tag="BARBAKC583_0168"
FT                   /product="ATP-dependent metallopeptidase HflB"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by similarity to GB:CAB51029.1; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF01434; match to protein family HMM PF06480; match to
FT                   protein family HMM PF07728; match to protein family HMM
FT                   TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44829"
FT                   /db_xref="GOA:A1URA3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URA3"
FT                   /protein_id="ABM44829.1"
FT                   /translation="MNSNFRSLMIWGLIALFLIVLFSFFNGNRQRASNGEVSYSEFLQK
FT                   IDNNELKTVTIQGQKLTGQTADRRMISTYAPRDPGLVQRLNTNKVNIRAVPESSGNSIF
FT                   LNLLFSLLPVLIIVGAWIFFMRQMQGGSRGALGFGKSKAKLLTEAQGRVTFKDVAGVEE
FT                   AKQDLQEIVDFLREPQKFQRLGGRIPRGVLLVGPPGTGKTLLARSIAGEANVPFFTISG
FT                   SDFVEMFVGVGASRVRDMFEQAKKNAPCIIFIDEIDAVGRHRGAGLGGGNDEREQTLNQ
FT                   LLVEMDGFEPNESIILIAATNRPDVLDPALLRPGRFDRQVVVPNPDVAGREKILEVHVR
FT                   NVPLAPNVNLRVLARGTPGFSGADLMNLVNEAALMAASRNKKVVTMQEFEDAKDKVMMG
FT                   AERRSTAMTQEEKELTAYHEAGHAIVALNVPVSDPVHKATIVPRGRALGMVMQLPEGDR
FT                   YSMSYLWMVSRLAIMMGGRVAEELKFGKENITSGAASDIEQATKLARAMITRWGFSDML
FT                   GHVAYGDNQDEIFLGHSVARTQNISEETARMIDAEVRRLIDDAYKTATKILKTQNKQWL
FT                   ALAQGLLEYETLTGTEINEVIAGKPPSRTQGSDTAPLRTSSVPKIGAKNSKGASKSGDA
FT                   EETEPSVGTKATAASSAKKVVKNASAKSAEKKASGTQVKAATPAATSIKATSAKVASAK
FT                   AETENVASAQAATENVAMVKAATANVAKKSVESAQADDAEKKRLEEHNKSAHNKKGNLT
FT                   AGAASNTEDEK"
FT   gene            181883..182002
FT                   /locus_tag="BARBAKC583_0169"
FT   CDS_pept        181883..182002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0169"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45545"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA4"
FT                   /protein_id="ABM45545.1"
FT                   /translation="MSSKSKLLLKWPMEILAFVEIWKWDNAFNVELSALNFQL"
FT   gene            182173..182298
FT                   /locus_tag="BARBAKC583_0170"
FT   CDS_pept        182173..182298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44992"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA5"
FT                   /protein_id="ABM44992.1"
FT                   /translation="MVFQDLENSVSRELMKRVASCFVEKDKHSGGKFVTGFKQSW"
FT   gene            182309..183661
FT                   /gene="glmM"
FT                   /locus_tag="BARBAKC583_0171"
FT   CDS_pept        182309..183661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="BARBAKC583_0171"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45449"
FT                   /db_xref="GOA:A1URA6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URA6"
FT                   /protein_id="ABM45449.1"
FT                   /translation="MARKYFGTDGIRGKANIFPMTPDFAMKVGIAVGVLFRSKATSRRV
FT                   VIGKDTRLSCYMLENALVAGFTAAGMDAFLLGPIPTPAVAMLCRSLRADIGVMISASHN
FT                   AFYDNGIKLFGPDGFKLSDEKETKIEALLDSDISELPLANCEEIGRAKRVEGDIYRYIE
FT                   YAKRTLPRDVRLDALRIVVDCANGATYKAAPRALWELGAEVIAINDEPNGFNINQECGS
FT                   TDLTSLRNKVHEVRADVGIALDGDGDRVLMVDEKGQMIDGDQLIAVIAEHWHKTGRLHH
FT                   KGIVTTVMSNLGLERFLSEKGLKLIRTDVGDRYVVDMMRQKKYNIGGESSGHIILSDFC
FT                   TTGDGLVAALQVLACMKESQQPMSQLCKRFEPVPQILKNKVVHNKNVLQKSEVQAALTK
FT                   ASEHLGKEGRLLVRASGTEPVIRVMAEGDDRKAMTAIVDDLITLIARHDHD"
FT   gene            184140..184478
FT                   /locus_tag="BARBAKC583_0172"
FT   CDS_pept        184140..184478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0172"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44835"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA7"
FT                   /protein_id="ABM44835.1"
FT                   /translation="MQSKGYKGAREGFVNAERISLFIIFMLFFYKFSLQGGRKVSVKGR
FT                   RKRARLDLNKICFRFSLDLFSVLSYGREALFILCCWPLIVKGQKIQLQYNRDIVKETIK
FT                   TMQMMRVQ"
FT   gene            184498..185469
FT                   /locus_tag="BARBAKC583_0173"
FT   CDS_pept        184498..185469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0173"
FT                   /product="putative tonB-system energizer ExbB"
FT                   /note="identified by similarity to SP:P0ABU7; match to
FT                   protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45170"
FT                   /db_xref="GOA:A1URA8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA8"
FT                   /protein_id="ABM45170.1"
FT                   /translation="MGPDVAPLLEGNFPSFAAHDFSPLGMFMAADFVVKAVMVLLILAS
FT                   IVSWTIAFAKIVEITLAKRKARRALHSAQQAQTLACLVDQLQNQTGASVLFLQETLREI
FT                   SLSTQQDVSLSAQQGFISSMQQGVAGQKGVALSTMQQGFSVQKGVPLSTMQQGVSVQKG
FT                   VPLSTTQQSAAGSEEAENNNNPDILSGMLHEGVKERVHSLLSRSLLVATQRMAAGNAIL
FT                   ATIGAISPFVGLFATVWGIMNSFIGIAKTQTTRLDVVAPGIAEALLATALGLFVAIPAV
FT                   VMYNGLSRALSHYRSDLGNVAAAIERLLSRDMDRQRQQKSLQ"
FT   gene            185469..185927
FT                   /gene="exbD"
FT                   /locus_tag="BARBAKC583_0174"
FT   CDS_pept        185469..185927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="exbD"
FT                   /locus_tag="BARBAKC583_0174"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="identified by similarity to SP:P0ABV2; match to
FT                   protein family HMM PF02472"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44613"
FT                   /db_xref="GOA:A1URA9"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A1URA9"
FT                   /protein_id="ABM44613.1"
FT                   /translation="MAMNFRDDWDNAEDFELNNTINVTPFIDVILVLLIVFMVAAPLAT
FT                   SVIPVQLPSVTQEPVSHPDEPLYITLKKDESWYVGNKPVSEADFMEILSQETEQNLETK
FT                   ILINADAEIDYGYVVGVIDRVRMAGYTKIGLVGLQKTANKTVETIPAE"
FT   gene            186058..186252
FT                   /locus_tag="BARBAKC583_0175"
FT   CDS_pept        186058..186252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0175"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45044"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB0"
FT                   /protein_id="ABM45044.1"
FT                   /translation="MLREKFSGVFSQHHQLFVLSSYSSSLFWPVCWIPFFFAPLEQEVE
FT                   VISRVMAEGYRECMLLLGA"
FT   gene            186417..186563
FT                   /locus_tag="BARBAKC583_0176"
FT   CDS_pept        186417..186563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44482"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB1"
FT                   /protein_id="ABM44482.1"
FT                   /translation="MLREQFLGVFSQYHRPFSRSSHSSSLFWPVCWMPFFFAPLEQEVE
FT                   VIS"
FT   gene            186682..186813
FT                   /locus_tag="BARBAKC583_0177"
FT   CDS_pept        186682..186813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0177"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44884"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB2"
FT                   /protein_id="ABM44884.1"
FT                   /translation="MHEGEGIHVRAVWGEVCLVVARMERVRKCKCMRWGQKPAYRVV"
FT   gene            complement(187140..187673)
FT                   /locus_tag="BARBAKC583_0178"
FT   CDS_pept        complement(187140..187673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0178"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45604"
FT                   /db_xref="GOA:A1URB3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URB3"
FT                   /protein_id="ABM45604.1"
FT                   /translation="MSLQDAHNSSSPSQKLPLWVQCLEHGQGLGLPHYATEGSAGLDLR
FT                   AALPENESITLSPGQRALIPTGLIFHLSPGFEAQIRPRSGLALKNGITCLNTPGTIDSD
FT                   YRGEVKVLLINLGQEDFIIERGMRIAQTVIAPVTQVEVRLLDPNSDLTSSQTDLSNQPN
FT                   TGRGTGGFGSTGQK"
FT   gene            188468..188581
FT                   /locus_tag="BARBAKC583_0179"
FT   CDS_pept        188468..188581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0179"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44831"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB4"
FT                   /protein_id="ABM44831.1"
FT                   /translation="MLCVRGQRRVRGNMKWAILRGREDVGGSMPKGKKMVA"
FT   gene            complement(188775..189578)
FT                   /locus_tag="BARBAKC583_0180"
FT   CDS_pept        complement(188775..189578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0180"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF01988"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45388"
FT                   /db_xref="GOA:A1URB5"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB5"
FT                   /protein_id="ABM45388.1"
FT                   /translation="MFEALFSLLKRKFSTSYTDSHALTVTGPCATLYCYSNSQAPLQLS
FT                   CPLKATFPANTKDHSSQHHQRCQCFSCKNYVKILESWLPEASPASVPAIQAAYAEGAKP
FT                   TDPIHSSPKYRQRLLTWIQPGLAGLMDGSVSTLAPIFAAAFATGDTHKTFLIGLSASIG
FT                   AGLSMGFTEAAHDDGKLSGRGSPLKRGIANGIMTTLGGLGHTLPYLLSSFYAATILALI
FT                   IVFFELWAIVWIQNKFMATPFWRASLQVIVGGILVFATGILIGSA"
FT   gene            189905..190024
FT                   /locus_tag="BARBAKC583_0181"
FT   CDS_pept        189905..190024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44947"
FT                   /db_xref="GOA:A1URB6"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB6"
FT                   /protein_id="ABM44947.1"
FT                   /translation="MEGCGYVVHGLWMRCGIVCGCSAYILWIAAPFYVWDVAL"
FT   gene            complement(190035..190607)
FT                   /locus_tag="BARBAKC583_0182"
FT   CDS_pept        complement(190035..190607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0182"
FT                   /product="DsbB domain protein"
FT                   /note="identified by similarity to SP:Q7MJN7"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45540"
FT                   /db_xref="GOA:A1URB7"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB7"
FT                   /protein_id="ABM45540.1"
FT                   /translation="MVPFLSLPSFLHKHLYQTQSNKERCFWALCLTLSLLVTVGLALGF
FT                   EYIGGYLPCSLCLIERLPYYSALVFLGTASLWAWFVKTSCWVRFLFLCVGGIMACSLGL
FT                   AIYHVGIEYQLWPAPTSCGVGATRLTTNANHLLHHLNNIQPPSCSQAPGHFLFLSFAGW
FT                   NAVASLFYMLLSLFVASKGMLSKRKIA"
FT   gene            complement(190620..191240)
FT                   /locus_tag="BARBAKC583_0183"
FT   CDS_pept        complement(190620..191240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0183"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45558"
FT                   /db_xref="GOA:A1URB8"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB8"
FT                   /protein_id="ABM45558.1"
FT                   /translation="MNIKQNIKRLKNWTISLGTRRTASYWLGFIVFIESSFFPVPGDVL
FT                   YIPMSLLRPKKAYHYAFIATVCSILGGILGWYIGAYAYDSIARPVLEFYDKYDYFQALQ
FT                   THITQEMLVVCIFLSGLFHIPPIKMTTLFAGAMDIPLWLFATTSLIARGARFYFFAWLI
FT                   QRFGSQVLSFISKQWKWVLFTGLIAFGLIYGLFSTVLKYYLNF"
FT   gene            191477..191561
FT                   /locus_tag="BARBAKC583_0184"
FT   tRNA            191477..191561
FT                   /locus_tag="BARBAKC583_0184"
FT                   /product="tRNA-Leu"
FT   gene            complement(192709..192930)
FT                   /locus_tag="BARBAKC583_0185"
FT   CDS_pept        complement(192709..192930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45684"
FT                   /db_xref="UniProtKB/TrEMBL:A1URB9"
FT                   /protein_id="ABM45684.1"
FT                   /translation="MNVLQKIHKKYGILGYALVEQVVGYGLSIKELNSVKRKQNSLADH
FT                   SRDCLDLMALHWGYVKAKSLKKPHIGFS"
FT   gene            complement(192958..193614)
FT                   /locus_tag="BARBAKC583_0186"
FT   CDS_pept        complement(192958..193614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44452"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC0"
FT                   /protein_id="ABM44452.1"
FT                   /translation="MIFFQENPMKKHAHSVKTPQQKKQDVTHSKQNVAQSLKKTGKSSQ
FT                   NPGKSSQNLGSLKTQAIAIETSNPYFQPAYKESSRNPRTIIAIADAYSRPIALLYAKGH
FT                   ISRAQYKAAEHFYKYWYQIQGQAHMGFDFTRQKVDGNPPYQGKIESQIEAAKQLREIKI
FT                   QLGILGYALVEQVVGYGLSIKELNPVKRKQNSLADHLRDCLDLMALHWGYVKAKS"
FT   gene            complement(193655..196021)
FT                   /locus_tag="BARBAKC583_0187"
FT   CDS_pept        complement(193655..196021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0187"
FT                   /product="putative DNA primase/helicase"
FT                   /note="identified by match to protein family HMM PF01751"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45163"
FT                   /db_xref="GOA:A1URC1"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC1"
FT                   /protein_id="ABM45163.1"
FT                   /translation="MSTLIEVKQKLLLYVQAIAEMLLPQGRKKGNAWIIGNIHGEAGQS
FT                   LSLCLSGSKAGLWYDFAEGIGGDLLDLWCAVKGIPLSAALEEARAYLNLSRPKPFMAPR
FT                   RTYCLPPPPKGHDPSGVVKSYLHHERRIPLEILARYRIKEEGNSILFPFYKPDGTLAMV
FT                   KARRAEAGAKAKPTTAQCEPILFGWQALFPASQPASQDPLGDLSSRPAQALSSSPASQV
FT                   SLQASSQALTSSPASQAPLGNLSSRPAQAPSSSPASQVSLQTSSQALTSSPASQAPLGN
FT                   LSSRSAQAPSSSPASQTSSPASQAPLSDRVFPLTQAPLNDLSSLSVQTSPQTSIKKPAT
FT                   QTSSPLLPTQASSPASQALLSDRAFPPTQNAKQARDLVITEGEIDALSLAAYGYPALSL
FT                   PFGGGKGGKHAWIEQEFDHLEIFEKIYLATDMDPPGEEAALAIANRLGRHRCYRVCLPY
FT                   KDANDCLTAGLDAATIAQAFAKAKSFAPEGLHRASDYKEKVLELFWPNPEQHVGYSVPY
FT                   PKLEGKLSFRPAELTLWSGASGAGKSQLLSDCIPHWIAQESRLCLASLEMKGEQSLRRL
FT                   IKQTGGTSHPTKEKIEQILHFLDHGLILYEHVGKSNVETLLDVFDYCRAKYGCDQFIID
FT                   SLMRLGIAADDYTGQEQAVYKIVDWAVLNAVHVHLVAHARKSGVDKDIPGTEDIKGASE
FT                   IGANAFNIITIWRNRPLEDKIFATQQLHEKAELTKRPGVVMNIAKQRSGDFEGKVGLWF
FT                   DPQSYRYRCSPEETPWLRRYLADASPRGLTPNPVH"
FT   gene            196703..196822
FT                   /locus_tag="BARBAKC583_0189"
FT   CDS_pept        196703..196822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0189"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44431"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC2"
FT                   /protein_id="ABM44431.1"
FT                   /translation="MSEMGVVSLGHECSEFLWLVREWVFIVGDDGVMVSGLDN"
FT   gene            complement(196797..197813)
FT                   /locus_tag="BARBAKC583_0188"
FT   CDS_pept        complement(196797..197813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45379"
FT                   /db_xref="InterPro:IPR010781"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC3"
FT                   /protein_id="ABM45379.1"
FT                   /translation="MRAHEIGIYTILLNEMYARGHPLDLSTQRLARLCGCDKRTFLSAL
FT                   NILIAEGKIIPLANGLWNKRCDSIFRERAKLLEQKSLAGRSSAQKRKKINATPQQLLNT
FT                   CRTDEPYNSEAQKKEKETPNGVSQKQQDKASLSADNSSSYALYCAPSCSSPSLSSAPSQ
FT                   EPIPTASTPVMGPTLATTSKIFTSQTLMTTPTPVTSSPSVISPTCLESPIISENSALPP
FT                   KRSARKGCLRGHRLPADWQADISMAMTEGLSEEQARWQEKKFRDYWQAKSGKEALKVDW
FT                   SATWRNWCRYEIERLRDTQDTRYPTPSLPRVPSHQTNRHTGEESFYQSLINYPNQKP"
FT   gene            197896..198225
FT                   /locus_tag="BARBAKC583_0190"
FT   CDS_pept        197896..198225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0190"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44836"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC4"
FT                   /protein_id="ABM44836.1"
FT                   /translation="MEDEVVVTGEAARRGADAGAGDAGDEIAEDEDGATGGVTAGDKGA
FT                   VSKADGATGEAAGRGADAGADEATGDAVAGADRGAKDTAATASEKNNPEEGTVVEDKVA
FT                   VQRAC"
FT   gene            198315..198440
FT                   /locus_tag="BARBAKC583_0191"
FT   CDS_pept        198315..198440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0191"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45206"
FT                   /db_xref="GOA:A1URC5"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC5"
FT                   /protein_id="ABM45206.1"
FT                   /translation="MMFLCLFMSAGDAGKVYHFVRCFWFALLLLQFVLLNNLIFH"
FT   gene            198720..199034
FT                   /locus_tag="BARBAKC583_0192"
FT   CDS_pept        198720..199034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0192"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44690"
FT                   /db_xref="GOA:A1URC6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC6"
FT                   /protein_id="ABM44690.1"
FT                   /translation="MNIDGWRQRLSEVLKKSGRSKRSISLSAGKGAGYLHSILSEGKDP
FT                   TIESLSDVCKTIDVSMGYILYGQAASTEDQEFIELISKISSEERQAILTLLRKPNDEVK
FT                   "
FT   gene            199345..199758
FT                   /locus_tag="BARBAKC583_0193"
FT   CDS_pept        199345..199758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032688.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44489"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC7"
FT                   /protein_id="ABM44489.1"
FT                   /translation="MIKHIPFVKEDEILIILCDDEEGDLYIGPIENSEEVLDLVDNREA
FT                   VQRLLRLDLTTLHADDVSESVADIYVALSDMAEKTESLQPFIVNSEAYHDYLEQQNKQA
FT                   YHDTLYGSYEQQHRLRFSDVLSAYDHLFDEQEG"
FT   gene            199764..199952
FT                   /locus_tag="BARBAKC583_0194"
FT   CDS_pept        199764..199952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0194"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032687.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45198"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC8"
FT                   /protein_id="ABM45198.1"
FT                   /translation="MQSYLMTLAYGVPLYDVGRQRGTIQLDPQKHQAFLFPSQKEAEGA
FT                   VQALAYDLYDFFDEQEG"
FT   gene            199958..200158
FT                   /locus_tag="BARBAKC583_0195"
FT   CDS_pept        199958..200158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032687.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45559"
FT                   /db_xref="UniProtKB/TrEMBL:A1URC9"
FT                   /protein_id="ABM45559.1"
FT                   /translation="MQSYLMTLAYGVPLYYVGRQHGTIQLDPQKHQAFLFPSQKEAEGT
FT                   VQALAYDLYDFFDLFEIESVS"
FT   gene            200489..201226
FT                   /locus_tag="BARBAKC583_0196"
FT   CDS_pept        200489..201226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0196"
FT                   /product="putative exonuclease"
FT                   /note="identified by similarity to SP:P03697"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45590"
FT                   /db_xref="GOA:A1URD0"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR019080"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD0"
FT                   /protein_id="ABM45590.1"
FT                   /translation="MLQVMGLQECGAWYAHWRGILSGSKTMPIRVECQQGTEEWRQVRR
FT                   GVITASVFEMVIARKKDGQRSQKYHSVMMKLAGERITGKIVDEGTTVPMRRGTELEPTA
FT                   RQLYATLTNTEPECVGFLLADDRRKGFSPDALIGANGLLEIKTKKPEILIPHFYQNIFP
FT                   VEHKAQCQGGLWIAQREWVDLMLYWPGMPPLIKRAYRDEVYIRKLDNEINRFNEALERM
FT                   VQAIKQVGERSQDIFRKYETIRG"
FT   gene            201257..201400
FT                   /locus_tag="BARBAKC583_0197"
FT   CDS_pept        201257..201400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0197"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45055"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD1"
FT                   /protein_id="ABM45055.1"
FT                   /translation="MKEQLCADLSAGRELNGESLREPVSQTSLQRRLKACEESGDEVWH
FT                   GV"
FT   gene            complement(201823..201897)
FT                   /locus_tag="BARBAKC583_0198"
FT   tRNA            complement(201823..201897)
FT                   /locus_tag="BARBAKC583_0198"
FT                   /product="tRNA-Thr"
FT   gene            complement(202279..202434)
FT                   /locus_tag="BARBAKC583_0199"
FT   CDS_pept        complement(202279..202434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0199"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44705"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD2"
FT                   /protein_id="ABM44705.1"
FT                   /translation="MCNGIFILIHDILWHDIFMGSFCLSWRKLQQTLWQTFRQILANFV
FT                   RSNFFA"
FT   gene            202405..202575
FT                   /locus_tag="BARBAKC583_0200"
FT   CDS_pept        202405..202575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0200"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032682.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44966"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD3"
FT                   /protein_id="ABM44966.1"
FT                   /translation="MNKNKNTVTHKDDQRKNEKAKQREQRLAKQLRDNLKRRKEQSRQR
FT                   SPEGFRKTLSV"
FT   gene            202726..204021
FT                   /gene="murA"
FT                   /locus_tag="BARBAKC583_0201"
FT   CDS_pept        202726..204021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="BARBAKC583_0201"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01072"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45225"
FT                   /db_xref="GOA:A1URD4"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD4"
FT                   /protein_id="ABM45225.1"
FT                   /translation="MDSIKITGGNILNGVIPISGAKNAALPLMIAALLTDETLIVDNVP
FT                   HLADVECLIRILNNHGIGYAVEGRQCHTVCSDARTIYFTAKNITTIRAPYELVRKMRAS
FT                   FWVIGPLLARCQEACVSLPGGCAIGTRPVDFILEGLKALGADIAIENGYVHAKALKGLK
FT                   GASYHFPKVTVGGTHVLLMAAVLAEGKTVLHNAACEPEVTNLVQALKAMGADISGEGTD
FT                   VLTIHGVKKLHGARVCVIPDRIEAGTYAMAVAMTGGDVLLQDAVPEHLTEVLTVLEKAG
FT                   LSIEIKAEGIRVFRDPHKKMKSVDITTAPFPAFPTDLQAQFMALMTLAEGNTHITETIF
FT                   ENRFMHVQELVRLGARITLQGKTATVHGTDKLQGAQVMATDLRASVSLVIAALAAEGET
FT                   TVNRVYHLDRGFERLEEKLAQCGACIQRVTTS"
FT   gene            complement(204599..205447)
FT                   /locus_tag="BARBAKC583_0202"
FT   CDS_pept        complement(204599..205447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0202"
FT                   /product="conserved hypothetical protein TIGR00282"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00282"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44671"
FT                   /db_xref="GOA:A1URD5"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD5"
FT                   /protein_id="ABM44671.1"
FT                   /translation="MRFLFLGDIVGATGCAAVFYALPRLIQQWQLDFVVVNGENASHGF
FT                   GLSQETYHSLLTAGANVITTGNHAFHCKEALKYANYSDRFLRPANFIAGTPGKGSGIFT
FT                   AKNGARILVTNILGSVFMPCTVENPFTTADKIVSKFPLKEETDAIIVDFHAEATSEKQC
FT                   FGHFLDGRVSVIVGTHTHIPTADAQILAGGSAYLSDAGMCGDYDSSLGMDKKEPLHRFV
FT                   YQESCGSYRPAQGPATLCGLAVEVSDRTGLAEKISPLRLGPRLKTEAPDFWEPLPENFM
FT                   L"
FT   gene            complement(205450..206088)
FT                   /locus_tag="BARBAKC583_0203"
FT   CDS_pept        complement(205450..206088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0203"
FT                   /product="5,10-methenyltetrahydrofolate synthetase"
FT                   /EC_number="6.3.3.2"
FT                   /note="identified by match to protein family HMM PF01812;
FT                   match to protein family HMM TIGR02727"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44806"
FT                   /db_xref="GOA:A1URD6"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD6"
FT                   /protein_id="ABM44806.1"
FT                   /translation="MNIFMDDGLAIPRMSKDSLSIQSVRSHLRHLGFSEREKLSKDTHR
FT                   IFSYRACWHIAHTLEQKMGDISQMIVAGYWPIRSELDPGPFLEYVVSRGGRLALPAVID
FT                   DETMVFRAYSPHTPLERARFHTMSPGASSAVVTPTFILVPLLAFDRQYNRLGYGKGYYD
FT                   RAIAALKAEGHCIDLFGLGFSCQEVESIPSTEHDLVLQGIFTEKGFLER"
FT   gene            complement(207002..207640)
FT                   /locus_tag="BARBAKC583_0204"
FT   CDS_pept        complement(207002..207640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0204"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45495"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD7"
FT                   /protein_id="ABM45495.1"
FT                   /translation="MPSELPPPQSFLSLDDLIPDPRPSTSSPPSAATLFDDRTPADLSQ
FT                   TQTMEQRKEAEIARLLRELKYCANANEAQKLSKQVQRLWLQSGSETIDLLMQWAENGIS
FT                   SDNYGLALDYLDTIIALNPTYAEAWVRRAWVHIQMSDFKLAMFDLSHALKLEPRNYLAY
FT                   FELGLTMEATDRIELAIKAYEMALHYYPQMRKLQKRIGLLLDEKSPQGT"
FT   gene            complement(208027..208152)
FT                   /gene="rpmJ"
FT                   /locus_tag="BARBAKC583_0205"
FT   CDS_pept        complement(208027..208152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="BARBAKC583_0205"
FT                   /product="ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44788"
FT                   /db_xref="GOA:A1URD8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URD8"
FT                   /protein_id="ABM44788.1"
FT                   /translation="MKIKNSLKALKGRHRDNRVVRRKGRIYILNKTNPRFRARQG"
FT   gene            complement(208634..208855)
FT                   /locus_tag="BARBAKC583_0206"
FT   CDS_pept        complement(208634..208855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0206"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45568"
FT                   /db_xref="GOA:A1URD9"
FT                   /db_xref="UniProtKB/TrEMBL:A1URD9"
FT                   /protein_id="ABM45568.1"
FT                   /translation="MLIPPFLALLFLPLFDSPSALLLKPLSFPAPCQLPLSLSSTRPLF
FT                   ISISFLAPLSCSPLYFCLPLLLPLFLIL"
FT   gene            complement(208863..209105)
FT                   /locus_tag="BARBAKC583_0207"
FT   CDS_pept        complement(208863..209105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0207"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44982"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE0"
FT                   /protein_id="ABM44982.1"
FT                   /translation="MLIPPFLAFLFLPLFDSPSALLLKPLSFPAPCQLPLSFSPTRPLF
FT                   ISFLASHSFSASSSPLASPPSLAYFLLLPWLLRHP"
FT   gene            complement(209516..210667)
FT                   /gene="purK"
FT                   /locus_tag="BARBAKC583_0208"
FT   CDS_pept        complement(209516..210667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="BARBAKC583_0208"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF02222;
FT                   match to protein family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45561"
FT                   /db_xref="GOA:A1URE1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE1"
FT                   /protein_id="ABM45561.1"
FT                   /translation="MVMNISDPLKPGSTIGLIGGGQLARMLAIAAAELGFQTIILCPEV
FT                   QCPAAQTANNHIVADYDDQAALQRLIDLCDVVTYEFENLPVTTIQWIEKACRLYPSSKA
FT                   LEISQDRVLEKNFLNEHGIATASWHAVQDQASLLAGLSALNSHELNNNGLNNDGFRGHG
FT                   LLKARRFGYDGKMQQSLHNPSPQVIAALSTELEKTPSILEEIVPFVAEISVIAARDPHG
FT                   ALVFYDCSENQHKNGILHKACVPSAVPQSVQKAAYEVSTRVLQALEYVGVLCIEFFVLS
FT                   DGQLLVNELAPRVHNSGHWTQKACVISQFEQHIRAICGLPLGNTERHSNCEMINLLGNN
FT                   LDDYVSALMQENTSVHLYGKKSVQPERKMGHIIRLTGPATHSV"
FT   gene            complement(210676..211173)
FT                   /gene="purE"
FT                   /locus_tag="BARBAKC583_0209"
FT   CDS_pept        complement(210676..211173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="BARBAKC583_0209"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44538"
FT                   /db_xref="GOA:A1URE2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE2"
FT                   /protein_id="ABM44538.1"
FT                   /translation="MAQQSYDVALLMGSQSDWQTMCHSAAMLTELGISYSAHIVSAHRT
FT                   PDRLYSFAKGAKAAGFKVLIAGAGGAAHLPGMVAALTPLPVFGVPMESHTLSGQDSLLS
FT                   IVQMPAGIPVGTLAIGKAGAVNAALLSAAVLALSDDALAKRLEAWRHQQTTHVAEYPND
FT                   GL"
FT   gene            211621..211743
FT                   /locus_tag="BARBAKC583_0210"
FT   CDS_pept        211621..211743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0210"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45164"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE3"
FT                   /protein_id="ABM45164.1"
FT                   /translation="MEKEALRDERCSDGWLSGMQAKGEYLSREQESGENVHGGT"
FT   gene            212182..212400
FT                   /gene="infA"
FT                   /locus_tag="BARBAKC583_0211"
FT   CDS_pept        212182..212400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="BARBAKC583_0211"
FT                   /product="translation initiation factor IF-1"
FT                   /note="identified by match to protein family HMM PF00575;
FT                   match to protein family HMM PF01176; match to protein
FT                   family HMM TIGR00008"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45031"
FT                   /db_xref="GOA:A1URE4"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URE4"
FT                   /protein_id="ABM45031.1"
FT                   /translation="MSKEEVLEFSGVVIELLPNAMFRVKLENDHEIIAHTAGRMRKNRI
FT                   RVLAGDKIMVEMTPYDLTKGRITYRYK"
FT   gene            212877..213539
FT                   /gene="maf2"
FT                   /locus_tag="BARBAKC583_0212"
FT   CDS_pept        212877..213539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf2"
FT                   /locus_tag="BARBAKC583_0212"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45450"
FT                   /db_xref="GOA:A1URE5"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE5"
FT                   /protein_id="ABM45450.1"
FT                   /translation="MEIELVLASASPRRLELLAQIGLKPDHVCATDIDETPHARENPAD
FT                   LAKRLAQEKALKAYDILFSTEQICEQDLTREQDLDSKKCLILAADTVVAVGGSILPKPN
FT                   GEEDAYTCLRALSRQAHKVYGAVCFLNEHREKTVTLVETCVRFKHLTPPMIEAYIASGE
FT                   WQGKAGGYAIQGKAAAFVIDVAGSYTNVVGLPLAETTDLLIAYGYPVFPQWTKIFEG"
FT   gene            213698..213880
FT                   /locus_tag="BARBAKC583_0213"
FT   CDS_pept        213698..213880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to SP:P67480"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44463"
FT                   /db_xref="GOA:A1URE6"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE6"
FT                   /protein_id="ABM44463.1"
FT                   /translation="MQNQPIHPLRPPRPCPECGQKSQYNTYPFCSSRCRAIDLNRWLSG
FT                   SYILPPPSQESDEEE"
FT   gene            214274..214390
FT                   /locus_tag="BARBAKC583_0214"
FT   CDS_pept        214274..214390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0214"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45154"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE7"
FT                   /protein_id="ABM45154.1"
FT                   /translation="MCLILDQGHLRPGSGGETLRFGREVWKRESAAPWSLRC"
FT   gene            214740..214853
FT                   /locus_tag="BARBAKC583_0215"
FT   CDS_pept        214740..214853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0215"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44917"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE8"
FT                   /protein_id="ABM44917.1"
FT                   /translation="MGKWLKGGLAKSLAKRDKKGKRSFIKGSLKGSDGGKG"
FT   gene            214858..217458
FT                   /gene="clpB"
FT                   /locus_tag="BARBAKC583_0216"
FT   CDS_pept        214858..217458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="BARBAKC583_0216"
FT                   /product="chaperone ClpB"
FT                   /note="identified by similarity to SP:Q7CEG6; match to
FT                   protein family HMM PF00004; match to protein family HMM
FT                   PF02861; match to protein family HMM PF07724; match to
FT                   protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45650"
FT                   /db_xref="GOA:A1URE9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1URE9"
FT                   /protein_id="ABM45650.1"
FT                   /translation="MNLEKYSEQLKIFLQTAQSNALSSDNQQLMPEHLLQVFLEDRQGL
FT                   TVSLIQKASGDMPTLRKMLQEALDALPKVQGGNAQLYMSQPLAKVFTMAEELAQKAGDQ
FT                   FVTVERVLQALSIEKTAKTADILTRAGVTPQALNQAINTMRKGRTTSSPHAESHYEALQ
FT                   KYARNLTQDAREGKLDPVIGREEEIRRAIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAL
FT                   RIINGDVPESLRDKQLYALDMGALIAGAKYRGEFEERLKAVLAEVQNENGQIILFIDEL
FT                   HNLVGAGKTDGPMDASNLLKPALARGELHCVGATTLEEYRKYVEKDPALARRFQPVFVP
FT                   EPTLEDTISILRGIKEKYEQHHKVRLADNALIAAARLSDRYISNRFLPDKAIDLIDEAA
FT                   ARVRMQIDSKPEELDVIDRRIVQLKIEREALKTEIDPTAKERLEILQTELNILEMQSAR
FT                   MTMAWQGEKQKLGHAADLKKRLEEARNALAIAQRNGQFQRAGELAYSVIPELERQLSVA
FT                   ENDDQANTLVEETVSAEHIAQIVSRWTGIPVDRMLVAERDRLLQMEEDIGKRVIGQSEA
FT                   VRAIARAVRRARAGLQDPNRPIGSFMFLGPTGVGKTELTKALATFLFQDHKAMLRIDMS
FT                   EYMEKHAGARLIGAPPGYVGYEEGGVLTEAVRRRPYQVILFDEIEKAHPDIFNLLLQVL
FT                   DEGRLTDSQGNTVDFRNTLLIMTSNLGAEFLTNLDEGESVDQAREDVMKVVKSAFRPEF
FT                   LNRVDEIILFQRLQRKDMEAIVDIQIEQLQNLLNERKITVQMDGEAKQFLAHKGYDPLY
FT                   GARPLKRILQREIQDPLAEKILLGQIPEGASVHITKEGNELQFSAFQKPQKKAQ"
FT   gene            217705..217902
FT                   /locus_tag="BARBAKC583_0217"
FT   CDS_pept        217705..217902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0217"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45668"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF0"
FT                   /protein_id="ABM45668.1"
FT                   /translation="MGGFWTLMFLLSIFGGAGLLSKKSDNAGTSGGSSQVASLQASSTV
FT                   EAVSTADAVSTTVEVFSTFV"
FT   gene            218145..218487
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0218"
FT                   /note="chaperone ClpB, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:Q7CEG6"
FT   gene            218734..218949
FT                   /locus_tag="BARBAKC583_0219"
FT   CDS_pept        218734..218949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44466"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF1"
FT                   /protein_id="ABM44466.1"
FT                   /translation="MGGFWTLMFLLSIFGGAGLLSKKSDNAGTSGGSSQVASLQASSTV
FT                   EAVSTADAVSTADAVSTTVEVFSTFV"
FT   gene            219192..219532
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0220"
FT                   /note="chaperone ClpB, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:Q7CEG6"
FT   gene            219843..220043
FT                   /locus_tag="BARBAKC583_0221"
FT   CDS_pept        219843..220043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0221"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44989"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF2"
FT                   /protein_id="ABM44989.1"
FT                   /translation="MKLSKESEAVQASGDSSEGVPSGVSHTADTVTAADTSSIADALTT
FT                   PEVVSVADALSTAAEVFSAFV"
FT   gene            220253..220551
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0222"
FT                   /note="chaperone ClpB, degenerate; this region contains one
FT                   or more premature stops and/or frameshifts which are not
FT                   the result of sequencing error; identified by similarity to
FT                   SP:Q7CEG6"
FT   gene            220520..220678
FT                   /locus_tag="BARBAKC583_0223"
FT   CDS_pept        220520..220678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0223"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45484"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF3"
FT                   /protein_id="ABM45484.1"
FT                   /translation="MTLLKGGRAYNLNSLNILTFFSSFAKILLGQIPEGASVHITKEGN
FT                   ELQLSAF"
FT   gene            220931..221089
FT                   /locus_tag="BARBAKC583_0224"
FT   CDS_pept        220931..221089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44754"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF4"
FT                   /protein_id="ABM44754.1"
FT                   /translation="MDLNMNMSAVLNVMEPLVQEFVGVGPKQVASAVIEHLPNLLSWGM
FT                   DAVLTIL"
FT   gene            222089..222208
FT                   /locus_tag="BARBAKC583_0225"
FT   CDS_pept        222089..222208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0225"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45660"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF5"
FT                   /protein_id="ABM45660.1"
FT                   /translation="MRRFIMLFETIAFTVLWIIGGMAFAVKMAEWVNGTPASS"
FT   gene            223488..223844
FT                   /locus_tag="BARBAKC583_0226"
FT   CDS_pept        223488..223844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45179"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF6"
FT                   /protein_id="ABM45179.1"
FT                   /translation="MTHEKFFPPWNKDDNSLRIPGRGQPKDACNQTTKLLKDAILIAAE
FT                   QAGYHHGQEGLVSYLQYHALNNPVPFFSLLAKVLPLQITEEEESDVKTISRIEIVPVVS
FT                   KKSAQDTKTFTEIS"
FT   gene            225008..226216
FT                   /locus_tag="BARBAKC583_0227"
FT   CDS_pept        225008..226216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0227"
FT                   /product="putative phage terminase, large subunit, PBSX
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45364"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF7"
FT                   /protein_id="ABM45364.1"
FT                   /translation="MSAVIGYRYGKAGERGVILCARQFQNSLNESSLEEIKRAIEAYPF
FT                   LRDYYDVGDKYVKSKDGRILYTFAGLDRNISSIKSMGRILLCWVDEAEPVTETAWQTLI
FT                   PTLREEGQDWHSELWVTWNPLRENAPVEKRFRLTKDPNIKGVEINWRDNPQFPDKLNRD
FT                   RLADLHQRPEQYGHIWEGDYLQAVQGAYYQKLLLDAEQEGRIAHVSRDPLIQIKIFWDI
FT                   GGTGAKADATALWVAQFIGREIRILDYYEAQGQPLSEHIGWICHRGYDKALMVLPHDGA
FT                   TKDRVYNVSFESALQQAGFQTKIIPNQGLGAVKMRIEAVRRLFPAMWFNRETTKAGRKA
FT                   LAWYHEKRDEQRNIGLGAEHDWASHGADSFGLLCVAYEQPTLQPRKNVYHRRPPSQTSW
FT                   MAF"
FT   gene            226952..228838
FT                   /locus_tag="BARBAKC583_0228"
FT   CDS_pept        226952..228838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44534"
FT                   /db_xref="InterPro:IPR032427"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF8"
FT                   /protein_id="ABM44534.1"
FT                   /translation="MDGFLMNQQISSFELIEPIAHQALFKKLVRWYQDDIAHVEQWRKN
FT                   AQEDYNFYNGRQWNEQDLAVLREQNRPVMTFNRIAPLVNAVIGAERNNKRHVQFIPRQE
FT                   GTALANQILTGAAEWFRDEADGEYEDSDAFQDAIICGMGWTDTRLDYDEDPQGKPIIAR
FT                   LDPMKMVWDTSAVKPNLIDAQRVWYIDEKPLSVAQAMFPHIDWRDLDADWVKHPTQAYN
FT                   EDDALQLQDNAEDDLCQEDVKMVTLAECRWFEREVIYKVLHPQTGQFVDYSEQDFQRLK
FT                   QESPHLQATRLTRKIVKRAFLGKKLLEEPDQPLVPPSQLGWECITGYFDKLSRQFYGVV
FT                   RPTKDPQRWANKYFSQVMHLLNSQSKGGVMAERDAFDDDRQAMESWARAESITWLKSGS
FT                   LAAGRIQPKPVAQFPAGFFQLFNEAKGAISQVTGLSPEFVGTRSVNQPGVLEEQRRQSS
FT                   LNLLASFFDALRRYRQRQGKIILYLIQNYLSDGRLVRIAGEDNAQYVPLTREMFTSLEY
FT                   DIIVDDAPTSPNEKERTFAMIMQILPLMQNFTTPDMMLDLLRYSPLPASLIQKIALRVQ
FT                   KQQQASDGHPDDSHNNHNVQQHNIQQGSETEQILQAVMQGMMTSGSNGTRRL"
FT   gene            229424..230368
FT                   /locus_tag="BARBAKC583_0229"
FT   CDS_pept        229424..230368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0229"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45529"
FT                   /db_xref="UniProtKB/TrEMBL:A1URF9"
FT                   /protein_id="ABM45529.1"
FT                   /translation="MDEEALTAMDEETFTLEEQSQFLQDSLHAGVEDEEESTFWAEDRE
FT                   DNEGVQGGEVPPDPQKDFIGYIQWLGKELQAKRDSQTHGEGKRKAGGFEVGRGEVGGKG
FT                   IGKREVKELEAGGKEAGEVTAEEVEVSKKEIREIIVGGKEVGAKDVGANASLQEAEQLR
FT                   SFFHQSSAAIKQKHHDFDQAANFVYDMRATQLAACAALYPEMADPKVVEAIIGDELKTI
FT                   LRDCAHKNQNPAEVIYTIAQKIGYTAPQTETIDTLQAKHNSARTLAAYNGLSPSGPISL
FT                   EMLDKMSEAEFSVWIDDPKNKTTFNRLMGGVDI"
FT   gene            230650..231825
FT                   /locus_tag="BARBAKC583_0230"
FT   CDS_pept        230650..231825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032664.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44834"
FT                   /db_xref="InterPro:IPR025267"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG0"
FT                   /protein_id="ABM44834.1"
FT                   /translation="MTVTHIGLNDPLAVRTWSKLLNREVSKAIPIAPLIGKDSNSIVQL
FT                   KDETNKASGDAISFGLRVQLLGDGVSEGQALEGNEEALQFLNDRLAINELVHAVRVKSE
FT                   GTIDQQRVLHNLRTEAKNGLVDWYADRLSMMFFIQVCGYTAKIINFEGRTLTLKPVHYG
FT                   FNTPTAPTDKRIVRPNGKTKDEDLKENDVFDLKLIDKAVERAKLANPKIRPVRIDGENV
FT                   YVLYLHPTQVTQLRTNTDIGQWLDITKAVYSGTRAKNPLYSGSLGMYNGVILREAEHVT
FT                   EGVATGSAGKTSDSSKNASGNAAQDAGGAPVASVRRAVLLGAQSAVIAFGKDRGATRYK
FT                   LVEELFDYEREFGVAAKTIIGMKKTCYHLPNSEQGEQDFGTIVIPTYAVPA"
FT   gene            231904..232029
FT                   /locus_tag="BARBAKC583_0231"
FT   CDS_pept        231904..232029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0231"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44432"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG1"
FT                   /protein_id="ABM44432.1"
FT                   /translation="MAPLMLFDFINLISALETFPPAFVVGRLFKQGGVDGPFDAV"
FT   gene            232244..233227
FT                   /locus_tag="BARBAKC583_0232"
FT   CDS_pept        232244..233227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0232"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45324"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG2"
FT                   /protein_id="ABM45324.1"
FT                   /translation="MTVTPVDPYQTMTNFQSSPFDVTKADCAKTLARMVMLIQDEIDDP
FT                   MAEYAVQIQDSIMAALRLCEREPFFFNEKKEITLKIQVGKTWYGAEDHPFIGAMMALES
FT                   VFLENPAAGQTQLLYKNAESLYKSYGDDGYFSRGEGSGIGSGDGEDKGSEGPEGSMDNG
FT                   HSSEDGRGEGSGDGEDKGSKGPEGSMDDRHSSEDVRDEGSGDGEDKGSKGSGAFSNLLQ
FT                   GTPIFYTFWQHKLGLFPTPNKVETVRLCYVPFRFDEGACIQEDNPWLIYAFDLIKARAK
FT                   YELYKNILKDPEYAAVSFNDFQEQLQILRSQTSRSKGHTTILATGF"
FT   gene            233396..234859
FT                   /locus_tag="BARBAKC583_0233"
FT   CDS_pept        233396..234859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44792"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG3"
FT                   /protein_id="ABM44792.1"
FT                   /translation="MAFFSIAEYRPDVADINGLFTDKLINVLPADGSYIPMPNFSPLSE
FT                   PFPGSILGAIAVRTKNGVSVIVGSENKLYLLDNTTFQWKDISQKGKAYLANVDAPWSFA
FT                   LFGDYVIAVNANDKPQVIDIRYDYTFRNLGGNPPQAGIVRVWGDFVCLMKLSDHPRRVH
FT                   WSGLNDAEFWTVGKKSCDYQDFPDGGYVQGATETTNPIIFMRSAIYAGSFIPGSKIIFS
FT                   FQKIHDKRGAKNSESIVCRGDTAFFVDEGGFFQIANDGHITSIGFEKIDRTMTKKINKS
FT                   YLPMMWAAIDGVYNRVYWMIDNDDHKKEHTLLIYDWGLQKWTIANVNVSIILPIFFSGY
FT                   TLEGLDKISCSLDDLPFSLDSKAWKNEIPVLGAFNYEGRLGSFSGEPMACVVTSQEMGQ
FT                   TNGSMTRVNSIMPQVNSAQCYVTVGVRLHQALEEDVVWLPERQPSRNTGQIHCRARGRF
FT                   YRFQLRIPAGAQWSHVTGFDVTSKPAGRR"
FT   gene            234856..235890
FT                   /locus_tag="BARBAKC583_0234"
FT   CDS_pept        234856..235890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0234"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45537"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG4"
FT                   /protein_id="ABM45537.1"
FT                   /translation="MMIFLRRRFRTRCGGRSACRGNCGGKAVGEKYGGEAVYGKNCRGK
FT                   KPVAGGLGGEAIGIVSPLKGALEEGEGGLKGAQKGRDGSEAVEKKYGGEAICGKNCRGE
FT                   EPVAGGFGGEAIGIVSPLKGALEEGEGGLKGAQKRRYGSEVVGKKYGGEAICGKNCRDE
FT                   KPGAGGFGGEAIGIVSPLKGAPEKSEGGLKGPKGASDGGYSLHLTHEWPWEKIEPYQGS
FT                   INAAMNKYAKRFPDDVCLQSVAQEIANGQTQLWLILKNETDFSAVSITKIETTHTGKKR
FT                   VVLLDLAGEGGLDLVPLIQHLEDWARTLKADEMLTMGRIGWAKRLRRHGHTFNLIHYRK
FT                   VFNR"
FT   gene            235887..237065
FT                   /locus_tag="BARBAKC583_0235"
FT   CDS_pept        235887..237065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44914"
FT                   /db_xref="GOA:A1URG5"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG5"
FT                   /protein_id="ABM44914.1"
FT                   /translation="MSRRTTTPQAQTTTQTNAPPAWATDIFKKAAADALNLYNKGIGEH
FT                   AYQGERYAGLSETTQNAIKGLSEAAQKYSASPLNDWLKGPTNSVTNLSDMAAGNLIGNN
FT                   NKFQEALNNALSKTSDSINQSMAGAGRYGSGAHTGVLTDELGALATKANAQQYNQDVQN
FT                   MINANKLIDGSMNDQINAANNFYQGQSHAQSSALKGGALQDADRQSALDAEREKWTEQE
FT                   NQAWNRLEKLLQAGVASAGNYGTKTGQSTTMPSVTKDPLSDAMRWLGLIKGVAGLSDVR
FT                   MKDNIVPIGQKNGYPLYEFNYKGGAQRYRGVIAQDVLRLNPDAVHCDEKTRLLYVYYNK
FT                   LGFNMETVDAKVSVDAPKERQMTHPRKGTFLSLLLALLACLPGFSFWKKGDV"
FT   gene            237065..237259
FT                   /locus_tag="BARBAKC583_0236"
FT   CDS_pept        237065..237259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0236"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45631"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG6"
FT                   /protein_id="ABM45631.1"
FT                   /translation="MSSIYDWSLQAPKNANADEIINWAEGQPPSSVNDSACAVMQRIRE
FT                   YLPDHGGSIEFGFWKKGDV"
FT   gene            237259..237453
FT                   /locus_tag="BARBAKC583_0237"
FT   CDS_pept        237259..237453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0237"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45355"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG7"
FT                   /protein_id="ABM45355.1"
FT                   /translation="MSSIYDWSLQAPKNANADEIINWAEGQPPSSVNNSACAVMQRIRE
FT                   YLPDHGGSIEFGFWKKGDV"
FT   gene            237453..238424
FT                   /locus_tag="BARBAKC583_0238"
FT   CDS_pept        237453..238424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0238"
FT                   /product="putative phage protein"
FT                   /note="identified by match to protein family HMM PF07484"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44694"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG8"
FT                   /protein_id="ABM44694.1"
FT                   /translation="MSSIYDWSLQAPENANADEIINWAEGQPPSSVNDSARAMMQRIRE
FT                   YLSDHGGSIETDFTVNETDNHTSIKLVTKSSLTVYHDEIVVRFKAQENNIGTTSVILNQ
FT                   LSAQPVYKTTGNGVEPLSGGEIQKGGLYELVYHCGLAGKDCDGWYLTNPTIIFPELFPS
FT                   GFIATFAMKTLPAGWLVCDGKEYQRDAYPALFTAIGEVWGKGDGKTTFNVPDFRGMFLR
FT                   GLDSGREIDKDRLFASQQDESFKAHTHEGTANAAGEHQHIYQQLMRTTSGSTTSMHLRY
FT                   FAPFKDVWTSSAGIHTHTLTLKETGGEETRPVNVAVVYAIKT"
FT   gene            238814..239101
FT                   /locus_tag="BARBAKC583_0239"
FT   CDS_pept        238814..239101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0239"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44808"
FT                   /db_xref="UniProtKB/TrEMBL:A1URG9"
FT                   /protein_id="ABM44808.1"
FT                   /translation="MAFFPFSIADINDPEQIRVVFYANGRMGHAPLNALLNQMHKRVER
FT                   TDKKTNKNYVKMEQRISALEDCVTTIMESKKYDDEKAKGDGKSDDPSPTL"
FT   gene            239158..239820
FT                   /locus_tag="BARBAKC583_0240"
FT   CDS_pept        239158..239820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0240"
FT                   /product="phage lysozyme"
FT                   /EC_number="3.2.1.17"
FT                   /note="identified by match to protein family HMM PF00959"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44851"
FT                   /db_xref="GOA:A1URH0"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR033907"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH0"
FT                   /protein_id="ABM44851.1"
FT                   /translation="MRKISKEGFALLQQWEGLRLEAYQDAVGIWTIGHGHTTGAGAPFV
FT                   RKGMKITKAQAEAILRRDLVQFEKAVEQGVFQPLTDEQFAALVSFCYNVGVEAFCQSTL
FT                   LKKLNKGDYEAVPAELQKWTRAGGKRLKGLVHRRAAEAGLWAKGAYVSSNYQKVETVEK
FT                   LSLLNVEILAPIIGSFSGLTGFFTGYGPVQWALAVVMVTAGIVGVFVYIARMREEKR"
FT   gene            239817..240068
FT                   /locus_tag="BARBAKC583_0241"
FT   CDS_pept        239817..240068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44582"
FT                   /db_xref="GOA:A1URH1"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH1"
FT                   /protein_id="ABM44582.1"
FT                   /translation="MTLLSRWGVMMTALFFVAFTSFFYGRSFERGKSLINAISSFQNRE
FT                   KINDEIFALSPFHLCLALGGMPEECADILRRVEQATLD"
FT   gene            240061..240201
FT                   /locus_tag="BARBAKC583_0242"
FT   CDS_pept        240061..240201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45306"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH2"
FT                   /protein_id="ABM45306.1"
FT                   /translation="MINKPADLVKTEPLLSRWIVATDRFGQQQKCWGILLKPHYSLTER
FT                   F"
FT   gene            240712..241098
FT                   /locus_tag="BARBAKC583_0243"
FT   CDS_pept        240712..241098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45144"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH3"
FT                   /protein_id="ABM45144.1"
FT                   /translation="MIVSVTLFVSVLLLCFVIIKNVIPSFSTQEVKQQSFVPLAIPTFD
FT                   LFVYCKEISASVMPSMRSEVYQRCLQLESETYLSIRALWNQIANTAKKKCIKMIRPGDG
FT                   NYFLLYDCLINEKDGENNKIRNYF"
FT   gene            241442..241558
FT                   /locus_tag="BARBAKC583_0244"
FT   CDS_pept        241442..241558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44541"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH4"
FT                   /protein_id="ABM44541.1"
FT                   /translation="MGLWWWVCTDGGKVKFFRASLNLSKFCKVGEAADYLRR"
FT   gene            241613..241837
FT                   /locus_tag="BARBAKC583_0245"
FT   CDS_pept        241613..241837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0245"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45567"
FT                   /db_xref="GOA:A1URH5"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH5"
FT                   /protein_id="ABM45567.1"
FT                   /translation="MGVSATDMRNFALKNVIFRWQREGKFLKGSKASFKILIIWRLLGF
FT                   LSLKVMWGLRCGRDTFKKESYFLSKIRRG"
FT   gene            242017..242145
FT                   /locus_tag="BARBAKC583_0246"
FT   CDS_pept        242017..242145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0246"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45008"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH6"
FT                   /protein_id="ABM45008.1"
FT                   /translation="MLFLLSDCCYFPTPMVVFFNKYGLFEKTLGILCEYRYDSTNY"
FT   gene            242345..242995
FT                   /locus_tag="BARBAKC583_0247"
FT   CDS_pept        242345..242995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0247"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45270"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH7"
FT                   /protein_id="ABM45270.1"
FT                   /translation="MRPQQNRRVRGHNNNNNNHRRNPNPLSRNYESNGPDIKVRGNAQQ
FT                   IADKYISLSYDAQGAGDRVMSENYLQHAEHYLRIILAAAGQMPPQNQRDENLEQECEDG
FT                   KTDGTKKEELNGEKPVSYAQVPRKNDRRKGREKPQQNGDASEIHTVADANGSLEQPPVA
FT                   KKPPAVKKAHLAEFSESEDEEIDTVVSLPSIKEEVRKKPRRRPSPPSYVEEKL"
FT   gene            complement(243152..243667)
FT                   /locus_tag="BARBAKC583_0248"
FT   CDS_pept        complement(243152..243667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0248"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44720"
FT                   /db_xref="GOA:A1URH8"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH8"
FT                   /protein_id="ABM44720.1"
FT                   /translation="MAKDKQMQTQQDSYDSRLKTLEHPLHQEPPLDPAVEEVRKKLMRL
FT                   MIVSIAITIILILAVFAGVVYKIMTPEPRSHKISAPTQERLSALYKDHPHTAHHTLSLP
FT                   QGAKIVSQSLAGRMLSLQILMPDGKIKLMIYDYYTGVLLAVFSVVSEKTTLTTLPQEEL
FT                   RLSPPQDD"
FT   gene            complement(243884..244912)
FT                   /locus_tag="BARBAKC583_0249"
FT   CDS_pept        complement(243884..244912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0249"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF07536"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45131"
FT                   /db_xref="GOA:A1URH9"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1URH9"
FT                   /protein_id="ABM45131.1"
FT                   /translation="MERIIFMMSITPVSTFPVEKSHLSALMQAIRNADMCVLYQTTNLT
FT                   YLWAENLPKHLYNQWYVGCRDRDFLSIDLANQMETIKLQLLATGKMQTIEVQFENKTKQ
FT                   ATWYQFSIDCHRNDSGEIIGVITTGIEISSLCRCEQVLKILLKEVSHRSKNLLAIIQSI
FT                   ASQTARYTESLQTFLRKFQGRLHSISHSQDLITASDWRGAKFRELVRSQTLDYSTKEVE
FT                   QLSIEGSNPYLFPNAALHIGLAFHELIVNSYSFGALSQNGGHICIRCDIQTQICGQTQL
FT                   LITWSENITTKTLVPSYQNACFGSTILEKIVPTAVNGSASLQLTQEGVFYCLCVPDNYF
FT                   DI"
FT   gene            complement(244912..245706)
FT                   /locus_tag="BARBAKC583_0250"
FT   CDS_pept        complement(244912..245706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0250"
FT                   /product="sigma-70 dependent response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF08281"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44661"
FT                   /db_xref="GOA:A1URI0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI0"
FT                   /protein_id="ABM44661.1"
FT                   /translation="MPLSTRIAPHLPYLRRFARSVTGSQSSGDAYVAAMLEALITDISI
FT                   FPQVSSDRIGTYWLFCHLFDQTTPNIAEPLPQFGFEQQANIQLSYLTPRARQAFLLIAV
FT                   EGFNEREASEIMNIDTQTFHHFLNQASLDISEQMTTQILIIEDEPLIAMDIEQMVESLG
FT                   HKVVGVARTSEEAMAMFQQKRPRMILADIQLADSSSGIDTVNDILKNECIPVIFITAFP
FT                   ERLLTGERPEPTFLVSKPFNPDMVKALISQALFFQENASKAA"
FT   gene            245912..246151
FT                   /locus_tag="BARBAKC583_0251"
FT   CDS_pept        245912..246151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0251"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45249"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI1"
FT                   /protein_id="ABM45249.1"
FT                   /translation="MNNCGEKNLTDRCAFRDNLFGVNREIALKLRQFYMSIQEEAIPAH
FT                   FLDLLEKLDQAEQANDLRNTKKGLILYDNRCEKF"
FT   gene            246126..246545
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0252"
FT                   /note="putative RNA polymerase sigma factor, degenerate;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error"
FT   gene            246542..246688
FT                   /locus_tag="BARBAKC583_0253"
FT   CDS_pept        246542..246688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45571"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI2"
FT                   /protein_id="ABM45571.1"
FT                   /translation="MSPSGLFYENSAARCHLVVGVIKVVFVERMVFYGNFLRSNVNMRI
FT                   EST"
FT   gene            246688..246804
FT                   /locus_tag="BARBAKC583_0254"
FT   CDS_pept        246688..246804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0254"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44524"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI3"
FT                   /protein_id="ABM44524.1"
FT                   /translation="MGEKFCWLENRVKPHNHDVMLDEAPQVNGSAIGMPEKT"
FT   gene            247061..248503
FT                   /locus_tag="BARBAKC583_0255"
FT   CDS_pept        247061..248503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0255"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF02518;
FT                   match to protein family HMM PF07568"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45233"
FT                   /db_xref="GOA:A1URI4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI4"
FT                   /protein_id="ABM45233.1"
FT                   /translation="MTAFSKRSSLSSTTPRWRWGCVIISLLMAILASFLIALLSNTVDQ
FT                   ELEQLNISSELREQADLMLISLVDMATANRRYEDTRLVEDKTFFAKAVRDLEDLLKYTS
FT                   LIVYSHPEWYDWFTSFKKEIEVRKHSMITHMAALDAFHGPSAESPSFPEITKLQMARLP
FT                   QLMTRFINGDGLSRQKQREGITIMRTTLTLAAIVSVVSSFLLAYIVINRFYRDVYSLKT
FT                   YQLLLHTENSALEARVKERTEKLEKARNHAEKERQRVEMLLQDASHRIGNSLSIVSSLL
FT                   ALQMNRSQNEEVRSILGAARDRVQTISTAYRRLRLNDDMETTLLADFLNSVVHDVELAV
FT                   PFELRENITIHTDFKDCRLSARDATTLGIILGELLTNALKYAFPDQRPGNLYISFGSQD
FT                   DGRMVLTVVDDGVGMSSQNVEGKTGFGEKTGLGHLVIEQLCMQFGAKPLFETSELGGTK
FT                   VTIPLPKLTTHDDTKKDDESVS"
FT   gene            complement(248644..250584)
FT                   /locus_tag="BARBAKC583_0256"
FT   CDS_pept        complement(248644..250584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0256"
FT                   /product="M23 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44682"
FT                   /db_xref="GOA:A1URI5"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI5"
FT                   /protein_id="ABM44682.1"
FT                   /translation="MWDNQYQKNDPGQEPALVLSRSKPEHRQVSIRWLTGTALTGVTAC
FT                   FLMGIALFTALDGQQRLVTPAQWFDLAYFPDEKTPDKGDRIAPTRARQSFDSKRQFEVS
FT                   ILQHQGDKKVVQTQNFEWIRMALAEERLHKYTYPKFDALSIFADDSKNQAIKLQTGGQI
FT                   YGTKTQTKMTLRSRPLNTYIEKFNQGDVLTADEVQQEIRKAGFDLEYNNEYFPILPFID
FT                   PLQLDDLFSSLEFSELPEVRVFQENVTISPQNHRIEVAHNYAEDIIPIHKKQTILEALK
FT                   DLKYTEEQIQLVAETLATFHNSNWLNEGNLLRIGVVTHLGEEDTIVRVSIYKGMSHKIT
FT                   IALDDYNQFVESTEPEMSHALKTAFQKGIPHPYVSTAKLPTVYDAIYHAILSHNLSNTL
FT                   SQHLVRLLATDIDMKSRITPTDQLEIFYAVPEQNDTDGQNADAPMNPDPEIRYVSATFG
FT                   NVTYKYYRYQAEDGTIDYYNFEGKSSKPFLLRKPVPNGAFVSPFGPRKHPILGYVRMHT
FT                   GVDWSAPKGSPIIAVGDGVVKQMKGTRGYGNQTVIQHANGYVSSYAHQQAYAPGIKPGV
FT                   KVRQGQIIGYVGSTGLATGPHCHFEIIVNGTQVDPMRIRLPDSRILTNQDLQAFLREKQ
FT                   NIDSLVASPVT"
FT   gene            complement(250710..250865)
FT                   /locus_tag="BARBAKC583_0257"
FT   CDS_pept        complement(250710..250865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0257"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44814"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI6"
FT                   /protein_id="ABM44814.1"
FT                   /translation="MTAKLTHNQMLVFNLLKTEKAPLSAYEILDRLHEKGLKAPLQVYR
FT                   ALKKLI"
FT   gene            251900..253371
FT                   /gene="rrsB"
FT                   /locus_tag="BARBAKC583_0258"
FT   rRNA            251900..253371
FT                   /gene="rrsB"
FT                   /locus_tag="BARBAKC583_0258"
FT                   /product="16S ribosomal RNA"
FT   gene            253697..253773
FT                   /locus_tag="BARBAKC583_0259"
FT   tRNA            253697..253773
FT                   /locus_tag="BARBAKC583_0259"
FT                   /product="tRNA-Ile"
FT   gene            253896..253971
FT                   /locus_tag="BARBAKC583_0260"
FT   tRNA            253896..253971
FT                   /locus_tag="BARBAKC583_0260"
FT                   /product="tRNA-Ala"
FT   gene            254278..257097
FT                   /gene="rrlB"
FT                   /locus_tag="BARBAKC583_0261"
FT   rRNA            254278..257097
FT                   /gene="rrlB"
FT                   /locus_tag="BARBAKC583_0261"
FT                   /product="23S ribosomal RNA"
FT   gene            257192..257310
FT                   /gene="rrfB"
FT                   /locus_tag="BARBAKC583_0262"
FT   rRNA            257192..257310
FT                   /gene="rrfB"
FT                   /locus_tag="BARBAKC583_0262"
FT                   /product="5S ribosomal RNA"
FT   gene            257437..257513
FT                   /locus_tag="BARBAKC583_0263"
FT   tRNA            257437..257513
FT                   /locus_tag="BARBAKC583_0263"
FT                   /product="tRNA-Met"
FT   gene            258644..259111
FT                   /locus_tag="BARBAKC583_0264"
FT   CDS_pept        258644..259111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44902"
FT                   /db_xref="GOA:A1URI7"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI7"
FT                   /protein_id="ABM44902.1"
FT                   /translation="MGSFNGILQWDPSMGSFNGILQWDPSMGSFVNLIIYGGIYLMKRI
FT                   VLVAALCSALSSVIVPVTANALPVGGGWGTVRDKVVGALVTEGNLGEGGRAILEKIVVP
FT                   SRKNLFEYKDKAFEIQERYRSIISALGLRVSCGLLNPDRYSGQRWMSCEFK"
FT   gene            complement(259768..260124)
FT                   /locus_tag="BARBAKC583_0265"
FT   CDS_pept        complement(259768..260124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0265"
FT                   /product="putative HTH-type transcriptional regulator ygjM"
FT                   /note="identified by similarity to SP:P67703"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44561"
FT                   /db_xref="GOA:A1URI8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039060"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI8"
FT                   /protein_id="ABM44561.1"
FT                   /translation="MNIKPIRTEEDYQEALEIVSALFDNPPEVHTEEFDKMEILVLLIE
FT                   AYETEHYPVSPPYPIEVIKFRMEQMNLSAQDLVPAIGHLNRVYEILSGKRKLTLRMIKN
FT                   LHQQFNISLESLIA"
FT   gene            complement(260121..260396)
FT                   /locus_tag="BARBAKC583_0266"
FT   CDS_pept        complement(260121..260396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44838"
FT                   /db_xref="GOA:A1URI9"
FT                   /db_xref="InterPro:IPR018669"
FT                   /db_xref="UniProtKB/TrEMBL:A1URI9"
FT                   /protein_id="ABM44838.1"
FT                   /translation="MQYPDAEQPLKAWVDEAKNAQWRSPHDIKEKYKNASILKNNRVVF
FT                   NIKGNEYRLIVSIFYPAGWLYIKFIGTHKQYDTIDANIIELKEFKK"
FT   gene            complement(260508..260633)
FT                   /locus_tag="BARBAKC583_0267"
FT   CDS_pept        complement(260508..260633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0267"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45693"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ0"
FT                   /protein_id="ABM45693.1"
FT                   /translation="MLNPYFIVSKDIIPSALPFKKSPLFSEKYIYFGIVKACFSW"
FT   gene            complement(260690..260809)
FT                   /locus_tag="BARBAKC583_0268"
FT   CDS_pept        complement(260690..260809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44901"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ1"
FT                   /protein_id="ABM44901.1"
FT                   /translation="MFNALILLIFFKGEGIGFSNLPLQILSRLIFQSRMQSNN"
FT   gene            complement(260823..260898)
FT                   /locus_tag="BARBAKC583_0269"
FT   tRNA            complement(260823..260898)
FT                   /locus_tag="BARBAKC583_0269"
FT                   /product="tRNA-Phe"
FT   gene            complement(261102..261233)
FT                   /locus_tag="BARBAKC583_0270"
FT   CDS_pept        complement(261102..261233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45628"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ2"
FT                   /protein_id="ABM45628.1"
FT                   /translation="MKATSITEEHYANQFLTWTQKAFLFIENTKIIVKNISINHASQ"
FT   gene            261273..262427
FT                   /locus_tag="BARBAKC583_0271"
FT   CDS_pept        261273..262427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0271"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="identified by match to protein family HMM TIGR01365"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44429"
FT                   /db_xref="GOA:A1URJ3"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ3"
FT                   /protein_id="ABM44429.1"
FT                   /translation="MKKPERRPNNPNFSSGPCKKRPGWTVEVLRNAIIGRSHRTKVGQL
FT                   KLAEAIDSTRDVLEVPSDYRIGIVPASDTGAVEMALWSLLGERGVDMVAWESFGLDWIT
FT                   DVVKQLKLSDVRQLKAPYGELPDLAQIDFDRDVVFTWNGTTSGVRVPNASFIPEKRAGL
FT                   TICDATSAIFAQNVDFSKLDVVTFSWQKVLGGEAAHGMLILSPRAVERLEQYVPVWPLP
FT                   KIFRMTRDGKLNEGIFNGETINTPSLLCVEDYLDALKWAKSLGGLQALVARADKNFAIL
FT                   DNFVHRTPWLEHLAKIPQTRSNTSVCLVIVDPVITALDTETQASFVKAIVARLDKEGAA
FT                   YDIGAHRNAPPGFRIWVGATIEAFDLELLTEWLEWAFQVEKAHL"
FT   gene            262691..262994
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0272"
FT                   /note="conserved hypothetical protein, authentic
FT                   frameshift; this gene contains a frame shift which is not
FT                   the result of sequencing error"
FT   gene            complement(263748..264389)
FT                   /locus_tag="BARBAKC583_0273"
FT   CDS_pept        complement(263748..264389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0273"
FT                   /product="resolvase/recombinase"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45303"
FT                   /db_xref="GOA:A1URJ4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ4"
FT                   /protein_id="ABM45303.1"
FT                   /translation="MALLGYARVSTNQQKLTLQIAALKKVGVREDRIFSDIMSGSTDKR
FT                   EGLQRLLGRAEKGDVIVCTKMDRLGRNTSDMIHIIDDCYKKGIVVRFLENGLSTEGTAG
FT                   KMVIQILAAVAEAERARILERTNEGRDAAMDKGIKFGRKPHPKAELALELIKQGFSSTI
FT                   VKQKTGISLSTHFRLKRQLRSKKTAQPGKNEDHLNNEYQTDIENFTNKTS"
FT   gene            264605..264856
FT                   /locus_tag="BARBAKC583_0274"
FT   CDS_pept        264605..264856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0274"
FT                   /product="putative DNA-binding transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF04014"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45414"
FT                   /db_xref="GOA:A1URJ5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ5"
FT                   /protein_id="ABM45414.1"
FT                   /translation="MPSLTVTAKGQVTLKRDLLQHLGIKPGERINFDKLPGGELRIKAA
FT                   QSVGTIDNFIGRFAGKVKKPLTVAEMNEIAASGWAGEK"
FT   gene            264853..265251
FT                   /locus_tag="BARBAKC583_0275"
FT   CDS_pept        264853..265251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0275"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45397"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ6"
FT                   /protein_id="ABM45397.1"
FT                   /translation="MKISVDTNVLVRAVLQDDQKQGRVASKILKEASLIAISLSCLCEL
FT                   VWILRRGAKLSKEDVAAMLRDLLTTNNIVMNRPAVEAGIAILEAGGDFADGIMAYEGNW
FT                   LGGETFVSFDKQAIDLLTQKGQVAKLLS"
FT   gene            complement(265664..265966)
FT                   /locus_tag="BARBAKC583_0276"
FT   CDS_pept        complement(265664..265966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0276"
FT                   /product="putative addiction module antidote protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44530"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ7"
FT                   /protein_id="ABM44530.1"
FT                   /translation="MKDKPYDEVMAEVFRNDPAYAVELLNDILEDGEPAELLIALRQMA
FT                   KAFGGVRNVAKSAELNANQLYRTLSEKGNPEIKSLSAILRVMGLRLAVQPLATHR"
FT   gene            complement(265997..266320)
FT                   /locus_tag="BARBAKC583_0277"
FT   CDS_pept        complement(265997..266320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0277"
FT                   /product="putative addiction module killer protein"
FT                   /note="identified by match to protein family HMM PF05973;
FT                   match to protein family HMM TIGR02683"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45190"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ8"
FT                   /protein_id="ABM45190.1"
FT                   /translation="MIEIKYYIDKTGRNIFADWHSEVRDIKARIAIDRRIMRVELGNFG
FT                   DHKPLREGIWELRIDVGPGYRVYYAKADLAVVLLLCAGDKRKQEADIDRACNYWRDWLS
FT                   RNN"
FT   gene            266629..266934
FT                   /locus_tag="BARBAKC583_0278"
FT   CDS_pept        266629..266934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44981"
FT                   /db_xref="UniProtKB/TrEMBL:A1URJ9"
FT                   /protein_id="ABM44981.1"
FT                   /translation="MNKKPPKSYMSEEEREKLKARGISPSDIYVFESRAADKANDEKTS
FT                   WEWLAMGELPAHALLGLKKRCGAQFIRDMGFPTKKADAEYGPDWLDRDIIIAGVHF"
FT   gene            266931..267236
FT                   /locus_tag="BARBAKC583_0279"
FT   CDS_pept        266931..267236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45128"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK0"
FT                   /protein_id="ABM45128.1"
FT                   /translation="MIGKLAKFIAQEYTLMEMNVETVEVRALHELRTDFCNHVLSIGQS
FT                   GDLSLIIEAEYNIIIEDLKRYANSPGMISSLETALIEINSIKKHTKKMYRCKSVLN"
FT   gene            267431..267664
FT                   /locus_tag="BARBAKC583_0280"
FT   CDS_pept        267431..267664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0280"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44424"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK1"
FT                   /protein_id="ABM44424.1"
FT                   /translation="MGCAFPSLSPLRTARRLINRGHSVSRRRKNGLPYDEARQALASHF
FT                   TRLSNLDKSRLMTAEKSIIDARKKYENGSKTL"
FT   gene            267624..267737
FT                   /locus_tag="BARBAKC583_0282"
FT   CDS_pept        267624..267737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0282"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45505"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK2"
FT                   /protein_id="ABM45505.1"
FT                   /translation="MHAKNMKMARKLYEKMQDKVLDVSLSHDKSDRYKSFI"
FT   gene            complement(267730..268002)
FT                   /locus_tag="BARBAKC583_0281"
FT   CDS_pept        complement(267730..268002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44888"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK3"
FT                   /protein_id="ABM44888.1"
FT                   /translation="MNSERKPLDFAALDEFKPKNPTSNITERKKIDKMVAFPSREQSDD
FT                   AQINIKTSTAILNRFRTMAKQNRYHHGAFLEVLMNAFEQGQGITK"
FT   gene            complement(268002..268688)
FT                   /locus_tag="BARBAKC583_0283"
FT   CDS_pept        complement(268002..268688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0283"
FT                   /product="putative partition protein ParA"
FT                   /note="identified by similarity to SP:P07175"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45373"
FT                   /db_xref="InterPro:IPR009744"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK4"
FT                   /protein_id="ABM45373.1"
FT                   /translation="MPVISFANSKGGSGKTTSALLLACELANTKPVTIIDADPRHPLST
FT                   WSQLPGKPENLTVITNESEKTILDEIETAAARDPFVIVDLEGTASRLTSYAISQSDLVI
FT                   IPMKEQQQDAETAIEIIKKIHRDMKAVRRPIFYAVLFTQSKVIAKSRTSRFVSYQFKEN
FT                   PQIDTFETEIHERDAFSAIFSTGGSHRNLNPKEVNNLKAAIDNIELFTAEVVTKLKANQ
FT                   NKEESV"
FT   gene            complement(269035..269277)
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0284"
FT                   /note="plasmid replication initiator protein RepA,
FT                   truncation"
FT   gene            269682..270971
FT                   /gene="purA"
FT                   /locus_tag="BARBAKC583_0285"
FT   CDS_pept        269682..270971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="BARBAKC583_0285"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="identified by match to protein family HMM PF00709;
FT                   match to protein family HMM TIGR00184"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45189"
FT                   /db_xref="GOA:A1URK5"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URK5"
FT                   /protein_id="ABM45189.1"
FT                   /translation="MANVVVVGTQWGDEGKGKIVDWLSEQADVVVRYQGGHNAGHTLVI
FT                   NGISYKLSLLPSGVVRGKLSVIGNGVVVDPHHFVSELKKLRDQGVEITPKVLRVAENAS
FT                   LILSVHRDLDAARENGISGLTIGTTKRGIGPAYEDKVGRRSIRMIDLAETNTLMAKIER
FT                   LLRHHNALRRGMGIAEIDPKTLYDELMQVADEILPFMDCTWRLLDERHRMGQRILFEGA
FT                   QGASLDNDFGTYPYVTSSNTVSGQAFIGSGMGPGSVHYVLGIAKAYTTRVGEGPFPTEQ
FT                   VNDVGEFLGMRGNEFGVVTGRKRRCGWFDAVLVRQMVKICSVRGIALTKLDVLDGLDEI
FT                   KICIGYEIDGRKIDYLPSCIEEQARVKPIYETLEGWKEATACTLNWEELPVQAIKYVRR
FT                   IEELIGVPIALLSTSPEREDTIFIIDPFAD"
FT   gene            271223..272722
FT                   /locus_tag="BARBAKC583_0286"
FT   CDS_pept        271223..272722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_033221.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45642"
FT                   /db_xref="GOA:A1URK6"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK6"
FT                   /protein_id="ABM45642.1"
FT                   /translation="MVDFVGILKKTIDAQNNVTPQVRKQVYERAIETLEHKLVEANMPE
FT                   TVIDAQRQALQSAISVVEEEYLAVEKELLSSVIGWKFTNEFDDHKRTPSTAFLKSKVMS
FT                   VFVTKQQHSFVTESIKNEILNKSSKILSIPDAELVNMDSFFASEHKINQNIEKKKSKND
FT                   AISSAQVDNFHIISHIFAQALQRANRASVRKRIVIGVCVFVSFCFVFISAFFVGKRVFV
FT                   SSDHQLQEDDTYVPNLSSTVVQANPKLTQRLLEDGSEINVGPVEEEEAQGEKGTSTVVA
FT                   NDINSMKHAGEVVFYQSRTDYDAEKVATGSALWSLVKETSVNGQSEELAIRGDIKIPDE
FT                   GLSLRLTLRRNTDLSLPAAYIMDLIFITSDKFSGQAISDIKTLTFKASEQSVGQALTRT
FT                   VVAKIDDDFFLVALSGHYPFLNRNLQLIRELDWIRLVMNDKNGRVNELTFAKGETGEAI
FT                   FNQVIGQWLAQTNKSTASESTKKNADIDGMKSSKFTDTDPL"
FT   gene            complement(272773..273684)
FT                   /gene="rpoH2"
FT                   /locus_tag="BARBAKC583_0287"
FT   CDS_pept        complement(272773..273684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoH2"
FT                   /locus_tag="BARBAKC583_0287"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02392; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45229"
FT                   /db_xref="GOA:A1URK7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK7"
FT                   /protein_id="ABM45229.1"
FT                   /translation="MAHISLPSIAANDGGLSRYLEEIRRFPILEPKEEYMLVKRYNEHN
FT                   DLKAAHKLVTSHLRLVAKIAIGYRGYGLPMGEVISEGNIGLMQAVKRFEPERGFRLATY
FT                   AMWWIKASIQEYVLRSWSLVKIGTTTNQKRLFFNLRKLKSKLQALDNGELNTEQVKEIA
FT                   TRLNVTEDEVVSMNHRLSGDTSLNAPLRTNEDEHSEWQDCLVDEASSQEQVLIEKDELE
FT                   NRRSLLIHAMANLNEREKRIFEARRLSDEVLTLEELSSEFNISRERVRQIEMRAFEKVQ
FT                   DFVRASALSQKQAQIQHCLHIS"
FT   gene            complement(273827..274837)
FT                   /locus_tag="BARBAKC583_0288"
FT   CDS_pept        complement(273827..274837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0288"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /EC_number="5.4.99.-"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44483"
FT                   /db_xref="GOA:A1URK8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK8"
FT                   /protein_id="ABM44483.1"
FT                   /translation="MTQQITDEDALGQRIDQWLAKHYQNELSRSRLQTLIREGYLKIDG
FT                   KLVTEPKTKIKSNQTIELTIPTLNNAYPEGEAIPLHILFEDDHIIVVNKPAGLVVHPGH
FT                   GNWTGTLVNALIYHCGDSLSGIGGVRRPGIVHRLDKNTSGVIVVAKNDLAHKGLSAQFS
FT                   DHGRTGVLDRRYHALIWGSPNRNIGVITASLGRARYDRTKQAVIHSHNIYARHAVTHFS
FT                   VIEKYQTCADKIPFASLLECRLETGRTHQIRVHMAHIGHPLVGDTVYGNAFKTKSNRFD
FT                   STIKEAIDLFNRQALHAASLTFEHPAKGNIMSFSAPLPQDMAELINHFKKLNTNY"
FT   gene            complement(274875..276305)
FT                   /locus_tag="BARBAKC583_0289"
FT   CDS_pept        complement(274875..276305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0289"
FT                   /product="aldehyde dehydrogenase (NAD) family protein"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45425"
FT                   /db_xref="GOA:A1URK9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1URK9"
FT                   /protein_id="ABM45425.1"
FT                   /translation="MLSKRKFYINGLWDDPSVVNDFHVIDPSTEEAFSVISMGSIKDAD
FT                   KAITAAKKAFQSWKTTTPSQRLAFVEKILKIYERRLEDMAKAISMEMGAPIDMARNAQA
FT                   TSGIQNIRNFITAFKNFSFQEALIEKNEHAILQYDPIGVVGLITPWNWPIHQITLKVIP
FT                   ALLAGCTMVLKPSEFSPLSAMIFAEIIDEVALPAGIFNLINGDGVHVGSYLSSHPDLEM
FT                   ISFTGSTQAGKAISKNASNTLKRVCLELGGKGANLIFADADANAVQRGIQHCFYNSGQS
FT                   CNAPTRMLVEHSIYDKAIRTAQHIAENTKVGPNHQTGDHIGPVVSKKQYDNIQALIQSG
FT                   IDEGATLVTGGIGLPKGMKRGYYVRPTIFSDVKPNMRIFREEVFGPVLSILPFRTEDEA
FT                   VALANDTEYGLTNYIQSQNREKCRRIATQLRSGMIEINGCNLPDGSYFGGVKFSGRARE
FT                   GGRWGIEEFLDTKAVSYW"
FT   gene            276479..276616
FT                   /locus_tag="BARBAKC583_0290"
FT   CDS_pept        276479..276616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0290"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44687"
FT                   /db_xref="GOA:A1URL0"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL0"
FT                   /protein_id="ABM44687.1"
FT                   /translation="MLMTIKTLYLRLAFDNFRKSYVFMKSNIAFLTIFIVFKNYFFIQN
FT                   "
FT   gene            276703..279321
FT                   /locus_tag="BARBAKC583_0291"
FT   CDS_pept        276703..279321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0291"
FT                   /product="FtsK/SpoIIIE family protein"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45556"
FT                   /db_xref="GOA:A1URL1"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL1"
FT                   /protein_id="ABM45556.1"
FT                   /translation="MGAMRNLKTQSDSVSFFSDNNAESVSERSINASEENSFSNISKMF
FT                   SYPAVWEKAFTLGQNVRFTRTPEVEILRRRIEKDPIFAKQFEAFIQQESQKLTDIIKCD
FT                   QESIKLPLVEKELNAQSVDNKSSFYSSTILKQSEQQIIATRTEHASTQYVHAVQAESVE
FT                   QGIKPFCYLSDTAFFECEPLMLEQIKVQDPQREATSIDSANNETLSEAVSDMSITSLYR
FT                   VLKCRFPQSHDSTVSEISAESVEDIEPIFDLSFTNNKASREVQIQSTEPIFRGDGDVKK
FT                   IQEIENVQEIQELSMVDAPAHEVGDGLMEIAVNNNQNNIIDYMKGNVAKSASDLSSTKA
FT                   GRKALQATNTPLCSRNTGFVSNVQFVYYGTYEFPPIDLLQEPVFQSDTVISEETLEYSA
FT                   GILENVLEDFGIKGEIIHVRPGPVVTMYEFEPAAGVKSSRVIGLSDDIARSMSAISARV
FT                   AVIPGRNVIGIELPNTVREVVYLRELIQSNSFRDSQFKLALALGKGINGEPVIAELVKM
FT                   PHLLVAGTTGSGKSVAINTMILSILYRMTPEQCRLIMVDPKMLELSIYDGIPHLLTPVV
FT                   TDPQKAVTALKWAVREMEERYRKMAKLGVRNIDGFNARVALAVEKGEIITCTVQSGFDK
FT                   DTGEMLYHEETMDLTQLPYIVIIVDEMADLMMVAGKEIEGAIQRLAQMARAAGIHLIMA
FT                   TQRPSVDVITGTIKANFPTRISFQVTSKIDSRTILGEQGAETLLGQGDMLYMAGGGRII
FT                   RVHSPFVSDEEVETVVAHLKRQGKPEYLSTVTDSESDDGAEDAKSIAENGNLDEEGNEL
FT                   YDQAIKIVMRDKKCSTSYIQRRLSIGYNKAASLVERMEEEGIVGTANHVGKREILCNEW
FT                   Q"
FT   gene            complement(279902..280318)
FT                   /gene="mscL"
FT                   /locus_tag="BARBAKC583_0292"
FT   CDS_pept        complement(279902..280318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="BARBAKC583_0292"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01741;
FT                   match to protein family HMM TIGR00220"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45284"
FT                   /db_xref="GOA:A1URL2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URL2"
FT                   /protein_id="ABM45284.1"
FT                   /translation="MLKEFKQFALKGNMVDLAVGVIIGSAFGGLVNSVVNDIFMPIIGL
FT                   ITGGIDFSNMFIQLAGDKKATLLAAKEAGATLSYGNFITLLINFLIISWILFFLVKGMN
FT                   KMTQKQEEVEKPKEMSPEGKLLTEIRDLLAAQKE"
FT   gene            280866..281954
FT                   /gene="pyrD"
FT                   /locus_tag="BARBAKC583_0293"
FT   CDS_pept        280866..281954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="BARBAKC583_0293"
FT                   /product="dihydroorotate oxidase"
FT                   /EC_number="1.3.98.1"
FT                   /note="identified by match to protein family HMM PF01180;
FT                   match to protein family HMM TIGR01036"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44480"
FT                   /db_xref="GOA:A1URL3"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URL3"
FT                   /protein_id="ABM44480.1"
FT                   /translation="MSFFQCIGRSALFMLDPEHAHNLAILWLKSGLNSHKRIVDKRLSV
FT                   RVAGLKFENFMGLAAGFDKNAEVVDAVFRLGFGFTEVGTVTPKPQAGNAKPRLFRLKED
FT                   EAIINRMGFNNDGHQIVHDRLQGRKKSDIVGVNIGANKDTLNRIGDYVAGITCFYDVAD
FT                   YFTVNISSPNTPGLRDLQARDNLRLLIKEISQARSENKKKHGFSIPIFLKLAPDLTEQE
FT                   LDDVAAELSLSDFDGLVVSNTTLFRQGLKKSAFMNEGGGLSGRPLFERSTIVLAKMRQK
FT                   LGKDIAIIGVGGVWDAQTALEKIKAGADLVQFYSGMVYEGPDLAKNITKDVLQMMQQDG
FT                   VDTIKAYRDHHVEKWAKFELHL"
FT   gene            282066..282142
FT                   /locus_tag="BARBAKC583_0294"
FT   tRNA            282066..282142
FT                   /locus_tag="BARBAKC583_0294"
FT                   /product="tRNA-His"
FT   gene            282333..283760
FT                   /locus_tag="BARBAKC583_0295"
FT   CDS_pept        282333..283760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0295"
FT                   /product="putative glutamine synthetase"
FT                   /note="identified by match to protein family HMM PF00120"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45060"
FT                   /db_xref="GOA:A1URL4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL4"
FT                   /protein_id="ABM45060.1"
FT                   /translation="MAVNSSEKMKRKKCEPVSDFLKNLRGVNNWEQVSQWLAFRGVEDI
FT                   ECITPDQAGVARGKMMLSKKFTSEASLALPSAVFMTTISGDYPEDGNGFEYPTTDGDLR
FT                   LDPDLSTLSIVPWEGAPTAQVICDIRYQNGQAVEYTPRNVLQTVIDFYNQMGLKPVVAP
FT                   EIEFYLVKKNPDPDYPLEPPVGRSGRSIGGGQGYSIAGVNEFNGLIDDIYHFSEAQGLE
FT                   IDTLIHEEGAGQFEINLRHGDPITLADQVFMFKRTLREAALKHNMYATFMAKPIQGQPG
FT                   SAMHIHQSIIDQKTGANIFTEEDGRESVYFRHFIGGLQRHMAGALVMLAPYVNSYRRLM
FT                   PDVSAPVNLQWGYDNRTTAFRVPRSIPQGRRVENRLPSSDANPYLAIAASLACGLIGLQ
FT                   QKLTPDKPTEKTVNSNNIELPRGLIEAVSLFEQDKALRDILGDAFVSTYAAIKRQEFET
FT                   FMDVISSWEREYLLLNV"
FT   gene            283772..285055
FT                   /locus_tag="BARBAKC583_0296"
FT   CDS_pept        283772..285055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0296"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44587"
FT                   /db_xref="GOA:A1URL5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL5"
FT                   /protein_id="ABM44587.1"
FT                   /translation="MAHYNSISPGVSWYEDTIGERPSYPCFDAQAQCDVVIIGGGFTGL
FT                   SAAYHLAKIGLSVVLLEASRFGDGASGRNGGQLGTGQRQWVETLEKKYGFERSKMLFDL
FT                   AEEAKRDILSWSAMPDCNIDFMAGQFSVIHKKRHSKTYQKHVETMQRYGYHGLTFMNKA
FT                   ETDERLGSSFYYGGIYDVQTGHINPLKLIVWLAKQAKKAGVKLYEKTKVTGIRSNNGQC
FT                   FVTTKKGNITATNILLATNAYHFGLKNFVENNVVAIRSYIGATEPLPEHHSILSGGEAV
FT                   DDSRFMVRYFRKSIDHRLLFGGVESYNNQCPADLDERIRQQIAEIYPQLHSINLTHRWG
FT                   ATVAITVERMPYVRQIMPGVTYCGGYSGHGVILAPFMGKLYAEWLSGNHERFKSFQDLK
FT                   ISSFPGGKILRYPLVFLAMNWFSLMDRF"
FT   gene            complement(285306..286205)
FT                   /gene="folD"
FT                   /locus_tag="BARBAKC583_0297"
FT   CDS_pept        complement(285306..286205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="BARBAKC583_0297"
FT                   /product="folD bifunctional protein"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="identified by match to protein family HMM PF00763;
FT                   match to protein family HMM PF02882"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44510"
FT                   /db_xref="GOA:A1URL6"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URL6"
FT                   /protein_id="ABM44510.1"
FT                   /translation="MDNIIDGKKLAENVIAKVKNETEKLKNSHNIQPGIAVIIVGDDPA
FT                   SQVYVASKSKKAEECGFFSMKHVLPKEVEESELLQLIEILNSDPKIHGILVQLPLPAHI
FT                   NTDRATQAIAVEKDVDGFHYINIGKLAANAIKDAIIPCTPAGAMMMIEQQCGQDLSGLN
FT                   AVIVGRSNIVGKPMAALLTAANATVTLAHSRTRDLDEICRRADILIAAVGRPQMIKKHW
FT                   VKKGAIVIDVGINRIAAPEKGPGKTRLVGDVDFEEVKGKTLAITPVPGGVGPMTIAMLM
FT                   VNTLKAAARSLKLPVPKF"
FT   gene            286511..288391
FT                   /locus_tag="BARBAKC583_0298"
FT   CDS_pept        286511..288391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0298"
FT                   /product="AsmA family"
FT                   /note="identified by match to protein family HMM PF05170"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45010"
FT                   /db_xref="GOA:A1URL7"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL7"
FT                   /protein_id="ABM45010.1"
FT                   /translation="MRAKIVKFLSGIFFAVVFLFGAAVIILPYIVSTDAIRIRLAQDLS
FT                   AWTGYNVQLRDPPRLDLFPYPKAFLSGVTLTQKIDDNAPLMEAESIEVDLSLIDLLWKR
FT                   VSFSETRIIRPQFVIEKPVKTIADFFDTLSQSQGALGLTIRSAREVVMHNPDQPDVEHL
FT                   LRQPFGRVVIKNGVLVYRDSVSDVAEKITGLNATMDWPESTRAARFRANAHWRGELTEL
FT                   IINADQALLLLAGGKSPLKISMNSLRGGITFVGQAQLSEYYVVDGKVSVRSPGWDQTLA
FT                   WIGGREFFGHKFKIPIVWESHFLAQPTCIQMNNVTFTMGAANARGALEFNFQNSVPIII
FT                   GSLAFDNLDLSLLESTLLSVEEKNKFFDTTIFNRIGLDVRLSAPRAKVGNVELTNLAAA
FT                   IQLKNGRGIFDLGNANLFGGSIQSNIQIIPNDKKVRIEGRTSGTSIDTKAVSDTLGFIP
FT                   FVQAKTNFIMTTQVLAGRWSEILAKMQGQLTLNMSTGRLIGYDLDNLQKKLLKNEKFLL
FT                   VNDGGVSTVFDRLDVKAKFASDAITTLTLSMDTTNWNLFIQKPTTLSVAKSKQNKQILR
FT                   AELQSNNRSETVCKDIQCLTNSLVWSLAFSLDPTEQALGNFFVKKNIHEN"
FT   gene            complement(288488..288631)
FT                   /locus_tag="BARBAKC583_0299"
FT   CDS_pept        complement(288488..288631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44713"
FT                   /db_xref="GOA:A1URL8"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL8"
FT                   /protein_id="ABM44713.1"
FT                   /translation="MSAKRATVITISTILAFIFIIVGIGSVGADRKHTIAEDGYGISIK
FT                   HR"
FT   gene            288857..289600
FT                   /locus_tag="BARBAKC583_0300"
FT   CDS_pept        288857..289600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0300"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44791"
FT                   /db_xref="GOA:A1URL9"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A1URL9"
FT                   /protein_id="ABM44791.1"
FT                   /translation="MRANYKFQRLFIQQPLVLNAEVIIEGSQASYLIHVLRMREGARIL
FT                   LFNGCDGEWLAELITIKKKIVVVRIIHQERVQTVRSDLVYCFAPIKSARLDYMVQKAVE
FT                   MGVSVLQPVITHHTQVTRINMARIEANIIEASEQCGILSLSECAPTVSLEALLTSWDEA
FT                   RPLFFCDESHEFHNPLPLLKKYRAMPVGVLIGPEGGFSEEERILLKKYPFVVPISLGPR
FT                   ILRADTAAVAALAIINTTVGDWSVD"
FT   gene            289667..291040
FT                   /locus_tag="BARBAKC583_0301"
FT   CDS_pept        289667..291040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0301"
FT                   /product="glutamate--cysteine ligase"
FT                   /EC_number="6.3.2.2"
FT                   /note="identified by match to protein family HMM PF04107;
FT                   match to protein family HMM TIGR01436"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44978"
FT                   /db_xref="GOA:A1URM0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM0"
FT                   /protein_id="ABM44978.1"
FT                   /translation="MAFDTTDEGRIDNLESLIGYFQEGCKEENDWCIGTEHEKFPFYIN
FT                   GFHPVPYEGAKGIRVLLEGMQEVLGWKPILDEGNIIGLVGSEGQGAISLEPGGQFELSG
FT                   AKLKTVGHTYCEVMEHLDLLKKISQPLGIGFLGMGASPKWTLPETPQMPKSRYKIMTNY
FT                   MPKVGHHGLDMMYRTATIQVNLDFSSETDMRRKMQVSMKLQPIVTALFASSPFTEGRPN
FT                   GFLSWRSAIWCGTDNQRTGILPFIFSDRFGFADYVEWALGVPMYFIIRDGHYHDCTHVT
FT                   FRQFMNGALKGQIIDSTPTMGDWVDHLSTLFPEVRLKRFLEMRGADGGSWQRICALSAF
FT                   WVGLLYDSEALSEAEALTKDWCYEEVLDMRNRVAKEGIKTPFRQTTILELASQAIAISR
FT                   KGLKSRKQYGSDGFDETNFLDPLEEVITTGQTSADKFLSHYYSIWGESTEPLFVEHAY"
FT   gene            complement(291509..291742)
FT                   /gene="rpsU"
FT                   /locus_tag="BARBAKC583_0302"
FT   CDS_pept        complement(291509..291742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="BARBAKC583_0302"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45063"
FT                   /db_xref="GOA:A1URM1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URM1"
FT                   /protein_id="ABM45063.1"
FT                   /translation="MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAR
FT                   EKAEAIRRTRKLARKRAQREGIVSNGRTASVR"
FT   gene            complement(292143..292219)
FT                   /locus_tag="BARBAKC583_0303"
FT   tRNA            complement(292143..292219)
FT                   /locus_tag="BARBAKC583_0303"
FT                   /product="tRNA-Arg"
FT   gene            292192..292308
FT                   /locus_tag="BARBAKC583_0304"
FT   CDS_pept        292192..292308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44787"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM2"
FT                   /protein_id="ABM44787.1"
FT                   /translation="MLYPAELRVHLIFYQLGYGVPNRFVDELQVKLGDFFVF"
FT   gene            292600..293736
FT                   /locus_tag="BARBAKC583_0305"
FT   CDS_pept        292600..293736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0305"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45504"
FT                   /db_xref="GOA:A1URM3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM3"
FT                   /protein_id="ABM45504.1"
FT                   /translation="MGLLKKIIPFVLLSIVLIASYLGFKYNSEKTTSAANETKNTSNTI
FT                   VKSSAEIPPANVVVDLVKVQNFYKQLHTVGSGKAIAAVDLTPWSAGVLDKFFVSSGAKV
FT                   QEGDLIAKLDSEKEEIAVAKAKIHHDNSALTLSRIMKLRASNTATEIQEITARLELENA
FT                   NLALLDANLALDQRTIRAPISGTVGILPIGVGNAVSSNSVIGRIENRERILVDVWVSEQ
FT                   YASYLHKGDEVTIAPTVQSDKNFVGRIYAIDNMIDAESRTLHVQVELQNEQETLMPGMS
FT                   FSVIFQFFEGLFPVVDPLAIQWNSKGSFVWRVKNGKVEYVPVSIIQRKADQVFVKADLE
FT                   KDDQIVIQGVQMLQSGRSVLIQDSKAHQKSLANEQDVQ"
FT   gene            293733..296867
FT                   /locus_tag="BARBAKC583_0306"
FT   CDS_pept        293733..296867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0306"
FT                   /product="RND transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45283"
FT                   /db_xref="GOA:A1URM4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM4"
FT                   /protein_id="ABM45283.1"
FT                   /translation="MSQQLETKQLLAKLQQNDIMAFFIRRPVFTFVLNAMIMIAGFSAW
FT                   MGVDVRELPDIDIPVTTVMTNFAGASAETIDREITKIVEDAVSRVSGVKTISSTSSFGR
FT                   SRVEIQFNVGVDLNVAASDIRDALSRVAYSLPKDADSPLIIKADSNAAAMMYLVVTSPT
FT                   MNIDDLTTIVNDQIVDVLSAVEGVADVEVDSARKKIFQIDIDQVKLANYGLSVADISSA
FT                   LSDMMVDVPVGSLRNAKQALIVRATAHLATPEDFERVLLKPHVLIGDVARVTLSPDIET
FT                   VILRVNGEEGIGLGIVRKAQSNTLNISKDVRITLDRLKMIIPPSVQISIISDDSIFIKS
FT                   ALHEVEIALVIAVLSVIFVIFIFLRDIRITLIPALSIPVALIGTIAAIYLAGFSLNILT
FT                   FLGLVLATGLVVDDAIVVLENIVRWRNKGHGSRSAAVLGTREVFFAVVATTLTLVAVFV
FT                   PISFLPGQVGGLFREFGFVLAISVLLSSVVALTLCPMLAARFLKEHVEENKEDVRRFII
FT                   LDKLGAFFSRNYAYYLHKCLGRPWTVILISFVFFGLCIGGYMKLQQELTPAEDRGMIFL
FT                   VIRGPQGISTQYLNEQVKQIEESLQPLRDAGEIVNSYSIAGAGGASNNAFLILLLSSWD
FT                   KRSRSQQEIVNDINSKIRQFPAVFVFAAQGNSLGVRGTGQGLRFAILGNNYEKLQSIAD
FT                   QLVNALQADQRFIRPQLASDATQPQFFIEINREKATDLGVDITNLGNTLQTMLDGRKIG
FT                   SIYVDDHSYDVKLTSREKFIDNPADLENILLKAKNNKYVPLSMIAHLHEKAIAPQLKRE
FT                   QRMNAVILSTNFAPNITLGDAYQIVQEISSPLLSEGSYVVPLGEVATLSETSSNLMVVF
FT                   GIAFLIILLILAAQFESFVSGFIIMATVPLGLGCAVIAMLLSGVSLNIYSQIGLILLIG
FT                   VMAKNGILIVEFADQLRDQGRSVREAVEEAANVRLRPVCMTMICAILGGIPLILAKGAG
FT                   AEARIALGWVIVGGLGLATIFTLYVTPVVYLLLGRFIRPKIEEAKQLERELNQAT"
FT   gene            297059..298708
FT                   /gene="pgi"
FT                   /locus_tag="BARBAKC583_0307"
FT   CDS_pept        297059..298708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="BARBAKC583_0307"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="identified by match to protein family HMM PF00342"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45455"
FT                   /db_xref="GOA:A1URM5"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URM5"
FT                   /protein_id="ABM45455.1"
FT                   /translation="MLPDKKAFKESLKALKKHVTQDKVCDIRQHFSEDEQRFARLSIRL
FT                   DDLLFDFSKCGVTLDTLQLLDNLAIAADVLGKREAMFSGKIINTTEKRSVLHIALRLAA
FT                   DKVFILNDRDIVQDIQSVLARMVKFSKMIRDGSYKGYSGERITDIVNIGIGGSDLGPAM
FT                   VTSALKPYHDGPHCHFVSSVDSAHITDILADLNPATTLFIIASKTFTTTETIENARVAR
FT                   QWIHSHLGENAVGVHFVAVSSAIDKAIEFGIDSSRIFEFWDWVGGRYSIWSAIGLVVML
FT                   AIGDQNFRQFLEGARQMDQHFKDTPLHQNIPIRFALLGFWHRVICGYSSRAIVPYEQRL
FT                   VRFPAYLQQLDMESNGKHVSLEGRPITFSTGPVVWGDSGSNGQHAFFQFLHQGTDIVPV
FT                   EFILFVKGHEPNLNHMHDILVANCLAQSEALMKGRSHEDVYHTLMNDGGESDEADNLAF
FT                   HKSLQGNRPSIMLIQDLLTPFTLGRLMALYEHRIFVEGILMNINSFDQWGVELGKEFAN
FT                   ELLPVIRGENEADNRDGSTLGLLKHIQNRYVE"
FT   gene            complement(298745..298834)
FT                   /locus_tag="BARBAKC583_0308"
FT   tRNA            complement(298745..298834)
FT                   /locus_tag="BARBAKC583_0308"
FT                   /product="tRNA-Ser"
FT   gene            299126..299599
FT                   /gene="rplU"
FT                   /locus_tag="BARBAKC583_0309"
FT   CDS_pept        299126..299599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="BARBAKC583_0309"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45385"
FT                   /db_xref="GOA:A1URM6"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URM6"
FT                   /protein_id="ABM45385.1"
FT                   /translation="MFAVIKTGGKQYRVVANQVLKVEKIVGNAGDVVNFSDVLMVGEGD
FT                   NAIIGAPIVADASVTAEIIGQERARKVISFKKRRRQNSKRTRGHRQEITTLRIVEILTG
FT                   GLKTKTATVKSNEKKAAAPKEVKADSVKETATKTVKKRNVSQKVEAASESKKD"
FT   gene            299612..299881
FT                   /gene="rpmA"
FT                   /locus_tag="BARBAKC583_0310"
FT   CDS_pept        299612..299881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="BARBAKC583_0310"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44500"
FT                   /db_xref="GOA:A1URM7"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URM7"
FT                   /protein_id="ABM44500.1"
FT                   /translation="MAHKKAGGSSRNGRDSESKRLGVKKFGGEAVIAGNIIIRQRGTRW
FT                   HPGENVGIGKDHTLFSLANGTVSFRTKVNNRSYVSVIPAAVEAK"
FT   gene            300854..302509
FT                   /locus_tag="BARBAKC583_0311"
FT   CDS_pept        300854..302509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0311"
FT                   /product="immunodominant surface antigen, Brp family"
FT                   /note="identified by similarity to GB:AAU44778.1; match to
FT                   protein family HMM PF05658; match to protein family HMM
FT                   PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44517"
FT                   /db_xref="GOA:A1URM8"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM8"
FT                   /protein_id="ABM44517.1"
FT                   /translation="MKEIQPQRGAVGCVLVSYFWLKRFLGIAIAALLSTILPAEGQPIE
FT                   HVTLSEHNGVPIVDGAFELQQSSNSGDRDCRNMNEVINRLSREVGDGRVLPLELEEKYC
FT                   ETIVERLHNLGDSNGISLQALNMIEGTGVHKGNSGKFKVYSVGLGHYSGVLGVGAATAV
FT                   NAFGAQAYGFGARAMAPATIAVGIGADAQNMGAVAVGGIASAKGKNSLALGPQTLAYSD
FT                   GSVAIGGDPDSEFGARALATNSLSMGAKSYTGENSEAAIAVGLGAQVRDGSPGGVALGW
FT                   GAFVAEGAEGGLALGRNSHVDVNQGVALGVGSRVNTPAGVAGYDPRSNDETKNTNSAWK
FT                   SRYGAVSVGDAERDITRQITGVAAGTQNTDAVNVAQLQALRDATVLYNRDEDGNKTNKI
FT                   ALQGGDPSQPVALDNLADGNVTEGSKQAVNGGQLYDFMQVQTDYTKEQTRRVLKDAKGY
FT                   TDKKFNALSYEIDGARKEARQGAAIGLAVSNLRYDDTPGSLSLAFGTGMWRHQYGFAVG
FT                   AGFMSVDGKVSANVSAATAGGHWGVGAGVSVTLN"
FT   gene            302541..303122
FT                   /locus_tag="BARBAKC583_0312"
FT   CDS_pept        302541..303122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0312"
FT                   /product="invasion associated locus B family protein"
FT                   /note="identified by match to protein family HMM PF06776"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45145"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A1URM9"
FT                   /protein_id="ABM45145.1"
FT                   /translation="MFALVLLSKGESFADEQSNLYTVHPPQLSVPSGKPGETRRIIMQF
FT                   SDWTLICDESQTVKRGVCNVTQAIHDQEGHTIFSWSLVLTTSGQAVMLLRMLPSADISV
FT                   PIRVSVEGFSEPIVIRYTQCDAKVCLAQSPLGLILRQQIEQRGKVRISYQVKSGQIFSF
FT                   VAPFEGLSEALSFLTIQGDNKNDMERKQKR"
FT   gene            304186..304308
FT                   /locus_tag="BARBAKC583_0313"
FT   CDS_pept        304186..304308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0313"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45017"
FT                   /db_xref="GOA:A1URN0"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN0"
FT                   /protein_id="ABM45017.1"
FT                   /translation="MRKNNFAKGKTFSETMLVLFLGFIFIEGVCYEKKFNNKGK"
FT   gene            304277..307984
FT                   /locus_tag="BARBAKC583_0314"
FT   CDS_pept        304277..307984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0314"
FT                   /product="immunodominant surface antigen, Brp family"
FT                   /note="identified by similarity to GB:AAU44779.1; match to
FT                   protein family HMM PF03895; match to protein family HMM
FT                   PF05662"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45617"
FT                   /db_xref="GOA:A1URN1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN1"
FT                   /protein_id="ABM45617.1"
FT                   /translation="MKKNSTTKGNNLDAKGNDLDDCHFPYRSFLFKAVILGTAMTALLS
FT                   SVALVFPVHSASIEETAQNAKKSESLKDYRSQNKKGADTSHLWGLNKNIALMDGVAQAK
FT                   HKTLNVAAPTRNLLLKENITIGSLMNAADRMATDSISIMHSNYEGRDAPINCAISFDTP
FT                   TAMCFGFRERMDSQDLPSISLAHYAHSYDNRVSDNYGSQIDKASKEGDVQSDSSRSLSK
FT                   EAEGEEKTYLEEGAKLADILNDTPIVTTFMTQDKPNLGGGDVFISANNSSGDKIYSRFG
FT                   IAETRSLDDLLCNTASKDILCIGQLTAAKGFASVALGYGSQAIRGPNVAGYDPITDGIS
FT                   TSSDYLWKSTHGELGIGNMDIKRSRQITGVAAGREDNEAVNVAQLKALRKWVQTRDTDI
FT                   SDIIQFRLLNVYGSGQISIGWDKASVQSISVNHKNGNKRYIEGIRDGVIASNSSMAVTG
FT                   GQLYSAYKTVEKFLGGGASFGVGGFGDKQPIFNIQGNRYRDVGAAFDGVDNSFSKFDKS
FT                   IEEIKNDISSAMGDSLVKQDVKTGIITIGSEKEGTVIDIANSKQETRQLTGLKAGIISQ
FT                   NSTDAVTGGQLWTTREKVNALDTNIKVAILDIAIVKNDVSILETNVNNAAANISQYLGS
FT                   YADVLKGVAPIYEIQGQTYRDVGAAFAGVDDSFGKFDKSIEEIKNDISSAMGDSLVKQD
FT                   VKTGIITIGSEKEGTVIDIANSKQETRQLTGLKAGIISQNSTDAVTGGQLWTTREKVNA
FT                   LDTNIKAAVLDIAILEGDVSILETNVNNAAANISQYLGGYADVLKGVAPIYEIQGQTYR
FT                   DISSAFDGVDKFLTKINSGNLEQDALLWSDEENAFVALHAAEKGKKSQNSKLKFLLDGD
FT                   VSEGSTEAITGNQLYVVSNQLALYLGGGAGYNNGQWIAPTFKVAQFSNNGSYSAEKTYN
FT                   NVADAFDGVNKSMADINNRVNEATQNGGKDSLNWNENIGTFDASHNGKPGAVTNVADGK
FT                   VEQGSKDAINGGQLWDVKEDVKGVQNQVNDLKDKVNGFDDKLNGIENAVDDMKDKIKDA
FT                   TDGVVSYDKDKNGKKTNKITLQGGDESKPVTLDNVADGKVEKGSQEAVNGGQLHDYTKE
FT                   KMQLVLDDAKKYTDEKIKNIVVDFVDEAVAKAKDYTDQKFNVLSYEIDGARKEARQGAA
FT                   IGLAVSNLRYDDTPGKFSLAFGAGMWRGESAVALGSAYTSENGRVRSNLSATSGGGHWG
FT                   VGAGLSLTLN"
FT   gene            308017..308562
FT                   /locus_tag="BARBAKC583_0315"
FT   CDS_pept        308017..308562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0315"
FT                   /product="invasion associated locus B family protein"
FT                   /note="identified by match to protein family HMM PF06776"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44887"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN2"
FT                   /protein_id="ABM44887.1"
FT                   /translation="MFALVLFLLNKGESFADEQSNLYTVHPPQLSVPGGLPGETRRIIM
FT                   QFSDWTLICDESQTVKRGVCNVTQAIHDQEGHTIFSWSLVLTTSGQAVMLLRMLPSADI
FT                   SVPIRVSVEGFSDPIVIGYTQCDAKVCLAQSPLGLILRQQIEQRGKVRISYQVTSGKIF
FT                   SFVAPFEGLSEALLSLQQ"
FT   gene            309236..309955
FT                   /gene="rrmJ"
FT                   /locus_tag="BARBAKC583_0316"
FT   CDS_pept        309236..309955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrmJ"
FT                   /locus_tag="BARBAKC583_0316"
FT                   /product="ribosomal RNA large subunit methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45665"
FT                   /db_xref="GOA:A1URN3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URN3"
FT                   /protein_id="ABM45665.1"
FT                   /translation="MKKTTRRTAGGRGGAGSHELYQRVKKKAGTIKASSRRWLERHLND
FT                   PYVHQSKADGYRSRAAYKLIEINERYKILKKGQKIIDLGAAPGGWCQVAARLVESKDYN
FT                   PSVVGIDYLHMEPLPGVAILEMDFFHEDAPQELISTLGSKPDVVLSDMAAPTTGHRQTD
FT                   HLRTIALCEAAVHFSISVLKPGGHFLTKTFQGGAEGNLLATLKQNFKKVHHVKPPASRA
FT                   ESVELYLLALQFKGKTD"
FT   gene            310141..311160
FT                   /locus_tag="BARBAKC583_0317"
FT   CDS_pept        310141..311160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0317"
FT                   /product="GTP-binding protein Obg/CgtA"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM TIGR02729"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45007"
FT                   /db_xref="GOA:A1URN4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URN4"
FT                   /protein_id="ABM45007.1"
FT                   /translation="MKFLDQAKVYVRSGSGGAGAVSFRREKFIEFGGPDGGNGGRGGDV
FT                   WALVVDGLNTLIDYRYQQHFRAKNGGHGKGRNMTGAKGDDVVLRVPVGTQIFEEDNKTL
FT                   ICDLTEVGQRYCLAKGGNGGFGNLHFVTSTNRAPRRANPGLSGEERALWLRLKLIADGG
FT                   IIGLPNAGKSTFLASVTTAKPKIAAYPFTTLYPHLGVARIDAREFVLADIPGLIEGAHE
FT                   GVGIGDRFLGHVERCRVLLHLISIQEEDVVKAYQIIRRELETYGNNLSDKTEIVALSQV
FT                   DTLPIEECKAKQEALQKSVGQPVMMFSAVSHEGLDNVLRSVAHVIEMARADMINKHQD"
FT   gene            311166..312305
FT                   /gene="proB"
FT                   /locus_tag="BARBAKC583_0318"
FT   CDS_pept        311166..312305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="BARBAKC583_0318"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01472; match to protein
FT                   family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45402"
FT                   /db_xref="GOA:A1URN5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN5"
FT                   /protein_id="ABM45402.1"
FT                   /translation="MVVQLQKLEQYKRIVIKVGSALLVDPQTGLRIEWLKSLVNDVAVL
FT                   RQKGVEILLVSSGAIALGRTLLHLPKRVLKLEESQACAALGQIELSKAYTDVLAQHGLK
FT                   TGQILLTLLDTEERRRYLNARATMNTLLRFGAVPVINENDTVATSEIRYGDNDRLAARV
FT                   ATMMGSDLLVLLSDIDGLYTCSPHLDPTAEFVPFIASITSDIEKMAGVAASELSRGGMK
FT                   TKLDAGKIANSAGTAMIITSGKRMNPLTAIDQGERSSFFAPNEKSVNAWKTWISSHLDP
FT                   SGILTIDQGAVKALKDGKSLLAVGIIAVEGVFSRGDTVAIVDEGGVEIARGLVSYDKDD
FT                   AVNIMGYKSEEIEQILGYEPHSAVVHRNDMVLRCLTDPI"
FT   gene            312366..313604
FT                   /gene="proA"
FT                   /locus_tag="BARBAKC583_0319"
FT   CDS_pept        312366..313604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="BARBAKC583_0319"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45406"
FT                   /db_xref="GOA:A1URN6"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URN6"
FT                   /protein_id="ABM45406.1"
FT                   /translation="MKIMGKKARNAALVLAVVSAEQKKHALEMIALSLESQADEILCAN
FT                   NQDLINAAQNNMAAAMIDRLKLDELRLCAMIDSVRQIACLPDPVGQVINAWTRPNGLHI
FT                   SCVRTPLGVIGIIYESRPNVTIDASCLCLKSGNAAILRGGSDSFHSAYALHSALAMGLE
FT                   KAGLPTDAIQMVETTDRDAVGEMLKGLDGTIDVIIPRGGQSLVKRVQSDARVPVFAHLA
FT                   GLCHIYIDQSANVEMARDIVLNAKLRRTGICGAVETVLIDRQALEKFLPVLIALQEKGC
FT                   EIRATEDIVSLVPTFALACEEDWSQEYLDAILSVKTVEGVEGAIEHIVRYSSGHTESII
FT                   AEDVGVVEIFFNRLDSAILLHNASTQFADGGEFGFGAEIGIATGKMHARGPIGVEQLTS
FT                   FQYQIRGNGQVRP"
FT   gene            313634..314218
FT                   /gene="nadD"
FT                   /locus_tag="BARBAKC583_0320"
FT   CDS_pept        313634..314218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="BARBAKC583_0320"
FT                   /product="nicotinate (nicotinamide) nucleotide
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00482"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44674"
FT                   /db_xref="GOA:A1URN7"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN7"
FT                   /protein_id="ABM44674.1"
FT                   /translation="MPYVERSNIVGLFGGSFNPPHAGHLLVAKTAVRRLYLNQLWWMVT
FT                   PGNPLKDCTQLPSLHERIRLSSELTNHPKIRVTGFEGVMGSKLSAETVSHILTRHSEVN
FT                   FVWVMGADILATIHYWHRWRDIVSMLPIVIIDRPSVRMAALSSPMARTYRYFRLDERKS
FT                   PLLPFMRPPAWTYLHGPLSFQSSTKLRLEGK"
FT   gene            314324..314716
FT                   /locus_tag="BARBAKC583_0321"
FT   CDS_pept        314324..314716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0321"
FT                   /product="iojap homolog"
FT                   /note="identified by match to protein family HMM PF02410;
FT                   match to protein family HMM TIGR00090"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45184"
FT                   /db_xref="GOA:A1URN8"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A1URN8"
FT                   /protein_id="ABM45184.1"
FT                   /translation="MVSPSLEKKIFSVADGLKVVLNSLENTKAEDIISIDIQGKSSLAD
FT                   YIVIASARSHRHVSSVANHLLWTWKESGYGTAKVEGLLGGDWVLIDTGDIIVHLFRPEI
FT                   RAFYNLEKTLLTPDLGTMQMVLIGDH"
FT   gene            314717..315199
FT                   /locus_tag="BARBAKC583_0322"
FT   CDS_pept        314717..315199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0322"
FT                   /product="conserved hypothetical protein TIGR00246"
FT                   /note="identified by match to protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44447"
FT                   /db_xref="GOA:A1URN9"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URN9"
FT                   /protein_id="ABM44447.1"
FT                   /translation="MQISIFAVGRMKVGAEQELVHRYLDRFSKSAGAVGLHFRKMQEVS
FT                   ESRAQTACQRMEEEGKRLFEALPEPSRLIVCDERGKSVSSIAFAEKLAFYRDEGVRDLV
FT                   IALGGPDGHSEQVRDRADFLLSFGLMTWPHQIARILLTEQLYRTVTIANNHPYHRF"
FT   gene            315302..316564
FT                   /locus_tag="BARBAKC583_0323"
FT   CDS_pept        315302..316564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0323"
FT                   /product="M23 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44669"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP0"
FT                   /protein_id="ABM44669.1"
FT                   /translation="MKFFLYEKMQYLSKVCVMSMMLALGMVFFSSISYAEDIHSREIAH
FT                   KILVETRQNISLSRERIAQLSDQVNRLKKDQHTLTREIIKVAKAERDTVNSINETEKKL
FT                   EKLTYQQKKSQQNLKNHRDEFAKVLTVLERVGMNLPPAIMARPEDVLASVRSSVLLGAI
FT                   IPEMRKKIQDLTVNLRELTDLARSVNTEYAILKVEIQNQVEQRKQLELLLNEKAKLQKM
FT                   SEQELIEQQRKNVALSEKSQSLEELILEINRQSQFSSNLSMQKSLQLLEELNFENQKGM
FT                   LLLPVAGKKIQQFNNSSYVTRFGEIIETETAAVVLSPVDALVVFAGSFRSYGQLVILDV
FT                   GRGYHIVLVGMARINVTQGQFVLSGEPLGMMSTQFIASTVALDVGKNAPMLYIEFRKDG
FT                   KPVNSTPWWRTEKSKRNKDDS"
FT   gene            316554..317858
FT                   /gene="ctpA"
FT                   /locus_tag="BARBAKC583_0324"
FT   CDS_pept        316554..317858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="BARBAKC583_0324"
FT                   /product="C-terminal processing peptidase"
FT                   /EC_number="3.4.21.102"
FT                   /note="identified by similarity to SP:Q44879; match to
FT                   protein family HMM PF00595; match to protein family HMM
FT                   PF03572; match to protein family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45226"
FT                   /db_xref="GOA:Q44879"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q44879"
FT                   /protein_id="ABM45226.1"
FT                   /translation="MIRKVIFFVAGVFLSASLIVMAQSITTNNEQNTYKQLARFGDIFE
FT                   RVRTQYVTIPDDQKLIENAINGMLLSLDPHSSYMDAEKAKDMRDSTKGEFGGLGIEVTM
FT                   ENNLIKVVSPIDDTPAAKAGVLAGDFISKIDGKQISGQTLNEAVDQMRGPAGTPITLTI
FT                   NRFGVDKPLDIKIVRDIIKVKAVKYRVEGDIGYLRLIQFTEKTFSDLQAAIKDIQSKIP
FT                   TDKLKGYVLDLRLNPGGLLDQAISVTDAFLNKGEIVSTRGRKQNDVMRFDAKLGDLTDE
FT                   KPIIVLINGGSASASEIVAGALQDHRRATIIGTQSFGKGSVQTIIPLGENGALRLTTAL
FT                   YYTPSGTSIQGIGITPDIVVEQPLPEKYKGYDVTLGESELRGHIKGKQESDKGSGSAAF
FT                   VPRDPKDDVQLNEAYKLLRGEITHAAFPPDPNKVF"
FT   gene            317927..318439
FT                   /gene="nudH"
FT                   /locus_tag="BARBAKC583_0325"
FT   CDS_pept        317927..318439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="BARBAKC583_0325"
FT                   /product="(Di)nucleoside polyphosphate hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by similarity to SP:P35640; match to
FT                   protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45640"
FT                   /db_xref="GOA:P35640"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35640"
FT                   /protein_id="ABM45640.1"
FT                   /translation="MDTMVDFKTLPYRKGVGIVVFNREGQVWIGRRLITSSHTYAEVSK
FT                   LWQFPQGGIDEGEEPLDAARRELYEETGMRSVNLIKEVQDWFCYDFPQELIGHVLNNQY
FT                   RGQMQKWFAFQFIGETSEIVINSPENSNKAEFDQWKWINLEVLPSIVVSFKRHVYMKVV
FT                   HEFRNII"
FT   gene            318556..319116
FT                   /gene="ialB"
FT                   /locus_tag="BARBAKC583_0326"
FT   CDS_pept        318556..319116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ialB"
FT                   /locus_tag="BARBAKC583_0326"
FT                   /product="invasion protein B"
FT                   /note="identified by similarity to SP:P35641; match to
FT                   protein family HMM PF06776"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45086"
FT                   /db_xref="GOA:P35641"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35641"
FT                   /protein_id="ABM45086.1"
FT                   /translation="MKKILNLFVISAFLSISSAAFAQNVKPAATKPSVATLPNGASSLT
FT                   ETYGLWSVNCGIQDGNKICIMLRQEVNEQDRVLLSMSVSLDGEGTVSGNLTIPFGILVS
FT                   KPIRLHVDDSKSVIESNVRTCVPAGCVVPIVFDKNFVGSLRAGKQLKLSMTVAAPGEPT
FT                   LDNLFVQLDGFSNALKRLTSLQK"
FT   gene            319442..319735
FT                   /locus_tag="BARBAKC583_0327"
FT   CDS_pept        319442..319735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0327"
FT                   /product="yggt family protein"
FT                   /note="identified by match to protein family HMM PF02325"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45047"
FT                   /db_xref="GOA:A1URP4"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP4"
FT                   /protein_id="ABM45047.1"
FT                   /translation="MIYALLQVIDLVFSIYIAFLIASAVFSWLYAFNIVNKYNPLVTVI
FT                   GDFLYRITEPVLSRVRYFLPNLGTIDISPIVVFMIIYFIRIFMWRAYSGLFL"
FT   gene            319766..320089
FT                   /locus_tag="BARBAKC583_0328"
FT   CDS_pept        319766..320089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0328"
FT                   /product="conserved hypothetical protein TIGR00251"
FT                   /note="identified by match to protein family HMM PF02594"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45193"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP5"
FT                   /protein_id="ABM45193.1"
FT                   /translation="MFYRVDVDSLILFVRLTPKASMNNIVGVESRDDGKQYLIIRLCAV
FT                   PEDGKANKALIKFLAKQWKIPSSCISLENGAISRYKQLRFSGGVEKIEKILHSLGNYTP
FT                   ART"
FT   gene            complement(320139..320672)
FT                   /gene="ppa"
FT                   /locus_tag="BARBAKC583_0329"
FT   CDS_pept        complement(320139..320672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="BARBAKC583_0329"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by similarity to SP:O34955; match to
FT                   protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44595"
FT                   /db_xref="GOA:P51064"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51064"
FT                   /protein_id="ABM44595.1"
FT                   /translation="MNIKEIPIGNNPPEDVNVIIEVPVDSQPVKYEMDKKSGSLFVDRF
FT                   ISTSMVYPGNYGFIPHTLSEDSDPIDVLVCNTRPLIPGCVINVRPIGALIMEDDGGKDE
FT                   KIIAVPTPKLTQQYIGIHDYTDLTENILKKIEHFFKHYKDLEAGKWAKIEGWRDKNFAR
FT                   ELIQQAIERAKAIQ"
FT   gene            complement(320734..322560)
FT                   /gene="typA"
FT                   /locus_tag="BARBAKC583_0330"
FT   CDS_pept        complement(320734..322560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="BARBAKC583_0330"
FT                   /product="GTP-binding protein TypA/BipA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45678"
FT                   /db_xref="GOA:A1URP7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP7"
FT                   /protein_id="ABM45678.1"
FT                   /translation="MQLRNIAIIAHVDHGKTTLVDGLLRQSGNIRDNQRTGERMMDSND
FT                   IEKERGITILAKATSVVWKDTRINIVDTPGHADFGGEVERILNMVDGAIVLVDAAEGPM
FT                   PQTKFVVGKALKVGLRPIVVINKIDRPDARADEVINEVFDLFASLDATDEQLDFPILYG
FT                   SGRDGWMAESPEGPKDQGLSPLFDLVIRHVPAPTVAEGPFRMIGTILEADPFLGRLITG
FT                   RIHSGSIKPNQNVKILGQDGTVLETGRISKILAFRGLERQPIEESVAGDIVAIAGLKKG
FT                   TVADTFCDPEIHEPLTAQPIDPPTVTMSFLVNDSPLAGTEGDKVTSRIIRDRLLKEAEG
FT                   NVALKIEESADKDSFYVSGRGELQLAVLIENMRREGFELSVSCPRVVMQKDENGTTLEP
FT                   IEEVVIDVDEEYSGTVVQKMSERKGEMVELRPSGGNRVRLVFYAPTRGLIGYQSELLTD
FT                   TRGTAIMNRLFRAYEPYKGEIGGRINGVMISNDNGEAVAYALFNLEDRGAMVIDAGVKV
FT                   YQGMIVGIHSRDNDLEVNVLKGKKLTNMRAAGKDEAIKLTPPVKMTLERALSWIQDDEL
FT                   VEVTPKNIRLRKLYLDPNERKRFEKTRSSILT"
FT   gene            complement(322845..324221)
FT                   /gene="mgtE"
FT                   /locus_tag="BARBAKC583_0331"
FT   CDS_pept        complement(322845..324221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="BARBAKC583_0331"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44451"
FT                   /db_xref="GOA:A1URP8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP8"
FT                   /protein_id="ABM44451.1"
FT                   /translation="MTKIETTFDFKNLSPEAIAEEFKNRHFADSIDIINDLDIMERVTI
FT                   LSLLPLDYTIELFDKPELEQPAAILELLPINRSVEILDGMSADAAADVFQEINGETRTQ
FT                   LYALLKPLTRTELKKLTSYPDHTAGALMTTEFITIPANWTVQRTLDHIRDVEQTRETVY
FT                   TSYVIDPKTGELLKAVSLRSLILASPDDQILNVSAHDTPITISPFTDHEDVARLFQRHD
FT                   LLSVPVIDDNNHVIGIVTVDDVLDTIVDEMSEDTYKFGGMEALDKPYMQINFLGMMKKR
FT                   GGWLALLFMGEMLTASAMQHFEDELEKALVLTLFIPLIMSSGGNSGSQATSIIIRALAL
FT                   RELSLKNWWRVIMREIPAGVALGLLLGGIGIMRIILWQQLGIYNYGEHWILVAMTVGAA
FT                   LVGVVTFGSLSGSMLPFILKSFKFDPASASAPFVATLVDVMGIVIYFSIASIILSGTLL
FT                   "
FT   gene            324569..326593
FT                   /locus_tag="BARBAKC583_0332"
FT   CDS_pept        324569..326593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0332"
FT                   /product="peptidase, M3 family"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01432"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45399"
FT                   /db_xref="GOA:A1URP9"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:A1URP9"
FT                   /protein_id="ABM45399.1"
FT                   /translation="MTKEAILDWTGFSGLPDFSLISDDDFKPAFEQALKEAEEEIEKIA
FT                   SIAESPTLENFLQPFELSGRALDRMCSIFFMRSGAHSNALIRQLEKEFIVKLSRYSSKI
FT                   MMDTRIFMKMDVLYKQAQQNAYDGETKRVIEQGWKQFIYNGAKLDEKGKKHLAEINEKL
FT                   ALLNATFGQHVLKDEAEWVLFLEKTDLSGLPDDLVSSMKEIACEKGRDGVYALTLTRSI
FT                   VEPFLKFSHHRDLRKIAFQAWSKRGENSNDNDNREIIVEIIKLRDEKAKLLGYKSFADL
FT                   KLDNTMAKSVDSVMNLLMPVWERARAKAAAEQAELQSFSENQGNNEFLAAWDWRYYAEK
FT                   LRAEKFSLDEAEIKHYFQLDRMIEAAFSVAGKLFGISFEEKTSTVLWHPDVRFWEVKKS
FT                   DGGVLGHFIGDYFARSSKRSGAWMSRLQSQHKLGSGQKPIIYNVCNFAKPPKGEVALLS
FT                   LDDARTLFHEFGHALHGLLSDVTWPSVAGTSVSRDFVELPSQLYEHWLTVPEVLKSYAT
FT                   HVKTGLPMPQDLLNKIALAHKFNAGFCAVEFISSALVDMAFHRGEIVDDPALFEHKELE
FT                   KLKMPDTIVMRHRPPHFTHIFSGDGYAAGYYSYMWSEVLDADAFQAFEETGDVFHPELA
FT                   ERLKRFIYSAGGSCDPEELYVAFRGQLPSPEAMIEKRGL"
FT   gene            complement(326785..328041)
FT                   /locus_tag="BARBAKC583_0333"
FT   CDS_pept        complement(326785..328041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0333"
FT                   /product="putative membrane-bound lytic murein
FT                   transglycosylase"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM TIGR02283"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44845"
FT                   /db_xref="GOA:A1URQ0"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ0"
FT                   /protein_id="ABM44845.1"
FT                   /translation="MQKAEPSTFAFSGRLINWRPLIIGFAFVVFTSLMLFSSHTHADSG
FT                   FKIWIQEFKKTALANNISSATFDMAFETVQAIDPEVLERAAYQPEFVDSSWNYFDNRIH
FT                   DIAIVGGRNHAKKWKTWLDKIEKRFGVNSHIILAIWSMESNYGKALENKRMMRDAIRSL
FT                   ATLAYADKKREKYARTQLIAAMKILQSGAIHRSQLTGSWAGALGHTQFIPSSYLAYAVD
FT                   MDGNGHCDIWTSIPDALATAANLLHMNGWQPGLHWGFEVKLPHGKQLPDDKLSFAQWTK
FT                   LGVQNANGKPFPSPSEYATLKLPDGPEGPAFLVTKNFFVLKRYNNADRYAFAVSLLANR
FT                   IAGHSGLVQDWKRPFKPINFQERMELQSHLAKLGHYKGEIDGKIGTASKKAIKDFQLLH
FT                   GLEVNGYPNYEVLLLLRKQ"
FT   gene            328310..329194
FT                   /gene="galU"
FT                   /locus_tag="BARBAKC583_0334"
FT   CDS_pept        328310..329194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="BARBAKC583_0334"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /note="identified by match to protein family HMM PF00483;
FT                   match to protein family HMM TIGR01099"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44782"
FT                   /db_xref="GOA:A1URQ1"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ1"
FT                   /protein_id="ABM44782.1"
FT                   /translation="MQKIRKAVFPVAGLGTRFLPATKTIPKEMLTIVDKPVIQYVVDEA
FT                   LEAGIEHLIFVTGRNKAVIEDYFDAQVELYATLAERSKKEELQHLQDLQPQPGMTSFTR
FT                   QQQPLGLGHALWCARELVGKEPFALLLPDMLMQAKKGCLSEMIHLYEKTQGGNIVAVQE
FT                   CHAEDVHKYGIVGKGEQIANGFEITQMVEKPEKGTAPSNLYINGRYILQPEIFDILSSQ
FT                   ERGAGNEIQLTDAMVRLSDKQAFFGFQLDGKTFDCGSKTGFIEANVAFALARTDLCQQV
FT                   SSSLKNLLETVKV"
FT   gene            329234..330226
FT                   /locus_tag="BARBAKC583_0335"
FT   CDS_pept        329234..330226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0335"
FT                   /product="sugar isomerase, KpsF/GutQ family"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01380; match to protein
FT                   family HMM TIGR00393"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45525"
FT                   /db_xref="GOA:A1URQ2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ2"
FT                   /protein_id="ABM45525.1"
FT                   /translation="MTQSVDMLALQCAVTSALKTISSEKQGLAVLEKALLKNLSHSFRE
FT                   AVQTIRDAKGRVVITGLGKSGHIGAKIAATLASTGTPAFFVHAAEANHGDLGMISFSDV
FT                   ILAVSWSGETTELSGIINYAKRFRTPLIAITSGENSTLGRQADIVLLLPKVEEACPHGL
FT                   APTTSTIMQLAMGDALAVALLEMRGFTAIDFKIYHPGGSLGARLKYVRDIMHQGDNIPL
FT                   VIQGTLMTEAMSVLVEKRFGCVGVVNQQGELIGIVTDGDLARNIHRDLSQFNVDEMMTK
FT                   DPKILSPDALVGTAIAFIHDHHIGAFFVVENKKPVGIVHFHDLLRVGAA"
FT   gene            complement(330466..330840)
FT                   /locus_tag="BARBAKC583_0336"
FT   CDS_pept        complement(330466..330840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0336"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44504"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ3"
FT                   /protein_id="ABM44504.1"
FT                   /translation="MKHIYSISCLTITALLLAACSFSQYYGQYPFVRNIPNGIDGEWID
FT                   TNGIVSSFHNGIFETRAADTEEKLSEGIYNYVNTQHVEIEIHSILRGTISRADCTISNN
FT                   AMQLFCTSSNGLQFSLNRKI"
FT   gene            331097..332482
FT                   /locus_tag="BARBAKC583_0337"
FT   CDS_pept        331097..332482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0337"
FT                   /product="sigma-54 dependent DNA-binding response
FT                   regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00158; match to protein
FT                   family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45554"
FT                   /db_xref="GOA:A1URQ4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ4"
FT                   /protein_id="ABM45554.1"
FT                   /translation="MIGPILIASEDHGKRIKLSATLRGFGHRVIEAENSLRTIDLLHRR
FT                   KNIVLALLDVVMSDLSASDVITMVRAAGVFVPIVVIAKQDDEESLQRALSAGAMDYWIY
FT                   PVTPLRLRITLNNLSLISALKREVHYTQKKNKNHLRFSDLHIKSDVIQELLEQAKRAAN
FT                   SSQNLLIEGEVGTDRETLARVIHHESLFSEGHFIRFQCLPITDPQEENRVWFEEFLPLV
FT                   SSSEKGTLCLCDVDRLEPIQQRRFANYFKERVEVTKKRTPFLRVIATSTSRLMDLIKED
FT                   FFLRNLFEQFSQLHIRVPSLRELRDALPEISQRLIDRIIVETGRSHIHGLAGSAISLLM
FT                   QYDWPGNHNELENLLFRAVLLSEGPLLTIKDFPQLMGNPLVSTSKVIDSTVQEHYEEKF
FT                   IKFFNINGHVRTFAEMERDIIEKAVKHYKRRMSEVARHLNVGRSTLYRKMDEYEGNKQL
FT                   TTE"
FT   gene            332541..332678
FT                   /locus_tag="BARBAKC583_0338"
FT   CDS_pept        332541..332678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45099"
FT                   /db_xref="GOA:A1URQ5"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ5"
FT                   /protein_id="ABM45099.1"
FT                   /translation="MKKWRISNFKKALFIVKFTYFFGLSCLQFQPYAILFDDIIVNVIL
FT                   "
FT   gene            complement(332697..332831)
FT                   /locus_tag="BARBAKC583_0339"
FT   CDS_pept        complement(332697..332831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0339"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44506"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ6"
FT                   /protein_id="ABM44506.1"
FT                   /translation="MYDNTKAEYYFLLQKYKNNIDDSKLALALKNVKIAPIICKNSFI"
FT   gene            332875..334445
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0340"
FT                   /note="phopholipase D-family protein, authentic frameshift;
FT                   this gene contains a frame shift which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   PF00614"
FT   gene            334582..336081
FT                   /gene="guaB"
FT                   /locus_tag="BARBAKC583_0341"
FT   CDS_pept        334582..336081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="BARBAKC583_0341"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="identified by match to protein family HMM PF00478;
FT                   match to protein family HMM PF00571; match to protein
FT                   family HMM TIGR01302"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45647"
FT                   /db_xref="GOA:A1URQ7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ7"
FT                   /protein_id="ABM45647.1"
FT                   /translation="MAKIIETKTGMLALTFDDVLLQPGYSVVMPSQVDLKTRIVADIEL
FT                   NLPLLSAAMDTVTESRLAIAMAQAGGLGVIHRNMLSEEQAEAVRQVKKFESGMVVNPVT
FT                   IGPDATLEEAKDLMHFHGISGIPVVENGAKGGVVGRLVGILTNRDVRFASDPRQKIHEL
FT                   MTHENLITVRENVQLDEAKYLLHHHRIEKLLVVDEQNRCVGLVTVKDIEKAQLHPNATK
FT                   DSQGRLRVAAATTVGDDGIERAERLIDAGVDVLVIDTAHGHSQRVLETVERIKKMALSV
FT                   SVIAGNVATSQATQALIDRGADAVKVGIGPGSICTTRIVSGVGVPQLSAIMDAAEVANK
FT                   AGIPVIADGGIKSSGDFAKALAGGACAAMIGSLLAGTEESPGEVYLYQGRSFKAYRGMG
FT                   SVGAMARGSADRYFQAEVRDELKLVPEGVEGQVAYKGPIASVLHQLAGGLRASMGYVGA
FT                   KNLAEFHEKATFVRITNAGLYESHTHDVSITRESPNYRGPV"
FT   gene            complement(336418..337278)
FT                   /locus_tag="BARBAKC583_0342"
FT   CDS_pept        complement(336418..337278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0342"
FT                   /product="putative universal stress protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45526"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ8"
FT                   /protein_id="ABM45526.1"
FT                   /translation="MTKPILALIDSSIYAKPVCDLALWAAKSMQTTIRLLYVLDKAEEE
FT                   ISLPETQQTSDNIQNTLISEQQDIGLAKALFTQKIGQEALEKAKNYLNSHSQIEIETRL
FT                   RHGNLSDALNIYGDQSSFIVMGKRGEQTESDTKQLGRNFENVVRSSRLPILVASSQFRP
FT                   IQRIFIAFDGGPLIMNAIDFICKREFFKDVTFILGMAEDQIQAVQDSFNETLTRLQSAQ
FT                   FTVESLKTEDNFEQMILHSVQTLNLDMLLMGAFHHSKIHNFFFGSKTQNIIPKTPIPIM
FT                   IMREL"
FT   gene            337522..338808
FT                   /locus_tag="BARBAKC583_0343"
FT   CDS_pept        337522..338808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0343"
FT                   /product="NOL1/NOP2/sun family protein"
FT                   /note="identified by match to protein family HMM PF01189"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44980"
FT                   /db_xref="GOA:A1URQ9"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1URQ9"
FT                   /protein_id="ABM44980.1"
FT                   /translation="MRLGGRLQAAIEVLHEIEVRHRPAGDALRDWGLSHRFAGASDRAA
FT                   IGTIVYDALRRRYSLQWRMDSDDIRDLAFGTLLDFGGMTIEQVDSVLAGDRFAPQLLGL
FT                   KQRQSWQTRQLEDAPDYIRSNVPQWCQTHLYPVFSDNWVVEAAALATRPSLDLRVNSLK
FT                   ATPKRVLKELAKTQVHSFSWFQQALRIAPTEQFNRHPNVQVEPSFQRGHFEIQDLGSQI
FT                   VTHLVEAKASMQLLDYCAGAGGKTLALSSHMGNRGQIYAYDSDKIRLSPIFDRLRRAGV
FT                   RNVQIRGNIEELKPLIGMMDIVLLDAPCSGTGTWRRRPDFKWRLTLKQVQKRQAEQCAI
FT                   LNQGLNYLKPGGRLVYITCSLFFDENEEQISRFLKQHSNFHPINMRELWQRHFSFSTMQ
FT                   PIFSDYGLTLSPATTKTDGFFLSILQKEH"
FT   gene            338944..340500
FT                   /gene="guaA"
FT                   /locus_tag="BARBAKC583_0344"
FT   CDS_pept        338944..340500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="BARBAKC583_0344"
FT                   /product="GMP synthase"
FT                   /EC_number="6.3.5.2"
FT                   /note="identified by similarity to SP:P04079; match to
FT                   protein family HMM PF00117; match to protein family HMM
FT                   PF00958; match to protein family HMM PF06508; match to
FT                   protein family HMM TIGR00884; match to protein family HMM
FT                   TIGR00888"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45387"
FT                   /db_xref="GOA:A1URR0"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URR0"
FT                   /protein_id="ABM45387.1"
FT                   /translation="MDTSHSDTVLIIDFGSQVTQLIARRVRAMGVYSEIVPFQSALGGI
FT                   NRIKPKAVILSGSPYSTLDNGSPRAPIEVFEAGIPVLGICYGQQVMCVQLGGKVEAGHE
FT                   REFGRAFLEIKEESALFDGVWEKGSSQQVWMSHGDRVTALPEGFCVIGTSKGAPYAAIS
FT                   DEKRNFYAVQFHPEVVHTPDGEKLLQNFVCKISGIKNNWSMAAYRDQAIAAIREKVGKN
FT                   RVICGLSGGVDSSVTAVLLHEAIGDQLTCIFVDHGLIRKNEAEEVLKLFRDNYNIELIH
FT                   VNAADMFINALEGETDPEKKRKTIGRLFIEVFEEETKKIGGAKFLAQGTLYPDVIESVS
FT                   AIGEAITIKSHHNVGGLPERMNMKLVEPLRELFKDDVRSLGRELGLPEEFIKRHPFPGP
FT                   GLAIRCPGAVTREKIEILREADAIYLDEIRKAGLYDKIWQAFAILLPVQTVGVMGDGRT
FT                   YEFVCALRAVTSVDGMTADFYPHDMDFLSRTAARIINEVRGINRVVYDITSKPPGTIEW
FT                   E"
FT   gene            340681..341403
FT                   /locus_tag="BARBAKC583_0345"
FT   CDS_pept        340681..341403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0345"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF03009"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44639"
FT                   /db_xref="GOA:A1URR1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR1"
FT                   /protein_id="ABM44639.1"
FT                   /translation="MLKPKIVAHRGGAHLYSENTLSAFRHAIALGVDEIECDVHLLKSG
FT                   EVVVFHDFHLEQLVGQTGYIDDMDNEMRKQIRVKGSTESPPLLEELLDLLMPTNVALHL
FT                   EIKTCGNVDREYILSQKALELIKGRGLVDRVSAISFDAVSLRPFIEAGISSGPCIDCFE
FT                   GDMLHCFSKWKKLGYSDLSLDGSIVSQDFIESALDAGFTVGVWTINGPARLSHWLDMPV
FT                   HYITTDQPDLALQLRSQR"
FT   gene            complement(341520..342557)
FT                   /gene="ugpC"
FT                   /locus_tag="BARBAKC583_0346"
FT   CDS_pept        complement(341520..342557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="BARBAKC583_0346"
FT                   /product="glycerol-3-phosphate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44479"
FT                   /db_xref="GOA:A1URR2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URR2"
FT                   /protein_id="ABM44479.1"
FT                   /translation="MATIQLLNIKKQYDNDIFVINDLNLTVADGEFLVIVGPSGCGKST
FT                   LLRIIAGLEKVTSGELYIDNELINNREPADRDIAMVFQNYALYPHMTVRGNLEYGLKNR
FT                   KTPKEDINKRIAHVAKLLEIEPFLDRKPQQLSGGQRQRVAMGRVIVRKPRVFLFDEPLS
FT                   NLDAKLRAHMCIEIKKLQRSLKTTSLYVTHDQLEAMTLADKMVVMNKGTIEQIGTPMEI
FT                   YDCPKTIFVADFIGSPPINFLDRQALEKHLGNLFSCSKDTDILAFRPEAILLGEYPDKG
FT                   PVFHTQIEFIRPIGTGCHVLTRWNDILFTVDIKERLTSDYGQKLNFTVTHQNFHTFNKK
FT                   TGNRT"
FT   gene            complement(342560..343411)
FT                   /gene="ugpE"
FT                   /locus_tag="BARBAKC583_0347"
FT   CDS_pept        complement(342560..343411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="BARBAKC583_0347"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by similarity to SP:P10906; match to
FT                   protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45382"
FT                   /db_xref="GOA:A1URR3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR3"
FT                   /protein_id="ABM45382.1"
FT                   /translation="MVENRPFLTFLTHLILILGIIIIFFPVYVAIIASTHNSIAFSTGI
FT                   LPLLPGQYGFENYKTIFGDGLVQLGLPRLWPLLMNSFIMAISISIGKIIISLFSAYAIV
FT                   YMRFPFRKTAFALIFITLMLPIEVRIIPTYTVVAQLGMINTYGGIIIPLIASATATFLF
FT                   RQFFLTVPNELLEAARMDGAGPFKFFKDILLPLSKSNIASLFIIMFIYGWIQYLWPLIV
FT                   TTDQNHQTILIILKQLVVESLQHNPQWNILMAVSVVAMIPPVLIVICMHRLFVKGLIET
FT                   EK"
FT   gene            complement(343422..344306)
FT                   /gene="ugpA"
FT                   /locus_tag="BARBAKC583_0348"
FT   CDS_pept        complement(343422..344306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="BARBAKC583_0348"
FT                   /product="glycerol-3-phosphate ABC transporter, permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45006"
FT                   /db_xref="GOA:A1URR4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR4"
FT                   /protein_id="ABM45006.1"
FT                   /translation="MQEKSAYFKNSLLPYWLLFPQLFIIFLFFIWPAVQAIKSSFERED
FT                   PFGFTTTFIGFENYVTVLSDPSYIKSLLTTIIFSTSVTFVAMSISLLLAVSVDRVIRAK
FT                   KAYTILLLWPYAVAPVLAGILWLFIFHPTIGIFPIILEKIGIIWNHRVNGTHAMILIVI
FT                   AASWQQISYNFLFFLAGLQSIPRSQIEAAAIDGATPFKRFWTVIFPQISPTTFFLLVIN
FT                   INHVMFDTFGIIDNITSGGPARATNTLVYKIYDDGFRNHIIGASAAQSTLLMLMVIILT
FT                   FIQFRWIERRVQY"
FT   gene            complement(344404..345729)
FT                   /gene="ugpB"
FT                   /locus_tag="BARBAKC583_0349"
FT   CDS_pept        complement(344404..345729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="BARBAKC583_0349"
FT                   /product="glycerol-3-phosphate ABC transporter, periplasmic
FT                   glycerol-3-phosphate-binding protein"
FT                   /note="identified by similarity to SP:P0AG80; match to
FT                   protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45593"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR5"
FT                   /protein_id="ABM45593.1"
FT                   /translation="MNRFYLFAAAFIISMTASATAFAKTTISFWHSMSGDLGKQTEDLI
FT                   HAFNESQSDYTVVSSFRGEYEETMVSLIAAFRGKQQPVLAQIYEIGTSTMMAAKGAIYP
FT                   IYQLSADTGQEFDFSDYLPAISNYYSDVQGRMFSMPFNASTPILFYNKDIFKNAGLDPE
FT                   QPPKTWKDIEKFSKKIIDSKAARCGFTMAYAAQWIGLENFSAFHNIPFGTKNNGLGGLD
FT                   AELTINGPLQIRMWTDLKKWSDQGIFYYGGSAGALDSGPMFMAQNCAIFIQSSGSLGGI
FT                   VSEAQFDVGFGMLPYYSDVENTPQNSIVGGASIWVLRGHTAKEYAGAAAFLKFLSRADN
FT                   QVKWHQTTGYLPITKTAYELSKQQNFYDKNLGADIAIRQINLNPPTANSKGIRFGNLPQ
FT                   IRSILDQELEAVLSGFKTPKNGLNTAVKRGNRLLREFEKTNH"
FT   gene            complement(346116..347063)
FT                   /locus_tag="BARBAKC583_0350"
FT   CDS_pept        complement(346116..347063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0350"
FT                   /product="ABC transporter, periplasmic substrate-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44755"
FT                   /db_xref="GOA:A1URR6"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR6"
FT                   /protein_id="ABM44755.1"
FT                   /translation="MRKFVKPFILLGLLSLFSLFTFSAIAHDKIKVVVSFSILADLVKN
FT                   VGGDRIVMTTLVGRNANIHMYEPTPRDAKALKDAHIIFINGLYLENFIHRLIAANSTKA
FT                   PLIVASANIFPLQIENHTHDTEHHMHDTGHNHMHSDVDPHAWQTIPNVKIYVKNIATAF
FT                   CEIDQRSCDSYNKNASAYIHKLNAVQTTITTQIAAIPEDKRTIITSHDAFGYFAHEYGF
FT                   TILAPESVSTEVEVTAADVAKLIKQIKANKASAIFIENISNPRLIKQISKETGIKIGGT
FT                   LYSDALSEKNGPAATYLDMIQYNVNTIINSITKD"
FT   gene            complement(347074..347946)
FT                   /locus_tag="BARBAKC583_0351"
FT   CDS_pept        complement(347074..347946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0351"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00950"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44651"
FT                   /db_xref="GOA:A1URR7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR7"
FT                   /protein_id="ABM44651.1"
FT                   /translation="MYSLFFSPFIDFQFMQNALIASILLTISACPIGVLLVLRGMSLTG
FT                   DAISHAILPGVATAFLFFGLSLIPMTIGGILAGLLVALATALISRNSLQKEDASMAVFY
FT                   LIALAAGIIIISLKGSMIDLLHLLFGSILAIDAQTLWLIAAITIITVSSLCIFWRAFVI
FT                   ESLDPLFFRSFSPLGKYIHILLLKLMVFNLVGGFQSLGTLLSIGIMMIPAITARFWLSH
FT                   LGPICVLSVILGIISSIFGLLVSFHMSLPSGPAIIMVAGFMYLLSCLISPRGLIVTWFP
FT                   RLFYSSPLL"
FT   gene            complement(347972..348709)
FT                   /locus_tag="BARBAKC583_0352"
FT   CDS_pept        complement(347972..348709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0352"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45366"
FT                   /db_xref="GOA:A1URR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR8"
FT                   /protein_id="ABM45366.1"
FT                   /translation="MVSMMDLHFDNVTLSYANKIIIKEFSTKIAAHSLIAITGDNGSGK
FT                   STLLKAIAGLIKPISGKIVKPTQNRIAYLAQQCDIDRTFPINVEALIKTGLWSFCGLLK
FT                   NQRPYQYKVQNALEMVGLTALAHRSLDELSNGQLQRALFARIIVQDSDIILLDEPFNGV
FT                   DLNTQKDLLALIAHWHQQGRTILVALHDSCMVQKHFPQMIQINKQCACYGETIQFFKTN
FT                   NHDIMQPFYTQLFSYRSTESYYQ"
FT   gene            complement(348936..349199)
FT                   /locus_tag="BARBAKC583_0353"
FT   CDS_pept        complement(348936..349199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44453"
FT                   /db_xref="UniProtKB/TrEMBL:A1URR9"
FT                   /protein_id="ABM44453.1"
FT                   /translation="MTQNEHIPAFDSLFIVFSKTKPDEKIHYLHGFSLVLCFDFLHSKQ
FT                   ALTHKQRTKPSKINILVEFLSRIPTHTLFCLLLYRRSNLDLK"
FT   gene            349418..349642
FT                   /gene="nrdH"
FT                   /locus_tag="BARBAKC583_0354"
FT   CDS_pept        349418..349642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdH"
FT                   /locus_tag="BARBAKC583_0354"
FT                   /product="Glutaredoxin-like protein NrdH"
FT                   /note="identified by similarity to GB:CAA70763.1; match to
FT                   protein family HMM PF00462; match to protein family HMM
FT                   TIGR02194"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45174"
FT                   /db_xref="GOA:A1URS0"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011909"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS0"
FT                   /protein_id="ABM45174.1"
FT                   /translation="MPVTIYSKPSCVQCNATYRAFDAKGVDYRIVDISCDEQAYNFVQS
FT                   LGYRQVPVVVCGENHWSGFRPDMIDGLCG"
FT   gene            349642..350034
FT                   /gene="nrdI"
FT                   /locus_tag="BARBAKC583_0355"
FT   CDS_pept        349642..350034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdI"
FT                   /locus_tag="BARBAKC583_0355"
FT                   /product="NrdI protein"
FT                   /note="identified by match to protein family HMM PF07972;
FT                   match to protein family HMM TIGR00333"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45037"
FT                   /db_xref="GOA:A1URS1"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="InterPro:IPR020852"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URS1"
FT                   /protein_id="ABM45037.1"
FT                   /translation="MGLIVYYSSATGNTEHFVSQLGQRFFKIDKKISSALVYEPYVLVV
FT                   PTYADGEGRKAVPKPVIHFLNEVENRKLMRGVIGGGNRNFGRNYSLASKIIAEKCSVPC
FT                   LYNFELRGTDEDVICVKKGLEKFWKQ"
FT   gene            350022..352172
FT                   /gene="nrdE"
FT                   /locus_tag="BARBAKC583_0356"
FT   CDS_pept        350022..352172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdE"
FT                   /locus_tag="BARBAKC583_0356"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to SP:Q08698; match to
FT                   protein family HMM PF00317; match to protein family HMM
FT                   PF02867; match to protein family HMM PF08343; match to
FT                   protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45497"
FT                   /db_xref="GOA:A1URS2"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR013554"
FT                   /db_xref="InterPro:IPR026459"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS2"
FT                   /protein_id="ABM45497.1"
FT                   /translation="METVSTKGLQRPDQITDYHALNAMLNLYDENGHIQFDMDRRAARQ
FT                   YFLQHVNQNTVFFHNLKEKINYLIEEGYYEKALFELYDFSFIKRLFKRAYAFKFRFPTF
FT                   LGAFKYYTSYTLKTFDGTRYLERYEDRVCLVALYLAQGNKDFAESCVDEIMTGRFQPAT
FT                   PTFLNAGKKQRGELVSCFLLRVEDNMESIGRSVNSALQLSKRGGGVALCLTNLREAGAP
FT                   IKQIENQSSGVLPVMKLLEDSFSYANQLGARQGAGAVYLHAHHLDIMKFLDTKRENADE
FT                   KVRIKTLSLGVVIPDITFELARNNEDMYLFSPYDIERVVGKPFSDISLTEHYRSFVDNP
FT                   KIRKKKISARVFFQTLAEIQFESGYPYILFEDTANRANPVAGRINMSNLCSEILQINEA
FT                   SELETDLGYRTVGSDISCNLGSMNIAKAMDSSDFGRTVETAVRALTAVSDMSNIACVPS
FT                   IAKGNAESHAIGLGQMNLHGFLAREKIYYGSPEAIDFTNIYFYTVTYHALRASNLIARE
FT                   RQEKFAGFEKSAYADGCFFEKYIKREWKPQFLLVQEIFARNNILIPTQGDWKKLKELIA
FT                   KYGLYNRNLQAVPPTGSISYINHATSSIHPIASKIEIRKEGKIGRVYYPAPYMDNTNLN
FT                   FYQDAYEIGPEKIIDTYAAATQHVDQGLSLTLFFPDTATTRDINRAQIYAWKKGIKSIY
FT                   YIRLRQKALSGTEVEGCVSCSL"
FT   gene            352185..353159
FT                   /gene="nrdF"
FT                   /locus_tag="BARBAKC583_0358"
FT   CDS_pept        352185..353159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdF"
FT                   /locus_tag="BARBAKC583_0358"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by similarity to SP:P17424; match to
FT                   protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45548"
FT                   /db_xref="GOA:A1URS3"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR026494"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS3"
FT                   /protein_id="ABM45548.1"
FT                   /translation="MTQITTKNSVVRAVNWNRLHDEKDLEVWNRLTGNFWLPEKVPLSN
FT                   DIPSWESLTEEEKKLTIRVFTGLTLLDTVQNTVGAVSLMADAVTEHEEAVLTNIAFMEA
FT                   VHARSYSSIFSTLCLTVDVDDAFRWSEENVYLQKKAKLVLEHYEANDPLKKKIASTFLE
FT                   SFLFYSGFYLPMYWSSRAKLTNTADLIRLIIRDEAIHGYYIGYKFQLGFAKLNEAQKQE
FT                   MKDFTFNMLFDLYNIECKYTEDLYDSLGLTEDVKVFLHYNANKALMNLGFESLFPSEVC
FT                   RVNPAILAALSPNSDENHDFFSGSGSSYVIGKAVATTDEDWEF"
FT   gene            complement(353156..354022)
FT                   /locus_tag="BARBAKC583_0357"
FT   CDS_pept        complement(353156..354022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0357"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM TIGR00536"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44772"
FT                   /db_xref="GOA:A1URS4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS4"
FT                   /protein_id="ABM44772.1"
FT                   /translation="MSNHSLNHAIRKTREKLQNQGISEANLDTKLLVEWVTSTSTIDRI
FT                   LQPDMCLSSQQIAQLEEAIKRRISGEPTHRIIGTREFYGISFALSKETLEPRPDTEILI
FT                   DLVLPILKKKVKKSGKATLLDMGTGTGAIAIAILKQVVQTCAVAVDIAEDALKTATQNA
FT                   KNADVLHRFTPLLSNWFNTVTGQFDLIISNPPYIPEKDIPNLAKEVRQYDPLRALIGGK
FT                   DGLDFYRKLADESATYLKEEGYIAVEIGYSQKKEVCNLFEKNGFKCLKIRDDLSGIPRA
FT                   ILFSLNT"
FT   gene            complement(354019..355098)
FT                   /gene="prfA"
FT                   /locus_tag="BARBAKC583_0359"
FT   CDS_pept        complement(354019..355098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="BARBAKC583_0359"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44805"
FT                   /db_xref="GOA:A1URS5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URS5"
FT                   /protein_id="ABM44805.1"
FT                   /translation="MVSLSQDRMKQIEKRFEIIESQMAQNPNAETYVKLASEYAELQQI
FT                   VTPIRTLNALYKEVTELEAMANTTQIDADMYALAQEELVLLRQKIEQLEQEIQILLLPK
FT                   DIADEKSAIIEIRAGTGGSEAALFAGDLFRMYERYANAHKWKVEVVSLSDSEVGGYKEI
FT                   IATISGKGVFSKLKFESGVHRVQRVPETETSGRIHTSAATVAVLPEAEEIDIEIRPEDI
FT                   RIDTMRASGAGGQHVNTTDSAVRITHIPTGIMVVQAEKSQHQNRARALQILRSRLFDIE
FT                   RQKAESERSASRKTQVGSGDRSERIRTYNFPQGRVTDHRINLTLYKLDRIMEGDLDELI
FT                   NPLISNHQTALLTEINDNA"
FT   gene            complement(355283..355699)
FT                   /gene="fur"
FT                   /locus_tag="BARBAKC583_0360"
FT   CDS_pept        complement(355283..355699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="BARBAKC583_0360"
FT                   /product="ferric uptake regulation protein"
FT                   /note="identified by similarity to GB:AAL04499.1; match to
FT                   protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45359"
FT                   /db_xref="GOA:A1URS6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS6"
FT                   /protein_id="ABM45359.1"
FT                   /translation="MDKKQSYEQTLQTSGLRITRQRRIILDILAYTDDHPNAFEIFQRA
FT                   NKIDSSISLSTVYRTMKILELNGTIHRHAFNGGPSRFEQADGEHHDHLIDIDTGQIIEF
FT                   QSDIIENIQKEIAHSLGYDVIHHRLELYGKKRNS"
FT   gene            complement(355713..358445)
FT                   /gene="secA"
FT                   /locus_tag="BARBAKC583_0361"
FT   CDS_pept        complement(355713..358445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="BARBAKC583_0361"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF01043;
FT                   match to protein family HMM PF02810; match to protein
FT                   family HMM PF07516; match to protein family HMM PF07517;
FT                   match to protein family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45515"
FT                   /db_xref="GOA:A1URS7"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URS7"
FT                   /protein_id="ABM45515.1"
FT                   /translation="MVSLSIIARKLFGSARESRIKRLRQKALQISALEEHFQKLSDGEL
FT                   CQKTDEFRQRLTDGETIDSLLPEAFATVREAAKRVYNMRPFDVQLIGGMVLHNRGIAEM
FT                   RTGEGKTLMATLPVYLNALEGKGVHVVTVNDYLANRDAETMGKIYSFLGLTTGVILHDL
FT                   DTNARRAAYACDITYATNNELGFDYLRDNMTFDRSQMVQRGHHYAIIDEVDSILIDEAR
FT                   TPLIISGPLEDRTDFYNLVNTFIPNLTPEDYEIDEKQKTTTFTEIGTEKIEKMLEQAGH
FT                   LKNDSLYDIENVAIVHHVNNALKAHKLFVRDKDYIVRNGEIVIIDEFTGRMMPGRRYSE
FT                   GLHQALEAKEHVAIQPENQTLASITFQNYFRMYEKLSGMTGTATTEAEEFSNIYGLEVV
FT                   EIPTNLPVQRLDEDDEIYRTTEEKYRAIVRDIRQAHEKGQPILVGTTSIEKSEQLAERL
FT                   RKEGITDFKVLNARYHEQEAYIVAQAGVPGALTIATNMAGRGTDIQLGGNIEMRIRQEL
FT                   QDIPEGSERTAKIEKIKQDVQKLKEKSLAAGGLYVLATERHESRRIDNQLRGRSGRQGD
FT                   PGRSKFFLSLQDDLMRIFGSDRMDSILQKLGLKENEAIIHPWINKALEKAQKKVEARNF
FT                   EIRKNLLKYDDVMNDQRKVIFEQRMEIMNAENLTDMMIEMRNDVIEDLIETHIPSGTYS
FT                   EKWNAKALQSELSQCFNLELPIEEWVKEDGIAEQQILERILDAVTKFENERTEHYSPEM
FT                   MVYFHKAILLKTIDMLWREHLINLDHLRSVIGFRGYAQRDPLNEYKTEAFELFQTMLKN
FT                   LRRDVVSKLMSFEIVQHPLESTMPQEMYAEHSTSRNIDKKDGILWAQMQNNTEVSDPIK
FT                   RDPGDSSTWEKVGRNELCPCGSSKKYKHCHGSFIPKMDG"
FT   gene            358846..359793
FT                   /locus_tag="BARBAKC583_0362"
FT   CDS_pept        358846..359793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0362"
FT                   /product="PPIC-type PPIASE domain protein"
FT                   /note="identified by similarity to SP:Q46105; match to
FT                   protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44920"
FT                   /db_xref="GOA:A1URS8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS8"
FT                   /protein_id="ABM44920.1"
FT                   /translation="MQFKFTKFFLTSALLMSTSLWAIAQDHVKVAQSDLNSLEEASEKP
FT                   VDPSHVMATIDGKNITAGQLDELALEINPNLVRIPDEQRRITVLRAYLDMQVLAKAAIQ
FT                   ENIHKTEAYDKRMAVMRDNILQQLYFKQMVVDKITDGDLKILYDKEVAALPKEDEVKAR
FT                   HILVKTKKEAQAIIKRLKKGENFEEIAKKDSTDGSAAVGGDLGYFSYGQMVKPFEDAAF
FT                   SLKVGEYTKNPVESPFGWHIIKVEDRRLKQPPEFDDAKEVLRAQIIKDRYQQLIADLRS
FT                   KIDVKYPDSRVAELMQSFNENGESLPGSFPDEEE"
FT   gene            359895..361133
FT                   /gene="argJ"
FT                   /locus_tag="BARBAKC583_0363"
FT   CDS_pept        359895..361133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="BARBAKC583_0363"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.35"
FT                   /EC_number="2.3.1.1"
FT                   /note="identified by match to protein family HMM PF01960;
FT                   match to protein family HMM TIGR00120"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45654"
FT                   /db_xref="GOA:A1URS9"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:A1URS9"
FT                   /protein_id="ABM45654.1"
FT                   /translation="MAIKGLSLYPETIQDLPPLSGVRIATAEAGIKYKNRIDLLFIIFD
FT                   EPANVAGVFTRSKCPSASVDHCRASLSHGVARGIVVNSGNANAFTGYKGKTTTKAIVKA
FT                   AADILKVKENEIFLASTGVIGEPMDESCFLNLLPNMAAMAEEGNWLKAAKAIMTTDTFP
FT                   KFATRKFDFGGEPVIINGIAKGAGMIAPDMATMLSFVVSDAAISSDILQSMLSEGVQGS
FT                   FNSITVDSDTSTSDTLMMFATGKAKGSFPCLTSRSDPRYEVFAKQLNDLLRELALQVIC
FT                   DGEGARHLIEVNVTGATTDSAAKTIALSIANSPLVKTAIAGEDANWGRVVMAVGKAGVE
FT                   ADRDLLTIWFGEHRVAVNGERDPDYSEETVGAYMKGQHITIRVDIGLGSSKATVWSCDL
FT                   TKEYVEINGDYRS"
FT   gene            361255..361668
FT                   /gene="mutT"
FT                   /locus_tag="BARBAKC583_0364"
FT   CDS_pept        361255..361668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /locus_tag="BARBAKC583_0364"
FT                   /product="mutator mutT protein"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00586"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45180"
FT                   /db_xref="GOA:A1URT0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT0"
FT                   /protein_id="ABM45180.1"
FT                   /translation="MCTKSSLLLVVACALLDQDNRVLLAERPQGKSLAGLWEFPGGKIE
FT                   QGETPEASLIRELEEELGIYVQQNDLHPLTFASYSYETFHLLMPFYICRRYEGIPQGRE
FT                   GQNLQWVFISDFGQYSMPDADKPLVEVLKNFLL"
FT   gene            362009..363364
FT                   /locus_tag="BARBAKC583_0365"
FT   CDS_pept        362009..363364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0365"
FT                   /product="transporter, dicarboxylate/amino acid:cation (Na+
FT                   or H+) symporter (DAACS) family"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44645"
FT                   /db_xref="GOA:A1URT1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT1"
FT                   /protein_id="ABM44645.1"
FT                   /translation="MILNVFINLFLFTMLLFLLFQSKKTKLSFALRVMMGLVIGLIFGS
FT                   ILQFVYGESEFILLKSVEWFNIVGDGYILLLQMIVMPLISISIISAVAHLHSSYGASKI
FT                   SIMTISILLFTTSLSALVGILVVNVFGLTADGLVDGGEDVSAILGRHIAQFGDMSVPKL
FT                   ILSFIPKNPFAELAGARPTSIISVVIFSAFLGAAAIILKKDDLDKGEQALSLIQIMQSW
FT                   VTRLVRIVIHLTPYGIFALMTKVGATSNVADILKLLIFSIASYVAIVLMFGVHAILLSI
FT                   SGINPLSFFKKVFPVLTFAFSSRSSTASIPLNIEAQTQWLGVPQSIAGFAASLGATIGQ
FT                   NGCAGLYPAMLATMIAPSVGIDPLDPMWIITLVGVVTLSSIGVAGVGGGAVFAALIVLP
FT                   IMGLPVALVAVVMSIEPLIDMGRTALNVNGSMLAGSMTSQILRATDKSIFEK"
FT   gene            complement(363387..364277)
FT                   /locus_tag="BARBAKC583_0366"
FT   CDS_pept        complement(363387..364277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:NP_698859.1; match to
FT                   protein family HMM PF08242; match to protein family HMM
FT                   TIGR02072"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45334"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT2"
FT                   /protein_id="ABM45334.1"
FT                   /translation="MLNNMSYPLIFDYMRIEQFRKRAFKKAQKGSDFLLSYVVEDLYKR
FT                   LSTVDRQFTLALDLHSHTGLAVEALNKSGKIHSIERVETDILYQSHNKKFHLRQREFLD
FT                   FPKHYCDLIISLLSLQLTNDTPGVLNQIKNILKPDGLFLAVMAGAGTLEELRKSLFQTE
FT                   MEMYGGVSPRIYPFADIRDVGAILQRAGFAMPVVDVEDITVRYNTMFDLMHDLKAMGMQ
FT                   NALINRSRRPVSKRFFLHAAEIYAQKFSDPDGRIRAHFSFIWLSGWAPDPNQQKPMRPG
FT                   SAQISLADVFKKQTK"
FT   gene            364495..365250
FT                   /locus_tag="BARBAKC583_0367"
FT   CDS_pept        364495..365250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0367"
FT                   /product="comF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44601"
FT                   /db_xref="GOA:A1URT3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT3"
FT                   /protein_id="ABM44601.1"
FT                   /translation="MRGVLGKFIKRLMAVVYPPTCPGCKVIVSAHGTICADCWKDLQFI
FT                   TKPYCPIMGIPFACDMGDGFLSGEALQTSYPFSRVRSAIAHKGLARTLTIRLKYGDRVE
FT                   LAQFMANWMVFAGREIIDDCDIIIPIPLHFRRFFWRRYNQSAELARYIAAKQKKKFKPG
FT                   WLVRCRHTRPQVGLSARERKFNVQNAFSVPRKIKKRMQGCSILLVDDVLTTGVTVTIAA
FT                   ATLKRAGARQVDVLTFSRVLKDISILPHS"
FT   gene            365290..365547
FT                   /gene="grxC"
FT                   /locus_tag="BARBAKC583_0368"
FT   CDS_pept        365290..365547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grxC"
FT                   /locus_tag="BARBAKC583_0368"
FT                   /product="glutaredoxin 3"
FT                   /note="identified by match to protein family HMM PF00462;
FT                   match to protein family HMM TIGR02181"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45276"
FT                   /db_xref="GOA:A1URT4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT4"
FT                   /protein_id="ABM45276.1"
FT                   /translation="MKEVTLYTRPNCPYCTKARILLDKKGIKYTDIDASTSLRQEMVKR
FT                   ANGRNTFPQIFIGDYHVGGYDDLHSLDAEGKLDSLLNNAQ"
FT   gene            complement(365565..366311)
FT                   /gene="ubiG"
FT                   /locus_tag="BARBAKC583_0369"
FT   CDS_pept        complement(365565..366311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="BARBAKC583_0369"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242; match to protein family HMM TIGR01983"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45687"
FT                   /db_xref="GOA:A1URT5"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URT5"
FT                   /protein_id="ABM45687.1"
FT                   /translation="MINKTRTTVDQSEIDHFSRIAAEWWNPQGKFRPLHKFNPTRLAYI
FT                   KEKICLAFDRDPFSLAPFAGLKILDIGCGGGLLCEPMVRLGATVIGADAAQNNIEVAKI
FT                   HATQSGLSIDYRATTAEKLADKGEKFDIILNMEIVEHVADVDLFISATAKMLKPQGLMF
FT                   IATLNRTWKSWGLAIVGAEYILRWLPKGTHDYKKFLKPQELKKLLLTNSLKVIDELGIT
FT                   YNPLNDSWNRSKDMDVNYMLLVKRLQ"
FT   gene            366495..367748
FT                   /locus_tag="BARBAKC583_0370"
FT   CDS_pept        366495..367748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0370"
FT                   /product="asparate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00656; match to protein family HMM
FT                   TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45119"
FT                   /db_xref="GOA:A1URT6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT6"
FT                   /protein_id="ABM45119.1"
FT                   /translation="MARIVMKFGGTSVANVERIQNVARHVKREVNAGNEVAVVVSAMAG
FT                   KTNELVQWTRDISPIYDVREYDTIVSSGEQVTAGLLALALQEIGVNARSWLGWQIPIRT
FT                   DSAHGSARIIDIDKSFLIQGFQENQVAVIAGFQGISSDNRISTLGRGGSDTSAVAVAAI
FT                   LQADRCDIYTDVDGVYTTDPRVEPKTRRLSKVSFEEMLELASLGAKVLQVRSVELAMVH
FT                   KVRTFVRSSFEHPDAPGMCDPINSSGTLICNEDEIVEQQNVTGIAFAKDEAQISLRRFS
FT                   DRPGISAAIFGPLAEARINVDMIVQNISEDGSKTDMTFTVPSADVERAVALLKKNHKEI
FT                   GFDVIQFASDLAKVSVVGIGMRSHAGVAATAFKALAEKGINIKAITTSEIKISVLIDSA
FT                   YTELAVRTLHAVYDLDKG"
FT   gene            complement(368168..369526)
FT                   /gene="nhaA"
FT                   /locus_tag="BARBAKC583_0371"
FT   CDS_pept        complement(368168..369526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="BARBAKC583_0371"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="identified by similarity to SP:P13738; match to
FT                   protein family HMM PF06965; match to protein family HMM
FT                   TIGR00773"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44900"
FT                   /db_xref="GOA:A1URT7"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URT7"
FT                   /protein_id="ABM44900.1"
FT                   /translation="MLDLSSNRLPNRASLITNRAFSAIERFLHIEAMSGVVLLLAAATA
FT                   LILANSQYTSLYEAFWHTPLGFNFGHFNLSWDLHFWVNDVLMTIFFLVAGMEIRREIHE
FT                   GALASVKQAILPIVAAIGGVCIPAIIYLSFNFNGGHIYGWAVPTATDIAFALGILALLG
FT                   KAIPSNLHIILLSLAIIDDIMAVLIIAFFYSTNLDPSGLAIAAAGIALVFFFQWISFAS
FT                   AWLYVLPGAIIWWGLMVTGIHPSLAGVILGMMTPVFPTRNLVSPLTTLSNAIQTLQEKN
FT                   TNTDLHHISTTLKKMRKGQRDIVAPVIRIQKELHPWVAYGVMPIFAFANAGVSFANFDL
FT                   ASQKSFLIVLGIIIGLCIGKPLGILAASYLAVKSGLCRLPPHVTWTGILLIGFLAGIGF
FT                   TMSIFVSMLAFQDIAQLNSAKIGVLCGSGLSALAGLGYGLIYIKNNKKTHNKP"
FT   gene            complement(369647..371350)
FT                   /locus_tag="BARBAKC583_0372"
FT   CDS_pept        complement(369647..371350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45632"
FT                   /db_xref="GOA:A1URT8"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT8"
FT                   /protein_id="ABM45632.1"
FT                   /translation="MVNFHDKYQYNYKYWLTCIVGFVTIFAIIVVGGFYMAKPHLDSFV
FT                   KSEIARRSINAEKSEVSIIGKVNLTNVTLPTPENVSLKIGAISGRPPIAFIPGTFTLYD
FT                   VDLKYNDIHLQIPQIAIGNISLKDKDVTITSRFLQSLMRVNISSINAPDILIFTENTNK
FT                   PTEKFNIKNFQLSGFKNGHIRSISIKNVVDHLEFAPAAFDSTKQIRLNAQSNKMQAYDI
FT                   DVSYLYSIISGKNNPDDQSKTVIGSIALKDIMVDIFKGKEKNASFSLGELKMSDLKIKP
FT                   LEETPEKLIKAYLNAKKMKDQAAQKEAQNTILRTSISAITSINVQMNKVDIDLPQLTTT
FT                   LKSFQIKSSQWQQPIPESFLLSLNDLSISPKKPEQKNLNFLQYMGFEHLDISGKINFFY
FT                   DEKNHALLLNGISFNIKDIGSGEISAKIVDVDKTLFSGEKEKIIAASQNLGITEIDMRY
FT                   TDFGFIDKLFSYLAQNLDDGKYDLKEELYDDFYLIITQSPKILLKNHCDVENIAQSLGD
FT                   FAKNPQTLKIQITAKDNKGLTADDLQVALQNNLPAVLSKVNLTIKNEPSH"
FT   gene            371869..372540
FT                   /locus_tag="BARBAKC583_0373"
FT   CDS_pept        371869..372540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0373"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44809"
FT                   /db_xref="GOA:A1URT9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:A1URT9"
FT                   /protein_id="ABM44809.1"
FT                   /translation="MSYDSFIHEVNEEFRQEKVYAFLKRHGFLVIVAAIIFILAIVGYQ
FT                   VYSHKKMNEARNIGDIFIKSLSLADSHDFDQAMNQLELVKASNFAGYPFLARLREASLL
FT                   SEQGDAVRAVEMFDTVAFDEKAPQILQKVAKIQAAYILVDIGTLDDVKKRVQDIANDID
FT                   PMRISAREALGLAAYKADKMDEAVYYFQKISEEGNLGIKIVERAKIMLELIQAEGKVNK
FT                   E"
FT   gene            372545..373966
FT                   /gene="engA"
FT                   /locus_tag="BARBAKC583_0374"
FT   CDS_pept        372545..373966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="BARBAKC583_0374"
FT                   /product="GTP-binding protein EngA"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF08477; match to protein
FT                   family HMM TIGR00231; match to protein family HMM
FT                   TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45486"
FT                   /db_xref="GOA:A1URU0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URU0"
FT                   /protein_id="ABM45486.1"
FT                   /translation="MSLTIAIVGRPNVGKSTLFNRLVGKKLALVDDKPGVTRDRRIHAA
FT                   RFQDLYFDVIDTAGLEEADDHTLEGRMRSQTKVAIDEADLILFVLDAKSGITSSDLNFA
FT                   SLVRKSEKPIVLVANKSESKAATEGKYEAWSLGLGEPCAISAEHGLGLSDLRDAIVDAV
FT                   GKDKAFDNKKEEDTIIQSASVGDNGDDLEEEGCIYDESAPIRIAIAGRPNTGKSTLINS
FT                   MLGQDRLLTGPEAGVTRDSISIDWEWRSRHIKLFDTAGLRRKSKIQEKLEKLSVTDTLR
FT                   AIRFAEVVVIVFDSTAPFEKQDLQIVDLVIREGRVPIIAFNKWDLIENCQEILADLHEK
FT                   CACLLPQVRGLRAVPLSGQYGQGIDKLMENITMIHRIWNRRISTGKLNRWLETVVTRHP
FT                   PPAISGRRLKVKYITQIKTRPPGFMISCSRPEVMPQSYLRYLSNGLRDAFDMPGVPIRL
FT                   SLRTSDNPFVGSAKK"
FT   gene            374282..374719
FT                   /locus_tag="BARBAKC583_0375"
FT   CDS_pept        374282..374719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_033249.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45095"
FT                   /db_xref="GOA:A1URU1"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU1"
FT                   /protein_id="ABM45095.1"
FT                   /translation="MAQGNKPVMPQRETEERKQEDFFHLENLADNLECRSRNLELSLIR
FT                   KGVFKKQEAESDSKGSQNGVARAINLSSEFLASVIVGVVLGLMFDKLVGSLPWGLVFFL
FT                   FLGFAAGVLNILRFVGYMTPSQLEHGILCQNKKISKSDIRG"
FT   gene            374721..375479
FT                   /gene="atpB"
FT                   /locus_tag="BARBAKC583_0376"
FT   CDS_pept        374721..375479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="BARBAKC583_0376"
FT                   /product="ATP synthase F0, A subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00119;
FT                   match to protein family HMM TIGR01131"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44998"
FT                   /db_xref="GOA:A1URU2"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URU2"
FT                   /protein_id="ABM44998.1"
FT                   /translation="MTSHAPDPIHQFEISRLINVSIGNVDFSFTNVSFFIIATVVLSSV
FT                   FLFISSSSRRLVPTRMQSISEMAYEFVASTLRESAGVQGMKFFPLVFSLFVFILVANFI
FT                   GLFPYFYTITSQIMITFSLAMLVILTVIGCGFYKHGIGFLKLFVPSGVPVMILPLVTVI
FT                   EVISFFSRPISLSLRLFANMLAGHITLKVFSGFIVSMVGLGFIGVGGSILPLIMTVAIT
FT                   ALEFLVAFLQAYVFTVLTCMYLNDAVHPGH"
FT   gene            375534..375764
FT                   /locus_tag="BARBAKC583_0377"
FT   CDS_pept        375534..375764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0377"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="identified by match to protein family HMM PF00137"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45242"
FT                   /db_xref="GOA:A1URU3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU3"
FT                   /protein_id="ABM45242.1"
FT                   /translation="MELALAAKYLGAGLACFGMAGTALGLGNIFGSYLSGALRNPSAAD
FT                   SQFGRLVFGFAVTEALGIFSLLIALLLLFAV"
FT   gene            375972..376457
FT                   /locus_tag="BARBAKC583_0378"
FT   CDS_pept        375972..376457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0378"
FT                   /product="ATP synthase F0, B subunit family protein"
FT                   /note="identified by match to protein family HMM PF00430;
FT                   match to protein family HMM PF02326"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45323"
FT                   /db_xref="GOA:A1URU4"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URU4"
FT                   /protein_id="ABM45323.1"
FT                   /translation="MFPPFDFSHFCSHFFWLVISFGFFYFFIARVIVPRIGCTIEIRRD
FT                   RIASDLDRAMRLKQEADTVVEIYERKLAEARLQAYAIAQKTSNEIKEKTKLERKEIETS
FT                   LDKKLADAEGQIAKIRNKAVQNIGSIAEEVVPEIVKKLIGVEVSKESVSLAVKAADN"
FT   gene            376469..376948
FT                   /locus_tag="BARBAKC583_0379"
FT   CDS_pept        376469..376948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0379"
FT                   /product="ATP synthase F0, B subunit family protein"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44850"
FT                   /db_xref="GOA:A1URU5"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URU5"
FT                   /protein_id="ABM44850.1"
FT                   /translation="MTDTFWAFIGLILFLALLFYFKVPAMALRSLDERAKRIAGELDEA
FT                   LRLREEAQGILAEYQQKCAGIEQDVQEIITAAKHEAEIIVAEARVKTEEYVKNRNKLVE
FT                   QKIAQAESDAIQEISSSAVNLAISSASKIINNELGAKKANDLIKESIIKVKTNLH"
FT   gene            complement(377343..379565)
FT                   /gene="glyS"
FT                   /locus_tag="BARBAKC583_0380"
FT   CDS_pept        complement(377343..379565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="BARBAKC583_0380"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02092;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00211"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45409"
FT                   /db_xref="GOA:A1URU6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU6"
FT                   /protein_id="ABM45409.1"
FT                   /translation="MSDLLLELFSEEIPARMQRKAAADLKKCVTNKLVDAGLTYKAACE
FT                   YWTPRRLTLDIRGLSTKSQDIYEERKGPSTQSPQQVIDGFLRATGLNNISEAHIAHDNK
FT                   KGDFYIAKIIKKGRIAEDIIAEILPDILRNFPWPKSMRWGEDSAKSGALRWIRSLQNIL
FT                   CVFGPQCGETHIIPFTIGSLKSNNLTYGHRFLSDGKPIPIRRFDDYIAQLEAHKVILDA
FT                   ERRKNIILVDAKNLCFANGLELVEDDPLIEEVAGLVEWPVVLMGNFDKAFLDIPPEIIR
FT                   LTIRANQKCFVTRKQGEKTKLSSHFVLVSNILASDEGKEIIKGNSKVVHARLSDALYFW
FT                   QKDQCDLFNIADLKSSAEKFDLDLNKPLDQRIANLDRLNVTFHAKLGTQGEKVERISAL
FT                   VQKIAPIVQADSTLAKRAAVLAKADLQTEIVNEFPELQGFMGKTYALLQGEDPRVAEAI
FT                   EDHYRPLGPTDRIPQEPVTIAVALADKIDTLVGFWLINEKPTSSKDPYALRRAALGVIK
FT                   LVLSHNCKINLTSLFHQAINIFLQQKTEYAAYLKESKQTQDTLVKEIDDILSDLLSFLH
FT                   ERLKIHLKDEGVRHDIIEAVLTKNADDFSLIVHRIEVLTSFINTNNGNNLLAAIKRAVN
FT                   ILENESKKGNEFASTINLELFIENEEKQLYQAIIAAEKKVNDHINTTDWLSALNALASL
FT                   KEPIDKFFEKVLVNDKNAAIRANRLALLEFIHTITQDIADFSKIII"
FT   gene            complement(379558..380508)
FT                   /gene="glyQ"
FT                   /locus_tag="BARBAKC583_0381"
FT   CDS_pept        complement(379558..380508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="BARBAKC583_0381"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="identified by match to protein family HMM PF02091;
FT                   match to protein family HMM TIGR00388"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45025"
FT                   /db_xref="GOA:A1URU7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU7"
FT                   /protein_id="ABM45025.1"
FT                   /translation="MNLSEHLNPTHSFQGLILTLQSYWAHYGCAILQPYDMEVGAGTFH
FT                   PATTLRSLGPRPWKAAYVQPSRRPTDGRYGKNPNRLQHYYQFQVIIKPSPPNLQELYIN
FT                   SLKAIGLDTNLHDIRFVEDDWESPTLGAWGLGWECWCDGMEISQFTYFQKVCGIECAPV
FT                   SGEITYGLERLAMYIQGVDNVYDLNFNGLEGEDRISYGDIFLQAEQEYSHYNFEFANTE
FT                   FLHQHFIDAERECITLLEAGKPNKEGDFHLCVLPAYDQCIKASHIFNLLQARGVISVTE
FT                   RQNYILRVRDLARRCGEAFLLTEAGTINVKGKSNV"
FT   gene            complement(380574..382304)
FT                   /locus_tag="BARBAKC583_0382"
FT   CDS_pept        complement(380574..382304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0382"
FT                   /product="tetratricopeptide repeat protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45181"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU8"
FT                   /protein_id="ABM45181.1"
FT                   /translation="MRCTTASRFFTFFMAGIMLMPLPAYSNIGATLNINSFSGAYLAGR
FT                   AARYENKIDLAISYLKQALAYNPDDIGVQKEIFEAMLSVGTFQDAVKQAKKLKAQDVTN
FT                   PFIFLTLSIDNFIKKNYTDAKLLLQTKTSPHINNPAFDIISTWVTFESGNHSQAIADLE
FT                   KLLGPPWYNLFIHYHLALMSDLAKRTKDAKKYFIQALNNQQGAIAAPDTYERIIIAYAS
FT                   FLLRHKMTNKAIETIQNGEKILLGREALKNIRKKIEKGANLENPVKTPQQGAGEVLYDF
FT                   GTAINRKDSEHIARIFIQLSLALYPQNEVAVFQLADISAKMNDTNQAIKLYHALPPLSP
FT                   YYRDSQIQLALLLANNNNHNEAIKLLTSLEKKIPNDRYIFMALSAIHMQANNFAETIKV
FT                   INRAMTGITDFQKDDWQLFYQRAIAFEHLKQWPKAENDLRKALELFPDQPQVLNYLGYM
FT                   LIERDQELEESLRMLQKASKLQSQNSYILDSLGWAYYKLKQYDQAVEILETAVKLQPQD
FT                   PVLNDHLGNAYWQIGRKREAIFQWNHAIDGQPENLEKIKEKLKFGLQKTTTLDHNHTKL
FT                   "
FT   gene            complement(382394..383410)
FT                   /locus_tag="BARBAKC583_0383"
FT   CDS_pept        complement(382394..383410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0383"
FT                   /product="polyprenyl synthetase"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45444"
FT                   /db_xref="GOA:A1URU9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A1URU9"
FT                   /protein_id="ABM45444.1"
FT                   /translation="MDAITKQDYKKNNQVSLQPLINLTKDDMERANQLIISMIKSNIEM
FT                   IPEICNHLISSGGKRLRPMITLAAAHMFGYQGDEHIKLATAVEFMHTATLLHDDVVDES
FT                   NLRRGKSTARMIWGNQASVLVGDFLLGQAFKIMVDARSMEALAILSNAAAVIAEGEVMQ
FT                   LAAANNIENDISNYLKIINAKTAALFSAAAEVGPIIAGYGCEERSALRKYGTSLGLAFQ
FT                   LIDDALDYSGDAQHLGKNIGDDFREKKITMPVIFSYMRGNAVEKEFWKQTFKESNHSDE
FT                   AFIHAQYLMEKYGCITDTIKHARIYGQHAIDALSSIKDSPAKSALIEVIDFCIARVN"
FT   gene            383672..384463
FT                   /locus_tag="BARBAKC583_0384"
FT   CDS_pept        383672..384463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0384"
FT                   /product="methyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44709"
FT                   /db_xref="GOA:A1URV0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV0"
FT                   /protein_id="ABM44709.1"
FT                   /translation="MDRATNHSDETIDKFHRGKFYLVQPREHGHRSGVDAMLLAGLVPS
FT                   LFKGKIVDLGAGAGAAGLAVASRCFETHVTLVERSAFMLSYAQKTLLLKENKELSSRIF
FT                   LLGADVTLRGKERIEAGLINNSFDFAIMNPPFNNSADRKTPDRQKSEAHVMPEAMFENW
FT                   LRSAAAIVKPGGYLGLIARPQSLTDILHALKRRFGDIRIIPVHSRAETAAIRILFYAKR
FT                   GSKTALSVLPALIMHEGNSHAFSPQVDAINNGHISLWEIFK"
FT   gene            384566..385417
FT                   /locus_tag="BARBAKC583_0385"
FT   CDS_pept        384566..385417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0385"
FT                   /product="peptidase, S49 family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF01343"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45447"
FT                   /db_xref="GOA:A1URV1"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV1"
FT                   /protein_id="ABM45447.1"
FT                   /translation="MIGCTKCFIPRYLRSSAFNIPVVRLHGAIMDSTSLMARTLSLSRC
FT                   ADLLDKAFSDKRAPAVALVINSPGGSPVQSRLIFQRIRDLADEKKKQVLVFVEDVAASG
FT                   GYMIACAGDEIFADATSIVGSIGVVSASFGFPELLKKIGVERRIYTAGKNKVILDPFQP
FT                   EKKTGIDHLKSLQLEVHQTFIDLVKERRESKLSDDPDIFTGMFWTGKRGIGLGLIDGLG
FT                   DVRSVVKERFGDKTKLRLISPSKSLLGPKTPSGISADVVNMAVDSLLTVAEERALWQRY
FT                   GL"
FT   gene            385496..385684
FT                   /locus_tag="BARBAKC583_0386"
FT   CDS_pept        385496..385684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0386"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44877"
FT                   /db_xref="GOA:A1URV2"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV2"
FT                   /protein_id="ABM44877.1"
FT                   /translation="MIRLILFSLICIAVFYVRYLFKHKSRRILQRADSTKVHSYTDIKK
FT                   TKGTLVHDPYTGEYYVQ"
FT   gene            385681..386595
FT                   /gene="ispE"
FT                   /locus_tag="BARBAKC583_0387"
FT   CDS_pept        385681..386595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="BARBAKC583_0387"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM PF08544; match to protein
FT                   family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45227"
FT                   /db_xref="GOA:A1URV3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URV3"
FT                   /protein_id="ABM45227.1"
FT                   /translation="MISTVQDSLEGHFHVLTPIKLNLALHIVGQRTDGYHLLESLVYFS
FT                   LSGDCLSYAPCERDRFILTGPFAKGLSCNSINLAVRARDFMHKTFPRSAKPSSFQLMKT
FT                   LPVASGIGGGSGDAASILNILRQKWKLDCSCEELAEMSLALGADVPMCLFALEYQQPLF
FT                   VKGIGNDVTRLEEACSIAMVLVNHGQKIATETIFNALEKRNHPPLKINPVALKTVSSLV
FT                   EVLQETRNDLFIPALKIAPQLAEVLSTLDESGSLFSRMSGSGATCFGIFKDQQAAQKAA
FT                   AFIKSMHPNWFVKSIITLGRSSQ"
FT   gene            386884..387552
FT                   /gene="rnhB"
FT                   /locus_tag="BARBAKC583_0388"
FT   CDS_pept        386884..387552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="BARBAKC583_0388"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44514"
FT                   /db_xref="GOA:A1URV4"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URV4"
FT                   /protein_id="ABM44514.1"
FT                   /translation="MSRNIRNVLNMSDLPPQPNFSYELDLQNQGFFHIAGVDEVGRGPL
FT                   AGPVVTAAVILSKDHSLDGLNDSKKLSVQKRNRLYCEILQSALAISIASICARAIDQSD
FT                   IRKATLEAMRRCVMGLAVPAHYALIDGRDIPPHLPCPAKALVKGDQRSVSIAAASIVAK
FT                   VTRDRMMEHAGQVYQGYGLEKHVGYATVAHRAAIAEYGPVIGLHRYSFALIKRYKEDIS
FT                   "
FT   gene            387549..388511
FT                   /locus_tag="BARBAKC583_0389"
FT   CDS_pept        387549..388511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0389"
FT                   /product="Sua5/YciO/YrdC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM PF03481; match to protein
FT                   family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45094"
FT                   /db_xref="GOA:A1URV5"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV5"
FT                   /protein_id="ABM45094.1"
FT                   /translation="MTILPLNSHSIKEAVEILKKGQLVVLPTETVYGLAGDATNGKAVA
FT                   SIFAIKGRPQFNPLIAHVSSIKMAECYVEIDCLSRRLMEAFWPGPLTLVLPLKPHHNIH
FT                   PLTTAGLNTLAVRFPDGGFAEIVQCFGRPLAAPSANQSGYLSPTSAASVFDSLGEKVSL
FT                   IIDNGPAKIGLESTIVKVCDGNIYLLRPGGIIAEDIEKVVEKSLKRMDQCAAIEAPGML
FT                   KSHYAPNSLVRLNAQTVENGEALLAFGTQRIAGVENAIYVLNLSESGQLEEAAFNFFQY
FT                   MKQLDLFKARCIAVEPIPFYGLGEAINDRLIRAAAPKGE"
FT   gene            388514..389923
FT                   /locus_tag="BARBAKC583_0390"
FT   CDS_pept        388514..389923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0390"
FT                   /product="FAD-binding protein"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44654"
FT                   /db_xref="GOA:A1URV6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV6"
FT                   /protein_id="ABM44654.1"
FT                   /translation="MEQNLIERFRNIVGPMHAITDQALIAPHLREYRGLFHGKTPLLLR
FT                   PSSTKEVSSIMHLASQTRTPIVPQGGNTGLVGAQQPDDSGCSVILSMERLNKIRSLNLE
FT                   GNYAVVEAGVILQTLQRKANEVERLFPLSLGSEGSCQIGGNLSSNAGGTAVLAYGSMRD
FT                   LCLGLEVVLPDGRILDDLRFVKKDNSGYDLKDLFIGAEGTLGVITAAVLKMFPKPKGKA
FT                   VAFVGLHSPAKALEFLSLAQSYGGSSLTGFELMNKLSLQMALNYKMCTRSPLDREYEWY
FT                   VLIDISSARSDNDALSVLSDFLEVALKDSIIQDAVITRSLKQQDFFWQLRENMSPAQKL
FT                   AGGSIKHDIAVPISSIPDFIAEAALIVENVAPGAQVVCFGHMGDGNLHYNVTQPIGAEP
FT                   KDFLQLWSQMNDHIHCLVMRYQGTFSAEHGVGQLKRKELRTFKSPVSLEIMQEIKKIFD
FT                   PLGIMNPGKIL"
FT   gene            390075..390593
FT                   /locus_tag="BARBAKC583_0391"
FT   CDS_pept        390075..390593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44697"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV7"
FT                   /protein_id="ABM44697.1"
FT                   /translation="MANQCFDQKKKGLEFRLNPCHLPQTITYLSPKNGNQIICSLNEKS
FT                   VFMKIDATSSLSRFMPATYFKGIAARIIETLSGKRAVTLELFHSDEEVCIPLLISRDLN
FT                   HVLLHWRLWADLYGLPMLMINEDDGIVFVKDYSSFRVTSPHYSRKGFLLNSHGLLGLRL
FT                   IIANRSVLQ"
FT   gene            complement(390863..392137)
FT                   /gene="purD"
FT                   /locus_tag="BARBAKC583_0392"
FT   CDS_pept        complement(390863..392137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="BARBAKC583_0392"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02843; match to protein
FT                   family HMM PF02844; match to protein family HMM TIGR00877"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45258"
FT                   /db_xref="GOA:A1URV8"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV8"
FT                   /protein_id="ABM45258.1"
FT                   /translation="MNVLLIGSGGREHALAWKIAASPLLTKLYCAPGNPATIEFGENIV
FT                   LDIDDHLLVIDFCKTHSIDLVIIGPEAPLISGITDALNAADIYVFGPNQKAAQLEGSKS
FT                   FTKDLCQRNNIPTSIYQCFDDASKAKSYIRQQGVPIVIKVDGLAAGKGVVIATTIEEAF
FT                   NAVDSCFEGAFGDAGKKIVIEAFLEGEEASFFCLCDGKTAIPFGSAQDHKRVGDGDIGE
FT                   NTGGMGAYSPAPVMTEEMVNRTLKEIIEPALRGMAEMEALFKGILFAGLMITSEGPKLI
FT                   EFNVRFGDPECQVLMMRLEEDILPLLLAAAQGNLENRPILWSEKTALTVVMAANGYPNA
FT                   PQKGSVIRNVDKVNTLSDVQVFHSGTALHNGELIANGGRVLNITAVGKTVSKAQKRAYE
FT                   AVDCIDWPQGFVRRDIGWRAIARES"
FT   gene            392230..393234
FT                   /gene="ubiA"
FT                   /locus_tag="BARBAKC583_0393"
FT   CDS_pept        392230..393234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="BARBAKC583_0393"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01474"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44841"
FT                   /db_xref="GOA:A1URV9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A1URV9"
FT                   /protein_id="ABM44841.1"
FT                   /translation="MKKNKNITQIQSCENQGRVMDASSKQWVYSFLPSSLWLYAQLARW
FT                   DRPIGWKLLMWPCFWSTTMALLSYEISQQPLLSVMIHWIWYLFLFFLGSIAMRGAGCTW
FT                   NDLVDHEIDSQIERTRSRPLPAGQISRFQAKVFILVQCFVGLGVLLQFNMFSFYLGISS
FT                   LVAVAFYPFMKRITDWPQFFLGIAFNWGALMGWAVVYGRLSWAPIALYAGSILWTIGYD
FT                   TIYAHQDRKDDAIVGVRSTARLFEKSTKRALILLYSGFLILVSLAFYLAKVPIISFLGL
FT                   FCAGVHMFIQIKAIDIDNSEQCLKLFKSNSFVGFFIFAGLICGGAWMILYPAI"
FT   gene            complement(393315..393962)
FT                   /gene="pdxH"
FT                   /locus_tag="BARBAKC583_0394"
FT   CDS_pept        complement(393315..393962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="BARBAKC583_0394"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="identified by match to protein family HMM PF01243;
FT                   match to protein family HMM TIGR00558"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45420"
FT                   /db_xref="GOA:A1URW0"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URW0"
FT                   /protein_id="ABM45420.1"
FT                   /translation="MLAKFESMMSNKVQTDDDFTQTQNPFTLFASWLEEATISEINDPN
FT                   AMALATVDETGLPNVRIVLLKNFNSTGFVFYTNYESCKGQEILKSMKASLVFHWKSLRR
FT                   QIRIRGLVEQVSPEEADAYFQSRPYGSQIGAWASKQSQLLEDRFVLEKEVSRYTADYAI
FT                   GNVPRPPYWSGFRIKPLFIEFWRDRPSRLHDRLLFTRDFLEQNNWKKQRLYP"
FT   gene            394256..395155
FT                   /locus_tag="BARBAKC583_0395"
FT   CDS_pept        394256..395155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0395"
FT                   /product="DnaJ family protein"
FT                   /note="identified by match to protein family HMM PF00226;
FT                   match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45471"
FT                   /db_xref="GOA:A1URW1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW1"
FT                   /protein_id="ABM45471.1"
FT                   /translation="MRNPYTVLGVERTAKPQEIKSAFRKLAKRYHPDHNMDDVKAKEKF
FT                   SEINQAYEIIGDTVKKAQFDRGEIDAEGKPLHQAYSAGGNFRNKQNPFAGGARGFDFSF
FT                   SGNAGFDASDVFRDLFGKATSFSDSAYSQPQQGAHVRTSLSITLEQMVSSDKVEAVFPN
FT                   GKKLKIKLPAYVEDGQTIRLKGQGEEVAYGQAGDALVSIRVQKHPRLRVEGRALHLDLP
FT                   IPLKHAVLGAKEEVETLEGRVVLTIPPWSSSDRVLRLKGRGLRLKNGERDDLYVHVRIM
FT                   LPEGGDAALEQFFQMQKD"
FT   gene            395293..396111
FT                   /locus_tag="BARBAKC583_0396"
FT   CDS_pept        395293..396111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0396"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44970"
FT                   /db_xref="GOA:A1URW2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW2"
FT                   /protein_id="ABM44970.1"
FT                   /translation="MVNSNGLLCGKRGLILGLANNRSIAWGIARAASAAGAELAFTYQG
FT                   EAMKRRVEPLAAELGGFVCGHCDVSDSASIDAVFSEIEKKWGKLDFLVHAIGFSDKDEL
FT                   NGRYVDISESNFMMTMNISVYSLTALTQRAEKLMFDGGSILTLTYYGAEKVVPHYNVMG
FT                   IAKAALEASVKYLAVDLGPKNIRVNAVSAGPIKTLAASGIGDFRYILKWNEYNAPLRRT
FT                   VTIEEVGDSALYFLSDLSRSVTGEIHHVDSGYNVIGMKAVDAPDISVIKE"
FT   gene            396240..397334
FT                   /gene="aroC"
FT                   /locus_tag="BARBAKC583_0397"
FT   CDS_pept        396240..397334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="BARBAKC583_0397"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44553"
FT                   /db_xref="GOA:A1URW3"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URW3"
FT                   /protein_id="ABM44553.1"
FT                   /translation="MSHNTFGHLFRVTTWGESHGAALGCVIDGCPPGIAFTLTEIQAYL
FT                   NKRRPGHSEYTTQRRELDQVEILSGVVSQNDGKALVTTGTPISMFIRNVDHHSEDYNAI
FT                   MHKYRPGHADYTYDVKYGIRDHRGGGRASARETVVRVAAGALARKIVPGLIVRGAVTAI
FT                   GPHNIDRDRWDWSEVDKNPFFSPDAQAACVFANYISQLCKTGSSVGAIVEIVAENVPAG
FT                   LGAPVYAKLDQDIASFLMSINAVKGIEIGDGFAAAHLTGEENADEMRMGSDGKPVFLSN
FT                   HAGGILGGISNGQPIVARFAVKPTSSILTPSRSIDIEGNDVNVMTKGRHDPCVGIRAVP
FT                   VGEAMVACAIADHYLRHRGQVGCI"
FT   gene            397345..398457
FT                   /gene="ribBA"
FT                   /locus_tag="BARBAKC583_0398"
FT   CDS_pept        397345..398457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribBA"
FT                   /locus_tag="BARBAKC583_0398"
FT                   /product="riboflavin biosynthesis protein RibBA"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00505; match to protein
FT                   family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45333"
FT                   /db_xref="GOA:A1URW4"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW4"
FT                   /protein_id="ABM45333.1"
FT                   /translation="MTYNQKKVVSAIQAFGRGEIVVVTDDDGRENEGDLIVAAVHCTEE
FT                   KMAFIIRHTSGIVCAPMPKEEAQRFDLAPMVLVNNSPQHTKFTVTVDFKHGITTGISAH
FT                   DRTLAVRNLANPNANANDFVRPGHVFPLIAHEGGVLMRSGHTEAAVDLCKITGLPPVGV
FT                   IGELVNDDGSVKHGDEITKFAQDNRLHTITVADLIAYRQREEILIKHVGTMQIETSVGS
FT                   AVVHSYQVPWKIIQHIAVVFGDIRDGKDIPVHLHHENILNDVFGLSPDIKVIMQHMMEK
FT                   EKRGVFVYLREGSVGIGSQSVIFDQDVVMKSLENHDEAIKREEEWHQIGLGAQILKHLR
FT                   ISSVIVYKFKESYYADLESFGIHISRTDIL"
FT   gene            398465..398719
FT                   /gene="xseB"
FT                   /locus_tag="BARBAKC583_0399"
FT   CDS_pept        398465..398719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="BARBAKC583_0399"
FT                   /product="exodeoxyribonuclease VII, small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF02609;
FT                   match to protein family HMM TIGR01280"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44609"
FT                   /db_xref="GOA:A1URW5"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URW5"
FT                   /protein_id="ABM44609.1"
FT                   /translation="MKQEIKKDDISGLSFEEALKQLEVIVENLERGDVPLEQSIDIYER
FT                   GEALKNHCDKLLKVAEAKIEKIQLSNNGTPEGVKPLDPE"
FT   gene            398917..400833
FT                   /gene="dxs"
FT                   /locus_tag="BARBAKC583_0400"
FT   CDS_pept        398917..400833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="BARBAKC583_0400"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45122"
FT                   /db_xref="GOA:A1URW6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URW6"
FT                   /protein_id="ABM45122.1"
FT                   /translation="MSRPLTPLLDCVLSPLDLRALPASDLARLADELRAEMIDVVSVTG
FT                   GHLGAGLGVVELTIALHYIFNTPDDRIIWDVGHQAYPHKILTGRRDKIRTLRQEGGLSG
FT                   FTKRSESIYDPFGAGHSSTSISAGLGMAMASALKAEERRNVIAVIGDGAMSAGMAYEAM
FT                   NNAGALDARLIVILNDNDMSIAPPTGAMSAHLARLVSRPSYRHLRERIKLFSKKFPKFF
FT                   SEQASRSEEFARGFLVGGTLFDELGFYYVGPIDGHNFEHLLPVLKNVRAYPNGPVLVHV
FT                   VTHKGKGYAPAEESADKYHGVNRFDVVTGKQVKAQSTRLSYTKVFSKALIEEATHDHKI
FT                   VAITAAMPTGTGLDSFAEKFSDRMFDVGIAEQHAVTFAAGIACEGYKPFVAIYSTFLQR
FT                   AYDQIIHDVSIQKLPVRFAIDRAGFVGADGATHAGSFDIVFLATLPEFVVMAPSDEVEL
FT                   MHMVRTAAVYDQGPISFRYPRGEGIGMDLPQRGEVLEIGKGRVLREGSRVALVCFGTQL
FT                   SEVLVAADELAAEGISTTVADARFAKPLDKDLMRRLAREHEVFITIEEGAIGGFGAHVL
FT                   QFLAQEALLEHGLKVRTLRLPDEYLNHGSPEKILSRVGLDAKGIINAVFTSLGYETRKT
FT                   LQI"
FT   gene            400841..401593
FT                   /locus_tag="BARBAKC583_0401"
FT   CDS_pept        400841..401593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0401"
FT                   /product="hemolysin A"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM PF01728; match to protein
FT                   family HMM TIGR00478"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44735"
FT                   /db_xref="GOA:A1URW7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW7"
FT                   /protein_id="ABM44735.1"
FT                   /translation="MAVMKRLDVLLVEKNFFTTRSRARDAVVRQTVKVDGQIVSKAGKM
FT                   ISDDAEIIVCDPAQNYVSRAALKLIGALDAFPVVTTQVIALDIGASTGGFTQVLLERGA
FT                   SHVIAVDVGHNQFDACLSNNSAVTLLEGLNVRDLRQEHLGGREIDLIVSDVSFISLKLV
FT                   LPSVFALIKKKAQAVLLVKPQFEVGREGIGKGGVLKNPSIAKKTAEELFDWLNTQKGWK
FT                   AKGLIPSPITGSDGNLEYLLFGEKRIEQ"
FT   gene            401583..402836
FT                   /locus_tag="BARBAKC583_0402"
FT   CDS_pept        401583..402836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0402"
FT                   /product="tRNA (Uracil-5-)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF05958"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45009"
FT                   /db_xref="GOA:A1URW8"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW8"
FT                   /protein_id="ABM45009.1"
FT                   /translation="MSNDVIIDHIGASGYGVTKTSHGSVYVPFTLPGEVVKVVHHGKYA
FT                   TPLKLKEKSLERLHALCQHFEECGGCVLQHWHLDAYHAWKRQLVVDTLKGRGFDVVVSP
FT                   LVECGLHTRRRITLTACVDKQGCNIGFNRYLSHNIVAIEECPITCSEIISKLDDIRGIC
FT                   ALLGHHAKRFHITITSVDNGLDVALSGCIVQDELTRQKMVRAALSYGIMRLSVDGEILV
FT                   EREKPMIHFGDVCVEFPSGGFLQATVKAENIISDIILTHFEKAKNAADLFSGVGTFALR
FT                   MAKKMNVHAVENNGAALTNLDRAARFAKGLKTVICEKRDLLRRPLSTEELERFDSVVFD
FT                   PPRAGAEEQVSELAKTAIPRVVAVSCNPVTFARDLSILVSGGYIIEKIIPIDQFLWSPH
FT                   VEIVAILNKRKAKAGWKL"
FT   gene            complement(402896..404314)
FT                   /locus_tag="BARBAKC583_0403"
FT   CDS_pept        complement(402896..404314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0403"
FT                   /product="TldD/PmbA family protein"
FT                   /note="identified by match to protein family HMM PF01523"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45575"
FT                   /db_xref="GOA:A1URW9"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A1URW9"
FT                   /protein_id="ABM45575.1"
FT                   /translation="MKSLIDNFDIPSSKVQSLVQETLHNADDGELYVEYTEREALLFDN
FT                   GQLKNSSFHQDIGFGLRVVSGEATGYAHSGELSAAALNRASEAAKAVIYHNQAGPYNAA
FT                   PPRTNRKLYEQINPLDAPSFEEKSKLLQKIDAYLREKNDKVHQVTVSLSGSLQHVEILR
FT                   SNGHLVRDIRPLVRLSISIIATNGNRHESGFYGCGGRQAFNQFISEENWKMAADEALRM
FT                   ALVNLEAEAAPAGTCDVVLANGWPGVMLHEAVGHGLEGDFNRKKTSAFSELLGQQVAAK
FT                   DVTIVDDGTIPECRGSLTVDDEGTPSGCNVLIENGKLVGFMQDRLNARLMGVNSTGNGR
FT                   RESYAHAPMPRMTNTIMLGGDKTPEEILSSLKSGIYAVSFGGGQVDITSGKFVFECTEA
FT                   YRVENGKIVAPIKGATLIGNGPEAMKRITMIGNDSKLDNGIGMCGKAGQNVPVGVGQPH
FT                   LRINDMTIGGTETS"
FT   gene            complement(404424..404963)
FT                   /locus_tag="BARBAKC583_0404"
FT   CDS_pept        complement(404424..404963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0404"
FT                   /product="invasion associated locus B family protein"
FT                   /note="identified by match to protein family HMM PF06776"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45419"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX0"
FT                   /protein_id="ABM45419.1"
FT                   /translation="MSLYQFVQKTFFVSSVIFALCNISSNHVIAQTSNTQNIPAPKTYG
FT                   AWTKVCSLPPGTPNMQCEIIQDVRAQERRDITFRITFYKLPKNQGTLMRVFVPIRVDLR
FT                   PGVSIKIDNKDIGRIEYHRCLGDNCIAEALLQDNVLKHFLDGKMATYVIFTTPEQGIGG
FT                   LIDLHGLADAYAALPK"
FT   gene            405361..406296
FT                   /gene="cyoE"
FT                   /locus_tag="BARBAKC583_0405"
FT   CDS_pept        405361..406296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoE"
FT                   /locus_tag="BARBAKC583_0405"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01473"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44828"
FT                   /db_xref="GOA:A1URX1"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URX1"
FT                   /protein_id="ABM44828.1"
FT                   /translation="MSISGKLLTEDNQLISPVATVYDYIALLKPRVMSLVVFTALVGLV
FT                   VSPVVVDPLYGFVAILCIAIGGGGAGALNMWYEADIDALMKRTQKRPIPSGKISRGKAL
FT                   IFSSILSVLSVFLMGVLINWFSALFLAFTIFFYIVIYTIWLKRITPQNIVIGGAAGAFP
FT                   PMIGWAAATGTISLDSFLLFLIIFMWTPPHFWSLCLFSSSDYEAAGIPMMPNVRGERST
FT                   KNQILVYAIITAVCAIGPYITGYAGIIYGISSTILGGMFVYFAYRLWKTDTHDETVPIA
FT                   KKTFFFSLFYLGAIFGILLIEFLIWHFIIR"
FT   gene            406484..407533
FT                   /gene="ispH"
FT                   /locus_tag="BARBAKC583_0406"
FT   CDS_pept        406484..407533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="BARBAKC583_0406"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="identified by match to protein family HMM PF02401;
FT                   match to protein family HMM TIGR00216"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44637"
FT                   /db_xref="GOA:A1URX2"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URX2"
FT                   /protein_id="ABM44637.1"
FT                   /translation="MSLLPPLTIRLCSPRGFCAGVDRAIQIVILALKKYGAPVYVRHEI
FT                   VHNRYVVEGLQQRGAVFVEELDEIPEKHRGQPVVFSAHGVPKSVSEKASLYNLFYLDAT
FT                   CPLVSKVHKQAIRHQRHGRHVILIGHSGHPEVIGTMGQLEKGAVTLIETVEDALYYQPE
FT                   NPNKLGFVTQTTLSVEDTAGILDVLQKRFPALESPATESICYATTNRQEAVKAAALGSD
FT                   LFLIVGSSNSSNARRLVEVAERFGARQSILVQRADDIDFDRLGTLSVISLSAGASAPEI
FT                   IVDEIITAFRKRYNVKIELAETAVETQQFLVNRELRDVILTPQDMAFVSGGVKTGRNDD
FT                   TQMLKIEEK"
FT   gene            407646..407771
FT                   /locus_tag="BARBAKC583_0407"
FT   CDS_pept        407646..407771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0407"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45327"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX3"
FT                   /protein_id="ABM45327.1"
FT                   /translation="MVHGIEENFLTLYEKFISKNHLFFCVVILQSFNLVKMGFYT"
FT   gene            407962..408429
FT                   /gene="rnhA"
FT                   /locus_tag="BARBAKC583_0409"
FT   CDS_pept        407962..408429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="BARBAKC583_0409"
FT                   /product="ribonuclease HI"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF00075"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44987"
FT                   /db_xref="GOA:A1URX4"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URX4"
FT                   /protein_id="ABM44987.1"
FT                   /translation="MLSETKVIEIYTDGACSGNPGLGGWGAILRWNSHERELYGGKEYT
FT                   TNNQMELMAAICALNALKESCSIDLYTDSVYVRNGISLWLENWKKNNWRTASKSPVKNM
FT                   ELWQALDGACARHNVRWHWVKGHAGHPDNERADALARKAITEYRQNGYFKG"
FT   gene            complement(408419..409324)
FT                   /locus_tag="BARBAKC583_0408"
FT   CDS_pept        complement(408419..409324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0408"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45577"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX5"
FT                   /protein_id="ABM45577.1"
FT                   /translation="MRKIQIFLNLQKMLMISHKKLSVIFSLTFMVLGLINPTFSTQTEQ
FT                   ETHLISTPWHESSGGRIRLAITKVSLHGMRDGIIEVVLKPEWKTYWRNPGNSGMAPFFN
FT                   FDQQVAYEIFYPTPQLYEKENDWSLGYKNKVVLPFRIFGSHKHLSGSLTIGICNKICMP
FT                   FTVDFNFSPFFPKNEHLSSSLLLKNAQASLPRIKHNALTISAEKKENALLITIHKNRKI
FT                   TPESLFLDGGDMQIGPAKKISDHQDYTFFSAPIYFIPDEPNQTVFYIISAKDHALSGTF
FT                   TINKQDYSDISIDQERLSIP"
FT   gene            complement(410045..412921)
FT                   /locus_tag="BARBAKC583_0410"
FT   CDS_pept        complement(410045..412921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0410"
FT                   /product="sensory box-containing diguanylate cyclase/cyclic
FT                   diguanylate phosphodiesterase"
FT                   /note="identified by match to protein family HMM PF00563;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF07695; match to protein family HMM PF07696;
FT                   match to protein family HMM PF08447; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45083"
FT                   /db_xref="GOA:A1URX6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX6"
FT                   /protein_id="ABM45083.1"
FT                   /translation="MKSLRKIVSVIFFAINLFIHLSLAQAIEPVKISSQDAAIDLSKAV
FT                   QIHRTNSSIFQTSTVPGPDGVIWRIEVQASHENFSGNWAVFSLANPTNEQIDRLIVAPH
FT                   YRIANSGFLWPDLGSARIQSITPSEGFSLDRQASTNSDVFRITLNPGAVITFVAELSSE
FT                   NLPQIYLWKPEAYKDTLNSYTLYHGILLGISGLLALLLTVLFVVRGTGLFPATAAVAWA
FT                   VLFYIGIDFNFLNKLFAITPITEPIWRAATEVSLAATLFIFLFTYLCLNRWHYHFSYGA
FT                   IAWIIALCGLGAFAIYDPTRAAGIARLSFGLTTILGTILISYFSIRNYDRAIMLIPTWL
FT                   LIIFWSFGAYICIAGNLNNDIIPSALAGGLVLIVLLISFTIMQQTFSNEPFHEGIFSDL
FT                   ERQALAARGAGSIIWDWNVERDHIAIHPDMTAIFGKNIPQLNGTMHNWISALHHDDREH
FT                   FQATLDIILKNKNGRINQIFRLSSGDGYYHWLSLRARPAIQKDGKVTRVIGTIINITNH
FT                   KKAEERLLYDAIHDNLTGLPNQQIFFDRLQSYTTLAKENIKIRPTVLMIDFDNFRQINR
FT                   KLGIAIGDTVLLIIARRLNRLINVQDTLSRLSADRFAIILLSETDPKKIAAFANHLRKI
FT                   ISAPIDIVEKKITLSTSIGLVTWNESRPTAKNILNDCELAMIHAKQKGGNHIEPFRPNL
FT                   RNLDLGYRNIEQDIHYAIKRNEMKILYHPIFNLSDGQIIGFEAVLEWHHPNYGHLNVSD
FT                   FIKVAENEQIVLNLAQFIIDEAVTSLINIQEKCFQQSFFISINLPSADMINPDLINQLR
FT                   STLLCHPLNEGSLMIEISEFVLRKNPEQSAHFLEKIKALGINLALDNFGTGYSSLTYLV
FT                   RYPFNMIKLDRSLVSINSPEKQLVLRSIINIATDLNLQIIAEGVENEKEAIFLKKEGCQ
FT                   YIQSTIITKPVTVEALISLVQNRFSYKN"
FT   gene            complement(413366..414634)
FT                   /locus_tag="BARBAKC583_0411"
FT   CDS_pept        complement(413366..414634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0411"
FT                   /product="peptidase, M16 family"
FT                   /EC_number="3.4.24.-"
FT                   /note="identified by match to protein family HMM PF00675;
FT                   match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44549"
FT                   /db_xref="GOA:A1URX7"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX7"
FT                   /protein_id="ABM44549.1"
FT                   /translation="MSVDISRLSNGLTIATHTMQHIDSVALGIWVKVGSRNEKSTQHGI
FT                   AHLLEHMAFKGTENRTAFKIASEIEDVGGEINATTSIETTAYFARVLKNDISLAIDILS
FT                   DIMTCSKFDEEELEREKQVVFQEIGATCDVPDDIIFDHFTETAFRDQSLGRSILGTPKT
FT                   IQSLTSDDLRSFMNEQYSADRMIVVAAGAVQHESFLREVESRLSIFRPYSKTPLANFAH
FT                   YTGGKFHEHRDLMDTQIVLGFEGYPYHTQDFYTAQILSIILGGGMSSRLFQEIREKRGL
FT                   CYSIYAFHWGFSDTGLFGIHTATGQRELETLFPVILDELSKVGQNIHISELQRAQAQYR
FT                   ANLIMSQENPSSQAHLIARQILLYGRPIPISETTGHLDLVTPQRLTNLANNLITNSKPT
FT                   LATVGPARSLINFDDLKSIFHPK"
FT   gene            complement(415015..415707)
FT                   /locus_tag="BARBAKC583_0412"
FT   CDS_pept        complement(415015..415707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0412"
FT                   /product="HAD hydrolase, family IA"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01509"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44734"
FT                   /db_xref="GOA:A1URX8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX8"
FT                   /protein_id="ABM44734.1"
FT                   /translation="MPQIDLIIFDCDGVLVDSEYLLAKIGSQLLKEIGYEISPEKLSER
FT                   FAGLIFSDILKKIEQEIGRPISAHFIDRMSDLFRTQMKTDLRPINGVKRAIENVKSRYP
FT                   YCICSNAMKTDIEQMLITVNLFDFFENKIFSAPEVGTKKPKPAPDVFLFAAHELGIKPQ
FT                   NTIVIEDSIHGVRSAKAAGMRIIGFTGGSHSYLNHSNDLIDFGAETVINKYAHLPEVLE
FT                   AMTIWQDS"
FT   gene            416018..417154
FT                   /gene="ccrMIM"
FT                   /locus_tag="BARBAKC583_0413"
FT   CDS_pept        416018..417154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrMIM"
FT                   /locus_tag="BARBAKC583_0413"
FT                   /product="modification methylase CcrMI"
FT                   /EC_number="2.1.1.72"
FT                   /note="identified by similarity to SP:Q45971; match to
FT                   protein family HMM PF01555"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45156"
FT                   /db_xref="GOA:A1URX9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:A1URX9"
FT                   /protein_id="ABM45156.1"
FT                   /translation="MTVVQLQKDPVNSPSQIPWCNQIFKGDCVAVLEKLPKHSVDMIFA
FT                   DPPYNLQLEGVLYRPDHSLVDAVDDAWDQFESFAAYDAFTRAWLLACRRVLKPNGTLWV
FT                   IGSYHNIFRVGTTLQDLGFWVLNDIIWRKNNPMPNFRGRRFQNAHETLIWAVRDQKDKK
FT                   YTFNYDSLKAANDDVQMRSDWLFPLCTGAERLKDEAGDKLHPTQKPQALLARIIMAASK
FT                   SGDVILDPFFGSGTTGAVAKLLGRNFVGIEREQRYIDAAHERIAAVKPLAKSELEIIKG
FT                   KKAEPRVAFINLLEAGLLCPGSVLYDKKKRVSAIVRADGTIMCDNEAGSIHAIGRKVQV
FT                   SQSCNGWTFWYYEDNGKLKSIDDLRMVIRSQILKTGVL"
FT   gene            complement(417244..418296)
FT                   /gene="mutY"
FT                   /locus_tag="BARBAKC583_0414"
FT   CDS_pept        complement(417244..418296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="BARBAKC583_0414"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF00730; match to protein
FT                   family HMM TIGR01084"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44886"
FT                   /db_xref="GOA:A1URY0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY0"
FT                   /protein_id="ABM44886.1"
FT                   /translation="MMHEISSRLLSWYDKNHRHLPWRITPKEQMKGIHPDPYQVWLSEI
FT                   MLQQTTVETVKPYFKKFLKLWPDLLSLSQASQDDIMKAWAGLGYYSRARNLKNCADQLM
FT                   RDYGGKFPQSMKILRSLPGIGDYTAAAIAAIAFSQPVSVVDGNIERIITRLFAITAMLP
FT                   KAKSEIKEKIQEIIAINRPGDFAQAMMDLGAIICKPRNPSCLLCPLQNLCEATKMQTVE
FT                   NFPVKPPKKERLLKTGAAFVVINKDKQIYLEKRETQTLLNGMTQIPNTIGLKNENALLH
FT                   APFAADWQFKGQITHVFTHFSLKFDVYYIDNICEINLKNGWWCNIQHLTKEALPTVMKK
FT                   AISVAIPNLF"
FT   gene            418329..418445
FT                   /locus_tag="BARBAKC583_0415"
FT   CDS_pept        418329..418445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45251"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY1"
FT                   /protein_id="ABM45251.1"
FT                   /translation="MQRKSFYFAIYSLCVAHEWVKFNWVQIGFFIHILRLLS"
FT   gene            418517..419011
FT                   /locus_tag="BARBAKC583_0416"
FT   CDS_pept        418517..419011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06647"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45638"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY2"
FT                   /protein_id="ABM45638.1"
FT                   /translation="MNKKYHKHHFYSLSETVAGILDPILRKRTGLNMALVEHWPQIAGF
FT                   DVAEYTMPLKIIWGYRSSQDEIFQPATLVVACEGFSALKLMHETGELIQRINSFFGYVA
FT                   INRIKIEQKQVDIRVDQLRVKSALNEKDKKRIEKMLDGVENKNLRQSLYELGCCIFSEK
FT                   K"
FT   gene            419106..419756
FT                   /locus_tag="BARBAKC583_0417"
FT   CDS_pept        419106..419756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0417"
FT                   /product="DSBA-like thioredoxin domain protein"
FT                   /note="identified by match to protein family HMM PF01323"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45196"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY3"
FT                   /protein_id="ABM45196.1"
FT                   /translation="MFNRHSLLSLVIICILAITTQINATVAFSGEVKPVAIVDMAKLLQ
FT                   SGKVKDRFEGDINAPVTIIEYASLTCAHCADFYNTVLPKIRKKYIKTGKVKLIFRDFAY
FT                   DPRATAGFMLARCAPEDRYFPLIEVLFEKQKDWAWVQDALTPLRKIGAMAGFTNESFDS
FT                   CLQNQSILDEVNASTERGKELGVTATPTFFINGHQYNGGMPTENFFSIIDSFL"
FT   gene            419941..422628
FT                   /gene="ppdK"
FT                   /locus_tag="BARBAKC583_0418"
FT   CDS_pept        419941..422628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="BARBAKC583_0418"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01326; match to protein
FT                   family HMM PF02896; match to protein family HMM TIGR01828"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44746"
FT                   /db_xref="GOA:A1URY4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY4"
FT                   /protein_id="ABM44746.1"
FT                   /translation="MTKWVYSFGDGNAEGSASERNLLGGKGANLAEMSNLGLPVPPGFT
FT                   ITTEVCNFYYANSKTYPEELQQSITLALKRVGQQTGREFGSKTAPLLLSVRSGARTSMP
FT                   GMMDTVLNLGMNDETVEAIAAQVGDERFAYDSYRRFIQMYSSVVLGLEHSCFEEILDEA
FT                   KARKGYNADTEMTAADWKNVVVSYKAYIEEKLSRLFPQDPEEQLWGAIGAVFSSWMTAR
FT                   AITYRRLHNIPESWGTAVNVQAMVFGNMGEDSATGVAFTRNPSTGKKELYGEFLINAQG
FT                   EDVVAGIRTPQNITEAARLIADSNKPSLEKIMPEAFEEFCQIAHKLEQHYRDMQDLEFT
FT                   IERGKLWILQTRSGKRTVRAALKMAIEMVEEGLISREEAVMRIEPKSLDQLLHPTLDPK
FT                   AKGFVVTRGLPGSPGAAIGEIVFTSEEAEIAAKEGRKVVLIRVETSPEDIHGMHAAEGI
FT                   LTTRGGMTSHAAVVARGMGKPCISGARNIRIDYSTNTMVVAGQSFQKGDIITIDGSSGE
FT                   VFKGKVAMLQPELCEDFVKLMEWADEMRRMKVRVNADTPSDARMGRSFGAEGIGLCRTE
FT                   HMFFAGERIIAMREMILSTDEDGRRKALDKLLPMQRSDFIELFEIMSDFPVTIRLLDPP
FT                   LHEFLPKTDAEILDVAMAMGVPAEILSERAQQLHEFNPMLGLRGCRLIITYPEIAEMQA
FT                   RAIFEAAAEVAQKSESSVMLEIMVPLVALKSELDFIKVRIDHVASSVMKEKGTKIQYMV
FT                   GTMIELPRAALRADELAETAEFFSFGTNDLTQTTFGISRDDAAPFLTTYFQKGLLKQDP
FT                   FVSIDRDGVGELIAIAAKRGRSRCEKIKLGVCGEHGGDPNSIALYEENDLDYVSCSPFR
FT                   VPIARLAAAQSAIAKKYKIDGSVF"
FT   gene            423255..423329
FT                   /locus_tag="BARBAKC583_0419"
FT   tRNA            423255..423329
FT                   /locus_tag="BARBAKC583_0419"
FT                   /product="tRNA-Gln"
FT   gene            423656..424252
FT                   /gene="sodB"
FT                   /locus_tag="BARBAKC583_0420"
FT   CDS_pept        423656..424252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="BARBAKC583_0420"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by similarity to SP:P50061; match to
FT                   protein family HMM PF00081; match to protein family HMM
FT                   PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45507"
FT                   /db_xref="GOA:A1URY5"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY5"
FT                   /protein_id="ABM45507.1"
FT                   /translation="MAFTLVDLPYTYDALEPYMSAETLEYHHDKHYLAYLTNTNNFVKD
FT                   LSLEDKTIENIVIESFGTNPGLFNNAAQYYNHTHFWKWMKKGGSGRKLPEKLNNAIERD
FT                   LGGYDKFRADFIAAGTAQFGSGWAWIAVKDGKLEIMKTLNGENPLVYGAQPILGVDVWE
FT                   HSYYIDYRNARPKYLEAFVDNLIDWDYVLALYEKC"
FT   gene            complement(424345..426435)
FT                   /locus_tag="BARBAKC583_0421"
FT   CDS_pept        complement(424345..426435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0421"
FT                   /product="peptidase, S9A/B/C family protein"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF02897"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45234"
FT                   /db_xref="GOA:A1URY6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY6"
FT                   /protein_id="ABM45234.1"
FT                   /translation="MTFSSILPPKASKIIHKEMHHGIFRNDPYHWLRASNWPDILKNPH
FT                   CLDKHIRHHLEQENAYQAAQMADTKQLQNLLFTEMKSRIKENDSSVPVKYGPFAYGFSY
FT                   VTEGQQPHYFRTPRNGGEKNVYLNGDTLAEGKDYFHLGSVQISPDHTHAAWAYDDKGSE
FT                   LYIIKIRNFKTLSDYDDTIFDTSGQIVWDAKSEGFFYTKMDENHRPSKLYYHQLHTDQS
FT                   QDKLIFCENDPGFFLHVNGSKLNDVIYINIHDHETSETWLIPAKEPLSPPQCVKKRQKG
FT                   IEYSLTEGGDVFYILTNQDNAKDFKIMVAPYTSPQSENWSELIPHRLGHLILSHDAYQD
FT                   FFIWLELFEGLPRIQLMEQSTKEIHSISFTEEAYSLALQGAAEYNSSVIRFSYSSMTTP
FT                   NQIFDYDIKNRTRLLLKTQEIPSGHNRDDYITRRITATAEDGETIPISLFYHKKTKLNG
FT                   TAPCLLYGYGAYGISIPANFNSNILSLVDRGFIYAIAHIRGGKDKGVEWYEKGKHLFKH
FT                   NTFTDFIACGRHLVNNQFTTHDRLVAQGGSAGGMLMGAVANIAPQDFAGIVANVPFVDV
FT                   LTTMLDASLPLTPPEWPEWGNPLESKEDYDLIASYSPYDNVKPQKYPPILAIAGLTDPR
FT                   VTYWEPAKWVAKLRDLKTDDNEILLRTNMDSGHAGTTGRFSKLEEIAYIYAYILKIVGK
FT                   DR"
FT   gene            complement(427036..427176)
FT                   /locus_tag="BARBAKC583_0422"
FT   CDS_pept        complement(427036..427176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0422"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44733"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY7"
FT                   /protein_id="ABM44733.1"
FT                   /translation="MTQKLYARKLHIVQKFFLSIELFQLITFNVKKTNKNLIFDILYNR
FT                   K"
FT   gene            427263..427694
FT                   /locus_tag="BARBAKC583_0423"
FT   CDS_pept        427263..427694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0423"
FT                   /product="transcriptional regulatory protein, ros/MucR
FT                   family"
FT                   /note="identified by similarity to SP:Q04152; match to
FT                   protein family HMM PF05443"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45138"
FT                   /db_xref="GOA:A1URY8"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY8"
FT                   /protein_id="ABM45138.1"
FT                   /translation="MEHHPVLEAESSLIITLVADVVAAYVSNNSIQPAEVPSLIADVHA
FT                   AFLKAGNTASVEVEKQRPAVNPRRSIFPDYLICLEDGKKFKSLKRHLMTHYQMSPEEYR
FT                   EKWQLESSYPMVAPNYTKARSALAKEMGLGHNRQKKKNK"
FT   gene            complement(427808..428215)
FT                   /gene="sufE"
FT                   /locus_tag="BARBAKC583_0424"
FT   CDS_pept        complement(427808..428215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufE"
FT                   /locus_tag="BARBAKC583_0424"
FT                   /product="cysteine desulfuration protein SufE"
FT                   /note="identified by match to protein family HMM PF02657"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44499"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:A1URY9"
FT                   /protein_id="ABM44499.1"
FT                   /translation="MADTIKNIIENFSLLDNWEDRYRYVIELGHELPPFPESSRNDTNK
FT                   VPGCVSQVWLLSSRDNLENPILTFQGDSDSHIVRGLIYIILAFYSGKTASEIRTANAEE
FT                   LIETLGLNENLTPQRSNGLKSMIQRIRTQSY"
FT   gene            complement(428340..428702)
FT                   /locus_tag="BARBAKC583_0425"
FT   CDS_pept        complement(428340..428702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45532"
FT                   /db_xref="GOA:A1URZ0"
FT                   /db_xref="InterPro:IPR035220"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ0"
FT                   /protein_id="ABM45532.1"
FT                   /translation="MIRFFIKSVFFLLFVFVIISFFVKKPNNDNSSSQIATNITTSDAA
FT                   TALKEAINDLRKFCERNIQTCETGKSFLGSIGERARNGAKTAYEYLDRTFGDNDTIQSK
FT                   NIDPKENSLSTIKEMN"
FT   gene            429266..430111
FT                   /locus_tag="BARBAKC583_0426"
FT   CDS_pept        429266..430111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0426"
FT                   /product="peptidoglycan binding domain protein"
FT                   /note="identified by match to protein family HMM PF01471"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44818"
FT                   /db_xref="GOA:A1URZ1"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ1"
FT                   /protein_id="ABM44818.1"
FT                   /translation="MTKKRKMRKTKVVKRRSIILAFFLLNGRFLFWVAKRLYHYTRINA
FT                   LLVIGLFFFVVSFGFILFNALFLQKKIKNDVFIQMKLAPISVIAKNSILLQEQAISQAQ
FT                   ADDVSMPIVNNLRQDSSLYSLQNSLSENLSKMHKKSAKFGLYDGSLDNSKIHHAATQWE
FT                   QKATNKTVPTQGDIVPKQSADEIALLIERSEMEMANDTATKGVVTQSEEASLKPVIADI
FT                   MQVQEALRAFGNQEVTITGIEDQKTVDAVKQFQKIFHLPITGKIDNTVLIKMREVGLLS
FT                   "
FT   gene            430337..430513
FT                   /locus_tag="BARBAKC583_0427"
FT   CDS_pept        430337..430513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0427"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45598"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ2"
FT                   /protein_id="ABM45598.1"
FT                   /translation="MAADCTGVGKRVANQQGGMLTRLMPIVQDGKNMCVVVIVVPAHNG
FT                   QKPRRVEVIVPAD"
FT   gene            430531..431196
FT                   /gene="feuP"
FT                   /locus_tag="BARBAKC583_0428"
FT   CDS_pept        430531..431196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuP"
FT                   /locus_tag="BARBAKC583_0428"
FT                   /product="transcriptional regulator FeuP"
FT                   /note="identified by similarity to GB:CAA73687.1; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45048"
FT                   /db_xref="GOA:A1URZ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ3"
FT                   /protein_id="ABM45048.1"
FT                   /translation="MRILIVEDDRDLNHQLAETVRNAGYVSDSAFDGEEAYFLGSTESY
FT                   DAVILDIGLPRMDGIRVVEKWRQDGHLMPILILTARDRWSDKVLGIDAGADDYVVKPFY
FT                   LEEVMARLRALIRRASGHATSALSCGAVLLDTKTSRVFVDGQLIKLTSHEFRLLSYLMH
FT                   HCDKVVSRTELIEHLYDQDFDRDSNTIEVFVRRLRKKLGVDFIETIRGMGYRVTLGGK"
FT   gene            431193..432614
FT                   /gene="feuQ"
FT                   /locus_tag="BARBAKC583_0429"
FT   CDS_pept        431193..432614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feuQ"
FT                   /locus_tag="BARBAKC583_0429"
FT                   /product="sensor histidine kinase FeuQ"
FT                   /note="identified by similarity to GB:CAA62009.1; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45264"
FT                   /db_xref="GOA:A1URZ4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ4"
FT                   /protein_id="ABM45264.1"
FT                   /translation="MTIVKNNSRLKRLFFFIGKSLTVRVMILSTLWVAVSLSSISAISI
FT                   LFYQRASEQSLERILSAQLYGLISTVTVTPEGHLRAIPGFSDIRYSDPTSGWYWEVMAV
FT                   SPNLRGRLTSPSLGSKIIASLSDVEVPFDSQFFRSYRIKEENGRRLQVTESDVILDNQN
FT                   RVARFRLIGNIDEAHAQVQEFKQTLQIFLWSFGIGSVLINIAIIFLSFQPLKRIRQTLN
FT                   DIREGKADYVNTDLLSEVMPLAQEMNALINNNRRIIERFRMQVGNLAHSLKTPLSVIIN
FT                   EINEADKMVGEQAILLREQAKIMQDQINHYLQRSRVAAQCNSVVYHTSVRKTLNRLVRV
FT                   MEKLNPDKHIQFIMENDDIFFSGAREDLEEIVGNLVENAAQWSRTKVLICCCLEENVED
FT                   TAFFSIIIEDDGPGLTEEQIDEALKRGRRLDESKPGTGLGLAIVSDMVNEYGGNLSLSR
FT                   SGLGGLRTKVFLPRR"
FT   gene            432728..433564
FT                   /locus_tag="BARBAKC583_0430"
FT   CDS_pept        432728..433564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0430"
FT                   /product="putative cytochrome c-type biogenesis protein
FT                   CycH"
FT                   /note="identified by similarity to SP:P45400"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44604"
FT                   /db_xref="GOA:A1URZ5"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ5"
FT                   /protein_id="ABM44604.1"
FT                   /translation="MPLLVFAVIFLIFLTIALFFSLRFDYELKKRGKFSAININQRQIY
FT                   KTESNCECDCTDVKKSQKEHFSSCYSNISFEIQKGFVQKLCEYPKNICVLKITGIIFVL
FT                   FVTGGIYYVTGDPEIKSYLFSELMDKDPKMLSKHERIVRLQTLFSRKPDDGKIADELAI
FT                   SYLEENLFQDAVNIYLDALRLNGESAPRLVGYGLALVGYEGGVITQEAQDVFQKAADLA
FT                   PNDFYPRLLLANALRQAGKFAQAIQFLENFLHKMPKDIAGRSRVEAMIAQLRRASD"
FT   gene            433763..434239
FT                   /gene="cycJ"
FT                   /locus_tag="BARBAKC583_0431"
FT   CDS_pept        433763..434239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycJ"
FT                   /locus_tag="BARBAKC583_0431"
FT                   /product="cytochrome c-type biogenesis protein CycJ"
FT                   /note="identified by match to protein family HMM PF03100"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45347"
FT                   /db_xref="GOA:A1URZ6"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1URZ6"
FT                   /protein_id="ABM45347.1"
FT                   /translation="MNSQSFKNFPSLKFISKKRRKERLLMVLLCLFIMAITTGLIVYAM
FT                   RNTANFFRTPSEITKEDILTGRVLRLGGIVEKGTVEHNGEMQVTFFVIDHLKHEKVVFN
FT                   GLLPDLFREGQSVIVEGYFDKQGLFIGKRVLAKHDETYMSKETADRLKKHHDIK"
FT   gene            434255..436234
FT                   /gene="cycK"
FT                   /locus_tag="BARBAKC583_0432"
FT   CDS_pept        434255..436234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycK"
FT                   /locus_tag="BARBAKC583_0432"
FT                   /product="cytochrome c-type biogenesis protein CycK"
FT                   /note="identified by match to protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44872"
FT                   /db_xref="GOA:A1URZ7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ7"
FT                   /protein_id="ABM44872.1"
FT                   /translation="MLIELGHIFLATVFAVSLLQVFLSIFGVVREEYSLMQAVVSLTYI
FT                   LFILLLLSFLIIVHAYVISDFSVLNVVRNSHSEKPMLYKIVGVWGNHEGSMLLWVLILA
FT                   FFSLLVALFGQKLPVQFKASVLGCQSLITSAFLLFILFLSNPFLRINPPALQGSDLNPV
FT                   LQDIALAIHPPLLYLGYVGFSVCFSFSVAALITGYVDRVWARWVRPWVLLAWIFLTLGI
FT                   MVGSYWAYYELGWGGYWFWDPVENVSFMPWLAGTALLHSILVLEKRGALKNWTLFLAIL
FT                   TFSLSLMGTFLVRSGILISVHSFAVDPARGWALLSILFFFTGSAFLLFALRAPILKTDG
FT                   FFLPISREGFIVLNNLFLTTATATILIGTLYPYFFETLTGQKISVGAAFFNLTFGPLMV
FT                   PLLFFVPFGPIIAWKRGDLLAVFERLWFVFLLSCIACFITFYAASWRDIFCALGVGLSV
FT                   FVFLGGLADLWVKSGHRKTPFFVRIKRFLGLPWSVFGAALAHMGLGITLFGIVYSSLFG
FT                   QERILVMKIGDSITMADKVIRFDEVRNVAGSNYSAMQFDFKIYENQNSIHTMTASKRFY
FT                   SSQNISTTKVGIQSYGFSQFYIVPGRIDDQGLALHIWWKPYVICIWFGAFMMAIGGCFS
FT                   LLNYWSRINIRQRRGIGFKRTEKG"
FT   gene            436237..436680
FT                   /gene="cycL"
FT                   /locus_tag="BARBAKC583_0433"
FT   CDS_pept        436237..436680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cycL"
FT                   /locus_tag="BARBAKC583_0433"
FT                   /product="cytochrome c-type biogenesis protein CycL"
FT                   /note="identified by similarity to SP:P45406; match to
FT                   protein family HMM PF03918"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45203"
FT                   /db_xref="GOA:A1URZ8"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ8"
FT                   /protein_id="ABM45203.1"
FT                   /translation="MKKLFYRAVILFYVVIFSMRLGMAVELDEMLDDPVLELRARDISL
FT                   HLRCPVCQNQSIDDSNASLARDLRILVRERLKAGDSDQQVIDFLVERYGAFILLKPPFN
FT                   KATWFLWLSPLIILIIGISFIFFQIKYCKYKELIALNADEEKS"
FT   gene            436882..438399
FT                   /locus_tag="BARBAKC583_0434"
FT   CDS_pept        436882..438399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0434"
FT                   /product="protease Do family protein"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF00089;
FT                   match to protein family HMM PF00595; match to protein
FT                   family HMM TIGR02037"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44594"
FT                   /db_xref="GOA:A1URZ9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:A1URZ9"
FT                   /protein_id="ABM44594.1"
FT                   /translation="MVNPTLYRTLRAIGFSTALASTMFFSGSNLWRSAAYAKPVFVTSG
FT                   QQQGFADIVSQVKPAVVAVQVKSDKKETKKDRFFGGFFGSPGMDQLPDQHPLKKFFEEF
FT                   HEYAWPNDKYSNRSRKPRSVAFGSGFFISSDGYIVTNNHVISGGTSYSIVLDDSTELEA
FT                   RLIGTDPRTDLAVLKVDDKRTFTYVDFADDTKVRIGDWVVAVGNPFGLGGTVTAGIVSA
FT                   RGRDIGAGVYDDFIQIDAAVNRGNSGGPTFNLNGQVVGVNTAFFSPSGGNGGNVGIAFA
FT                   IPAITAQQVVKQIIEKGSVQRGWIGVQIQAVTKEISDSVGLKEVKGALVTDPLKGPAQK
FT                   AGIKAGDVIISVNDKKVTDARDLARRIANIRPGETATLGVWRSGKEDSVKVKIDSMPES
FT                   ENKGEGSKSSSKKGGSETLEDYGLIVTTSDDDSGLIVTDVDLDSDAAERGIRPGDVIVT
FT                   VNNKPVKKASDVADAIKYAQELGRSAILLQVRTKDQNRFVALPIIKK"
FT   gene            438476..439162
FT                   /locus_tag="BARBAKC583_0435"
FT   CDS_pept        438476..439162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0435"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44837"
FT                   /db_xref="GOA:A1US00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1US00"
FT                   /protein_id="ABM44837.1"
FT                   /translation="MKILIIEDDRETGRYLEKAFLEAGHAADIACDGDTGYALAETERY
FT                   DVMIIDRMLPHRDGLSIISELRAKGNETPVLILSALGQVDDRVMGLRAGGDDYLTKPYA
FT                   FSELLARVEVLQRRKNPKEAETVYCVGDLELDRLSHTVKRGEMNITLQPREFRLLEYLM
FT                   RHAGQVVTRTMLLENVWDYHFDPQTNVIDVHISRLRAKIEKDFDIPLLHTVRGAGYMLK
FT                   APDKKT"
FT   gene            439159..440541
FT                   /locus_tag="BARBAKC583_0436"
FT   CDS_pept        439159..440541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0436"
FT                   /product="sensor histidine kinase"
FT                   /note="identified by match to protein family HMM PF00512;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45452"
FT                   /db_xref="GOA:A1US01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1US01"
FT                   /protein_id="ABM45452.1"
FT                   /translation="MNYLINMMRTTALRLSALYILLFGLVAAALSIYMMAFSISLLTDQ
FT                   TEQALREELGNIESAYNYGGLALLVRTIDHRSRQPGAFLYLVTDPMGRILAGNVAYIEP
FT                   GLLNHNGFLPSSFLYSRFGEHGQTSKHRALAIIVDLPNAMKLLIGRDLDEPERFAIIIR
FT                   KAMVIALVAMVGGALLIWFFVGRRALQRIDRVTDASQRLMDGNFSERLPVSGAGDEFDR
FT                   LSANLNVMLDRIEELNIGLRQVSDNIAHDLKTPLMRLRNRAEEALSGKKTELEYRQALD
FT                   DVIAESDQLIRTFNAILMISRIEATNSIENFEIMNMKQILEDAVELYEPFAEEEGILLQ
FT                   LGHTFDKNLKLNRELIAQSIFNLIDNAIKYASEGEKKTEISLSMECFGERLRVVVSDNG
FT                   PGIAVDKLEKVTERFVRLEESRTQPGFGIGLSMAKAVMKLHGGELILENANPGLRAILS
FT                   FP"
FT   gene            440609..440734
FT                   /locus_tag="BARBAKC583_0437"
FT   CDS_pept        440609..440734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0437"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45398"
FT                   /db_xref="UniProtKB/TrEMBL:A1US02"
FT                   /protein_id="ABM45398.1"
FT                   /translation="MKYFFKKIHKRLKNVSLFCIHLMKVVINDCKILKKKVKKKI"
FT   gene            complement(440857..443178)
FT                   /locus_tag="BARBAKC583_0438"
FT   CDS_pept        complement(440857..443178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0438"
FT                   /product="putative non-motile and phage-resistance protein"
FT                   /note="identified by similarity to SP:P37894; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF02518; match to protein family HMM PF08447; match to
FT                   protein family HMM TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44919"
FT                   /db_xref="GOA:A1US03"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1US03"
FT                   /protein_id="ABM44919.1"
FT                   /translation="MAKLDVYNAPTETHSDAKSSAQSCKTRTAHINHLSDSNYKRLLFI
FT                   EPWLRRFIPFIIITFLIVLAAIRFVLIYDWHNAIDKDTRSKITLLTTHIINIINRDLLS
FT                   ATKKERKAILSHNHLQNILINFQNEGLTNTNTMITIIDQNRNVLASSNPDITLGKPLQD
FT                   FIPQSTALWTLGKYTGAMQIMIGEEPALASFHETENGQYGVFISEKTHHIYMEWHKVFS
FT                   LNLILFIGTASIILALLYAYYTQVTRARNTDLISEKIQNRIDMAMMRGRCGLWDWNMAS
FT                   GRIYWSRAMYEMLGYVPQDALLSISQITAIINSTDINFFDLAQELMSGEKKHIDINVPM
FT                   RHADGHHVWMRIRAEVTEEEEPHLVGISFDISEQHQFVEQTAQADLRIRDAIENISESF
FT                   VLWDSEGRLVMSNSKFCEYAAIPKQMLQSGIQRATVTAMARPAISEYFLKEDDGTGNLT
FT                   SIRQTADGFWLKINERRTQDGGLVCIGTDISELKQQQEKFEDSERRLFSFIQELKRARG
FT                   NAQQRATEVEKLNKSLQAEKERAESANKAKSEFLANISHELRTPLNAILGFSDIMLQST
FT                   FGPLGSQRYEEYMRDIHNSGTHLLTLINDILDMSKIEAGRFTLDCKNVDLEPIISEAIR
FT                   TLTPQAQEKKISITANIAPKLHAELDCRAMRQIFLNLISNAVKFTPSGGSIDICAFQKK
FT                   NNLIFKIKDTGVGIPQSAIKKLGKPFEQVENQFTKTHTGSGLGLAISRSLLELHKGKLE
FT                   IASEEENGTTVTITIPIKQN"
FT   gene            complement(443458..446085)
FT                   /gene="pepN"
FT                   /locus_tag="BARBAKC583_0439"
FT   CDS_pept        complement(443458..446085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="BARBAKC583_0439"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="identified by similarity to SP:P37893; match to
FT                   protein family HMM PF01433; match to protein family HMM
FT                   TIGR02414"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44864"
FT                   /db_xref="GOA:A1US04"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:A1US04"
FT                   /protein_id="ABM44864.1"
FT                   /translation="MKQPVTPIYRLEDYQPTPYAIPKIQLNFCLEPTKTCVTATLFIEP
FT                   RNDTKEFTPLILSGDELTLISIFLNGKKLAENAYKSTPSYLEITRPPAAPFTLELITEI
FT                   NPAQNSQLMGLYLSNGVYCTQCEAEGFRRITYFYDRPDVLSTYTVKIEADSQTTPILLS
FT                   NGNLVETGTLDNNRHFAVWTDPYPKPSYLFALVGGNLDQLKDYFTTASGRRVKLGIYVE
FT                   KGKAEYAMYAMDALKRSMRWDEECFGREYDLDVFNIVAVSDFNMGAMENKGLNIFNDKY
FT                   ILADPETATDRDYKNIERIIAHEYFHNWTGNRITCRDWFQLCLKEGLTVYRDQEFSSDQ
FT                   NVRSLQRIENIKMLKATQFPEDSGPLAHPVRPRQYSEINNFYTTTVYEKGAEVVRMVHT
FT                   ILGSTLFRKGMDLYFQRHDGQACTIEDFISCFAEVSGQDFSQFMLWYEQAGTPNVEIDS
FT                   HYNEGILTIHAKQYIPKTPQQNKKSPMLIPIAFGLLGHNGEPLTYEADKNIQSDVMMLS
FT                   QESQTFTFRGLSEKPILSLLRNFSAPITLHIPFDESELIFLAQNDSNQINRWQSLNYLM
FT                   TQTLIQAIKDKTLEKIAMPSKLLTLIATIVKDENLEPEFRALCLSLPSEIELAHTLTNN
FT                   IDPDRIYDVRNQFLASIAHTHQELFATIYAQMQIKEPYSPNTVQTGKRALRNIILDYLS
FT                   LAENKPDHAITQYEMSDNMTDRIASLNILVQRFNKSKQTQNALSDFETRYKNNPLVMDK
FT                   WFSIQAIVAGKSTLDHVQKLMKHPLFSQDNPNRVRALIGAFATENPTSFHRIDGASYHF
FT                   LCQLILEIDKKNPQLASRLLTIMRSWQQWEPIRQKKLEMALKTIAAAPKLSSDVADIIN
FT                   RILT"
FT   gene            complement(446164..446991)
FT                   /locus_tag="BARBAKC583_0440"
FT   CDS_pept        complement(446164..446991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0440"
FT                   /product="uracil-DNA glycosylase, family 4"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45461"
FT                   /db_xref="GOA:A1US05"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1US05"
FT                   /protein_id="ABM45461.1"
FT                   /translation="MSQQTQCPISYEELLSFYKESGADAALADEPINRFNQSPSSEQKL
FT                   KQTCDIPSHQQTPPTIKLNAPPLNHPDTTQHALSAIEMAKNAKTLDELKSALLAFDGCS
FT                   LKMTAKNTCFSDGTAGSPLMLIGEAPGREEDIQGIPFVGKAGILLNKILASIGLTRENV
FT                   YIANTVPWRPPGNRTPTAREMALCRPFIERQIQLANPRILVALGGTAVQFFTGTQSGIV
FT                   RIRGKWLTYETEDKVKIPVMPTFHPAYLLRTPSQKKLTWIDFLEVKNRLNNLS"
FT   gene            complement(447202..447960)
FT                   /gene="thiD"
FT                   /locus_tag="BARBAKC583_0441"
FT   CDS_pept        complement(447202..447960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="BARBAKC583_0441"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by similarity to SP:P56904; match to
FT                   protein family HMM PF01256; match to protein family HMM
FT                   PF08543"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44655"
FT                   /db_xref="GOA:A1US06"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1US06"
FT                   /protein_id="ABM44655.1"
FT                   /translation="MALIPSILVVAGTDPTGGAGIVRDIETTAHFQIKASLAITSVNVQ
FT                   NNNHVAEIAPMSGKFVAAQMQVALEANPISAIKIGMTGTQEIIAEICNILKNYNHIPVV
FT                   LDPVFVASSGGRLTTEKIIEIMNNKLLPHIDILTPNMKELALLSQSPLASNHQEAMQQA
FT                   KKLLSLGPRYILVKGGHADGPFATDSLISQTEVINISAPRLKGTMRGTGCILSSAIATR
FT                   LALNETMTDAVKNAKAYIHTLLLTHCQKDH"
FT   gene            complement(447951..448556)
FT                   /gene="thiE"
FT                   /locus_tag="BARBAKC583_0442"
FT   CDS_pept        complement(447951..448556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="BARBAKC583_0442"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by similarity to SP:O34294; match to
FT                   protein family HMM PF02581; match to protein family HMM
FT                   TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45287"
FT                   /db_xref="GOA:A1US07"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1US07"
FT                   /protein_id="ABM45287.1"
FT                   /translation="MKLDPFYLIVDNADWIERCVPLGIKLVQLRIKNKDTELIRHHIKR
FT                   AKNICDQFGAQFIVNDYWEIAIDEKCDFIHLGQEDLNNADIPAIRKNGIKFGLSTHDEY
FT                   ELDIALSFCPEYIALGPIYPTILKKMKWPPQGLEKIKQWKKLIGPLPLVGIGGLTPERA
FT                   INVLQVGANSAAAITDIILHKKPKERVQQWIKVTQKWR"
FT   gene            complement(448553..449326)
FT                   /gene="thiG"
FT                   /locus_tag="BARBAKC583_0443"
FT   CDS_pept        complement(448553..449326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="BARBAKC583_0443"
FT                   /product="thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44577"
FT                   /db_xref="GOA:A1US08"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US08"
FT                   /protein_id="ABM44577.1"
FT                   /translation="MLNFYGHEFSSRLLLGTAQYPSPEILRKVIDKSGTEIVTVSLRRE
FT                   TAGGKHSGQFWQFLKELNVTILPNTAGCYTIKEAVTTAQLARDLFKTPWIKLEVIGNPD
FT                   TLQPNIFALVEAAQILNNEGFQIFAYTTDDLIVAEKLLEVGCRVIMPWCAPIGSAKGPR
FT                   DTDGLRSIRAYLPDLTLVIDAGIGRPSHATIAMELGYDAILLNTAVAKSGDPVLMAEAF
FT                   SKAVNAGYMAYKAGILEARDVAVPSTPIIGKAVFS"
FT   gene            complement(449331..449528)
FT                   /gene="thiS"
FT                   /locus_tag="BARBAKC583_0444"
FT   CDS_pept        complement(449331..449528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="BARBAKC583_0444"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45140"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1US09"
FT                   /protein_id="ABM45140.1"
FT                   /translation="MKIFVNDEIIQTDVTYLNLLLEELGYKGNWLATAVNSEVVSSDAR
FT                   GQYALHEGDRIEILSPMQGG"
FT   gene            complement(449532..450482)
FT                   /locus_tag="BARBAKC583_0445"
FT   CDS_pept        complement(449532..450482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0445"
FT                   /product="thiamine biosynthesis oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM TIGR02352"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44665"
FT                   /db_xref="GOA:A1US10"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1US10"
FT                   /protein_id="ABM44665.1"
FT                   /translation="MKNILIKGAGIGGLTVAFMLQQQGAAITLSAPPHFPIGSASWYAG
FT                   GMLAPYCEKESSEQIVEDLGIRAIQWWSKIFPEIVKQRGTLVVAPTRDIAELERFSLRT
FT                   NNHKTINSTKIAHLEPDLNGRFHHALFYATEAHIDPRKALLTLKNILIKNGAYIVDVGI
FT                   SEKKFDIIIDATGIARLGKDKDIRGVRGEMLLLRSADIKISRPIRLLHPRFPLYVVPRQ
FT                   DNIFMIGATMIESDFNSAISARSMMELLNAAYTLHPAFAEAEIIESGVGIRPCYPDNLP
FT                   HVSKKNNHISINGFYRHGFLLSPEIAKQAVKLALE"
FT   gene            complement(450479..452314)
FT                   /gene="thiC"
FT                   /locus_tag="BARBAKC583_0446"
FT   CDS_pept        complement(450479..452314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="BARBAKC583_0446"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45238"
FT                   /db_xref="GOA:A1US11"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US11"
FT                   /protein_id="ABM45238.1"
FT                   /translation="MQKHTPSVSCSPFPSSHKFYQQSLLFPNVRVPLRKILLTDGSGES
FT                   PFNVYDTSGPYTDENVIIDITKGLPAIRIPWLSERADTESYPARLVKPEDNGFTHGKDL
FT                   TPVFEKKRPILRSKNGKSITQMTYARAGIITAEMEYVAIRENEGLIEKNKQHTTSSKAF
FT                   DASIPEVYTAEFVRNEIACGRAIIPQNINHPECEPMIIGRNFRVKINANIGNSAVTSSM
FT                   AEEVEKMVWAIRWGADTVMDLSTGRNIHNIREWIIRNSPVPIGTVPIYQALEKVHGIAE
FT                   NLTWDIFRDTLIEQAEQGVDYFTIHAGLKLAFIPLTIDRTTGIVSRGGSIIAKWCLHHH
FT                   KENFLYEHFDEICDIAHTYDVSLSLGDGLRPGSIADANDEAQFAELKTLGELTQIAWEK
FT                   NVQTMIEGPGHVPMHKIKENMDQQLALCNEAPFYTLGPLTTDIAPGYDHITSAIGAAMI
FT                   GWFGTAMLCYVTPKEHLGLPDKNDVKTGVITYKIAAHAADLAKGLPRAQLRDNTLSRAR
FT                   FDFRWHDQFNLSLDPDTARAFHDETMPKEAHKLAHFCSMCGPKFCSMRISHDIRDAVAI
FT                   KKTRDEGMAAMAEKYQQNGDLYMKVMPSIKETVDD"
FT   gene            complement(453146..454366)
FT                   /locus_tag="BARBAKC583_0447"
FT   CDS_pept        complement(453146..454366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0447"
FT                   /product="porin family protein"
FT                   /note="identified by match to protein family HMM PF02530"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44571"
FT                   /db_xref="GOA:A1US12"
FT                   /db_xref="InterPro:IPR003684"
FT                   /db_xref="UniProtKB/TrEMBL:A1US12"
FT                   /protein_id="ABM44571.1"
FT                   /translation="MNIKTLLLCSTVAFIGISGAHAAPDIVEKPKSIKYLRACDAYGAG
FT                   YFYIPGTETCMKLSGYVRASFKGGHDVDAKTNADLDQHKKTYDVSSRLALIFQAASETE
FT                   LGTLRSYARLTSDWVNGKSGAGGRLNAAYIRLGGFSVGLDDTIFSTWTSYGEVINDDLI
FT                   APAGNVRTNFVSYTFASNTGFAAIIGAELGNASDPIGPDKKYYYIDKSDQVSIVADNDL
FT                   LSKQTKDYIPHILLGAQFVQGWGGVSTITVYDSHYKKWANKTRLDFKVNDDINVWVTGG
FT                   YKTNVDYYTADEQNVLSRENTTIYAGWGGKWAAWTGVTYQITPEAKLNTQISYSAVKTF
FT                   SASANIVYTLVPGFTITPEVSYIAWKDDRTFKGQQDSAQRNSTPNYTHALNGKNALQTM
FT                   IRLQRSF"
FT   gene            454701..454791
FT                   /locus_tag="BARBAKC583_0448"
FT   tRNA            454701..454791
FT                   /locus_tag="BARBAKC583_0448"
FT                   /product="tRNA-Ser"
FT   gene            455541..455819
FT                   /locus_tag="BARBAKC583_0449"
FT   CDS_pept        455541..455819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45078"
FT                   /db_xref="UniProtKB/TrEMBL:A1US13"
FT                   /protein_id="ABM45078.1"
FT                   /translation="MNCRNESEQVKKNCKVFTNLCAAETGLWGRGVYIFLKLSKSRNKI
FT                   VDILYLNKAEILAFKARNSRLIIGALSSFTGLFSRKGLWLCAIGSKY"
FT   gene            455883..456107
FT                   /locus_tag="BARBAKC583_0450"
FT   CDS_pept        455883..456107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45615"
FT                   /db_xref="UniProtKB/TrEMBL:A1US14"
FT                   /protein_id="ABM45615.1"
FT                   /translation="MVLLKKYLVIILRALSAFFVALVKAFCASKKAEQHKRTKHELKMA
FT                   VTRLEVENDINQKSDADVRADLSRWLRDK"
FT   gene            456224..456382
FT                   /locus_tag="BARBAKC583_0451"
FT   CDS_pept        456224..456382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45032"
FT                   /db_xref="UniProtKB/TrEMBL:A1US15"
FT                   /protein_id="ABM45032.1"
FT                   /translation="MVGNVARKQGNKNVELTEIRKDSTRGDEYLQGCKNDVSLYVMDGN
FT                   DYIFVHF"
FT   gene            complement(456477..458420)
FT                   /locus_tag="BARBAKC583_0452"
FT   CDS_pept        complement(456477..458420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="homology to a family of hypothetical proteins in
FT                   Leptospira interrogans; identified by similarity to
FT                   RF:NP_711581.1; match to protein family HMM PF07598"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45458"
FT                   /db_xref="InterPro:IPR011455"
FT                   /db_xref="UniProtKB/TrEMBL:A1US16"
FT                   /protein_id="ABM45458.1"
FT                   /translation="MKLRLLLFLFSLLLSLHTSFSAPIPAQVLQTPTDHPNDKIIGVKL
FT                   HNGEQYCYAPIFTEGDGYVYIDKCNSPYVKKARHDLFQRVSWNIDGVWLCMTAPNSVTG
FT                   LEGKSTADWGYLLLRPCVINNPNQRWIIKDRSFHTADGRFRVKDHKWYAYISKNEKDYY
FT                   DHHLTFEMMAWTQTISPPGNLSSKTFVGWAYVTQYPPAFRFYYLRNNVSIESETPALLY
FT                   YNPENGHIAQYYTAFGGFYCMVSQQSAGEDWNWVTWQPCTDTVPSSKNSAYWDLSQLNG
FT                   TEGIILDYKGNVLRVARYGSHWGVPYTVSKSYIEKDTTHSPLSSFTLSRDIERWNRYVN
FT                   GNLGETLTYCPAPGKKKNATQVSTAKTRTKRSLPSDFQLTEQWMKRLWDIARSNIPGSS
FT                   PKISFCGVCMLHTMQMLAELQEDHISGPRQTGGYFFNTRPGVDPFISFRNRFPVLTERL
FT                   EATISYNTVPWRANENVFTRTSRVSRAIALILLPRYDWRPSNLATTEDEIRSELRKLLR
FT                   FPPGTLWYVVIIRSNRDRTSTVGHVQPILRTEEGLVIIPTNAANISWDEFRRAVTATRD
FT                   VDPLISELSLGGTRTLYSLVTYQIAWRDEISLNFYISQRNCTGEGDHRRGNGQLPRASL
FT                   LNQCGSGRCAIQ"
FT   gene            459089..459862
FT                   /locus_tag="BARBAKC583_0453"
FT   CDS_pept        459089..459862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0453"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family
FT                   protein"
FT                   /EC_number="3.5.1.28"
FT                   /note="identified by match to protein family HMM PF01471;
FT                   match to protein family HMM PF01510"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44857"
FT                   /db_xref="GOA:A1US17"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A1US17"
FT                   /protein_id="ABM44857.1"
FT                   /translation="MYTIDYNKYRSVKGFNNRVRFLVMHYTAVNFEKSIASLTGADVSA
FT                   HYLVPDPMEETYIASGFKGVHIFNLVDEDKRSWHAGVSSWAGRANLNDTAIGIETVSLA
FT                   TEKDGVFTFPPYNLNQIDAIKKLSLNILQRYPDITPTNVVGHSDISIGRKSDPGAAFPW
FT                   KELYEAGIGAWYDEEVKNKYYHHFLREIKLPSKEEVITRLKRYGYDTSAADSDKGFKNL
FT                   IRAFQLHFRQKNYDGVLDIETLAILYALLDKYFPR"
FT   gene            complement(459877..460071)
FT                   /locus_tag="BARBAKC583_0454"
FT   CDS_pept        complement(459877..460071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45207"
FT                   /db_xref="UniProtKB/TrEMBL:A1US18"
FT                   /protein_id="ABM45207.1"
FT                   /translation="MTAIYLYKTEDFSTHIYKMCKNFLQINSFYQKEYFSITQNATSNI
FT                   LPNTGKPPQYAISWWFTFL"
FT   gene            complement(460068..460862)
FT                   /gene="hmuV"
FT                   /locus_tag="BARBAKC583_0455"
FT   CDS_pept        complement(460068..460862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="BARBAKC583_0455"
FT                   /product="hemin ABC transporter, ATP-binding protein"
FT                   /note="identified by similarity to GB:CAC34395.1; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44455"
FT                   /db_xref="GOA:A1US19"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1US19"
FT                   /protein_id="ABM44455.1"
FT                   /translation="MIEATNICVQRGKTHIINHITLQAKSGALTVIIGPNGSGKSTFIK
FT                   ALSGEISYSGKITLNGYDVTQTKACKMATMRAILPQSTALAFPFLVHEVVRLGLSISQP
FT                   GVTKTEFQNLPQQALEQVGLADYGDRYYHQLSGGEQARVQFARVLCQIWNPIYNQIPRW
FT                   LILDEPIANLDVQHQLIVMNIAKNFAYRGGGVLAILHDLNLAAHYADKIILFKQGKIYC
FT                   EGSVFHVLTTKNLRDVYHCPLSVSKLPKADIPFVLPQTASHW"
FT   gene            complement(460855..461955)
FT                   /gene="hmuU"
FT                   /locus_tag="BARBAKC583_0456"
FT   CDS_pept        complement(460855..461955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="BARBAKC583_0456"
FT                   /product="hemin ABC transporter, permease protein"
FT                   /note="identified by similarity to GB:CAC34394.1; match to
FT                   protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45429"
FT                   /db_xref="GOA:A1US20"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A1US20"
FT                   /protein_id="ABM45429.1"
FT                   /translation="MTNNISMTRASEIKQNRKETRVNRGKIALFSLMLFLFFSIFLGLL
FT                   SGASNVSFINLIHVLFTEDFSVSSKTRDYLVFIDIRLPRIILGLLVGAALAVSGVLMQG
FT                   LFRNPLADPGIVGVSAGASLGAVLAIVVNISFPPLLAPFLESYQIIIGAFLGGLLSTII
FT                   LYIIATHHSCTSIATMLLAGIALSSLNGAVVGTLIFIANDQQLRDITFWNLGSLVGGTW
FT                   LKVGLILPFVWIGLIFSPFLSRALNALALGESVANHIGFNTQKIKNIAILLVALMCGGA
FT                   VAVSGGIGFIGIVVPHILRLLIGPDHRYLIPCSAILGAALLIFADTFARFIVAPAELPI
FT                   GIVTALFGAPFFLWILIYQRRINFHD"
FT   gene            complement(461952..462863)
FT                   /gene="hmuT"
FT                   /locus_tag="BARBAKC583_0457"
FT   CDS_pept        complement(461952..462863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="BARBAKC583_0457"
FT                   /product="hemin ABC transporter, periplasmic hemin-binding
FT                   protein"
FT                   /note="identified by similarity to GB:CAC34393.1; match to
FT                   protein family HMM PF01497"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44681"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:A1US21"
FT                   /protein_id="ABM44681.1"
FT                   /translation="MCTPFLRRLSSLFLICMLCSFICLTKKVIADPTTNFPKNAHIISI
FT                   GGALTETIYALGAQNQLIARDSTSTYPKEALTLPELGYMRALSPEGLLSLDPEGILLVE
FT                   GSGPPSTIDILKKTSIPILIVPENFSRESIIEKIRLVGKALHRETQAAALIEKINHKFM
FT                   ENDALLAKVTKPKRVLFIFSIQNGRAMVSGTHTAADAMIKLSGAINAVSDYRGYKLLNN
FT                   EELLKSNPDFILLTNHTENLIKIDKILSMPAIKATPAAQNHAIKQVDTMYFLGFGPRTA
FT                   DASKELIDMLYSTDNPAKADKK"
FT   gene            complement(462881..463924)
FT                   /gene="hmuS"
FT                   /locus_tag="BARBAKC583_0458"
FT   CDS_pept        complement(462881..463924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="BARBAKC583_0458"
FT                   /product="hemin transport protein HmuS"
FT                   /note="identified by similarity to GB:CAC34392.1; match to
FT                   protein family HMM PF05171"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44897"
FT                   /db_xref="GOA:A1US22"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="UniProtKB/TrEMBL:A1US22"
FT                   /protein_id="ABM44897.1"
FT                   /translation="MSYTAEMIIRLREEKKEVRNRDFATSIGISEAELVAAYCTVGKAK
FT                   RLQADVTTFLEHVPKIGIVMALTRNDNAVHEITGCFEKIVQGEHVLLTLGEIDLRIFPK
FT                   KWKFCFEYEMVISGNPRKSLQFFDQHGIAIFKSYCKDATNMEEWSLLVEKLLHTDQSPT
FT                   LDVLPAPTPIQNDITELDVEKFRNRWQKMTDVHQLHAILSEFKISRHDAVKHAGDEFVD
FT                   ELNIESVEIMLNEAAQQELPIMCFVGNEGCIQIFTGKVKNIKKMGPWLNILDQNFQMHL
FT                   LTSEIDKVWHVRKPTKDGYVSSLEVFDKNGEMVIQFFGLRKEGQKEREDWRFLLNNLPK
FT                   YQEMAAT"
FT   gene            463995..464126
FT                   /locus_tag="BARBAKC583_0459"
FT   CDS_pept        463995..464126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0459"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45393"
FT                   /db_xref="UniProtKB/TrEMBL:A1US23"
FT                   /protein_id="ABM45393.1"
FT                   /translation="MAQPITNQALLLPITEQLKISKLELFKAFILILNSKKTKIKMQ"
FT   gene            complement(464173..466368)
FT                   /locus_tag="BARBAKC583_0460"
FT   CDS_pept        complement(464173..466368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0460"
FT                   /product="TonB-dependent heme/hemoglobin receptor family
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715; match to protein
FT                   family HMM TIGR01785; match to protein family HMM
FT                   TIGR01786"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45677"
FT                   /db_xref="GOA:A1US24"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A1US24"
FT                   /protein_id="ABM45677.1"
FT                   /translation="MQIKWKNIYKSCVALSALSIWAPSFVFAQNNDEGSVTDLKSIVIE
FT                   GKQDLDPSSTVTILTDRQTAQNIEQKQVSDVHDVNRLNSSISYNSSNDSFIVRGLDANR
FT                   VLTTIDGIPLPWLNDEARSVKGGNSTFDFNTLSTFDLIQGSDSSIYGSGALGGIIALRT
FT                   LNPEDLLTEEKNWGSLTKGSYNSVDNSWQVDQAYAVRANQTFVLFQGSLVGGHERKNMG
FT                   SIGDYGTKRTLANPADFDQNNLLFKVHQYFDHNHRLSFTAERFHYNKDTHVMNAPAIYF
FT                   PESVHEENKKSRERFSLSYDYEGSQDTLLDAFHGQIYWQNQLNNHILSGNRVVSPKGNY
FT                   LRDNQIRNTTYGLNTNSIKKVDIGTTTNTLQLAINIFESKFHQYASGKDNCHLPENARG
FT                   CAFLHTNQSDAPDTNSRGFGLAFENEIDFYRYHVRITPGIRYDWYTHNPQETASYGKVP
FT                   ISQKLPSKSSSSHFSPKLRLEWDIHNQVALYAQWAQAFRAPSVSELYLNYINPSFYYRA
FT                   GNPDLKPETSNGYDLGVKYGNMNFGGSFGAFINDYKNFIDLVDKGPSREFRLSREHYVN
FT                   RAHVRIFGVETKAHWNLDNGLHSDFSLSYAHGKDLDKKEYLSSIPALKTIFGLGYAKEF
FT                   WGLDFVLTLAAKNDKVAKKSSYREVPGYSLVDVLSWWKPFGKDGLTIRAGVYNIFNTKY
FT                   WNASDLPSVSPRGESPLPKDYFSQPGRSFKVSFVQKF"
FT   gene            466635..467435
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0461"
FT                   /note="TonB domain protein, authentic point mutation; this
FT                   gene contains a premature stop which is not the result of
FT                   sequencing error; identified by match to protein family HMM
FT                   TIGR01352"
FT   gene            complement(467633..469597)
FT                   /locus_tag="BARBAKC583_0462"
FT   CDS_pept        complement(467633..469597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0462"
FT                   /product="transglycosylase, SLT domain protein"
FT                   /note="identified by match to protein family HMM PF01464"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45438"
FT                   /db_xref="GOA:A1US25"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1US25"
FT                   /protein_id="ABM45438.1"
FT                   /translation="MTQQSKNPPVPPHHIIIPHLNINDIIAIDQLKLGLDSLSKNNITQ
FT                   AIALRNMMAKNSLNRYILTWAIGTSNQKDIPSSELFNALNELKEWPGIALIQRNAEHAF
FT                   VNETNSAQKIIQKFSNRLPITAQGMAAFTEALITTGQITHARQIIAPWWHKTKLNAEEE
FT                   ELILKKAHAALKPIDHLKRMRTMLYVQRISSAERIATLAKAQSLFKAVAAVEKNDPQAA
FT                   QKLQAVDPSWKKDPLLQFAQIRHLRRTGQYSAAATLMMKAPRDKASLVNPDAWWIERRA
FT                   ISREMLDLNQYQIAYQLVATHIGVTPIWAIDAEFHAGWYALRFLHNPQLAMNHFRRIPQ
FT                   ISSGPVSTSRGYYWMGRAKEILGEHQNALHYFRRAAHFSTTYYGQLANSRLNQTKLTIL
FT                   FPKPTPTDRQNFNTRKIVQVIQQLEEVGYDHLAKILYKELGQQIESPGELALLAVMAEK
FT                   KGDYHTSLKIGKTAVVQGKNVGALSHPLGAIPASANISATKKALVYAIARQESEFNPIA
FT                   LSIAGAQGILQLLPKTAKELAKKHSIIWSPQKLSSDAGYNATLSAHFLNEQLERFNGSY
FT                   ILALISYNAGPRRANEWIERYGDPREQTLDKVIDWIERIPYAETRNYVMRVMENYGVYK
FT                   ARLTGITDIKTDLMSGHQQ"
FT   gene            469596..469760
FT                   /locus_tag="BARBAKC583_0463"
FT   CDS_pept        469596..469760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0463"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44896"
FT                   /db_xref="UniProtKB/TrEMBL:A1US26"
FT                   /protein_id="ABM44896.1"
FT                   /translation="MTEEWGRAKGIGIFWGEKVICANAFEGKIIAINTGVITVRVKDLI
FT                   DNERIKNKP"
FT   gene            469973..470857
FT                   /gene="dapA"
FT                   /locus_tag="BARBAKC583_0464"
FT   CDS_pept        469973..470857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="BARBAKC583_0464"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by match to protein family HMM PF00701;
FT                   match to protein family HMM TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44638"
FT                   /db_xref="GOA:A1US27"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US27"
FT                   /protein_id="ABM44638.1"
FT                   /translation="MLKGALTALITPFNENGSVDEETFCNFIEWQITQGIDGLIPAGTT
FT                   GESPTLSHEEHKKVIELCVEKVAKRVPVVAGAGSNSTDEAVELAQHAKKAGADAVLVVT
FT                   PYYNKPNQEGIYSHFATIAKAVSIPIVIYNIPGRSVVDMAVETMKDLCQNFKNIIGVKD
FT                   STGNIERVSEQREKCGKDFVQLSGDDQTALGFNAHGGVGCVSVASNVAPKLCAELYAAC
FT                   RSGDYKTALELNDRLMPLNRSIFIEPSPSGIKYAVAKLGFCRDTVRLPLVPLKDTTKEI
FT                   IDAALQHAGLIKE"
FT   gene            470876..471352
FT                   /gene="smpB"
FT                   /locus_tag="BARBAKC583_0465"
FT   CDS_pept        470876..471352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="BARBAKC583_0465"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44574"
FT                   /db_xref="GOA:A1US28"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US28"
FT                   /protein_id="ABM44574.1"
FT                   /translation="MRKKKNVLIRKIIAENRKARFNFELLEHLEAGIVLNGTEVKSLRS
FT                   NHANIAESYASFENEELWLVNAHIPEYTQANRFNHEPRRLRKLLVSKREIGRFFNAVSR
FT                   EGMTIVPLKLYFNERGCVKLEIALARGKKIHDKRETEKKRDWGREKARLLRRYG"
FT   gene            complement(471387..472073)
FT                   /locus_tag="BARBAKC583_0466"
FT   CDS_pept        complement(471387..472073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0466"
FT                   /product="uracil DNA glycosylase family protein"
FT                   /note="identified by match to protein family HMM PF03167"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45111"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:A1US29"
FT                   /protein_id="ABM45111.1"
FT                   /translation="MIDPGNHNDRLAQFCPEPPKNCNLCPRLHDFITDWRIKEPLWHNA
FT                   PVSPFFPYKGPATTRLLIVGLAPGLRGANRTGRPFTGDYAGQLLYSTLKKFGFAQGVFE
FT                   ERPDDSLKLIDAAIVNSVRCVPPQNKPSSIEINTCRYFFAPLLKNLPKLKAVITLGSIA
FT                   HLSTIRALNANASAHPFGHGKINNIGKLRIFSSYHCSRYNTNTGRLTDAMFHQVFQKAK
FT                   TYLDQC"
FT   gene            472472..472870
FT                   /gene="rpoZ"
FT                   /locus_tag="BARBAKC583_0467"
FT   CDS_pept        472472..472870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="BARBAKC583_0467"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF01192;
FT                   match to protein family HMM TIGR00690"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44936"
FT                   /db_xref="GOA:A1US30"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US30"
FT                   /protein_id="ABM44936.1"
FT                   /translation="MARVTVEDCIDKVDNRFELVLLAGHRARQISQGAQITVSRDNDKN
FT                   PVVALREIADETLSPADLKEDLIHSLQKHVEVDEPEAVTEFISHSSETESVLDTSREEE
FT                   NCSFDYMSEEDLLAGIEGLVVPEKSDDY"
FT   gene            472998..475226
FT                   /gene="relA"
FT                   /locus_tag="BARBAKC583_0468"
FT   CDS_pept        472998..475226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="BARBAKC583_0468"
FT                   /product="GTP pyrophosphokinase"
FT                   /EC_number="2.7.6.5"
FT                   /note="identified by similarity to SP:O52177; match to
FT                   protein family HMM PF01842; match to protein family HMM
FT                   PF01966; match to protein family HMM PF02824; match to
FT                   protein family HMM PF04607; match to protein family HMM
FT                   TIGR00691"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45500"
FT                   /db_xref="GOA:A1US31"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:A1US31"
FT                   /protein_id="ABM45500.1"
FT                   /translation="MMHQCELVERVRRYKRDVNEALLNKAYAYAMQKHAHQRRASGDPY
FT                   FSHPVEVAAILTDMRLDEATIAVALLHDTIEDTSATREEIDQLFGAEIGKLVEGLTKLN
FT                   KLDFVSKKAVQAENLRKLLIAISDDFRVFLVKLADRLHNMRTLGVMCDDKRRWIAEETM
FT                   DIYAPLAGRMGMQDMREELENLAFFYLNPESYRAIVEKLSELSRRNCDVLSTIENELTK
FT                   LFSEYGITADVKSRQKKPYSVFRKMESRALCFEQLSDIFGFRVIVKTVHDCYGALGIIH
FT                   TTWPMIPGRFKDYISIPKQNDYRSIHTTIVGPSRQRVELQIRTGVMDEIAEYGVAAHSI
FT                   YKDHGSSYSVSKLSSETKAYAWLCQTIQSLSDGDNPEEFLEHTKLELFQDQVFCFTPKG
FT                   QLIALPQGAIPIDFAYAVHTDIGNSCVGVKINGRIMPLMTKLKNGDEVDIICSQAQIPP
FT                   AVWEFLVVTGKARSAIRRATRAAVRKQYSGLGYRILEHAFGCVEKQFSKDMLQQVVLHL
FT                   ARRDVEDILEAVGSGELTSVDVIKAVYPDYQNYRLMQKSYLNFGEEGRLNVENSQSVIS
FT                   TIPENEQDKTSEEGYQRKALPIRGTRRDIPMLFSPEGAVPGDRIVGIMKPGAGIVIYPI
FT                   QSSALIAYDDKPERWIDIRWDIDGEMNERFPALINILAANNPGSLAEVTQVIFANDANI
FT                   KNLSLIHTAPDFTEIVIDLEVWDLKYLNRILSQLKGLNSVNVARRVYG"
FT   gene            475242..475820
FT                   /gene="pyrE"
FT                   /locus_tag="BARBAKC583_0469"
FT   CDS_pept        475242..475820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="BARBAKC583_0469"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01367"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44994"
FT                   /db_xref="GOA:A1US32"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US32"
FT                   /protein_id="ABM44994.1"
FT                   /translation="MNTQDVINIFKQADAILEGHFILTSGRHSATFLQKAKVFMHADLT
FT                   EKLCRGLAQEIKRHVEGKIDYVVGPAIGGLIPSYETSRHLGVPSIWVERENGVFRLRRF
FT                   EVEKGARVVIVEDIVTTGLSIRETIEALVAVEADVVASACIIDRSGGKVDVGVPLIALA
FT                   EYEIVSYTRDTLPHELSKIPAVKPGSRDI"
FT   gene            475914..476516
FT                   /locus_tag="BARBAKC583_0470"
FT   CDS_pept        475914..476516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44830"
FT                   /db_xref="GOA:A1US33"
FT                   /db_xref="InterPro:IPR018639"
FT                   /db_xref="UniProtKB/TrEMBL:A1US33"
FT                   /protein_id="ABM44830.1"
FT                   /translation="MLFRHQKPINLRERIRLLVWPRRSFARSFHYICKRILRISATPHK
FT                   VALGFAIGIFSACSPFFGLHIILAVFFSWILRGNFTAAIIGTIFSNPVTFFPIIVVDYK
FT                   VGYLFLSFFEHVDKISLVQIRTMFDGLTFSQIWLVFWETWDLVMIPMILGGVFLGSILG
FT                   GLFYIGVYSGTVRFQKKRYRKIMEKVNLHQENQKSVS"
FT   gene            476513..476914
FT                   /gene="acpS"
FT                   /locus_tag="BARBAKC583_0471"
FT   CDS_pept        476513..476914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="BARBAKC583_0471"
FT                   /product="holo-(acyl-carrier-protein) synthase"
FT                   /EC_number="2.7.8.7"
FT                   /note="identified by match to protein family HMM PF01648;
FT                   match to protein family HMM TIGR00516; match to protein
FT                   family HMM TIGR00556"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45412"
FT                   /db_xref="GOA:A1US34"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US34"
FT                   /protein_id="ABM45412.1"
FT                   /translation="MIIGLGNDMIDIRRIEKILIRHSSRFIQRIFTDIEQNKSENFPKR
FT                   SYAYAKRFAAKEACAKALGTGIAYGVNWRDIGIVNSPSGKPTIKLTNHAQIQLEKLLPS
FT                   NHDAFIHLSMTDDFPWAQAFVIIEALPRG"
FT   gene            476982..477764
FT                   /gene="lepB"
FT                   /locus_tag="BARBAKC583_0472"
FT   CDS_pept        476982..477764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="BARBAKC583_0472"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="identified by match to protein family HMM PF00717;
FT                   match to protein family HMM TIGR02227"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45311"
FT                   /db_xref="GOA:A1US35"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1US35"
FT                   /protein_id="ABM45311.1"
FT                   /translation="MSQKETTKNKKEKGGLLEFISVFVQAFIWAMLIRTFLFQPFTIPS
FT                   GSMRPTLLVGDYLFVSKYAYGYSRFSFPLSLPIFSGRIWASQPERGDVLVFRLPSDPSI
FT                   DYIKRVVGLPGDRIQVRQGVLYINDQAISRQFMGQVDDPDITAINNPVDVYREKMSNGV
FT                   SYDTLSFGYFSQVDDTKVFEVPSGHYFVMGDNRHNSDDSRLNVGYVPEENLIGRANLIF
FT                   FSVSNNSRAWQFWRWPFDVRWARLFSSVNTIHDFPLNK"
FT   gene            477775..478482
FT                   /gene="rnc"
FT                   /locus_tag="BARBAKC583_0473"
FT   CDS_pept        477775..478482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="BARBAKC583_0473"
FT                   /product="ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="identified by match to protein family HMM PF00035;
FT                   match to protein family HMM PF00636; match to protein
FT                   family HMM TIGR02191"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45546"
FT                   /db_xref="GOA:A1US36"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US36"
FT                   /protein_id="ABM45546.1"
FT                   /translation="MKHQTIDQLKKLTGHSFKNEDLLKKALTHSSVQRSEQGNYERLEF
FT                   LGDRVLGLLVAEMLYQFFPQASEGELSVRLNGLVNAQTCADIAREIGLPDMVHVGCEMK
FT                   NLEGRRLANMHADVVEALIAVIYLDGGLKSVRPFIQRYWQDRAKKIDASRRDAKTELQE
FT                   WAHTQNGVQPQYRVIKRCGLDHDPVFVVEVSVPGFVSEVGEGGSKRHAERAAAEKILRR
FT                   EGMWGSIEKDDHG"
FT   gene            478475..479380
FT                   /gene="era"
FT                   /locus_tag="BARBAKC583_0474"
FT   CDS_pept        478475..479380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="era"
FT                   /locus_tag="BARBAKC583_0474"
FT                   /product="GTP-binding protein Era"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM PF07650; match to protein
FT                   family HMM PF08477; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00436"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45148"
FT                   /db_xref="GOA:A1US37"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1US37"
FT                   /protein_id="ABM45148.1"
FT                   /translation="MDEITKTRFGFVSLVGVPNAGKSTLVNQLVGTKVSIVTHKVQTTR
FT                   ALVRGIVIHEKTQIVLVDTPGIFRPRKRLERAMVSAAWSGIRDADALLVLIDVQNGLSD
FT                   EVNAMLDNLANIKQDKILVLNKIDTVAKSSLLALTAKINERVNFLRTFMISALNGSGCK
FT                   DLLDYLSTMMQPGPWCYPEDQISDMPMRQLAAEITREKLFFRLHEELPYASTVETENWE
FT                   ERPDGSVKINQVIYVERESQKKILLGTKGHTIKAIGQAARKELTEILEQRVSLFLFVKV
FT                   RDNWDTDPERYRAMVLDFSK"
FT   gene            479383..480120
FT                   /gene="recO"
FT                   /locus_tag="BARBAKC583_0475"
FT   CDS_pept        479383..480120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="BARBAKC583_0475"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44724"
FT                   /db_xref="GOA:A1US38"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US38"
FT                   /protein_id="ABM44724.1"
FT                   /translation="MKWKEQAIILGARQYGETSVILEVVTRQHGRYMGVVKGGRSRRMA
FT                   ALLQPGNFVEAEWWARLDEHLGLFKLEALDLCASRLMFLPEALYGLQLMASHFRLLPER
FT                   DPHPILYDILHLFMQNFDEQFVNAELLVRFEMRLLEELGFGLDLSHCAVTGRQEKLYYV
FT                   SPKSGRAVCEEVGLPWKNKLLLLPKFLIERTNRPVDFDDIRNGFTLTDFFLTRHVWEPR
FT                   GIKQPSVRAILIQLFERRFHTKA"
FT   gene            480157..481002
FT                   /gene="panC"
FT                   /locus_tag="BARBAKC583_0476"
FT   CDS_pept        480157..481002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="BARBAKC583_0476"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018; match to protein
FT                   family HMM TIGR00125"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45328"
FT                   /db_xref="GOA:A1US39"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US39"
FT                   /protein_id="ABM45328.1"
FT                   /translation="MRVLKTIAEVRQHLTEERRLGLSIGFVPTMGALHHGHLALVQKAR
FT                   EMCDRVLVSIFVNPKQFGSHEDFEVYPRDLLSDCTLLNKEAVEYVFAPSVEEMWPLGND
FT                   TIVEVEGLSRILMGELRPGHFCGVTSVVAKLFNIVQPDKVFFGEKDFQQLLIIRRMVKD
FT                   LAFPIEVIGVPILRDSDGVASSSRNQLLTPEDRKAAKIIPESGKAAEKLYRQGERSVDK
FT                   LCKAVRDILQQELRAIVESVDLRNMETLSAIKGTLDAPAVLLLTVRFGDVRLIDQYILQ
FT                   "
FT   gene            481014..481829
FT                   /gene="panB"
FT                   /locus_tag="BARBAKC583_0477"
FT   CDS_pept        481014..481829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="BARBAKC583_0477"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44890"
FT                   /db_xref="GOA:A1US40"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US40"
FT                   /protein_id="ABM44890.1"
FT                   /translation="MSVHKSIKRITASEIQAKKKQEPIVSLTAYQAYSARIADPHCDFL
FT                   LVGDSVGMIVHGFDTTLPVDVDMMILHGKAVMRGSQRALVVVDMPFGSYEKSPEQAFSN
FT                   ASRILADTGCGAVKLEGGIHMAKTIDFLCKRGIPVMSHIGLTPQAVNHFGGFKTQGRDK
FT                   SDWEKIEADAAAIEDAGAFAVVVEAVVEPLAVKLTEKLSIPTIGIGASNQCDGQILVME
FT                   DMLGYGAWAPKFVRRYGTLEQAMDTAIRNYAEDVKSRAFPSDSEIYKLK"
FT   gene            complement(482190..482766)
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0478"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error"
FT   gene            complement(482811..483671)
FT                   /locus_tag="BARBAKC583_0479"
FT   CDS_pept        complement(482811..483671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0479"
FT                   /product="aminomethyltransferase"
FT                   /note="identified by match to protein family HMM PF01571;
FT                   match to protein family HMM PF08669"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45527"
FT                   /db_xref="GOA:A1US41"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A1US41"
FT                   /protein_id="ABM45527.1"
FT                   /translation="MIEKQNAISLKNRKIINVIGEEATHFLQMLITTDVTKIGPQELFP
FT                   GALLSPQGKVIADFLIGKIDQGYMIDIAESLADTFQKRLLLYKLHKKIEVTQPLQTITT
FT                   IFLENEINTSKFTLSFIDKRFPENEKIIRTYGETPFLAPKDNDNWHRMRIRYAITESGQ
FT                   DYEIGTVFPHDINYDQIGGLSFNKGCYVGQEVVSRMHHRKIARRRFLIVTGQHYLTPGS
FT                   TIEASNKTLGKLGTCIANEALALMRIDHVKDAMDKDSQFTVNNLPVTISIAENMNFTFP
FT                   ESTVD"
FT   gene            483735..485060
FT                   /locus_tag="BARBAKC583_0480"
FT   CDS_pept        483735..485060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0480"
FT                   /product="dihydroorotase family protein"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44813"
FT                   /db_xref="GOA:A1US42"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1US42"
FT                   /protein_id="ABM44813.1"
FT                   /translation="MSKTFDTIFKGSTLVNHDGSGKRDIAVTNGRIAEIGDLTCASAGE
FT                   VIDCTGLHIVPGIIDSQVHFREPGNEHKEDLESGSRSAVLGGVTAVFEMPNTNPMTTSE
FT                   EALADKVKRGFHRMHCDFAFWIGGTRENAHEMAELERLPGAAGIKVFMGSSTGNLLVDD
FT                   DEGVRRILQNTRRRTAFHSEDEERLNERKMLRVEGDVSSHSVWRDEVAALKCTQRLVKI
FT                   ARETGARIHVLHISTAEEIDFLKNHKDIATLEVTQHHLTLTANDYKQFGALIQMNPPIR
FT                   ESRHREGLWYGVQQGIIDVLGSDHAPHTLEEKQKPYPSSPSGMTGVQTTVAIMLTHVNT
FT                   GKMSLERFVDLTSHGPHRVFGISRKGRIAVGYDADLTVIDLKREEMITNAMIGSRAGWT
FT                   PYNGNKVKGWPVGTIIRGMRVMWEGEIVMPSQGEPVKFIEAL"
FT   gene            485478..486980
FT                   /gene="cysS"
FT                   /locus_tag="BARBAKC583_0481"
FT   CDS_pept        485478..486980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="BARBAKC583_0481"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="identified by match to protein family HMM PF01406;
FT                   match to protein family HMM TIGR00435"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45202"
FT                   /db_xref="GOA:A1US43"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US43"
FT                   /protein_id="ABM45202.1"
FT                   /translation="MGNLRFYNTLTRKKEDFIPIDSSKVRLYVCGPTVYDYAHIGNARP
FT                   VIVFDILFRLLRHVYGKDHVIYARNVTDVDDKINARAIREYPKLTLNDAIHQLTERTYD
FT                   QFQQDTEALGCLLPTYQPRATDHLEEMRSLIERLLEKGHAYIAENHVLFSVNSIKNNPL
FT                   YGVFAKRSLNEMKAGARVDVAPYKRDDMDFVLWKPSTQQEPGWKSPAGISVLGRPGWHI
FT                   ECSAMSMAKLLTPYGGGLACDDLSVNVFDIHGGGIDLIFPHHENEIAQSCSVFGTERMA
FT                   NFWMHNGFLQVEGRKMSKSFGNFITIRSILESNFVEFSNAMTDDLKQSWAGLSARFSML
FT                   QTHYREPLNWTAQRLAQSSSELYRWYELLRCERSCLDNGGVIDASLISTLSDDLNTPNS
FT                   FTLLRKFYKEENAVALVQGMDLFGLLRQEWVREIECPLFVKGIDLDSKFIDQRIAERLL
FT                   FIQNKEWAAADEIRNELAKKGIALKDEKDSQTGERITTWEVK"
FT   gene            487389..489272
FT                   /locus_tag="BARBAKC583_0482"
FT   CDS_pept        487389..489272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0482"
FT                   /product="ABC transporter, permease/ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44972"
FT                   /db_xref="GOA:A1US44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A1US44"
FT                   /protein_id="ABM44972.1"
FT                   /translation="MKQNKKVKTVSADSGQTLRTLYNLWPYMWPSGRSDLKMRVVWAVL
FT                   YLILAKFVLISVPYFLKYATDAFDTSFEPPVWLSSTWLIPIMLVLAYNIARIVQAGLNQ
FT                   LRDSLFATVGQHAIRRLAYKTFVHIHELSLRFHLERRTGGLFRVIERGTKGIEAIVRFS
FT                   ILNTVPTILEFALTALVFYISYGWNYFLVVLATVGLYTWFTIKASNWRIGIRHEMNEAD
FT                   TEANTRAVDSLLNFETVKYFCNETLEARRFDASMAGYEKAAIKIWTSLSWLNFGQAFIL
FT                   GIGMTVLMLMSAYEIFYATQTIGDFIFINALLIQLSIPLNFIGSIYREIRQGLADIEAM
FT                   FDLLDVQQEIVDKPDAKPLVVRDGTIRFHQVKFSYDSCRPILKDIDFEVPGGKTVAIVG
FT                   PSGSGKSTISRLLFRFYDIESGAITIDGQDIRDVTQESLREVIGIVPQDTVLFNDTVAY
FT                   NIRYGRPSATDEEMCKAAEMAQISKFIEMLPEGFQSIVGERGLKLSGGEKQRVAIARTL
FT                   LKAPPLLILDEATSALDTTTEQDIQQALDIVSRGRTTLIIAHRLSTVIGADEILVLKDG
FT                   CIVEKGTHTDLLAKKGLYASMWNKQLEASRAEEKLRKMREEDEMGVVNPKK"
FT   gene            489384..490082
FT                   /gene="psd"
FT                   /locus_tag="BARBAKC583_0483"
FT   CDS_pept        489384..490082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="BARBAKC583_0483"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="identified by match to protein family HMM PF02666;
FT                   match to protein family HMM TIGR00164"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45376"
FT                   /db_xref="GOA:A1US45"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US45"
FT                   /protein_id="ABM45376.1"
FT                   /translation="MSVFRSIRDGVVPIHKEGYPFIVAFFVASLILGWIWDPLFWFGLV
FT                   LTVWCIYFFRDPERVTPMNADWVVSPADGRISFVGLCVPPEELDLGKNEMMRVSVFMDV
FT                   FSCHINRAPVSGTIESIVYSPGKFVNADLDKASEFNERNGVVIDSKHGKIGVVQIAGLV
FT                   ARRIICWSKEDDSVAAGQRFGMIRFGSRLDVYMPAEIKLRVAVGQTSIAGETVLGSFDS
FT                   DITTTDFRLN"
FT   gene            490091..490930
FT                   /gene="pssA"
FT                   /locus_tag="BARBAKC583_0484"
FT   CDS_pept        490091..490930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="BARBAKC583_0484"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="identified by match to protein family HMM PF01066"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44488"
FT                   /db_xref="GOA:A1US46"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:A1US46"
FT                   /protein_id="ABM44488.1"
FT                   /translation="MKNSLPFSSFDPEGQRDDIAHRRRLPMPMRYVIPNIITILAICAG
FT                   MSGIRLAFENRYESAIFMILLAAVLDGADGRIARLMDGSSSFGAHMDSLADVVNFGVTP
FT                   ALVVYSFILTQAHQVGWVAALVYCVACCLRLARFNVMLDNTDIPGWQKDYFVGVPAPAG
FT                   ALLLLLPVYLGALGLVPSWSWSLFFSLYTVVIAFLLVSRLPVWNAKTVGQKLRRDIVIP
FT                   CMLVMVIYVGFLATYTWYTLLITAVGYMIFLPYSAFCYSKRAALEEKEINITVDQDS"
FT   gene            complement(491013..491762)
FT                   /locus_tag="BARBAKC583_0485"
FT   CDS_pept        complement(491013..491762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0485"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45221"
FT                   /db_xref="GOA:A1US47"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1US47"
FT                   /protein_id="ABM45221.1"
FT                   /translation="MEKSDFNLSGRVALITGASRGIGYHLAIELAARGAHIIAIARTLN
FT                   SLTELEKKIQNIGSSATLVPLNLQNLEAIDDLSILIAERWKKLDIMVVNASILGTLSSI
FT                   SHVENVVFEEVIQVNLISSWRLMKTVEPLLRQSDAGRAILLSSSVAHSARASWGPYAAS
FT                   KAGLEIIARCWAEELKQTHIKVNCVNPGATRTKMRAQAFPDEDPQTLPSPQEVAKKIAH
FT                   LSLPDLKETGKLFDVRKNRFMNYCVPD"
FT   gene            complement(491765..493255)
FT                   /gene="cvpA1"
FT                   /locus_tag="BARBAKC583_0486"
FT   CDS_pept        complement(491765..493255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA1"
FT                   /locus_tag="BARBAKC583_0486"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44533"
FT                   /db_xref="GOA:A1US48"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A1US48"
FT                   /protein_id="ABM44533.1"
FT                   /translation="MTKINVSCQEFSLNDDTLHEECGVFGILGHEDAATLTALGLHALQ
FT                   HRGQEAAGIVSYHNQVFYQEKHLGLVGDHYTNPATLARLSGDRAIGHTRYSTTGETALR
FT                   NVQPLFAELNAGGIAIAHNGNLTNGLTLRHELISSGAICQSTSDSEVFLHLIARSRHES
FT                   SSDRFVDAIRQVEGGYAMLALTRTKLIAARDPVGIRPLVMGELDGKPIFCSETCALDII
FT                   GAKYIRDVKNGEIIICEIQKNGEITITVIEPEIEKPEKLCIFEYVYFARPDSIVGGRSV
FT                   YTVRKNMGIRLAQEAPCDADVVIPVPDGGTPAAIGYAQEIGIPFELGIIRNHYVGRTFI
FT                   EPTQQIRAFGVKLKHSANRSVIRGKRVILIDDSIVRGTTSVKIVQMLRDAGAKEVHMRI
FT                   SSPMIFYPDFYGIDTPKIENLLANQYPDLKSMCNFIGADSLEFLSIDGIYLAVTGKKRN
FT                   NSNPQFTDHYFTGDYPTHLTDQKNTEKVHKLSVLKTRN"
FT   gene            complement(493343..493906)
FT                   /gene="cvpA2"
FT                   /locus_tag="BARBAKC583_0487"
FT   CDS_pept        complement(493343..493906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA2"
FT                   /locus_tag="BARBAKC583_0487"
FT                   /product="CvpA protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44767"
FT                   /db_xref="GOA:A1US49"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A1US49"
FT                   /protein_id="ABM44767.1"
FT                   /translation="MAITILDGIVIIVILFSSFLAMLRGFSRELLSLISWIVATVITLF
FT                   LFKPALPFVEQYLSNKMIALIVTLVIIFVIVLSIISIVTMKIADLIIDSQIGMLDRTIG
FT                   FIFGALRGLLIVVISMMLVNTLIKPEQQANWLKNAKTKPILDSLGLEIWDVLPKNLSYA
FT                   LEKIETFFKKDDVITDIENSPLSN"
FT   gene            complement(494201..494668)
FT                   /gene="cvpA"
FT                   /locus_tag="BARBAKC583_0488"
FT   CDS_pept        complement(494201..494668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="BARBAKC583_0488"
FT                   /product="CvpA protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44678"
FT                   /db_xref="GOA:A1US50"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A1US50"
FT                   /protein_id="ABM44678.1"
FT                   /translation="MDMTILDGVAIVIILCSSLLAMLRGFSREVLSLTSWIVAAFITLF
FT                   LCKPILPFTNQYISHAMITLIALIALLIIIFIIVLSIISIITMKIANFIINSRIGIIDR
FT                   TVGFIFGAVRGALIILISMLLVDILLKLEQKSDMYILVKSTSQEQYAPLRI"
FT   gene            complement(494823..496196)
FT                   /gene="radA"
FT                   /locus_tag="BARBAKC583_0489"
FT   CDS_pept        complement(494823..496196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="BARBAKC583_0489"
FT                   /product="DNA repair protein RadA"
FT                   /note="identified by match to protein family HMM TIGR00416"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44726"
FT                   /db_xref="GOA:A1US51"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1US51"
FT                   /protein_id="ABM44726.1"
FT                   /translation="MARNRIKFICQNCGTIYSRWAGKCTSCGEWNSLIEEDMNSGIGSG
FT                   PMKNVRKGRVIALTSLSGDIKDAPRIHSGIAELDRVTGGGFVRGSALLVGGDPGIGKST
FT                   LLTQTAAALSQKGHHVIYVSGEEAVEQIRLRAQRLGAADTAVQLAAETNVEDILATLNE
FT                   HKKLDMVIIDSIQTLWSDATESAPGTVTQVRISAQEIIRFAKKTGAAVILVGHVTKDGQ
FT                   IAGPRVVEHMVDGVLYFEGEGSHHYRILRTVKNRFGPTNEIGVFEMSDKGLQEVTNPSE
FT                   LFLGERNEKAPGAAVFAGMEGTRPILVEIQALVAPSSLGTPRRTVVGWDGGRLSMILAV
FT                   LESHCGVRFGQHDVYLNVAGGYKISEPAADLAVAAALVSSLANIPLPAHYVYFGEISLS
FT                   GTIRTVSHSVQRIKEAEKLGFQGSIQPSATIEMKSPIFQQRTFSDLSELVAIIVANKK"
FT   gene            complement(496209..497711)
FT                   /gene="dnaB"
FT                   /locus_tag="BARBAKC583_0490"
FT   CDS_pept        complement(496209..497711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="BARBAKC583_0490"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45317"
FT                   /db_xref="GOA:A1US52"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A1US52"
FT                   /protein_id="ABM45317.1"
FT                   /translation="MEETSILNSSPSHKEKTSSFRQLPYNIEAEQALLGAILINNNAID
FT                   RVSDFLKPEHFFEILHQKIFDILSQIIKKGKLANPVTIKPFIPAEEKIGDITVFNYVIR
FT                   LAKEAITIINAEDYGRIIYDLFIRRSLINIGNQIVNTAFDAPVELTPAQQIEMVERNLF
FT                   QLAETGKYGGGFESFDDAIKKAIDMAGAAKKRSSKLSGIATHINKLDEQMGGLQPSDLI
FT                   ILAGRPGMGKTSLATNIAFNIANAYNRNAKIKDPSKENEGGIVGFFSLEMSSEQLATRI
FT                   ISEQTEVSSSEIRRGNISEEQFAKLLRTVNRLQKAPLYIDQTGGISITQLAARARRLKR
FT                   QHGLDVLIIDYIQLMTSNSKRSSENRVQEITEITTGLKALAKELNVPIIALSQLSRQVE
FT                   NRTDKRPQLSDLRESGSIEQDADIVLFVYREEYYLKNEEPKAGSPEHLKWQTDMDAVFE
FT                   KADIIVAKQRHGPTGTVRLAFQSEYTRFSDLADNDYLPEQFG"
FT   gene            complement(498165..498704)
FT                   /gene="rplI"
FT                   /locus_tag="BARBAKC583_0491"
FT   CDS_pept        complement(498165..498704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="BARBAKC583_0491"
FT                   /product="ribosomal protein L9"
FT                   /note="identified by match to protein family HMM PF01281;
FT                   match to protein family HMM PF03948; match to protein
FT                   family HMM TIGR00158"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44435"
FT                   /db_xref="GOA:A1US53"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US53"
FT                   /protein_id="ABM44435.1"
FT                   /translation="MDIILLERINRLGQIGDIVSVKDGYARNFLLPKGKALRANEANKK
FT                   FFETQRIKLEARNLECKNEAQKIAERLNGKSFIVVRSAGETGQLYGSVSTRDITDIITM
FT                   DGFSIERNQIELNHPIKTIGLHPVTLNLHPEVQISVTIHVARSANEAQLQEEAKILTSV
FT                   EATEIVQEQPLEENIG"
FT   gene            complement(498730..499710)
FT                   /locus_tag="BARBAKC583_0492"
FT   CDS_pept        complement(498730..499710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0492"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45299"
FT                   /db_xref="GOA:A1US54"
FT                   /db_xref="UniProtKB/TrEMBL:A1US54"
FT                   /protein_id="ABM45299.1"
FT                   /translation="MKNFRFYEITVGILAGLFAAIIGIVITSIANIAPYLSFFLGCFIS
FT                   LPIFVSAFSLGTLSSLAALISATAILVTTNSVYIGFSFMLLFFLPAVYASWLLGLAKPT
FT                   QEKNSLIWYPLSSVIFLLTNFIALISTFIGFYIQNHPNTPIIAQEIAENVVQAMRQSKS
FT                   IDENDILAFSDLITTHIATLTAIALVIYSLIFLIGNLYFSIIIAQRMQWLARPRDDWRQ
FT                   TFRLPISGLAIFIIICITSVIEFGSIFDLSIRVFTTAYTIIISISGLAYLHNITQGINS
FT                   RIIILSLVYIAILTVVFAPPIFFVILLMGIWATIQYNNQSLDRLY"
FT   gene            complement(499866..500114)
FT                   /gene="rpsR"
FT                   /locus_tag="BARBAKC583_0493"
FT   CDS_pept        complement(499866..500114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="BARBAKC583_0493"
FT                   /product="ribosomal protein S18"
FT                   /note="identified by match to protein family HMM PF01084;
FT                   match to protein family HMM TIGR00165"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45191"
FT                   /db_xref="GOA:A1US55"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US55"
FT                   /protein_id="ABM45191.1"
FT                   /translation="MSDINQNLARRPFNRRRKTCPFSGTNVAKIDYKDIKLLQRYISER
FT                   GKIVPSRITAVSQKKQRELANAIKRARFLGLLPYVVK"
FT   gene            complement(500114..500524)
FT                   /gene="rpsF"
FT                   /locus_tag="BARBAKC583_0494"
FT   CDS_pept        complement(500114..500524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="BARBAKC583_0494"
FT                   /product="ribosomal protein S6"
FT                   /note="identified by match to protein family HMM PF01250;
FT                   match to protein family HMM TIGR00166"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44636"
FT                   /db_xref="GOA:A1US56"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US56"
FT                   /protein_id="ABM44636.1"
FT                   /translation="MALYEHVFLARQDIAPQQVDELLKTYKNVIESHGGKVERTENWGL
FT                   RSLAYRIRKNRKAHYVLINIDAPAAAIAEMERQMRINEDILRYITIRVEKHEKEQSAML
FT                   SRPDRDDFPGKDEERPRPSRRQYEDVVEGGVE"
FT   gene            500881..501468
FT                   /locus_tag="BARBAKC583_0495"
FT   CDS_pept        500881..501468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0495"
FT                   /product="PAP2 superfamily protein"
FT                   /note="identified by match to protein family HMM PF01569"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45689"
FT                   /db_xref="GOA:A1US57"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A1US57"
FT                   /protein_id="ABM45689.1"
FT                   /translation="MDLFYQIDGALFEMLSGNHQTWSVLVWFGIICAKFLIYIIPLHIF
FT                   ILWFCGGYRERRVVLSICTSICFVFFLSYFISLMYFRPRPFVANLTQPLIHHKATASFP
FT                   SHHALVIGCYAACLYFSQYKIISKFALMFLFLICWGRVFTGVHYPFDVLVGAVLGSFVG
FT                   WSIIRFVSPYFPGFLYKIPPLKYNFSADIYSK"
FT   gene            501535..502479
FT                   /gene="fabD"
FT                   /locus_tag="BARBAKC583_0496"
FT   CDS_pept        501535..502479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="BARBAKC583_0496"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM PF00698;
FT                   match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44454"
FT                   /db_xref="GOA:A1US58"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A1US58"
FT                   /protein_id="ABM44454.1"
FT                   /translation="MVAAFTFPGQGSQVVGMGKMLTEQFVEARMVFEEVDDALGEKLSH
FT                   IIFEGPEDLLTLTANAQPALMAVSLAIIRVMEKLGLNIESKVKFVAGHSLGEYSALCAA
FT                   NTFSLADTARLLRIRGNAMQEAVAVGEGLMAALIGLNEQEVEEICKAVVKEGICQIAND
FT                   NGGGQIVISGEAKAVQAAVKIASEKGAKRAILLPVSAPFHSSLMQPAADAMKDALRIVN
FT                   LAAPVIPLIANVSVAPENDPERILTLLVHQVTGQVRWRETIEWFGAHGVDMLFEIGSGK
FT                   VLTGLARRINKDIKGLTIGTAEEIEEALKILGV"
FT   gene            502498..503235
FT                   /gene="fabG"
FT                   /locus_tag="BARBAKC583_0497"
FT   CDS_pept        502498..503235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="BARBAKC583_0497"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659; match to protein
FT                   family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44899"
FT                   /db_xref="GOA:A1US59"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1US59"
FT                   /protein_id="ABM44899.1"
FT                   /translation="MFELTNRRALVTGASGGIGEAIARIFHAQGAIVGLHGTREEKLKE
FT                   IAADLGDNIFVFPAHFSEREAIKKLAETAEEKMGGVDILVNNAGITRDGLFVRMQDKDW
FT                   DDVLAVNLTAAFTLTRELVHAMMRQRYGRIINITSIVGFVGNPGQTNYCAAKAGLIGFS
FT                   KSLAQEIASRNVTVNCIAPGFIKSAMTDKLNEKQKEAIMAAIPMKRMGMCEEIASAAVY
FT                   LASDEAAYVTGQTMHINGGMAMI"
FT   gene            503494..503730
FT                   /gene="acpP"
FT                   /locus_tag="BARBAKC583_0498"
FT   CDS_pept        503494..503730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="BARBAKC583_0498"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM TIGR00517"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45626"
FT                   /db_xref="GOA:A1US60"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US60"
FT                   /protein_id="ABM45626.1"
FT                   /translation="MSDTEERVKKIIVEHLGVDADKVVQNASFIDDLGADSLDTVELVM
FT                   AFEEEFGIEIPDDAAETIFTVNDAVKFIDKASS"
FT   gene            503840..505102
FT                   /gene="fabF"
FT                   /locus_tag="BARBAKC583_0499"
FT   CDS_pept        503840..505102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="BARBAKC583_0499"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 2"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45280"
FT                   /db_xref="GOA:A1US61"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1US61"
FT                   /protein_id="ABM45280.1"
FT                   /translation="MRRVVVTGLGLVSPLAGDVECSWRRLLEGKSGVRRITEFDVVDLP
FT                   CQIAARVPVGDGTNGTYNADLHMEPKQQRKVDPFIVYAVAAADQALADAEWCPKNDEDQ
FT                   IRTGVMIGSGIGGIEGIVEAGYTLRDKGPGRVSPFFIPGRLINLASGHVSIKYGLRGPN
FT                   HAVVTACSTGAHAIGDAARLIAFGDADVMVAGGAESPINRISIAGFAACKALSTGRNDD
FT                   PERASRPYDVDRDGFVMGEGSAVIVLEELEHAKKRGARIYAEIIGYGLSGDAYHITAPP
FT                   ESGEGAQRSMIAALKNARVNVCDIDYINAHGTSTMADVIELAAVERVLGHHASQVLMSS
FT                   TKSSIGHLLGAAGAAEAIFCILAIRDNIAPATLNLDNLSIETKIDLVPHKPRERKIDTI
FT                   LSNSFGFGGTNASLVMRRFTG"
FT   gene            505068..505199
FT                   /locus_tag="BARBAKC583_0500"
FT   CDS_pept        505068..505199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0500"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44664"
FT                   /db_xref="UniProtKB/TrEMBL:A1US62"
FT                   /protein_id="ABM44664.1"
FT                   /translation="MHHWSCDALQDEESTFVYHDCFFNFFLDDKASEQKSSVVFQGY"
FT   gene            505211..506320
FT                   /locus_tag="BARBAKC583_0501"
FT   CDS_pept        505211..506320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02618;
FT                   match to protein family HMM TIGR00247"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44672"
FT                   /db_xref="GOA:A1US63"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A1US63"
FT                   /protein_id="ABM44672.1"
FT                   /translation="MSDSKNEILSQDIDGSSPNHLLNNDDVLACKKQKKSHVVRNPFVI
FT                   FSHFLLMVIIFVILAVSVPIYIGKNIFEGKGPAEKEQVVFIHPGTGIREIASLLKKRNL
FT                   IRSSDIFVYGVSYYRQAKHLKAGEYLIPAYASMKGIMDIFVQGKSIEHVLTVPEGLTVQ
FT                   QVFDRLAAHEVLVGDLPETLPPEGSLMTDTVHFIRGTTRAEIIKRLIEGQKKLIQEIWD
FT                   SRSPDLPIKSIDEFVILASIVEKETGIATERPQIAAVFYNRLVKRMRLQSDPTVIYGIF
FT                   GGKGNPSGRPIYRSDLEKETPYNTYKIYGLPPTAIANPGKASLKAVANAPKSDALYFVA
FT                   DGSGGHVFSKTLDEHNINVRKWRALKKTR"
FT   gene            506402..507067
FT                   /locus_tag="BARBAKC583_0502"
FT   CDS_pept        506402..507067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0502"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="identified by match to protein family HMM PF00625"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44883"
FT                   /db_xref="GOA:A1US64"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1US64"
FT                   /protein_id="ABM44883.1"
FT                   /translation="MTLFNNELSSQKTGQRRGFLFILSSPSGAGKSTLSHLMLKDERLE
FT                   LSISVTTRPRRPSEIDALHYYFISKQEFEYKRDEGEFIEWAEVHGNYYGTLRKNVEDAL
FT                   STGQDMLFDIDYQGTEQLQKKMPGDTVSVFILPPTMKELVARLHRRAEDSQDIINLRLN
FT                   NARTEIQQWRSYDYVIINEDLDQSLLLVKSIYRAETMKRDRCCFLESFVNKLSVEKID"
FT   gene            complement(507118..507948)
FT                   /gene="ksgA"
FT                   /locus_tag="BARBAKC583_0503"
FT   CDS_pept        complement(507118..507948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="BARBAKC583_0503"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF00398;
FT                   match to protein family HMM TIGR00755"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45468"
FT                   /db_xref="GOA:A1US65"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US65"
FT                   /protein_id="ABM45468.1"
FT                   /translation="MPIDNLPPLREVINAYGLQANKSLGQNFLFDLNLTSKIARQAGNI
FT                   EGKPVIEIGPGPGGLTRALLAKGAIVTVIERDKRCLPALLEIEKHYPKKLNLIFDDALK
FT                   QDLSKLSETYPEKPRIIANLPYNIGTQLLLNWLLTTSWPPFYESMTLMFQREVAKRITA
FT                   TPQSPHYSRLSVLAGWRTIAKIAFDVPPQAFIPAPKVTSSVINIIPRPQPLACSVQKLS
FT                   LVTKVAFGEKRKMLRQSLKTIGGKELLEKAGIDETRRAETLLIPEFITLANLMT"
FT   gene            complement(507939..508949)
FT                   /gene="pdxA"
FT                   /locus_tag="BARBAKC583_0504"
FT   CDS_pept        complement(507939..508949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="BARBAKC583_0504"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="identified by match to protein family HMM PF04166;
FT                   match to protein family HMM TIGR00557"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45062"
FT                   /db_xref="GOA:A1US66"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:A1US66"
FT                   /protein_id="ABM45062.1"
FT                   /translation="MAPLIISGGDPAGIGPEIVIKAWSMRNIRDITPFVLVADPDVIRS
FT                   RARFFQLKIDVESVSIDNPVRNFQTALPVIPLKNQQSDQLGVPSPDNAAGTIEAIKHCV
FT                   QLIHSGHARAMVTCPIAKKNLYDIGFEFAGHTEFLAHLAQKHFGQPYHPIMMLSGPQLK
FT                   TVPITVHIPLNEVPLHLTSDLIIRTSLSVESALKTQFAITSPRLAIAGLNPHAGENGTI
FT                   GKEDIEIITPAIDYLKKQGLHIIGPLSSDTMFHKNARQTYDVALCMYHDQALIPIKTLD
FT                   FDTTVNITLGLPFIRTSPDHGTAFDIAHKGIASPESFIAALQTANQLANNHLICQ"
FT   gene            complement(508949..509926)
FT                   /locus_tag="BARBAKC583_0505"
FT   CDS_pept        complement(508949..509926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0505"
FT                   /product="SurA domain protein"
FT                   /note="identified by match to protein family HMM PF09312"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44820"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1US67"
FT                   /protein_id="ABM44820.1"
FT                   /translation="MRKFTAVKKNKNHFLTLFFTAFLGVSSLFINVLSISPVFAQQTKV
FT                   ALTVNGNAITNYDIQRRIAFLKLQQKKENLSVQAKNELIDEMLKKIEIKQRNIDVSDSE
FT                   VDAAFENFAVQNHMTINQLSEMLTQTNVTVKHFKDYIRGQIGWGRLVNARYQAEGGLLT
FT                   EQEVAHKILKNGGQKPSTDEYTLQRIIFVIPAHRRSEILQKRTQEANSFREHFNGCNNT
FT                   RAQVKGILDVTIRSSVKILEPQLPQDWKKFILETPAGKMTQVQETPNGIEAFAVCQIKR
FT                   VSDDRVAQLLFSIQHSQEDIPQELETLSEKYLKELQQAAHIKDS"
FT   gene            complement(510034..512409)
FT                   /locus_tag="BARBAKC583_0506"
FT   CDS_pept        complement(510034..512409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0506"
FT                   /product="organic solvent tolerance protein"
FT                   /note="identified by match to protein family HMM PF03968;
FT                   match to protein family HMM PF04453"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45510"
FT                   /db_xref="GOA:A1US68"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:A1US68"
FT                   /protein_id="ABM45510.1"
FT                   /translation="MSQKIILKKLSILALKSVISFILILSLALSCSVRAQNPAPFFHNN
FT                   TENSKNPLLLSADELIYNHDINTVSAQGNVQIEYDGNKVTAQSVTYNQKTGRIIAQGNV
FT                   EIIQKNGNKIYSNQIDMTEDFGEGFINSLRIETANNIHFAAANAQRSLPQITIFNNATY
FT                   TACQPCYDKPNRETLWKIKAKKIIWNNVIKTIRFEDAHFEIFGIPVIKFPVFELPDPAE
FT                   KRVSGLLTPHFFYANHLGFGIKNSYFWNLSPHYDFTLSGTFYTKQGLLTEGEWRQHFKT
FT                   GIYSIRFAHIYQTNPHNFENNTVDAQNTNRYMMATKGDFRINSRWTYGWDIFAQSDPHF
FT                   SRAYKIETYSNPVQTSQLYLNGLTGKNYFDTRFYHFQIQDSMFNNPFHENHSQQAWVLP
FT                   RIDYFLTPEEPVYAGELTFNSNMQSIYRSHAAGFNDTDWQNSPLNITQLSGIAGKSFRL
FT                   TGELEWKKRFNTQNGFIIIPTLALRADTIAINAHENYNAHTLNSSSTKFNVASSAAIRS
FT                   MATIGLELRYPFLITSEISTHILEPTVQVFIRNNEHHVGQFPNEDAQSFVFDSTTLFQR
FT                   DKFSGYDRVEGGTRANIGLRYSGNLSKNWSFYSLVGQSFHLAGKNSFAERDPINTGFYS
FT                   GIETARSDYVAMFGVNHDNGFSVESRGRFNKITGKIRRNEIEASQKWSNLWIATQYTYI
FT                   QNQPDYEYTQDRQEISFQTGVKLSNNWSINNNVSYDLVSRKFVKQGINLSYIDECFGIT
FT                   FGYQQITNPGEKAPLKNFNFSLSLRTIADFGQKIKLNL"
FT   gene            complement(512422..513513)
FT                   /locus_tag="BARBAKC583_0507"
FT   CDS_pept        complement(512422..513513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0507"
FT                   /product="putative permease, YjgP/YjgQ family"
FT                   /note="identified by match to protein family HMM PF03739"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44619"
FT                   /db_xref="GOA:A1US69"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:A1US69"
FT                   /protein_id="ABM44619.1"
FT                   /translation="MIRWILGRYFFIQYLRITCYFLLGAFILAFLIDFIENSSRLTSLP
FT                   HYTTKGALLISFLRIPLIMQQLFPFIALFSAITMLISLNRKFELVIARSIGVSAWQFLM
FT                   PACFGAFFLGLVAIFLFNPFAAWGYSQAEKIIAEWHSNNVQTSLNNHRIPWFTQHTDLG
FT                   TTTIGAKSITDEGLSLINAIFVQYNEDATIKNWIHAQKATLTNSAWFLTHGTIYKTGHI
FT                   PEKFAEFWIETNLKPEFLTEYLADPATTSFYKLPKKIAVARSFGYSANKFDMYLQSLIA
FT                   LPALLVAMTLIAATVSLKFTRLEQSGKLILSGVIAGFVLYVISVLVRAFGNAGYIPPII
FT                   AAWVPVIIALFLGISFLLHKEDG"
FT   gene            complement(513510..514700)
FT                   /locus_tag="BARBAKC583_0508"
FT   CDS_pept        complement(513510..514700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0508"
FT                   /product="putative permease, YjgP/YjgQ family"
FT                   /note="identified by match to protein family HMM PF03739"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45291"
FT                   /db_xref="GOA:A1US70"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:A1US70"
FT                   /protein_id="ABM45291.1"
FT                   /translation="MRILELYILKRIFILFSAVITATVCIIWTVQILARINFLTTSGQT
FT                   FLTALYFSSLLIPSVISLVIPFALMIAIITTLSRMNQDSELTIISASGIPKTTIWKPIL
FT                   FLAILASCASFFITNFVAPQARLHMREMLASAHSDLINLFIHEGSFQKLTNNLYIGIGE
FT                   RYPDGTIGRLFIADQRDPKIDLLYYATKGAIVSNKSGNILVLNNGEIKRLNHQNDSVSI
FT                   IKFSSYTFNLSEFIPNDRIPTIYPKDRPLSYLYRPDPDDPNYQRQPLQYKAEFHRRLTE
FT                   WLYPIVFALIAVAAAGDARSYRQARISTTFFAIIFSLLIYLVRYFFVEKTENNLAYIPL
FT                   LYITPLGTSILIFFRLLINRKMDFFAKFNDTIRTIFQKIIGIFGHRKSQYSSDKLL"
FT   gene            515077..515526
FT                   /gene="holC"
FT                   /locus_tag="BARBAKC583_0509"
FT   CDS_pept        515077..515526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="BARBAKC583_0509"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF04364"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45310"
FT                   /db_xref="GOA:A1US71"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:A1US71"
FT                   /protein_id="ABM45310.1"
FT                   /translation="MVDILFYHLTQSTPENVLPVLVERALNNFDRVTIQCINEERRDAM
FT                   DKHLWVYADGAFIGHGTECDEYPDLQPVFLTTGNENPNNSTIRFLIEGAVCSDIHSYQR
FT                   LVVMFDSRDETQLNTARAQWKNYKAQNHNVTYWQQTEDRSWKKKA"
FT   gene            515526..515705
FT                   /locus_tag="BARBAKC583_0510"
FT   CDS_pept        515526..515705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0510"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45401"
FT                   /db_xref="GOA:A1US72"
FT                   /db_xref="UniProtKB/TrEMBL:A1US72"
FT                   /protein_id="ABM45401.1"
FT                   /translation="MHITSFILIFIGIIGMMKPELFIMEGSGGGRWVFIVIFLLGATKI
FT                   WPITKMFERNNNSD"
FT   gene            515698..515961
FT                   /locus_tag="BARBAKC583_0511"
FT   CDS_pept        515698..515961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0511"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44547"
FT                   /db_xref="GOA:A1US73"
FT                   /db_xref="UniProtKB/TrEMBL:A1US73"
FT                   /protein_id="ABM44547.1"
FT                   /translation="MIDQIFLSIWAVALAFFCVSWLGTTHILSRIFSVTYIGMVVDILF
FT                   FFLCVFFAWLLWWSVPQPISLKMKLAVSLPPTLILLFFIISN"
FT   gene            516533..518980
FT                   /locus_tag="BARBAKC583_0512"
FT   CDS_pept        516533..518980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0512"
FT                   /product="putative adhesin/invasin"
FT                   /note="identified by similarity to GB:AAD41751.1; match to
FT                   protein family HMM PF03212; match to protein family HMM
FT                   PF03797; match to protein family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45243"
FT                   /db_xref="GOA:A1US74"
FT                   /db_xref="InterPro:IPR003991"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A1US74"
FT                   /protein_id="ABM45243.1"
FT                   /translation="MQYKWKLSYWVLMVSSCLVQPTSASDWCDVVPPESDVRYRQYDCK
FT                   VKKTGELIHVQETEEGMIIIKPYDKLTYFGGYYGVDNALIIIDDGKILKDSILAGGNVA
FT                   NISHEESDIPNNEKNSPGKSVNVIVKDEGKLYVNKGGMSKNTVIDRGGSELVEATGGLQ
FT                   GVSKNATVKKDGWQIIDQGGKSEGAQIYGGKQVILGEGLVGDKDTSSSAYDTVIYSDGE
FT                   TLGEQKVYDGGIAQNTKIMNGGVQEVAKVGPKEIKGGFVQNTEVFGGGKQYVSAGGSAE
FT                   SVTLNETAMQAIYSGGFVKDLTINNEASSWVYGGATLAGRVEINHNGSIYLYAGNDEHH
FT                   TKVENVILNGRNATLFSVGTKEDNDFTQIENLSGTGIVQFILSGDNDKHYSQLHVKNLL
FT                   GNLNFMFNTTIATSRGDYLVVENGQGKHTVSVFDSGVEITQPQSQTHDLITDKSGGADF
FT                   TLVNLSGAKINAVDGGTYVYGLQKREHENAKIWYLAAKFKPEPEPSPQPSPDPLTTPST
FT                   DALLSIGVTPQLIFHTELQTLRADRGILDRTKKNTALWSYVLRGKERLATGHTHFDLDQ
FT                   TGVVLGTDVLRELTSGDLFIGGFGSYDHAHIAHARKGVSNVDVYGAGIYATYFDQEGWY
FT                   VDSILKYNYYQNNLRAFSTNSEKIEGDYQQSAFGTSFEAGYRFQIEHNSWVQPYGQLTW
FT                   LQVENKNIRLSNGMIGDIGSATSLQSALGLFIGRDFTIKENTQVTTYIAASWLREYIDN
FT                   NYVTINKQNKFITDLSGNTGKFGLGLKGSVSDNLTLYAEANYLKGSKRKQSVSGLLGVR
FT                   YNF"
FT   gene            519417..521819
FT                   /locus_tag="BARBAKC583_0513"
FT   CDS_pept        519417..521819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0513"
FT                   /product="putative adhesin/invasin"
FT                   /note="identified by similarity to GB:AAD41751.1; match to
FT                   protein family HMM PF03212; match to protein family HMM
FT                   PF03797; match to protein family HMM TIGR01414"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45020"
FT                   /db_xref="GOA:A1US75"
FT                   /db_xref="InterPro:IPR004899"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="InterPro:IPR030930"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A1US75"
FT                   /protein_id="ABM45020.1"
FT                   /translation="MKNEYRLVFWSLVVSSFLTQNANAEEKKQGGRVFFNGYEVPIRKG
FT                   NNLEKVLPKHLGASLMQGTVIGNGQIEVVKDGGTSMSATVKEGGIQVVTSRGYAHNTKI
FT                   ESGKQFVFEREGFGSSERRPQVVRPKGENSRSGRPPRDISAVVIGERKASAYDATVSGE
FT                   NGKWGEQNVYGGGEAWNTQVKKGGMQSVFNSGFASGTQVFDGGEQRVLAKGKVGSVTLH
FT                   NGAKQVVYTGGELSDLLTIGNGARSWVEIGAKLGGKIDVKSGGHLYVYGSDNKARIIGE
FT                   RFKLDQEGAMELFSVNVQRGTGASSIHITDLSGHGKIHLPTSDYSGRYPQLNVDNLSGD
FT                   LHFIINLGGGYYGNSFIRIKENSSGNHKVSIVDTGVEYANSSTLTSKLNLISDAVGGAQ
FT                   FALANLSGNGIENVDLGAYKYKLGYDEKSQETDDEKDKRTWYLALDTENSKNFTSLRKS
FT                   RKRRVIDLDYEDDGSGYGGYTANEISLPSSLESMQTANFSTTPSTDAILSMAVASELIF
FT                   YNELDALRTGRGIIDRTKKNTALWTALFKDKERLSTGHTHFDLGQTGIVLGADLLKELI
FT                   SGNLFIGGFSSYDQARITHKAGGVSGVNTYSLGIYATYFDHNGWYLDGIVKYNSYQSDL
FT                   KAVSTNGLAIQGNYRQSALGTSFETGYRFETGYNSWVQPYSQFSWVRVAGKEIELSNGM
FT                   RGDIDASTSFRTEVGVLLGRDFNVGDSAFVSYLTASWRREYIDDNHTTINKKYKFITDL
FT                   SGNTGKFGLGLKGSVSDNLTLYAEVNYLKGSKRKGSVNSLIGLRYSF"
FT   gene            522543..522965
FT                   /gene="ndk"
FT                   /locus_tag="BARBAKC583_0514"
FT   CDS_pept        522543..522965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="BARBAKC583_0514"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by similarity to SP:Q59636; match to
FT                   protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45114"
FT                   /db_xref="GOA:A1US76"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US76"
FT                   /protein_id="ABM45114.1"
FT                   /translation="MAIERTFSMIKPDATRRNLTGAITKMLEDTGLRVIASKRVWMSRR
FT                   EAEGFYAVHRERPFFEELVEFMSSGPTVVQVLEGENAIMKNREVMGATNPADAEMGTIR
FT                   KVHALSIGENSVHGSDSPETAKTEIAYWFSDTEIVG"
FT   gene            complement(523436..524020)
FT                   /gene="pgsA"
FT                   /locus_tag="BARBAKC583_0515"
FT   CDS_pept        complement(523436..524020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="BARBAKC583_0515"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /EC_number="2.7.8.5"
FT                   /note="identified by match to protein family HMM PF01066;
FT                   match to protein family HMM TIGR00560"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45614"
FT                   /db_xref="GOA:A1US77"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:A1US77"
FT                   /protein_id="ABM45614.1"
FT                   /translation="MKKDHTFSFPNILTYARIVAVPLVVACFFLEGQLQSSDIARWTAV
FT                   SIFIIASITDFLDGYLARIWEQTSNIGRMLDPIADKLLVSACLLLLAADSTIAGWTLWA
FT                   AIIILCREILVSGLREYLAELKVSVPVSRLAKWKTFVQMIAIILLLAGPAGNKIIPYTI
FT                   EFGIAMLWISALLTLWTGWDYFRAGLKHVIT"
FT   gene            complement(524104..526080)
FT                   /gene="uvrC"
FT                   /locus_tag="BARBAKC583_0516"
FT   CDS_pept        complement(524104..526080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="BARBAKC583_0516"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF01541; match to protein
FT                   family HMM PF02151; match to protein family HMM PF08459;
FT                   match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45033"
FT                   /db_xref="GOA:A1US78"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:A1US78"
FT                   /protein_id="ABM45033.1"
FT                   /translation="MTRKSNTPSCPNEEKNLPFLSDIIWDSANRNNESNNGPKGSALIQ
FT                   EFVKHLPHKPGVYRMFNEYGDVLYVGKARNLKKRVSNYTHEHGHNNRIIRMIRATSHME
FT                   FVVTHTEIEALLLEANLIKRLQPRFNILLRDDKSFPYIIITDDHRIPALYKHRGARTRK
FT                   AHYFGPFASASAVTQTINVLQRAFLLRTCTDSVLENRTRPCLLYQIKRCSAPCTNEINN
FT                   SDYIKLVKEARAFLSGKSQSIKQDMVQAMHKAAENLDFERAANYRDRLSALSHVQSHQG
FT                   INPRTIEEADVFAIAQQGGITCIQVFFFRMGQNWGNQAYFPKADPSFSSAEILASFIAQ
FT                   FYDNKPIPKLILLSEEIEEAVLLTEALSLKAHCKISLSLPRNGERKTLINHAYTNAHEA
FT                   LGRKLSETSTYTKLFQNLAEIFQLPRTPNRLEVYDNSHIMGTNAVGIMIVANQTGFIKN
FT                   QYRKFNIRSTDITPGDDLGMMKEVIERRFSRLIKTYGLPTQNKDIEDENSFPMWPDLIL
FT                   IDGGEGQTNIVRTILSKLGVDDLVTVVGIAKGTDREAGRERFFIQGKPSFTLSPRDPIL
FT                   YFLQRLRDEAHRFAIGTHRTKRKKETFKNPLDEINNIGPTRKRALLNYFGSTKAIANAS
FT                   VEDLTKVSGISITIAQNIHNHFN"
FT   gene            complement(526474..527340)
FT                   /locus_tag="BARBAKC583_0517"
FT   CDS_pept        complement(526474..527340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0517"
FT                   /product="yhiR family protein"
FT                   /note="identified by similarity to SP:P37634; match to
FT                   protein family HMM PF04378"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44668"
FT                   /db_xref="GOA:A1US79"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1US79"
FT                   /protein_id="ABM44668.1"
FT                   /translation="MNYRHIYHAGNFADVFKHVIVTRIVEYLKRKEKAFRVIDTHAGIG
FT                   LYDLSSLEAQKTGEWREGIGRILSNPIPEDLQTLLDPWLDVIYAFNQENNREITFYPGS
FT                   PILIRKLLRKQDRLTAIELHDEDYQTLANNFSGDYQTKVLHLNGWLSLNAHLPPKEKRG
FT                   FILVDPPFENPGEFSRLIEGLVKAYRRFPGGIYALWYPVKYDKDIENFLHALHKTDIPK
FT                   ILQLEMRIRENSILPTMNGSGLILINPPYLLEEEMRKISPFLITCLRQDKSAHITYQWI
FT                   NDEGLVA"
FT   gene            complement(527435..527557)
FT                   /locus_tag="BARBAKC583_0518"
FT   CDS_pept        complement(527435..527557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44880"
FT                   /db_xref="UniProtKB/TrEMBL:A1US80"
FT                   /protein_id="ABM44880.1"
FT                   /translation="MVLLSKIRTQPFESFVHENFIDVKNNTIISTDNLKKHSFL"
FT   gene            528351..529628
FT                   /gene="serS"
FT                   /locus_tag="BARBAKC583_0519"
FT   CDS_pept        528351..529628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="BARBAKC583_0519"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44691"
FT                   /db_xref="GOA:A1US81"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US81"
FT                   /protein_id="ABM44691.1"
FT                   /translation="MLDIKWIRENPEKLDEALASRGIEPHAERLIALDLERRSHVVEVQ
FT                   CAQERRNSASKEIRQALAAGDQKTVERIKAEVEEIKTFLSSAAIKEKRLTESLEKILSA
FT                   IPNIPLDSVPKGENEEANIVIRHFGTPPTFNFIPKEHFDLGQNLKQMNFERASRLSGAR
FT                   FTVLSGALARLERALGQFMLDVHVNEHGYEEISLPLLVRDEIVYGAAQLPKFSDDLFRT
FT                   TDGRWLISTAEVPLVNLVNGEVLHESDLPLRFSSLTPCFRSEAGAAGRDTRGMLRQHQF
FT                   WKVEMVSITTEEQSLIELERMTECAEDVLKRLELPFRTVVLSTGDMGFASCKTYDIEVW
FT                   LPGQGCYREISSCSVCGDFQGRRMNARYRKDGDKTLHFVHSLNGSGTAIGRCLIAILEN
FT                   YQQADGSIIIPGALQPYMKGISRITA"
FT   gene            529763..530422
FT                   /locus_tag="BARBAKC583_0520"
FT   CDS_pept        529763..530422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0520"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01135"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45392"
FT                   /db_xref="GOA:A1US82"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1US82"
FT                   /protein_id="ABM45392.1"
FT                   /translation="MEQKDILQFREKLASLVLKMRSKGIDDVNFFAAFEKIPRQYFVSS
FT                   PWLNSAYDNKVIPIECGEYIERLEEQLLILFALSLRKKHRVLEIGTGSGFCSALIAYLS
FT                   DRVVTVDRYKTLVDLARQKFQTLGIENIVVHQIDGSRGVTGFGLFDRILIWPSRSDEPE
FT                   EFLELLTGNGILIQAIGPDEGVQMVTRYIKNGSRFKRLEMFQARYQPFIKNVAAVL"
FT   gene            530587..531780
FT                   /locus_tag="BARBAKC583_0521"
FT   CDS_pept        530587..531780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0521"
FT                   /product="LysM/M23 peptidase domain protein"
FT                   /note="identified by match to protein family HMM PF01476;
FT                   match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45262"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A1US83"
FT                   /protein_id="ABM45262.1"
FT                   /translation="MYLKTLNDIFRYNFQKIALLAIATIITGCSSGTQRFFDGFYEGEA
FT                   STQLTENTAMSADRRIISQSSVIQSDELPPVEPLHSSGDHNHASYNFSRQEAGSSFREN
FT                   RVSPDGRIMGSPPQNLGTLSRSNVNNPSIFQKGSYIVQSGDTLFSIAQQKGISVESLKV
FT                   ANGMGDNAIYIGQKLVIPDKQTVVTSNAQNNAVGSSTTTSSTQSKGMSFVKKEEISAAS
FT                   RSVNTAPAAIINTPDVKKNVSKQMTTSKSASNSSKTVKDSDNITVPQATGVSKMRWPVR
FT                   GRLLSHFGQKKGTITNRGIDINVPEGSSVKAAENGVVIYASDGLKELGNVVMIRHEDNI
FT                   ITIYGHNSKLTVSRGQRVKRGDEIAKSGVSGDATTPRVYFEIRQNSVPVNPAQYLEN"
FT   gene            532091..532258
FT                   /locus_tag="BARBAKC583_0522"
FT   CDS_pept        532091..532258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0522"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44446"
FT                   /db_xref="UniProtKB/TrEMBL:A1US84"
FT                   /protein_id="ABM44446.1"
FT                   /translation="MQFLRIVDAMIEIDGNTINAVNGFGYNFLRFLNRMISLITKVEFH
FT                   LNKMAYMNNY"
FT   gene            532537..533001
FT                   /gene="yajC"
FT                   /locus_tag="BARBAKC583_0523"
FT   CDS_pept        532537..533001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="BARBAKC583_0523"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="identified by match to protein family HMM PF02699;
FT                   match to protein family HMM TIGR00739"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44715"
FT                   /db_xref="GOA:A1US85"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:A1US85"
FT                   /protein_id="ABM44715.1"
FT                   /translation="MLITNAQAQAQAAGGAAGGTSFVTFIPFILIFVIMYFLIIRPQRV
FT                   QMKKRQEMLNAVRRGDVIVTGGGIIGKVIKVHDEIGELEVEIGEDMHIRILRSTLADVR
FT                   VKGEPVSEEKATPSAKVKTPKKSGNKTTTKDSVAVAKKAKSPSEEEKPKA"
FT   gene            complement(533009..533182)
FT                   /locus_tag="BARBAKC583_0524"
FT   CDS_pept        complement(533009..533182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0524"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45014"
FT                   /db_xref="UniProtKB/TrEMBL:A1US86"
FT                   /protein_id="ABM45014.1"
FT                   /translation="MPIKNEKFTLSLFLQKKQLQLCTTLNIMAKTAHISETPMNKTLFT
FT                   DLKHLCFFTEML"
FT   gene            533391..533777
FT                   /locus_tag="BARBAKC583_0525"
FT   CDS_pept        533391..533777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to PDB:2FVT_A; match to
FT                   protein family HMM PF04430"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44525"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:A1US87"
FT                   /protein_id="ABM44525.1"
FT                   /translation="MSHAIQVREAHFPGRAPIDAYGNGGFRFADMSHQGSIICVPSGVY
FT                   GIDMVGPMPSRDDISRILQEADEIEIFLIGTGIELLRLPEELRVVLWEKRISTDTMSTG
FT                   AAVRTFNVLLSENRAVAALLFAVE"
FT   gene            533774..534634
FT                   /locus_tag="BARBAKC583_0526"
FT   CDS_pept        533774..534634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0526"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45597"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A1US88"
FT                   /protein_id="ABM45597.1"
FT                   /translation="MTHFLPHCLSVLRATDRDRYISVLFAPKRKRRALAALYAFNAEIA
FT                   RIRESVSDPLIGEMRLRWWYDSIANSTVPNGENNPILNELLETIILFNLPKEAFLQYCD
FT                   ARIFDLYNNSIITIHDLESYCYKTASKILQLACQILDFDSAKNFTDACEHGGVSQALSG
FT                   ILRLLSLMQSRYQCYFPSDMLRALGIDREDLESNRITDKQKCQMIEAMVALSRDHYLKF
FT                   YEYSIILPETLKPAFLPLAITPVSLQKALKLEAEVFQNSINSSLLHRYWLITKTAICGN
FT                   FPKLS"
FT   gene            complement(534886..536775)
FT                   /locus_tag="BARBAKC583_0527"
FT   CDS_pept        complement(534886..536775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_033401.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44807"
FT                   /db_xref="GOA:A1US89"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:A1US89"
FT                   /protein_id="ABM44807.1"
FT                   /translation="MLDSIRNTTNSWVTKIFFAILLLCFVFLWGIPQLNIKNESNLLTS
FT                   GKSVITVDDYRLALADYSLRLALASQLGRMLSPDEIQQYGIPAFVFYQLQQDILFDEQA
FT                   RKMKISLSQDALAHIISSDSIFQTNGNFNRNLFLNYLQQLNISQSHFLDYYTQREKRNQ
FT                   LILASLSGAKIPNLFYEAFALHREEKRTADYLVVNLEKEKKISTPNKETLQKWFDTHRN
FT                   MFRAPEYRTVSLLSITPNDFVKLENISANEAMTYYNQNASRFTVPEKRIIEELRFPTRE
FT                   AADKAAQKIANGMSFDQLVQSEKKTLKDIKKGPLAESELPNYLASDIFELKQGQISAVI
FT                   NDLQGPIIVRVMQIIPSGPIPFEDIEQDIRQTLAQNRAVTDLRSKYTEIENARFEGASL
FT                   KELADQYNLSLRQITIDKEGKTIEGVMLTDLPQKEIVLSAIYQATEGSELDPLSLQEGG
FT                   YLWYQVDAITPARDKALEEVEKEAVAEWKNAKIQQLLDEKANNILKQLTEGKSLDSLAA
FT                   KLSVKKKTTPALRRQDSSDILGIEGVKALFSGPKGHYGIIKGAVATNRIIYKITESSIP
FT                   KNVTAQTIPSDIREDMDMTLKEDLKLGMLQIANEEHPIEINGSNYNQLFSTSQ"
FT   gene            536964..537728
FT                   /gene="tpiA"
FT                   /locus_tag="BARBAKC583_0528"
FT   CDS_pept        536964..537728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="BARBAKC583_0528"
FT                   /product="triosephosphate isomerase"
FT                   /EC_number="5.3.1.1"
FT                   /note="identified by match to protein family HMM PF00121;
FT                   match to protein family HMM TIGR00419"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44445"
FT                   /db_xref="GOA:A1US90"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US90"
FT                   /protein_id="ABM44445.1"
FT                   /translation="MTSSIRPLLAGNWKMNGTSESLRELRAIASGIDSDRDRCFEALVC
FT                   VPATLLSRASDILSDENIFLGGQDCHFNDSGPHTGDISACMLKEAGASHVILGHSERRT
FT                   DYRESDAIVCAKVKAAWRAGLVALICIGETLEERENNTVLDVLAQQLKGSVPAGAMDHN
FT                   TVIAYEPRWAIGTGKTPTSEDIAQVHGFIRKEVSHRFGDEGHKIRLLYGGSVKPSNASE
FT                   LLETSHVNGALIGGASLKATDFLTICNIYRKL"
FT   gene            537827..538276
FT                   /gene="secG"
FT                   /locus_tag="BARBAKC583_0529"
FT   CDS_pept        537827..538276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="BARBAKC583_0529"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by match to protein family HMM PF03840;
FT                   match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45013"
FT                   /db_xref="GOA:A1US91"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A1US91"
FT                   /protein_id="ABM45013.1"
FT                   /translation="MQTVLIVIHFLIVIVLVGVVLIQPSEGGGLGVGGGSGFMSTRGTR
FT                   NTLTRLTAILAICFFVTSIALIVVGSISNSNLDILNRIPVNSEQNSINKNASEGVPSPG
FT                   NGTQPSILEQLGGASTSSQEQKGSAGSATDNPVPPPVKSLNSDSE"
FT   gene            538394..540022
FT                   /gene="pyrG"
FT                   /locus_tag="BARBAKC583_0530"
FT   CDS_pept        538394..540022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="BARBAKC583_0530"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44882"
FT                   /db_xref="GOA:A1US92"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US92"
FT                   /protein_id="ABM44882.1"
FT                   /translation="MARYVFITGGVVSSLGKGIAAAALAALLQARGYRVRIRKLDPYLN
FT                   VDPGTMSPYQHGEVFVTDDGSETDLDLGHYERFTGRSANRHDNITTGRIYRNIIERERR
FT                   GDYLGATVQVIPHVTDEIKNFITTGNEESDFVLCEIGGTVGDIEAMPFLEAIRQLHNEL
FT                   PRQSVVYMHLTLMPYISSAGELKTKPTQHSVKELQSVGIAPDILLVRADRPIPESERCK
FT                   LSLFCNVRPSAVIQALDVSTIYDVPIAYHKEGLDSEILSAFGIDSAPEPKMDRWEDIAY
FT                   RIHHPEGEVTIAIVGKYTGLKDAYKSLIEAVAHGGLANKVKVNIEWIEAEIFEKEDPAL
FT                   FLQKVHGILVPGAFGVRGSEGKIRAIQFARNHKIPFLGICFGMQLACIEAVRNLAGIEN
FT                   ASSSEFCETKDSVVGLMTEWLKGDVFEKRTASGNLGGTMRLGAFIAQLKKDSHISKIYG
FT                   TTSICERHRHRYEVNIHYKDILERFGFVFSGMSPDGVLPEAIEYNNHPWFIGVQYHPEL
FT                   KSRPFDPHPLFSSFIAATVEQSRLF"
FT   gene            540059..540907
FT                   /gene="kdsA"
FT                   /locus_tag="BARBAKC583_0531"
FT   CDS_pept        540059..540907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="BARBAKC583_0531"
FT                   /product="3-deoxy-8-phosphooctulonate synthase"
FT                   /EC_number="2.5.1.55"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR01362"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45460"
FT                   /db_xref="GOA:A1US93"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US93"
FT                   /protein_id="ABM45460.1"
FT                   /translation="MSQPNVSVKVGNVVFSNKAPLSLIVGPCQIESRDHAFEMAGRIKA
FT                   IADQAGIGFVYKSSYDKANRTSLSAARGIGLEKAIAIFADLKKEFGFPILTDVHTEEQC
FT                   RAVSSVVDVLQIPAFLCRQTDLLVAAAKTGCVINIKKGQFLAPWDMENVLKKVTQSGNP
FT                   DVMLCERGTSFGYNRLVSDMRSLPIMSSFGAPVIFDATHSVQEPGGKGDSSGGQRQFVE
FT                   ILARAAVAVGVAGIFLETHQDPDNAPSDGANMIEIDNLQRLIEILMNFDRLTKNELNIH
FT                   A"
FT   gene            540998..542269
FT                   /gene="eno"
FT                   /locus_tag="BARBAKC583_0532"
FT   CDS_pept        540998..542269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="BARBAKC583_0532"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44895"
FT                   /db_xref="GOA:A1US94"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1US94"
FT                   /protein_id="ABM44895.1"
FT                   /translation="MTRIVDIVGREVLDSRGNPTVEVDVYLENGVFGRSAVPSGASTGA
FT                   HEAVELRDGGKRYQGKGVEKAVAAINGEIFKELGGRDARNQLAIDQAMIALDGTSNKER
FT                   LGANAILGVSLSVAKAAAKSFGLPLYRYIGGTQAHLLPTPMMNIINGGAHADNPIDFQE
FT                   FMIIPVGAPTFKEAVRYGAEIFHTLKRYLQDAGYNTNVGDEGGFAPNLKSAEQAINLIM
FT                   ESITSCGYKPGEQIAIGLDCASTEFYKNSLYAYEGEGKCRDVKEQVEYLAHLVDSYPII
FT                   TIEDGMAEDDWAGWKQLTQAIGNKCQLVGDDLFVTNSARLRDGIKMGAANSILIKVNQI
FT                   GTLSETLDAIETAHKAGYRAIISHRSGETEDSFIADLTVATNCGQIKTGSLARSDRLAK
FT                   YNQLIRIEEMLGTQARYEGNWHRR"
FT   gene            542600..542929
FT                   /locus_tag="BARBAKC583_0533"
FT   CDS_pept        542600..542929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0533"
FT                   /product="septum formation initiator family protein"
FT                   /note="identified by match to protein family HMM PF04977"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45591"
FT                   /db_xref="GOA:A1US95"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:A1US95"
FT                   /protein_id="ABM45591.1"
FT                   /translation="MWTKQKRRSIKTHFILPVMTVWVVSYFSYHIYHGEYGLRARGEIN
FT                   QHIFELKEELHQIEVERTSIENRISLLREGHIEKDMLDEYVRENLNFSRPNELTILVSP
FT                   KESKN"
FT   gene            543060..544112
FT                   /gene="pdhA"
FT                   /locus_tag="BARBAKC583_0534"
FT   CDS_pept        543060..544112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /locus_tag="BARBAKC583_0534"
FT                   /product="pyruvate dehydrogenase E1 component, alpha
FT                   subunit"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM TIGR03182"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44991"
FT                   /db_xref="GOA:A1US96"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A1US96"
FT                   /protein_id="ABM44991.1"
FT                   /translation="MAERIKKNSASVENAALLNTAKTVCRTAQIAHFTKEEEINAYREM
FT                   LLIRRFEEKAGQLYGMGLIGGFCHLYIGQEAVVTGTLKAAKEGDQIITSYRDHGHMLAA
FT                   GMSPRGVMAELTGRRGGFSKGKGGSMHMFSKEKDFYGGHGIVGAQVSLGTGLAFSNQYL
FT                   KKDNVALVYFGDGAANQGQVYESFNMASLWKLPVVYVIENNQYAMGTSVVRSAAGADFS
FT                   RRGLSFEIPGIAVDGMDVCAVKGAADEAISWARSGKGPIILDIQTYRYRGHSMSDPAKY
FT                   RSKDEVEKVKTEHDPIEQVKNRIIKQGWASEDDLKSIDKEVRAVVADAADFAQNDQEPD
FT                   AFELYTDILV"
FT   gene            544129..545493
FT                   /gene="pdhB"
FT                   /locus_tag="BARBAKC583_0535"
FT   CDS_pept        544129..545493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhB"
FT                   /locus_tag="BARBAKC583_0535"
FT                   /product="pyruvate dehydrogenase E1 component subunit beta"
FT                   /EC_number="1.2.4.1"
FT                   /note="identified by similarity to SP:O66113; match to
FT                   protein family HMM PF00364; match to protein family HMM
FT                   PF02779; match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45214"
FT                   /db_xref="GOA:A1US97"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1US97"
FT                   /protein_id="ABM45214.1"
FT                   /translation="MSIDILMPALSPTMEEGKLSKWLKKEGDQVNSGDAIAEIETDKAI
FT                   MEVEAVDEGVLGKILISEGTEGVKVNTPIAVLLEEGETAENISQVVTSFKKPQKDFSSL
FT                   SSLVPASPVLDIANDPDIPVGTEMVMMTVREALNQAMAEEMRRDDLVFLMGEEVAEYQG
FT                   AYKVSQGLLEEFGGRRVIDTPITEHGFAGLGVGAAFAGLRPIIEFMTFNFAMQAIDQII
FT                   NSAAKTRYMSGGQMSVPIVFRGPNGAAARVGAQHSQCYAAWYSHVPGLKVVMPYSAADA
FT                   KGLLKAAIRDDNPVIFLENEIIYGHQFEVPKIDDFVLPIGKARIHKSGKDVTIVACGIG
FT                   MHYAIQALPEIEKLGIDVELIDLRTVRPMDLPTILTSVKKTGRLVTIEEGYPQSSVGTE
FT                   IATRVMQQAFDYLDAPVATIAGKDVPMPYAANLEKLALPNIAEIVEAVKAVTYKT"
FT   gene            545508..546833
FT                   /gene="pdhC"
FT                   /locus_tag="BARBAKC583_0536"
FT   CDS_pept        545508..546833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /locus_tag="BARBAKC583_0536"
FT                   /product="pyruvate dehydrogenase complex dihydrolipoamide
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.12"
FT                   /note="identified by similarity to SP:Q9R9N3; match to
FT                   protein family HMM PF00198; match to protein family HMM
FT                   PF00364; match to protein family HMM PF02817; match to
FT                   protein family HMM TIGR01349"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44495"
FT                   /db_xref="GOA:A1US98"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006257"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A1US98"
FT                   /protein_id="ABM44495.1"
FT                   /translation="MPIKITMPALSPTMEEGNLSKWNIKEGDKVSSGDVIAEIETDKAT
FT                   MEVEAIDEGTVAKIVVPAGTQGVKVNALIVILAEEGEDLAEAVKAAEEDVALSGKKSKV
FT                   TKQVEAKEELVADASLAQQFIQRDGDNTRLFASPLARRLAAESGFDLSVISGTGPHGRI
FT                   IKRDVEKALSGGALRDSRSSSVNRPIVTGASDEQVMKLFKESEYTFASHNSMRKTIAKR
FT                   LVESKSTIPHFYVTVDCELDALLKLRAELNAIAPMVTTQENMNPAYKLSVNDMVIKAVA
FT                   LSLRALPDANVSWLEGGMLYHKHCDVGVAVSIPNGLITPIIRHAEEKSLPVISNEMKDF
FT                   ATRARANKLKPEEYQGGTTAISNMGMYGVKDFSAIINPPHATIFAIGAGEQRAVVKNGA
FT                   LAIATVMSVTLSVDHRAVDGALAAELVQTFKKLIENPLSILV"
FT   gene            547049..548509
FT                   /gene="lpdA2"
FT                   /locus_tag="BARBAKC583_0537"
FT   CDS_pept        547049..548509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA2"
FT                   /locus_tag="BARBAKC583_0537"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by similarity to SP:P50970; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF00890; match to protein family HMM PF02852; match to
FT                   protein family HMM PF07992; match to protein family HMM
FT                   TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45219"
FT                   /db_xref="GOA:A1US99"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1US99"
FT                   /protein_id="ABM45219.1"
FT                   /translation="MANLYDVIVVGSGPGGYVTAIRAAQCGFKTAIVEREHLGGICLNW
FT                   GCIPAKALLRSAEIKHFAEHAKDYGLKLNGSIEANVKDVVTRSRRVSARLNAGVGFLMK
FT                   KNKVDIIWGEAKLTKGVKGNQLAEILVSPLSKKIMQPQNPVPKGTLGEGVYQAKHVIIA
FT                   TGARPRAIPGIEPDGKLIWTYFEAMIPQAIPKKLLVMGSGAIGIEFASFYHDMGAEVTV
FT                   VEMMPNIMPVEDIEISIFARKQLEKRGIRIITEAKVTKVEKASDSVTAHIDVKGKTQTM
FT                   IVDRLISAVGVQGNIENLGLEALGVKTDRGSIITNEWSWTGVEGIYAIGDVAGPPMLAH
FT                   KAEEEGVTCIEHIAGLKSAHPLDKRKIPGCTYCTPQVASVGLSEAKAKEAGYDIRVGRY
FT                   SFSANGKAIALGEDQGLVKTIFDKKTGQLLGAHMVGAEVTELIQGFVIAMNLETTEEEL
FT                   MHTVFPHPTLSEMMKESVLDAYGQVLNA"
FT   gene            548586..549539
FT                   /gene="lipA"
FT                   /locus_tag="BARBAKC583_0538"
FT   CDS_pept        548586..549539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="BARBAKC583_0538"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44617"
FT                   /db_xref="GOA:A1USA0"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USA0"
FT                   /protein_id="ABM44617.1"
FT                   /translation="MVTVVDKVTSMRVRHPEKAHRPDTSIQKKPDWIRVKAPTSQVYKE
FT                   THGIVRANKLVTVCEEAGCPNVGECWSQRHASFMILGEICTRACAFCNVATGIPLAVDD
FT                   DEPERVADAVAQMGLKHVVITSVDRDDLADGGAQHFAKVIYAIRRKSLGTTIEVLTPDF
FT                   RHKDHALEIVVAAKPDVFNHNLETVPSKYLKVRPGARYFHSIRLLQRVKEIDPMIFTKS
FT                   GIMVGFGEERNEILQLMDDLRSADVDFMTIGQYLQPTRKHHPVIRFLPPDEFESFAKIG
FT                   KAKGFLHMASSPLTRSSHHAGDDFEILKKARAQKFS"
FT   gene            549551..550012
FT                   /locus_tag="BARBAKC583_0539"
FT   CDS_pept        549551..550012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0539"
FT                   /product="cyclase/dehydrase family protein"
FT                   /note="identified by match to protein family HMM PF03364"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44484"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA1"
FT                   /protein_id="ABM44484.1"
FT                   /translation="MSTFTTHRQVAHTAHEMFDLVADIECYPEFLPMCEALIVRSREEY
FT                   GDKTLLLADMTVGYKMIQETFTTQVLLKPKENLIEVKYIDGPFKYLENRWAFHQIQDMN
FT                   ACNIEFFIDYEFKSKVLGMLMGSMFDIAFNKFTDAFEKRSHQIYGFPGK"
FT   gene            complement(550103..551296)
FT                   /gene="ispDF"
FT                   /locus_tag="BARBAKC583_0540"
FT   CDS_pept        complement(550103..551296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispDF"
FT                   /locus_tag="BARBAKC583_0540"
FT                   /product="IspD/IspF bifunctional enzyme"
FT                   /EC_number="2.7.7.60"
FT                   /EC_number="4.6.1.12"
FT                   /note="identified by match to protein family HMM PF01128;
FT                   match to protein family HMM PF02542; match to protein
FT                   family HMM TIGR00151; match to protein family HMM
FT                   TIGR00453"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45054"
FT                   /db_xref="GOA:A1USA2"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USA2"
FT                   /protein_id="ABM45054.1"
FT                   /translation="MSIAAIILAAGRGSRAGSLQNGPKQYRFLGREPVICHTIRCFLQH
FT                   PAITNIILVIHPDDYQICANAIADLKDHLTIIEGGETRQISTLQGLRALKNVKPNYVHI
FT                   HDGARPFIGNELLEQIHTSINHKEGILPVLSVSDTLKYVSNTHHVLETIPRTNLYRAQT
FT                   PQCFPFELILAAHEKAMQSHKQDFTDDSAIAEWFGIPIRTIPGDPNNIKITWPADLETA
FT                   RSYLLKGMQIFPDIRTGNGYDVHSFEDGHYITLCGIKIPFEKKLNGHSDADVALHALTD
FT                   ALLATQGAGDIGTHFPPSDPQWKNASSEIFLHHAIEIIKKAEGRIANVDITLIAEKPKI
FT                   GPYRHIMTENLMKILKISTDRISIKATTNEKLGFIGREEGIAALATATVIYPGEIPK"
FT   gene            551809..551940
FT                   /locus_tag="BARBAKC583_0541"
FT   CDS_pept        551809..551940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45607"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA3"
FT                   /protein_id="ABM45607.1"
FT                   /translation="MLALKHFRMHFFSKNIALFLFSNQLDILNIVCQFLPQGVVQGE"
FT   gene            551962..554190
FT                   /gene="ntrY"
FT                   /locus_tag="BARBAKC583_0542"
FT   CDS_pept        551962..554190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrY"
FT                   /locus_tag="BARBAKC583_0542"
FT                   /product="nitrogen regulation protein NtrY"
FT                   /EC_number="2.7.13.3"
FT                   /note="identified by similarity to SP:Q04850; match to
FT                   protein family HMM PF00512; match to protein family HMM
FT                   PF00672; match to protein family HMM PF00989; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   TIGR00229"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44566"
FT                   /db_xref="GOA:A1USA4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR017232"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA4"
FT                   /protein_id="ABM44566.1"
FT                   /translation="MSTTSEVHLQGINQDTYNDRSHHLSKVYTFLGITIIVLALLTASI
FT                   SFIILIGFTPVVPSRVVTLILIGVNSVWIFGLVVIVFYEMIPIMHAWRSRRAASRLHVR
FT                   LISLFALVATLPAVAVALVSGPALNLGLDRWFDTTTRQIVGSSIDLANAYADEMLQNLK
FT                   NLSYAMAFALDNKSLLLHNLAEYRLQLTRHAAGRNIRGAFLLSAGGTIFASSDLGDEDK
FT                   LPIPPSNLIIRATNTRPFSFQPGIHDYFGIILKFTNIPNTFLYLVRDVDKTVLSALRLT
FT                   EVNTERYRDLNENRLPTQIAFGILYLCLFLSLLLSAIWAGIAVADRLVRPIRLLIGAAD
FT                   DVASGNMEVFVPVRAKDGDIGQLSKTFNYMVSELKSRRNELIAVRDQIDERRRFSEAVL
FT                   SGVTAGVAGIDDNGDITIINRSIETMFSIDSQQVIGHSLLSLSAEIWQVFELVRASSRK
FT                   NHREQVTLSVAGQERVCNVQITMEEEDGQGKSWVLTIDDITDLVEAQRSSAWADVARRI
FT                   AHEMKNPLTPIQLSAERIRRRYDKMVAQDREVFDRCIDTIVRQVGDIGRMVDEFSSFAR
FT                   MPEPQMHTSDIRGLLREACFLIEVVRYDIHFEKDLGSIPLIGEFDNRLIVQAFSNVIKN
FT                   ASEAIDSVIRAEGVCGHILVRSYRQEENLVVDIIDNGKGLPKEQRQKLLEPYITTRKKG
FT                   TGLGLAIVRKIIEDHGGYMELYDAPSSFYGGCGAMIRMVFPADKVDLC"
FT   gene            554218..555576
FT                   /gene="ntrX"
FT                   /locus_tag="BARBAKC583_0543"
FT   CDS_pept        554218..555576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrX"
FT                   /locus_tag="BARBAKC583_0543"
FT                   /product="nitrogen assimilation regulatory protein NtrX"
FT                   /note="identified by similarity to SP:Q04849; match to
FT                   protein family HMM PF00072; match to protein family HMM
FT                   PF00158; match to protein family HMM PF02954"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45139"
FT                   /db_xref="GOA:A1USA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA5"
FT                   /protein_id="ABM45139.1"
FT                   /translation="MVSDILIVDDEVDIRELVAGILNDEGYETRVACNSDEALAEINGR
FT                   IPKLIFLDIWLQGSRVDGLALLDKIKIRYPALPVVMISGHGNIEMAVSAIKRGAYDFIE
FT                   KPFKADRLVLVAERALENSKLKRELFELRKRSNEAPAFLGTSTAMKHLRQVIEKVAPTN
FT                   SRVMITGPSGAGKEMAARAIHALSTRYNGPFVTINAAMITPERMEIELFGNEMESGERK
FT                   VGALEEAHGGTLYLDEIADMPRGTQSKILQVLTSQTFERVGGTKRVKVDVRVISSTVQN
FT                   LENLISDGRFREDLFHRLSVVPISVPPLSARREDIPELVHYFVKTISRQIGIKPRDISD
FT                   DAIAVLQSHTWPGNVRQLRNNIERLLILARDDDRPITPELLPVEVNDSFPHMQMETDES
FT                   IMDLPLREARELFEKRYLTAQIGRLGGNISRTAEFIGMERSALHRKLKALGVS"
FT   gene            555580..556956
FT                   /gene="trkA"
FT                   /locus_tag="BARBAKC583_0544"
FT   CDS_pept        555580..556956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="BARBAKC583_0544"
FT                   /product="potassium uptake protein TrkA"
FT                   /note="identified by similarity to GB:AAR91791.1; match to
FT                   protein family HMM PF02080; match to protein family HMM
FT                   PF02254"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44703"
FT                   /db_xref="GOA:A1USA6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA6"
FT                   /protein_id="ABM44703.1"
FT                   /translation="MRVIICGAGQVGYGIAERLSFENHDVTVIDTETKLVEKIRDTLDV
FT                   RSFVGHGTHPEVLLAAGADQADMLIAVTLFDEVNMVACQVAHSLFNVPTKIARIRSQSY
FT                   LKPCYKTLFARENIPVDVVISPEIEVGEMVLRRIALPGAIDVLYFCDDEIVVLALKCME
FT                   DCPIINTPLRQLTELFPDLQTTVAAIKRGSELLVVHSETQLRVGDITYLVAARDQVRRA
FT                   LGLFGYKEQEAHRIIIAGGGHIGLYVAQAIEKRLHKLKLKIIEAHRERALTIADQLEKT
FT                   TVLHGNVLDPLILQEAGIDQADLMITLTNQDQVNLLSAIIAKRLGCKSNMVLINNVAYQ
FT                   EFSRAVGVDTHLNPRSVTVSRILQQMRRGRIRAVHSVFNGAAEIIEAEAMQTSSLIGKT
FT                   LSELNLSEGLRIGAIYRNKTIIQLSSDTRILPGDRIVIFALADCVRDVEQFFRVSLEYF
FT                   "
FT   gene            557027..557805
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0545"
FT                   /note="conserved hypothetical protein, degenerate; this
FT                   region contains one or more premature stops and/or
FT                   frameshifts which are not the result of sequencing error;
FT                   identified by similarity to RF:NP_698118.1"
FT   gene            557915..558547
FT                   /gene="clpP"
FT                   /locus_tag="BARBAKC583_0546"
FT   CDS_pept        557915..558547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="BARBAKC583_0546"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45433"
FT                   /db_xref="GOA:A1USA7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USA7"
FT                   /protein_id="ABM45433.1"
FT                   /translation="MSDLVKTALSLVPMVVEQTNRGERAYDIFSRLLKERIIFINGPVE
FT                   DSMAMLVCAQLLFLEAENPKKEISLYINSPGGVVTSGMAIYDTMQFIRPPISTLCMGQA
FT                   ASMGSLLLTAGAKGHRFSLPNARIMVHQPSGGFQGQASDIERHAQDIIRMKRHLNEIYV
FT                   QHTGQDYEIIENTLDRDHFMTAEEAKMFGLIDDVIQYRAETKKEEKD"
FT   gene            558755..560029
FT                   /gene="clpX"
FT                   /locus_tag="BARBAKC583_0547"
FT   CDS_pept        558755..560029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="BARBAKC583_0547"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44544"
FT                   /db_xref="GOA:A1USA8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USA8"
FT                   /protein_id="ABM44544.1"
FT                   /translation="MSKVSNSGSEPKNTLYCSFCGKSQHEVRKLIAGPTVFICDECVEL
FT                   CMDIIREENKSSGIKTRDGVPTPQEIIEVLDDYVIGQRYAKRVLSVAVHNHYKRLAHQS
FT                   KNNAIELAKSNILLVGPTGCGKTYLAQTLARIIDVPFTMADATTLTEAGYVGEDVENII
FT                   LKLLQSADYNVERAQRGIVYIDEVDKISRKADNPSITRDVSGEGVQQALLKIMEGTIAS
FT                   VPPQGGRKHPQQEFLQVDTTNILFICGGAFAGLERIISGRGEKTSIGFSATIKAPDERR
FT                   VGEIFHDLEPEDLVKFGLIPEFIGRLPIIATLEDLDIDALVRILSQPKNALVKQYQHLF
FT                   EMENVELTFHEDALRAIANKAIERKTGARGLRSIMEKILLDTMFELPALEGVQKVVISS
FT                   DVVEGKARPLYIYSERVEDKENVSA"
FT   gene            560206..562629
FT                   /gene="lon"
FT                   /locus_tag="BARBAKC583_0548"
FT   CDS_pept        560206..562629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="BARBAKC583_0548"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02190; match to protein
FT                   family HMM PF05362; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR00763"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45278"
FT                   /db_xref="GOA:A1USA9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:A1USA9"
FT                   /protein_id="ABM45278.1"
FT                   /translation="MQYINEETKVMEELYAVLPLRDIVVFPHMIVPLFVGREKSIHALE
FT                   KIITEDKPILLATQKNAADDDPKAEDIYDIGTVANILQLLKLPDGTVKVLVEGTARAKI
FT                   SQFITNEDYYQAYAAITEEFEEDEVEIEALSRSVMVYFENYVKLNKKISPEVVSAVSQV
FT                   YDPSKLADTIASHLVIKLSDKQEILALLPIRDRLERVLSFMEGEISVLQVEKRIRSHVK
FT                   RQMEKTQREYYLNEQLKAIQRELGASDDSRDELSELEERINRTKLSKEARAKASAELRK
FT                   LRNMSPMSAEATVVRNYLDWLLAVPWGKKSKIKNDLDFSEKVMDNEHFGLEKIKERIIE
FT                   YLAVQSRSSKIKGPIICLLGPPGVGKTSLARSIAKATGREYVRISLGGVRDESEIRGHR
FT                   RTYIGSMPGKIIQSMRKSKKTNPLFLLDEIDKMGQDFRGDPSSALLEVLDPEQNGTFID
FT                   HYLEVEYDLSDVMFVATANTLNIPGPLMDRMEIIRIAGYTGCEKMEIAKRHLLPKVLKD
FT                   HSLSKKEFSVSDDAVRSIIQFYTREAGVRNLEREVMKLARKSVTKILKNNQKSIAITED
FT                   NIDDFLGVKRYRFGQVEGENQIGVVTGLAWTEVGGELLTIEGVMMPGKGKMTVTGNLRD
FT                   IMKESISAAASYVRFRAVDFGIKPTLFEERDIHVHVPEGATPKDGPSAGIAMVIAIVSV
FT                   LTEIAVHKDIAMTGEITLRGRVLPIGGLKEKLLAALRGGIKKVLIPEENAKNLVDIPDD
FT                   VKNNIEIVPVSHVSEVLKHALVCFPEAIEWTDPSKKVSTTVRTGSDDESIPVAH"
FT   gene            562604..562717
FT                   /locus_tag="BARBAKC583_0549"
FT   CDS_pept        562604..562717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0549"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44753"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB0"
FT                   /protein_id="ABM44753.1"
FT                   /translation="MKAYRLHIDSFFEFSVVFFKAMKSHFRGKGFYFFEKK"
FT   gene            562856..563134
FT                   /gene="hupB"
FT                   /locus_tag="BARBAKC583_0550"
FT   CDS_pept        562856..563134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="BARBAKC583_0550"
FT                   /product="DNA-binding protein HU-beta"
FT                   /note="identified by similarity to SP:P0ACF4; match to
FT                   protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45153"
FT                   /db_xref="GOA:A1USB1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB1"
FT                   /protein_id="ABM45153.1"
FT                   /translation="MNKSELVNSIAAKAGVSKAQAGSVLDAFIASVTEALGEGGDVRLP
FT                   GFGSFEVSRRAATKGRNPSTGAEINIPARSVPKFSAGKNLKEAVNKR"
FT   gene            complement(563823..565217)
FT                   /gene="gid"
FT                   /locus_tag="BARBAKC583_0551"
FT   CDS_pept        complement(563823..565217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gid"
FT                   /locus_tag="BARBAKC583_0551"
FT                   /product="gid protein"
FT                   /note="identified by match to protein family HMM PF01134;
FT                   match to protein family HMM TIGR00137"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44898"
FT                   /db_xref="GOA:A1USB2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USB2"
FT                   /protein_id="ABM44898.1"
FT                   /translation="MLNKLNLPIHIIGGGLAGSEASWQIAQLGIPVILHEMRPQRLSEA
FT                   HKTDKLAELVCSNSFRSDDSLTNAVGLLHAEMRLAKSLIMKAADANKVPAGSALAVDRD
FT                   GFSQTVTESLENHPLITIKREEIHDIPENWHNVIIATGPLTSPALAYAIQAVTGTEALS
FT                   FFDAIAPIIYTDSINMNICWYQSRYDKIGPGGTGKDYINCPLDKEQYEAFIQALKDGEK
FT                   IEFREFENVPYFDGCLPIEVMAERGVETLRHGPMKPMGLTNTHTPKVKAYAIVQLRQDN
FT                   MLGTLYNMVGFQTKLKYSEQVRIFRTIPGLEKAEFARLGGLHRNTYLDSPTILDETLRL
FT                   KKKPQLRFAGQITGCEGYVESSAIGLLAGRFAAAEYNNTYPSLPPKTTAFGALLNHITS
FT                   GYIVTQETEKHSFQPMNINFGLFPPIDSTNHQRKTMQYKEKKLAKRQAIVERALNDCTQ
FT                   WLNGLK"
FT   gene            565396..565478
FT                   /locus_tag="BARBAKC583_0552"
FT   tRNA            565396..565478
FT                   /locus_tag="BARBAKC583_0552"
FT                   /product="tRNA-Leu"
FT   gene            565640..567064
FT                   /gene="tig"
FT                   /locus_tag="BARBAKC583_0553"
FT   CDS_pept        565640..567064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="BARBAKC583_0553"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45428"
FT                   /db_xref="GOA:A1USB3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USB3"
FT                   /protein_id="ABM45428.1"
FT                   /translation="MQVTETLNEGLKREIQVMVPMKDLEAKLNERLDDTKGKIKLNGFR
FT                   PGKVPSSYLRKMYGKSFMAEVLNEIINDAPRSILVDRNERSAVQPQIDINEDQKVLDGE
FT                   ADFIFNLKYEVLPEFEIKDFKDIEITREIADVSEQEIDEEVKKILSSTRSYSEGDAPSE
FT                   EGDRVTIDYLGKIDDVPFDGGTGHDVQLVLGSNQFIPGFEEQLVGVKAGDTKAISVKFP
FT                   DNYGVAHLAGKDAVFNITVKTVSKPDELKIDDEAAKKLGLESLDRLREVVQGQIENQYG
FT                   LMTRQKIKRQILDSLDADYNFEIPERLVEIEFNNIWAQVNSDLQKSGRSFEDENTTEEK
FT                   AREEYHMLAQRRVRLGLVLSEIGMKANIQVSESELQTAIFEQVRQYPGQEKEIMNFFRR
FT                   TPEAIANLRAPIFEEKVIDYLLTHIKIKDKKVTVEELMKEFDESDAIEKSLVKKKTASD
FT                   NKKSNEIKKKSTMKKV"
FT   gene            567236..568735
FT                   /gene="gatB"
FT                   /locus_tag="BARBAKC583_0554"
FT   CDS_pept        567236..568735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="BARBAKC583_0554"
FT                   /product="glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn)
FT                   amidotransferase, B subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01162;
FT                   match to protein family HMM PF02637; match to protein
FT                   family HMM PF02934; match to protein family HMM TIGR00133"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45052"
FT                   /db_xref="GOA:A1USB4"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USB4"
FT                   /protein_id="ABM45052.1"
FT                   /translation="MQMIDIRPPDPRHFISGSTGDWEVVIGMEVHAQIVSDSKLFSGAS
FT                   TKFGAEPNNHVSLIDAAMPGMLPVVNQECIRQAIRTGLGLKAQINLKSVFDRKNYFYPD
FT                   LPQGYQISQFHYPIVGEGKVTISIGPDSNGQFEDVEIGIERLHLEQDAGKSIHDQHPTM
FT                   SFVDLNRSGVALMEIVSKPDMRSSEEAKAYITKLRMILRYLGTCDGNMDEGSIRADVNV
FT                   SVRRPGEPLGTRCEIKNVNSIRFIGQAIEYEARRQIAVLEDGGVIDPETRLFDAAKCET
FT                   RSIRLKEEAHDYRYFPDPDLLPLEFDQAFVDALASELPELPDDIKARFINDMGLTVYDA
FT                   SILITEKEIADYFQKVARGRDGKMVANWVINDLLGALNKNNCKIEDTPVKPDQLGAIID
FT                   LIEEGIISGKIAKDLFEIIWHEGGDLRQIVEERGMKQVTDTGAIQSAVDEIMANNPDKV
FT                   SQAKEKPALVGWFVGQVMKETGGKANPQTVNKLVKMKLEID"
FT   gene            568930..569328
FT                   /locus_tag="BARBAKC583_0555"
FT   CDS_pept        568930..569328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0555"
FT                   /product="putative NADH dehydrogenase (ubiquinone)"
FT                   /note="identified by match to protein family HMM PF05071"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45605"
FT                   /db_xref="GOA:A1USB5"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB5"
FT                   /protein_id="ABM45605.1"
FT                   /translation="MAGFLKQTFTWWNGNTINTRFFTWRKGRRIGEDQFGNIYYEGGHH
FT                   KDGYPRRWVIYKDFSEASTIPPGWHGWIHHRCDMPPTEENYKAHEWEKPHSENMTGTKE
FT                   AYRPKGSIAYSAEHLSARKDYDAWFPKK"
FT   gene            569416..569814
FT                   /locus_tag="BARBAKC583_0556"
FT   CDS_pept        569416..569814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45125"
FT                   /db_xref="GOA:A1USB6"
FT                   /db_xref="InterPro:IPR019225"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB6"
FT                   /protein_id="ABM45125.1"
FT                   /translation="MKFCLVSKFRHFSCVFLMGMVGVLLWVGNMQAKRVSNTIAVFSGL
FT                   DKITGRTTRFEVPIDRVYQFGALQVTPRICYTSSEDEPARPASFIEVNEVTLDKKTQRI
FT                   FTGWIFADSPGLNAVEHPIYDVWLKDCK"
FT   gene            569989..570492
FT                   /locus_tag="BARBAKC583_0557"
FT   CDS_pept        569989..570492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0557"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44458"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB7"
FT                   /protein_id="ABM44458.1"
FT                   /translation="MCAPLHLTKKLLAAALMITLVGCQLSNEPTIKHSYDIQVTEVSSG
FT                   NFYYTHNPLILLEMQAKWVSNQGYVLDITTTSTNSGDLNLTLAWSQNRNYRYIPGEKLV
FT                   IMCVIGCTVSEKGRLFIPEDEFHTYARTGFKFQLIGRGNSVDGFLDARAFRRVLYKMQV
FT                   LPRK"
FT   gene            570600..571322
FT                   /locus_tag="BARBAKC583_0559"
FT   CDS_pept        570600..571322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0559"
FT                   /product="peptidase, S54 family"
FT                   /EC_number="3.4.21.-"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44643"
FT                   /db_xref="GOA:A1USB8"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB8"
FT                   /protein_id="ABM44643.1"
FT                   /translation="MKITHSQYDDALLSPNRPKEPLLNVPFIIIFLIAFCFFIYFVSDQ
FT                   LHARILVLFAFIPAFFKADPVGFSHTVVSYSFMHGSLGHIALNMIWLLVFGSPLVRHLG
FT                   NLRFLIFWVLTAVASVLTYFIFHQNSEIPLIGASGAISGMMGAAARYFFSTCSNSSTRD
FT                   GKFEGPILSIRESLHSRTVLIYIGVWFMINFITGIFPHFSEEDNVSIAWEAHVGGLISG
FT                   FLLISFFNIPWRKSKITV"
FT   gene            complement(571312..572142)
FT                   /locus_tag="BARBAKC583_0558"
FT   CDS_pept        complement(571312..572142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0558"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45187"
FT                   /db_xref="GOA:A1USB9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A1USB9"
FT                   /protein_id="ABM45187.1"
FT                   /translation="MIEKARRNSYFASLRRQYRDTKGFISSPSARFKYGPSPLTAEKIR
FT                   LYGIHAVNAALQNPNRVLECLYATPNALKRLNIVESNPPCLLELCSPKKLDTLIGSDAV
FT                   HQGVVLETKPLKSRHLSELTHTDLVVVMDQITDPHNVGAIMRSAVAFKAGALITTHRHS
FT                   PQESGVLAKAASGALEMIDYITVRNLAEALKELHKADFISFGLDSEGGKPLEIALTGQK
FT                   IALILGAEGKGLRKKTRETVCALARLDMPGNIKSLNVSNAATIALYATHKYLRP"
FT   gene            572344..572427
FT                   /locus_tag="BARBAKC583_0560"
FT   tRNA            572344..572427
FT                   /locus_tag="BARBAKC583_0560"
FT                   /product="tRNA-Tyr"
FT   gene            572451..572524
FT                   /locus_tag="BARBAKC583_0561"
FT   tRNA            572451..572524
FT                   /locus_tag="BARBAKC583_0561"
FT                   /product="tRNA-Gly"
FT   gene            572465..572605
FT                   /locus_tag="BARBAKC583_0562"
FT   CDS_pept        572465..572605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0562"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44565"
FT                   /db_xref="UniProtKB/TrEMBL:A1USC0"
FT                   /protein_id="ABM44565.1"
FT                   /translation="MVEQQPSKLNMRVRFPLPAPDIWGLSKIVVEFFSIVNEADFFRLL
FT                   V"
FT   gene            572688..573863
FT                   /gene="tuf1"
FT                   /locus_tag="BARBAKC583_0563"
FT   CDS_pept        572688..573863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf1"
FT                   /locus_tag="BARBAKC583_0563"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45353"
FT                   /db_xref="GOA:A1USC1"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC1"
FT                   /protein_id="ABM45353.1"
FT                   /translation="MAKSKFERTKLHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQI
FT                   DAAPEERARGITISTAHVEYETDQRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAA
FT                   DGPMPQTREHILLARQVGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDI
FT                   PIVKGSALAALEDSDKSIGEDAVRLLMSEVDRYIPTPERPVDQSFLMPIEDVFSISGRG
FT                   TVVTGRVERGVVKVGEEIEIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGIDR
FT                   EGIERGQVLAKPGSVTPHTKFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVT
FT                   LPEGTEMVMPGDNVAMDVSLIVPIAMEEKLRFAIREGGRTVGAGIVSKIIE"
FT   gene            573914..573989
FT                   /locus_tag="BARBAKC583_0564"
FT   tRNA            573914..573989
FT                   /locus_tag="BARBAKC583_0564"
FT                   /product="tRNA-Trp"
FT   gene            574217..574420
FT                   /gene="secE"
FT                   /locus_tag="BARBAKC583_0565"
FT   CDS_pept        574217..574420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="BARBAKC583_0565"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45041"
FT                   /db_xref="GOA:A1USC2"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A1USC2"
FT                   /protein_id="ABM45041.1"
FT                   /translation="MTNPIAFLKQVRAEITKIKWPTRRETVISTVMVLVVTAVASAFFF
FT                   IVDQVINFSVWQGIDLLKYIFG"
FT   gene            574441..574971
FT                   /gene="nusG"
FT                   /locus_tag="BARBAKC583_0566"
FT   CDS_pept        574441..574971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="BARBAKC583_0566"
FT                   /product="transcription termination/antitermination factor
FT                   NusG"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM PF02357; match to protein
FT                   family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45585"
FT                   /db_xref="GOA:A1USC3"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A1USC3"
FT                   /protein_id="ABM45585.1"
FT                   /translation="MVARWYIVQAYSNFEKKVAEAISKEAKQKGLDHLFKKIFVPIERV
FT                   VEVRRGRKVDSERKFFPGYVLVCAELTDDVYHLIKNTPKVTGFLGSDARPVPISDREAE
FT                   QILQQVQEGVESPKSSVTFEVGEQVRVADGPFISFNGVVQEVEEDRSRLKVEVLIFGRP
FT                   TPVDLEFGQVEKL"
FT   gene            575124..575552
FT                   /gene="rplK"
FT                   /locus_tag="BARBAKC583_0567"
FT   CDS_pept        575124..575552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="BARBAKC583_0567"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45340"
FT                   /db_xref="GOA:A1USC4"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC4"
FT                   /protein_id="ABM45340.1"
FT                   /translation="MAKKNAGQLKLQVPAGAATPSPPIGPALGQRGINIMEFCKAFNAA
FT                   TQEMEKGAPIPVVITYYQDKSFTFSLKTPPVSFFLKKEANLKSGSKEPGKVFVGTISRD
FT                   KICSIAEAKMKDLNANNIEAAMRMIEGSARSMGLEVVG"
FT   gene            575557..576255
FT                   /gene="rplA"
FT                   /locus_tag="BARBAKC583_0568"
FT   CDS_pept        575557..576255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="BARBAKC583_0568"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44465"
FT                   /db_xref="GOA:A1USC5"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC5"
FT                   /protein_id="ABM44465.1"
FT                   /translation="MVKIVKRIKKIREGINFNELYTLTDAVSMVKERAVAKFDETIEIS
FT                   MNLGVDPRHADQMVRGVAHLPNGTGKNIRVAVFARGDKAEEAKAAGADIVGAEDLFETV
FT                   NGGTINFDRCIATPDMMPLVGRLGKVLGPRSLMPNPKVGTVTTDIAGAVKASKGGAVEF
FT                   RVEKAGIVHAGVGKASFGAEQLIENIKTFVSAVIKAKPQGAKSEYIKRVAVSSTMGIGI
FT                   KVDLVTIRSE"
FT   gene            576612..577130
FT                   /gene="rplJ"
FT                   /locus_tag="BARBAKC583_0569"
FT   CDS_pept        576612..577130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="BARBAKC583_0569"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44827"
FT                   /db_xref="GOA:A1USC6"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC6"
FT                   /protein_id="ABM44827.1"
FT                   /translation="MNRAEKREFVTWLNKIFQESGSVVVAHYSGLTVSQMSDLRSKIGE
FT                   AGGAVKVAKNTLAKIALQGTKSESMANLFTGQTLIAYSEDPIVAPKVAVDFAKANDKLV
FT                   ILGGSMGAVSLSVDAVKSLASLPSLNELRAKLVGMISTPATRVAQVIKAPAGQVARVIG
FT                   AYAQKGEAA"
FT   gene            577236..577607
FT                   /gene="rplL"
FT                   /locus_tag="BARBAKC583_0570"
FT   CDS_pept        577236..577607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="BARBAKC583_0570"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44614"
FT                   /db_xref="GOA:A1USC7"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC7"
FT                   /protein_id="ABM44614.1"
FT                   /translation="MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGS
FT                   AAAPAAEEKTEFDVVLVDGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGVSKD
FT                   EAEKIKAQLEAAGAKIELK"
FT   gene            577891..582042
FT                   /gene="rpoB"
FT                   /locus_tag="BARBAKC583_0571"
FT   CDS_pept        577891..582042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="BARBAKC583_0571"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565; match to protein
FT                   family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45609"
FT                   /db_xref="GOA:A1USC8"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC8"
FT                   /protein_id="ABM45609.1"
FT                   /translation="MAQTLAMMSQFNGRKRVRKFFGKIPEVAEMPNLIEVQKASYDQFL
FT                   MIKEPKGGRPDEGLQAVFKSVFPISDFSGTAMLEFVRYEFDAPKFDVEECRQRDLTYAA
FT                   PLKVILRLIVFDIDEDTGSKDIKDIKEQGVYMGDMPLMTSNGTFIINGTERVIVSQMHR
FT                   SPGVFFDHDKGKSHSSGKVLFAARVIPYRGSWLDIEFDAKDIVYARIDRRRKIPVTSFL
FT                   MALGMDASDILSTFYNKVTYERVESGWRIPYSVDRFKGVKLVSDLVDAESGEVVAEAGK
FT                   KLTARTAKLLVEKGLKAIRVSEDELLGSYLADDIVNYETGEIYLEAGDEIDEKVLKVLF
FT                   DVGANQINILDIDHMSVGAYIRNTLKVDKNESRQDALFDIYRVMRPGEPPTIDTAEAMF
FT                   HSLFFDSERYDLSAVGRVKMNLRMGLDCPDTVRVLRQEDIIGVVKMLVELRDGRGEIDD
FT                   IDNLGNRRVRSVGELMENQYRVGLLRMERAIKERMSSVEIDTVMPQDLINAKPAAAAVR
FT                   EFFGSSQLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIE
FT                   TPEGPNIGLINSLATFARVNKYGFIESPYRKITDGKVTTEVVYLSAMEEAKHYVAQANS
FT                   SLDSEGRFTEEFVVCRHAGEVLMVPRDHIDLMDVSPKQLVSVAASLIPFLENDDANRAL
FT                   MGSNMQRQAVPLIRSEAPFVGTGMEAIVARDSGAAISAKRGGIVDQVDATRIVIRATED
FT                   LDPSKSGVDIYRLQKFQRSNQSTCINQRPLVHVGDRIEKGDIIADGPSTDLGDLALGRN
FT                   VLVAFMPWNGYNYEDSILLSERIVADDVFTSIHIEEFEVAARDMKLGPEEITRDIPNVA
FT                   EEALRNLDEAGIVYIGAEVQPGDILVGKITPKGESPMTPEEKLLRAIFGEKASDVRDTS
FT                   MRMPPGTFGTVVEVRVFNRHGVEKDERAMEIEREEIERLAKDRDDEQSILDRNVYARLA
FT                   GMLKDKSAIRGPKGFEKGQKIDSTVLNNYPRSQWWQFAVDDEKVQNKIEALCNQYDESK
FT                   EALQRRFMDKVEKVQRGDEMPPGVMKMVKVFVAVKRKIQPGDKMAGRHGNKGVVSRILP
FT                   VEDMPFLEDGTHADIVLNPLGVPSRMNVGQILETHLGWACAGMGKKIGDLVDFYQETGD
FT                   ILPLRQRIENLIPDNDRNEPVRQYDDESLVKLAHQMRKGVSIATPVFDGAHEADINAML
FT                   EDAGLDSSGQVTLYDGRTGEPFDRQVTVGYIYMLKLHHLVDDKIHARSIGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYEAIVRGDDTFEA
FT                   SIPESFNVLIKEMRSLGLNVKLGDAREFMAQQALPEVVEN"
FT   gene            582204..586415
FT                   /gene="rpoC"
FT                   /locus_tag="BARBAKC583_0572"
FT   CDS_pept        582204..586415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="BARBAKC583_0572"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45019"
FT                   /db_xref="GOA:A1USC9"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USC9"
FT                   /protein_id="ABM45019.1"
FT                   /translation="MNHEVMNLFNPQALAQIFDSIRISIASPENILSWSYGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPIKDYECLCGKYKRMKYKGIICEKCGVEVTLSRVRRERMG
FT                   HIELAAPVAHIWFLKSLPGRISTLLDLTLKDIERILYFESYIVTEPGLTSLKLHQLLSE
FT                   EEYMLAIDKFGEDQFTAMIGAEAIYDLLAGMELDKIANDLHAELAETTSELKQKKLIKR
FT                   LKIVENFLESGNKPEWMIMKTIPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLIELRAPGIIVRNEKRMVQEAVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRF
FT                   RQNLLGKRVDYSGRSVIVTGPELKLHQCGLPKKMALELFKPFIYARLDAKGYSSTVKQA
FT                   KKLVEKEHPEVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTA
FT                   FNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILHPANGAPIIVPSQDMVLGLYYLSI
FT                   VSEKEPGEGMAFADMGELHHALENKVVTLHTKIKGRFKNIDKDGKEVAQLYDTTPGRLI
FT                   IGELLPKNPNISFDIVNQEMTKKNLSKMIDQVYRHCGQKETVVFCDRIMQLGFSHACRA
FT                   GISFGKDDMVIPESKSRLVAETEALVKEYEQQYDDGLITQGEKYNKVVDAWGKCTDRIA
FT                   DEMMKGIQAVKFDPKTGRQQRMNSIYMMSHSGARGSANQMRQLAGMRGLMAKPSGEIIE
FT                   TPIISNFKEGLTVNEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDAIISAVDCG
FT                   TIKGLTMQPIIDAGQIVASLGQRILGRTALLDILHPVSGEVIIEGGTMIEEADVLKIEE
FT                   ARIQSVQIRSALTCETRLGVCAKCYGRDLARGTPVNQGEAVGVIAAQSIGEPGTQLTMR
FT                   TFHLGGTAQVVDSSYFESSYEGIVELRNRNVVRNSEGHLVVMGRNMAVLIKDENGKERA
FT                   VHRISYGARLFVDDGDIIKRGQRIAEWDPYTRPILTEVDGYVGFEDMVDGLSVTETTDE
FT                   STGITKRQVIDWRVNPRGADLKPAMIIHSDKQGKNIAKLHKGGEARYVMSVETILSVEP
FT                   GSHVKAGDVIARLPMESAKTKDITGGLPRVAELFEARRPKDHAIIAEISGTVRFGRGYK
FT                   NKRRIIIEPNDETLEPVEYLIPKGKLFHLQEGDKIEKGDYILDGNPAPHDILAIKGVEA
FT                   LASYLVNEIQEVYRLQGVLINDKHIEVIVRQMLQKVEITESGDSDYIPGDNVDRIELDE
FT                   INDHLIAEGKKPASGTPILLGITKASLQTPSFISAASFQETTRVLTEAAVSGKIDTLQG
FT                   LKENVIVGRLIPAGTGGTIAQIRRIATVRDDLIVDEQRKSSNDGISKAMLTDMTANAAA
FT                   E"
FT   gene            586776..587462
FT                   /locus_tag="BARBAKC583_0573"
FT   CDS_pept        586776..587462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0573"
FT                   /product="nitroreductase family protein"
FT                   /note="identified by match to protein family HMM PF00881"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44666"
FT                   /db_xref="GOA:A1USD0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD0"
FT                   /protein_id="ABM44666.1"
FT                   /translation="MMNCTTDIFQSILSRKSIRAFTDRPVEQEIVEKILKLAARAPSGT
FT                   NLQPWQVIVVVGEALQQLGQELSQLALSGVKGEREYHYYPRQWREPYLSRRRKIGLDLY
FT                   KSLGIQKNENEKMLRQQARNFSFFGAPVGLLFTMDRDMEMGSWLDLGMFMQTVMLAARG
FT                   FGLDTCPQASFADYHQKIHMILSVPPERQIICGMALGYRDTSAPENNFETEREPIENFA
FT                   RFVQSC"
FT   gene            587625..587738
FT                   /locus_tag="BARBAKC583_0574"
FT   CDS_pept        587625..587738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0574"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45661"
FT                   /db_xref="GOA:A1USD1"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD1"
FT                   /protein_id="ABM45661.1"
FT                   /translation="MVSQLSMEDTIEKNCWVVARRATLVFVAVIFLVYLTI"
FT   gene            587812..589195
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0575"
FT                   /note="L-serine dehydratase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error; identified by
FT                   similarity to SP:O86564"
FT   gene            589606..589734
FT                   /locus_tag="BARBAKC583_0576"
FT   CDS_pept        589606..589734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0576"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44803"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD2"
FT                   /protein_id="ABM44803.1"
FT                   /translation="MNRMLSYAEDQLFVAPKRSLTGTLPVRLATRKWIRTGGIAER"
FT   gene            complement(589946..591292)
FT                   /locus_tag="BARBAKC583_0577"
FT   CDS_pept        complement(589946..591292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0577"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00768;
FT                   match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45068"
FT                   /db_xref="GOA:A1USD3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD3"
FT                   /protein_id="ABM45068.1"
FT                   /translation="MYINNKKIAQFYKKTAIFLVIFVASYSWVEAAPKGVHADKYAAIV
FT                   IDANTGKTLFQANATMRRYPASLTKMMTLYMLFEAMQVRRVAPNTPIPISAYASTRPPT
FT                   KIGLKTGQTIPVEAAAKALITKSANDVAAAIGEYLGGSEQKFAQMMTVKARQLGMINTN
FT                   FANASGLPDTRNYSTAQDLAILSLALREHFPQQYKLFKIKSFVFHGKIINSHNKLVQTM
FT                   KGVDGIKTGYTQMSGSNLATSMRLGGRSIVAVVMGGKSSVERDIHMANLLNKYLPKASP
FT                   VKTDKRLVAAATYHNLPTGAKAPIPVAKANSRNLEDDISSLLTALAAEPNHFNTAITAV
FT                   NQAIIPTPNPHKDTSIKKVITASLSTNSGWAIQIGALPSKEQANSMLIKAKNATPENLR
FT                   NASSHMQLFEKNGKRYYRARFVGFQSKKAALDTCSALKREKFNCYTVAY"
FT   gene            591619..591897
FT                   /gene="clpS"
FT                   /locus_tag="BARBAKC583_0578"
FT   CDS_pept        591619..591897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpS"
FT                   /locus_tag="BARBAKC583_0578"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="identified by match to protein family HMM PF02617"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44508"
FT                   /db_xref="GOA:A1USD4"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD4"
FT                   /protein_id="ABM44508.1"
FT                   /translation="MPQVRQKLQKPKLYRVLLLDDDYTPMDFVVFILKNFFKKNFEEAT
FT                   RIMLNIHHNGIGECGTYTYEVAEMKIVQVMECARQNEHPLQCVIEAK"
FT   gene            591904..594270
FT                   /gene="clpA"
FT                   /locus_tag="BARBAKC583_0580"
FT   CDS_pept        591904..594270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpA"
FT                   /locus_tag="BARBAKC583_0580"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpA"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR02639"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45369"
FT                   /db_xref="GOA:A1USD5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD5"
FT                   /protein_id="ABM45369.1"
FT                   /translation="MPSFTPSLEEVLHRALTIATQAQHEYATLEHLLLALLDDADASSV
FT                   ICACQVNVEELRERLISYIQSELDAQIRADQDTKPTVFFQRVIQRAVIHAQSAGKDEVS
FT                   GANVLVAIFSERESHAAYFLQEIGMTRYDAVRFISHGIVRDDGLSLLLEDLEEHLDQQD
FT                   LENNEKVPSVLSTYCVNLNCKARSGNIDSLIGRDTEVSRMIQILCRRSKNNPLLVGDPG
FT                   VGKTAIVEGLAKRIVDGQVPEVLSNATIFSLDIGGLLSGTRYRGDFEERLKQVVRELEQ
FT                   YPDAVLFIDEIHTLIGAGATSGGNMDAANLLKPGLSSGNIRCIGSTTYREYRKIFEQDR
FT                   ALERRFQKIDVNEPSVADAIKILQGLKPYFEDFHQIKYTDEAMRASVELSSRYIADRRL
FT                   PDKAIDVVDESGAAQMLLPKKQRKKSIGVKEIESIIAAIARVPSKTVSRDERKLLSNLE
FT                   KELKHVIYGQDQAITALVSSIKLARAGLREPEKPIGNYLFSGPTGVGKTEVAKQLASSL
FT                   GIELLRFDMSEYMERHTVARLIGAPPGYVGFDQGGLLTDAVDQKPHAVVLLDEIEKAHP
FT                   ELFSILLQVMDYGKLTDNNGKKIDFRNIILIMTTNAGAADMEKSAIGFGSVHRDGDDIE
FT                   AINRLFTPEFRNRLDAVIPFTPLSQLVINQIVQKFIFQLEAQLVDRGVTFELSTSAMMW
FT                   LANKGYNAQMGARPLSRVIQEHIKKPLADEILFGKLRNGGMVRIFTNKINEGRETLQLE
FT                   ILPSICSKKSRKAIKTSLGAIKQRISKKALQYKIS"
FT   gene            complement(594267..594689)
FT                   /locus_tag="BARBAKC583_0579"
FT   CDS_pept        complement(594267..594689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0579"
FT                   /product="histidine triad domain protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45427"
FT                   /db_xref="GOA:A1USD6"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039384"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD6"
FT                   /protein_id="ABM45427.1"
FT                   /translation="MKQVYDNNNIFAKLIRNEIPSVRVYEDDDAIAFMDIMPQAPGHTL
FT                   VIPRKGSRNLLDADTEALSSVIKVVQKVANAVKKAFQADGVTIMQYNEAASQQTVYHLH
FT                   FHVIPRMEGVELKSHNNVITPTEILEEQAQKIRTAF"
FT   gene            complement(594775..595239)
FT                   /locus_tag="BARBAKC583_0581"
FT   CDS_pept        complement(594775..595239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0581"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44775"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD7"
FT                   /protein_id="ABM44775.1"
FT                   /translation="MTNSSIESRLKKFGIIIPEAMSSIANYTTVSQSGKQLFVSGQLPL
FT                   INGKPIAIGKVGATVSVEQAKKSAEVCALNILAQIKLFLGDLNKIEHIVKITVFVAVDH
FT                   NFTDVPLVANGASDLLIKVLGEAGKHARSAIGVTSLPMGAPVEVEAIIEI"
FT   gene            595376..596191
FT                   /locus_tag="BARBAKC583_0582"
FT   CDS_pept        595376..596191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0582"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_221870.1; match to
FT                   protein family HMM PF08904"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45501"
FT                   /db_xref="InterPro:IPR015000"
FT                   /db_xref="UniProtKB/TrEMBL:A1USD8"
FT                   /protein_id="ABM45501.1"
FT                   /translation="MVRLLFILGLHVAFLFSARAEEAVALTPHRVIYDFKLGDTPSEMK
FT                   ALGMSGRLVHELIGSECKGYKVSSRFISRTHTENVQERITDQQIVSYETSDGRKFHFEV
FT                   NDNVGQEVKHNIQGVAERTDDGIVVKLKKPKEDVYKLPLADFPTMYLKNIIRQAKANHH
FT                   LYQATVFDGTGNANKIIERSVIIGEKQVLPSDSKMEKLDQEDHWPVQISYYDDEKNKGG
FT                   LPTYHMSFLLSETGIMRDLSINYGEFSMHADLVSFELLDDEKDSESCKH"
FT   gene            596350..597165
FT                   /gene="rpsB"
FT                   /locus_tag="BARBAKC583_0583"
FT   CDS_pept        596350..597165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="BARBAKC583_0583"
FT                   /product="ribosomal protein S2"
FT                   /note="identified by match to protein family HMM PF00318;
FT                   match to protein family HMM TIGR01011"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45535"
FT                   /db_xref="GOA:A1USD9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USD9"
FT                   /protein_id="ABM45535.1"
FT                   /translation="MALPDFTMRQLLEAGVHFGHQTQRWNPKMARYIYGQRNNVHIIDL
FT                   SQTVPLLYQALKLVSDTVVRGGRVLFVGTKRQASDIIADAASRSAQYHVNARWLGGMLT
FT                   NWKTISNSIHRLRKLDKILAAEARGFTKKERLNLERDREKLNRALGGIKDMGSIPDLMF
FT                   VIDTNKENIAIQEAKRLGIPVVAIIDTNCDPDGIDYPIPGNDDASRAISLYCDLFARAA
FT                   LDGIARQQGAMGVDLGAQAYAPIEPVLEDVAVDTSAADLISEDTTPVSN"
FT   gene            597285..598208
FT                   /gene="tsf"
FT                   /locus_tag="BARBAKC583_0584"
FT   CDS_pept        597285..598208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="BARBAKC583_0584"
FT                   /product="translation elongation factor Ts"
FT                   /note="identified by match to protein family HMM PF00627;
FT                   match to protein family HMM PF00889; match to protein
FT                   family HMM TIGR00116"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45297"
FT                   /db_xref="GOA:Q8RT66"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RT66"
FT                   /protein_id="ABM45297.1"
FT                   /translation="MSITAAQVKELRELSGAGMMDCKAALMETNGDIETAVDWLRKKGM
FT                   AKADKKAGRTAAEGLIGIASKGLSAVVVEVNSETDFVARNDAFQTIVRNVATAALDTEG
FT                   SVESVSASIYPGSEKTVEEAIKDAIGTIGENMAFRRSAKLSVQNGAVATYIHNSVADGL
FT                   GKLGVLVGIETTGDKEVAVDFARKVAMHIAATNPLALTVADVDASIVEREKAIFSDQAR
FT                   QSGKPENIIEKMVEGRIRKFYEEVVLLSQAFVMNPDVTVEASLKDAEKMIGAPAKITGF
FT                   VRFALGEGVEKEEVDFAAEVAAAAKG"
FT   gene            598348..599067
FT                   /gene="pyrH"
FT                   /locus_tag="BARBAKC583_0585"
FT   CDS_pept        598348..599067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="BARBAKC583_0585"
FT                   /product="uridylate kinase"
FT                   /EC_number="2.7.4.-"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR02075"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44422"
FT                   /db_xref="GOA:Q8RT65"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RT65"
FT                   /protein_id="ABM44422.1"
FT                   /translation="MTLALRYKRVLLKVSGEALMGEQSFGIDVSVADRIASDIAEVRKM
FT                   GVEVAIVIGGGNIFRGVAVASHGGDRVTGDHMGMLATAINSLALRTSLTKLGVETVVLS
FT                   AITMPQICESFSQRKAMSYMNQGKVVIFAGGTGNPFFTTDSAATLRAAEIGADVLLKGT
FT                   QVDGIYSADPKINSTAKRFDQLTHVEILRLGLSIMDTTAVTLARENNIPIIVYSIHEKG
FT                   GLTKVLNGTGRFTVVSE"
FT   gene            599104..599664
FT                   /gene="frr"
FT                   /locus_tag="BARBAKC583_0586"
FT   CDS_pept        599104..599664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="BARBAKC583_0586"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45147"
FT                   /db_xref="GOA:Q8RT64"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RT64"
FT                   /protein_id="ABM45147.1"
FT                   /translation="MSVTSIMDDLKRRMDGAISAFKHELSGLRTGRASASLLEPLTVEA
FT                   YGSVVPIKQVANISVLEPRMLSVSVWDKTMVGAVERAIRDCGFGLNPIVDGMNLRIPLP
FT                   ELNEERRKELVKIAHQYAEQARVAIRHVRRDGMDNLKKLEKEGEISQDEARSLSEKVQK
FT                   LTDDAIADIDKILIMKETEIMQV"
FT   gene            600413..601231
FT                   /gene="cdsA"
FT                   /locus_tag="BARBAKC583_0587"
FT   CDS_pept        600413..601231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdsA"
FT                   /locus_tag="BARBAKC583_0587"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /EC_number="2.7.7.41"
FT                   /note="identified by match to protein family HMM PF01148"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44862"
FT                   /db_xref="GOA:A1USE3"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="UniProtKB/TrEMBL:A1USE3"
FT                   /protein_id="ABM44862.1"
FT                   /translation="MSNLFLRILTALVFGTITLCLTWFGGALFFLFIWGIGGFILYEWI
FT                   TITKDKWSLLQRILAGVFYFIFCIFLLLGTSSPLIFGILIALAVFLGSVGLFKNIGWVL
FT                   CGFLYASFPVVSLSFLRGYEILGLRMVIFLFVIVWGTDIAAYFIGRAFGGPKLAPKFSP
FT                   NKTWSGAIGGTLVGVSSGVFVAFFVFNMGQITIVVPLLALIISIISQISDLGQSWLKRR
FT                   FSVKDSGYLLPGHGGFMDRMDGLVGAAFVLYLISSFMSNLNTPFNFFYMI"
FT   gene            601231..602310
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0588"
FT                   /note="zinc metallopeptidase, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error"
FT   gene            602564..604960
FT                   /locus_tag="BARBAKC583_0589"
FT   CDS_pept        602564..604960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0589"
FT                   /product="surface antigen/outer membrane protein, OMP85
FT                   family"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244; match to protein
FT                   family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45269"
FT                   /db_xref="GOA:A1USE4"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A1USE4"
FT                   /protein_id="ABM45269.1"
FT                   /translation="MATNSKFFNAASMLVLAKVTAVPIIAAIPVSIIGNAQASVVQSIE
FT                   IHGNSLVDAKTIQDNISIKAGKTFESSDINAAVKQLFGLGLFYDVKINQVDNKLIVTVK
FT                   EYEIINQVLFQGNRALKEPDLKRFITLKPNTTFSAAKLSADIKTIKDAYRTVGRSNISV
FT                   SAQTINLGKGRVNVIFTIVEGQRTKIKNIVFEGNKAFGNRRLHDVISTKSSGIFSLLMR
FT                   GDVYTEERLAADEQALRLFYYNRGYADFRVVSSKALFDEISNSYEIYFVLDEGARYKIG
FT                   NVGVESDIDGIDTKSMTNMLKTRPGDVYSAERIERSVAIINDKVADSGYAFAKVDPRGN
FT                   RDFQNHTISILYNIEQGPRVYIQRIDIRGNEKTRDNVIRREIDLNEGDAYNQTLVRRAQ
FT                   RRLESLGFFKAVNISMVPTSESDQVTLVIDVVETPTGDFSFSGGYTTGGNSPGMSLEAS
FT                   VTERNLGGYGQYARLGLGAGQGNSRNYNFSFVEPYFLGYRLSSGVDIFRSTSRVDKAYD
FT                   SQQTGGSLRFGVSINEEISASLAYSYVQEEYNFGSNYDLTDDAVIEELYDKYSGAIVQA
FT                   AKNSPWRRSSVIFGLTYNSVDNMRNPHDGLYIHALQEYAGLGGNAKFLKTTGKAIMYKT
FT                   LSDEMDLVGLLSIGAGYMHEIGKDGVRIFDMFKSNTDIIRGFRYNGIGPRQISNTGEVS
FT                   FLGGTTYMNATAEAQFPIPLIPDSLGFRGAVFADAATLYGNNYKPVLQNEKPVTDRGSA
FT                   WRTSAGVSLMWESPFGPLRVDYAWPITKQNGDQVQNLNFGISTKF"
FT   gene            605027..606076
FT                   /gene="lpxD"
FT                   /locus_tag="BARBAKC583_0590"
FT   CDS_pept        605027..606076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="BARBAKC583_0590"
FT                   /product="UDP-3-O-[3-hydroxymyristoyl] glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF04613; match to protein
FT                   family HMM TIGR01853"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44658"
FT                   /db_xref="GOA:A1USE5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A1USE5"
FT                   /protein_id="ABM44658.1"
FT                   /translation="MMADTFFFMPSRRLTVADIVELTGAKLRDPKFSNIVIKTLSSVEN
FT                   AREGSLVFLENQKFSDSLLGSFAAAVFCRSDVVVKIPESIAALVTQTPQRDFAQIGRIL
FT                   FPDSVKPMPWFGQKEISPHAHIHPSAKIEHDVCIEAGAIIGKNVEIGAGTLVSSTAVIG
FT                   ENCRIGRECYIAPRVTIQYSLIGDKVRLHPGVCIGQDGFGYVSGAFGIEKIPQLGRVII
FT                   QDGVEIGANTTVDRGTFEDTIIGEGSKIDNLVQIAHNVKIGRYCLIAAQCGIAGSTSIG
FT                   DMSRLGGSVGVVDHVTIGEGVQIAAGSGVMSDIPDGEKWGGSPAQPFKKWFREMVALRN
FT                   IGQVKREKR"
FT   gene            606078..606542
FT                   /gene="fabZ"
FT                   /locus_tag="BARBAKC583_0591"
FT   CDS_pept        606078..606542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="BARBAKC583_0591"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45350"
FT                   /db_xref="GOA:A1USE6"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USE6"
FT                   /protein_id="ABM45350.1"
FT                   /translation="MVNTGEIKNLEAIDIVKLLSVLPHRYPFLLIDRIIEIDGDRKAIG
FT                   IKNVTVNEPHFVGHFPENPVMPGVLILEAMAQTAGAISLLALGRGKEDLVYLMTIDNAK
FT                   FRKPVVPGDQMRIHVQLLKKRSEVRRFLCIAEVEGTRVSEAEISAMVVKS"
FT   gene            606568..607392
FT                   /gene="lpxA"
FT                   /locus_tag="BARBAKC583_0592"
FT   CDS_pept        606568..607392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="BARBAKC583_0592"
FT                   /product="acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44748"
FT                   /db_xref="GOA:A1USE7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USE7"
FT                   /protein_id="ABM44748.1"
FT                   /translation="MSGTKIHPTAFVEEGAQLGENVSIGPFCHIGPQAVIGDGCCLMSH
FT                   VVIMGNTILGANSKIFPHAILGGDPQNNKHKGGHTSLFIGKNCIIREGVTMHRGSDTCA
FT                   GKTVIGDNCQFFSYAHVAHDCHVGHHVTFANNAMIGGHVTVGDYVIIGGGSAVHQFVRI
FT                   GHHAFIGGVSALVGDLIPYGMAVGVQAKLAGLNIIGMKRAGLERKEIRSLRHAVSMLFD
FT                   HSKPLRERVYDVFSFYSTSQSVVDIVNFIQEKGKRFYCTPRFENDTMCSNKD"
FT   gene            607395..608267
FT                   /locus_tag="BARBAKC583_0593"
FT   CDS_pept        607395..608267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_221856.1; match to
FT                   protein family HMM PF06230"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45506"
FT                   /db_xref="InterPro:IPR010415"
FT                   /db_xref="InterPro:IPR041255"
FT                   /db_xref="UniProtKB/TrEMBL:A1USE8"
FT                   /protein_id="ABM45506.1"
FT                   /translation="MSSSNVRSFLSSRTAIIAGNGVLPIAVAQALEECGQKPFLILLHG
FT                   EAESALYNYEHCELSIVELARLFKILKEKEICNIILAGGIRKRPDFFKLHFDWTTLLAL
FT                   PKLLKILGSGDDILLKSFIQLIEARGFCVVGAHEVVPDLLAPMDFSLTSRRASQKEKNS
FT                   ILLAAKAAKLLGHLDIGQAVVVINNRVVAVEGAEGTDDMLKRVQEMRKKKQIPSKGGVL
FT                   VKCAKPQQDHRADLPSIGPTTIVNAAKSGLVGVAVEAGKSLILSCKRTIEEANKHSLFV
FT                   ETFRTSDDR"
FT   gene            608257..609441
FT                   /gene="lpxB"
FT                   /locus_tag="BARBAKC583_0594"
FT   CDS_pept        608257..609441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="BARBAKC583_0594"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /EC_number="2.4.1.182"
FT                   /note="identified by match to protein family HMM PF02684;
FT                   match to protein family HMM TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44923"
FT                   /db_xref="GOA:A1USE9"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A1USE9"
FT                   /protein_id="ABM44923.1"
FT                   /translation="MTDNCSLKIAVIAGEESGDLLGADLISSLSHQTGCKIHLIGVGGK
FT                   HLEALGLKSIFNSDDISLIGLWAVLKKLLLLLMHIRNVSRFIAREKPDCLIIIDSPDFT
FT                   HRVAKKVRILEPSIPIIKYVAPTVWAWRPERAKAMRKFVDHILAVFPFEEKIMKNLGGP
FT                   PLTYVGHRLLAYPPLLKIQSQKECLDTQRETFTMVVLPGSRSLEVRYLMPVFGETVAIA
FT                   KQRIPNLRVILPTLPHLIDEVRYFAQNWKNEVEIVVGEDAKWHAFTDADVALAALGTVS
FT                   LELALAKIPMVLCYKLDCLFKFFLFPKTTLWSAALPNIIADKPAIPEYFNEFLRPGMLA
FT                   RQVEQLLHNHSLRQVQLDAFDVMKKKMQTELSSGVIASQTVINILKNKSRHLGL"
FT   gene            complement(609473..610252)
FT                   /locus_tag="BARBAKC583_0595"
FT   CDS_pept        complement(609473..610252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0595"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45656"
FT                   /db_xref="GOA:A1USF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF0"
FT                   /protein_id="ABM45656.1"
FT                   /translation="MNPENKNNNSFDIDKSPVISIRNLNKWYGNFQVLHSINLDIKAGE
FT                   RIVICGPSGSGKSTLIRCINQLEQAQTGSIYIYDVDIAAASIQQQKNVLRKVGMVFQNF
FT                   NLFPHMTVMQNCILAPMTVHGLSKEQAKKQAIYYLTHVGIEKYCEQYPSQLSGGQQQRV
FT                   AIARALCMEPEVLLFDEPTSALDPENVREILEVMAQLTNTGITMLCVTHEMNFAREISE
FT                   RILFLESGKIIEDTTSDIFFTNPKTQRARDFLAKIKY"
FT   gene            complement(610332..611039)
FT                   /locus_tag="BARBAKC583_0596"
FT   CDS_pept        complement(610332..611039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0596"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45185"
FT                   /db_xref="GOA:A1USF1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF1"
FT                   /protein_id="ABM45185.1"
FT                   /translation="MIPEWLYFLFNPELLDSYGLKFLDGLIVTLELVSISFFIGFLLSI
FT                   PITLGHLSKNELLKYSAQTYTYFFRSSPLLAQLFLFYYGLGSIRDFWEKIGLWWFFQNA
FT                   WYCCIFIFALNSAAYQTIIFIGSFSSVKIGQHEASKALGLHSSTKFFKVILPQAMILAL
FT                   RPLGNEFTLIMKSSAIASLITIYDLMGIAKLLYARTLDFQVYIWAAIIYLIIVELIHRF
FT                   IILIERRLTRYLQ"
FT   gene            complement(611036..611758)
FT                   /locus_tag="BARBAKC583_0597"
FT   CDS_pept        complement(611036..611758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0597"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44521"
FT                   /db_xref="GOA:A1USF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF2"
FT                   /protein_id="ABM44521.1"
FT                   /translation="MIENLALLSFSNGGWGVVILLSAGMTLSLAVCCVLLGLPLGLLNA
FT                   MMTQSNIRIAKIIATSFSAIFRGLPELLILFLVYHGLQSLIQTVLDYLKIEMTFSINAF
FT                   IASVLALSMVFAAFSCEIWISALKVFNKGQYEAAKALGFSSSTTFFRIVFPQLIRNALP
FT                   GLSNNWLTLLKDTSLVSTISLVDLMRQTNLAVSATGKPMLFYLVACLLYLLFSAFSSLI
FT                   LRYLEIYTQENCQKVSSL"
FT   gene            complement(611817..612584)
FT                   /locus_tag="BARBAKC583_0598"
FT   CDS_pept        complement(611817..612584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0598"
FT                   /product="amino acid ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /note="identified by match to protein family HMM PF00497"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45106"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF3"
FT                   /protein_id="ABM45106.1"
FT                   /translation="MKSLVIALIASVALFTQWANAETLKIASEGSYPPFSYIDSNNKLH
FT                   GFDIDISYALCEKMKVECVIIAQDFDGIIPGLLAKKYDAIIASLNPTQERLKKIDFTNA
FT                   YYSTELAVIVTKDSNIEKISTEAFKGKNLGVQSNTVQAIYAEDNYASKGANIKLYPTAI
FT                   EVNRDLISHRLDVSITDKLQILNWLKNEGEECCKFLGVIENTKLPVAIAIRKKNENLKN
FT                   KFNQAIEEIHADGTYEKIIKKYFKSDSYNIDMN"
FT   gene            complement(612955..614247)
FT                   /gene="gltA"
FT                   /locus_tag="BARBAKC583_0599"
FT   CDS_pept        complement(612955..614247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="BARBAKC583_0599"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="identified by match to protein family HMM PF00285;
FT                   match to protein family HMM TIGR01798"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45250"
FT                   /db_xref="GOA:A1USF4"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF4"
FT                   /protein_id="ABM45250.1"
FT                   /translation="MPENKAYIIINDKKIELPVRKGTIGPDVIEIASLYKETDTFTYDP
FT                   GFTSTASCESKITYIDGDEGVLLYHGYSIDQLAENGDFLETCYLLLYGELPNKQQKIDF
FT                   DRCIMQHTMVHEQFARFFHGFRRDSHPMAVMVACLGAMSAFYHDSINITDPQQRMIASI
FT                   RLISKVPTLAAMAYKYSIGQPFVYPRNDLNYATNFLHMCFSVPCEEYKISPVIARAMDR
FT                   IFTLHADHEQNASTSTVRLAGSSGANPFACIAAGVACLWGPAHGGANEACLKMLQEIGS
FT                   VKKIPQFIARAKDKNDPFRLMGFGHRVYKNYDPRAKIMQKTCHEVLKELNIQDNPLFDI
FT                   AMELEHIALNDEYFINKKLYPNVDFYSGITLKALGFPTEMFTVLFALARSVGWVAQWKE
FT                   MIEDPEQKIGRPRQLYTGPTAREYISIDNRL"
FT   gene            complement(614495..615925)
FT                   /gene="gltX1"
FT                   /locus_tag="BARBAKC583_0600"
FT   CDS_pept        complement(614495..615925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX1"
FT                   /locus_tag="BARBAKC583_0600"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44719"
FT                   /db_xref="GOA:A1USF5"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USF5"
FT                   /protein_id="ABM44719.1"
FT                   /translation="MSVITRFAPSPTGFLHIGGARTALFNWLYAKHHGGKMLLRIEDTD
FT                   RERSTDAAVKAIINGLHWIGLSYDGDPISQFERTERHREVAEQLVKDGKAYYCYASPEE
FT                   LAEMRESARAEGRPPHYDGHWRDRDISEAPKGIKPVIRIKAPKEGATIVRDRVQGDVLF
FT                   PNKDLDDFIILRSDGTPTYMLAVVVDDHDMGITHIIRGDDHLTNAARQTIIFNAMGWKI
FT                   PVMAHIPLIHGEDGAKLSKRHGALGVDAYRAMGYLPAALRNYLVRLGWSHGNDEIISTE
FT                   DMISWFDIDDINKGAARLDFKKLNAINGHYIRMSTDQDLFDSTLSILPEIESGLEIIDK
FT                   LDKKHRAQFLAAIPHIKERSKTLLELIDGASFIFTKQPLLLDEKAKMLLNEDGQAILKS
FT                   IYPILESCSYWDTNTLDEALRHYAQKQELKFGTIAQPLRAALTGRATSPGVFDVLVLLG
FT                   RNESLNRINQQINTTKCS"
FT   gene            616042..618315
FT                   /locus_tag="BARBAKC583_0601"
FT   CDS_pept        616042..618315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0601"
FT                   /product="competence protein"
FT                   /note="identified by match to protein family HMM PF03772;
FT                   match to protein family HMM TIGR00360"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44426"
FT                   /db_xref="GOA:A1USF6"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF6"
FT                   /protein_id="ABM44426.1"
FT                   /translation="MLDPNKINDDLSIGNFSKKGNFILSQRGYPSIIDGSNNATYNEKK
FT                   LSLFNILRDFIILVWQWLIECIKKEISFGLLFLLILVFSTTGVIFYFSLDQEPNWEQFV
FT                   VLIISFLGILYILRCYRGIWLVVGFLFCVLLGALAAKIETWRMSTPMLSNNVSTTLTGR
FT                   IVSIETMEKGEFRLIVDVLKTKNPTLHYGPDRVRLVARHLPDGSVPGDGLYGKVRLRAL
FT                   SGPVRPGSYDFSFHNYFNRIGAQGTYFGKPIKISVSQPDTILGMASQKIENLRMKMTQR
FT                   IRTKISGEEGSVAAALITGQRGAISSDTNEALRMSGLAHILSISGLHMALLSGMVIIVI
FT                   RSFFALFPVFSSYYSTKKFSVIVALIITAFYLILSGAAVAAQRSFVMVAVMLIAVLCNR
FT                   SGVTMRNFAIAGLAIVVVVPHEILGPSFQMSFSATIALIAAFEWWSKRHSSDRRKITPS
FT                   HVGGKIVRFAFLSFSSTCSSSLIAGLASGIYAAYHFTNVAPFSIISNALALPIVSILVM
FT                   PFGLIAAFAMLLEFEWLPLQIMGFGISLVTKIAYSITAISPVINPGFIPLSTLILLSLG
FT                   LVGLTFFKTSLRFFFIIFIFIGIWVYVMRSPVQLIIADNMNLVGIINEKILYADRSRVS
FT                   KFTKSVWEKSFYINETIKPTKIGPALNGQFVCDDNICTALLENGLKVVVLYKETDQCIK
FT                   SDVIIQTSIMHDKTCNDVAGIVFTPQQLLSRGSVMMMKNKDIIWYYTAFHRPWNVHRQK
FT                   LQNL"
FT   gene            618674..619375
FT                   /gene="rpiA"
FT                   /locus_tag="BARBAKC583_0602"
FT   CDS_pept        618674..619375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="BARBAKC583_0602"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45346"
FT                   /db_xref="GOA:A1USF7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USF7"
FT                   /protein_id="ABM45346.1"
FT                   /translation="MNAQELKKVAAAKALEFVQDGMRLGIGSGSTANEFIRLLGERVAN
FT                   GLHVIGVATSHYSEQLCRQVGVPVTTLEQIPELDLDIDGADEIGPNMTLIKGGGGALLR
FT                   EKIVAAASHEMLIIADETKVVKTLGAFALPIAVNQFGLSVTRSAIEKMAKGLGLSGKVT
FT                   LRMNGDNPFKTDDGHFIFDASWGHIVQPKLLSNALFEIPGVIEHGLFVGLASRSIIAMA
FT                   DGQIKILEKKC"
FT   gene            619437..619979
FT                   /locus_tag="BARBAKC583_0603"
FT   CDS_pept        619437..619979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0603"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44599"
FT                   /db_xref="InterPro:IPR018637"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF8"
FT                   /protein_id="ABM44599.1"
FT                   /translation="MKNIFSLQHFVTSFGAIAILVVNIGLVHARDVSDQHLDAAKKMIK
FT                   AVHATDQFDSFLPIAARDLKNELIGNDPHLATTISDIVDKQALALAKRRADLEKEIAHV
FT                   YVKHFSQEELDKITIFYNSDAGKKFLKEVPSIARDSYAVFDMWRSSIVKDLMKNVEGEM
FT                   SKTLNLDKSATPMKLPL"
FT   gene            620181..621566
FT                   /gene="gor"
FT                   /locus_tag="BARBAKC583_0604"
FT   CDS_pept        620181..621566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gor"
FT                   /locus_tag="BARBAKC583_0604"
FT                   /product="glutathione-disulfide reductase"
FT                   /EC_number="1.8.1.7"
FT                   /note="identified by similarity to SP:P48639; match to
FT                   protein family HMM PF00070; match to protein family HMM
FT                   PF02852; match to protein family HMM PF07992; match to
FT                   protein family HMM TIGR01424"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44821"
FT                   /db_xref="GOA:A1USF9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006324"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1USF9"
FT                   /protein_id="ABM44821.1"
FT                   /translation="MSFDFDLFVIGGGSGGVRAARLAGALGKRVAIAEEYRIGGTCVIR
FT                   GCVPKKLFVYASQYAQEFSDSAGFGWKCADPIFDWQKLVAAKDKEISRLEELYRKILKN
FT                   NNVHIYESRVVFIDEHTLELTATGERIRAKKILIATGAKVAPNTVVGSDLCLTSNEIFD
FT                   LKKLPKSIIIIGGGYIGVEFSNIFHELGVQTTLLHRGDLILSGFDYDLRHLLSDAMIQK
FT                   GISVVYGAAVSQVKVESKSYNVTLANGQTITADQVMWATGRVPNTKGLGLEQAGVKLNS
FT                   AGAVIVDEKMMTNVPHIWAIGDVTGHLQLTPVAIHEAMCFINTTFKNTPTVPDYDLISV
FT                   AVFSQPEIGTVGLSEENAIRCYKRVEIYRTLFRPMRNILSGNSEKMFMKLVVDGESRIV
FT                   VGAHILGAGASEMIQLIGISLKGKLTKDVFDETMALHPTAAEELVTMYEPSYVYENGKK
FT                   LEN"
FT   gene            621641..623005
FT                   /locus_tag="BARBAKC583_0605"
FT   CDS_pept        621641..623005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0605"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF01474;
FT                   match to protein family HMM TIGR01358"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45115"
FT                   /db_xref="GOA:A1USG0"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG0"
FT                   /protein_id="ABM45115.1"
FT                   /translation="MREKWTPESWRTKPIKQVPTYPDKFLLANIEKKLCGYPPLVFVNE
FT                   VRDLKNELAAVAEGKAFLLQGGDCAESFAEHEAGRIRDFFRVFLQMALVLTFGSSKRVI
FT                   KTGRIAGQFAKPRSSDMEKKENDELPAYQGDIINDIEFSKSSRTPDPRRMSIVYHQSMV
FT                   TLNLLRAFVQNGYANLENIHKWIVNFIANNLQSERYELLAKRVFESIDFMHSINISEKM
FT                   NDALCQTPLYTSHEALLLGYEEALTRIDPTSGDWYATSGHMLWIGDRTRQLDHAHVEYC
FT                   RGIKNPVGLKCGPSLNPDELLKLIDILNPENESGRLTLIIRLGHDKVETYLPQLIRIVE
FT                   REKRKVVWSCDPMHGNTIIANGYKTRFFDHIFKEIENFFSIHWEEGTYPGGIHIEMTGR
FT                   HVTECIGGAQAISIDDLFDRYQTYCDPRLNANQALELSFLVAELIKKNRDTNQLI"
FT   gene            623117..624799
FT                   /gene="nadE"
FT                   /locus_tag="BARBAKC583_0606"
FT   CDS_pept        623117..624799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="BARBAKC583_0606"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /note="identified by similarity to SP:Q03638; match to
FT                   protein family HMM PF00795; match to protein family HMM
FT                   PF02540; match to protein family HMM PF06508; match to
FT                   protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44550"
FT                   /db_xref="GOA:A1USG1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG1"
FT                   /protein_id="ABM44550.1"
FT                   /translation="MMMAKELIKDDFRIAVAQLNPIVGDIEGNFVLAKMAHQKAQQQGA
FT                   DLVLLTELFISAYPPEDLVLKPAFTKACENAIKKLAKVTKEGPGIIIGAPIKRGDAIYN
FT                   GVVLLDNGQVIAEYLKFDLPNYLEFDEKRVFSPGPSPEPIVYRGITLGIVVCEDIWNDS
FT                   SICTEFRNKGAEFILVSNGSPYCHNKILKRMSIVRARAIQAGVPVIYANQVGGQDELIF
FT                   DGGSFALNEQGTVAFQMKHFESHIAVSHWQRKSIGWQCVSGPNEKLLGGLAADYHACVL
FT                   GLRDYVNKNGFKDVILGLSGGIDSALCAAIATDALGAERVRAIMMPYHYTSEESLKDAK
FT                   DCAHFLNCHYEIIPIVQPVENFLSIIAPIFSGLPSDVTEENLQSRVRGTILMALSNKFG
FT                   SMVITTGNKSEMAVGYATLYGDMNGGFNPIKDIYKMQVYALAEWRNKNHLLNFLGAEGV
FT                   VIPPNIIKKAPSAELRENQKDEDSLPPYPILDDILQSLVENDMSVDEIVKCGHLRETVE
FT                   KVEHLLYVAEHKRRQSAPGIKISSKNFGRDRRYPITNYFRDKS"
FT   gene            624810..626180
FT                   /gene="gltX2"
FT                   /locus_tag="BARBAKC583_0607"
FT   CDS_pept        624810..626180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltX2"
FT                   /locus_tag="BARBAKC583_0607"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /EC_number="6.1.1.17"
FT                   /note="identified by match to protein family HMM PF00749;
FT                   match to protein family HMM TIGR00464"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44944"
FT                   /db_xref="GOA:A1USG2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USG2"
FT                   /protein_id="ABM44944.1"
FT                   /translation="MIKVRFAPSPTGYIHIGNTRIALFNWLYAQANNGTFILRYDDTDL
FT                   ERSKQEYIDGIMTDLEWLDIKPDEIHHQSKRFSRYDKVAETLKERGLLYPCYETVEELG
FT                   RHRKIQLSRKLPPVYDRRALKLTKEDKRLLESQGRKPHWRFLLPNFESNPFQIKRTEIS
FT                   WDDIVKGKQTIDLASISDPVLIREDGSYLYTLPSVIDDIDMAITHIIRGEDHITNTGAQ
FT                   ITIFEALNAKLPAFGHINLLTTVSGQGLSKRNSDLSICSLREEGFESMAVRCLSVLTGT
FT                   SKNIEAHRDQKALLEHFSLQNTSKSAAKFDITDLISLNSHFVHELTYEEVKTRLEKLSI
FT                   CGEKAEYFWNTIRDNIDKVNDAALWWEIIHSDQSFDAVSFEDRAFLQQSVDLLPEGSLN
FT                   DESWKIWTTALKEKTDRKGKALFMSLRLALTGRQHGPEMGKLLPLLGREKIINRLTI"
FT   gene            complement(626256..627644)
FT                   /locus_tag="BARBAKC583_0608"
FT   CDS_pept        complement(626256..627644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0608"
FT                   /product="DEAD/DEAH box helicase domain/helicase conserved
FT                   C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45423"
FT                   /db_xref="GOA:A1USG3"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG3"
FT                   /protein_id="ABM45423.1"
FT                   /translation="MTPPLNNFDNLGLSAKVIKAVQLAGYTAPTPIQSETIPHVLQHKD
FT                   VLGIAQTGTGKTASFVLPMLTLLEKGRAKARMPRTLILEPTRELAAQVKENFDKYGINH
FT                   RLNVALLIGGVSFDHQDRKLERGADVLIATPGRLLDHFERGTLLLMGVEILVIDEADRM
FT                   LDMGFIPDIERICKLTPFTRQTLFFSATMAPEIIKLTEQFLHSPVCVEITKESSTARTI
FT                   TQRLVKSGSKAWHKRAVLRKLIHDENKELKNAIVFCNRKKDISELFRSLVKYNFSVGVL
FT                   HGDMDQHSRMNTLADFKENKLTLLVASDVAARGLDIPDVSHVFNYDVPTHAEDYIHRIG
FT                   RTGRAKRSGKAFTIVTKNDQKYISAIEKISKENIEWLDGDLSTLINDEVNDISLKTKST
FT                   KSPKKNIQKNAIKMPKDNAEICVKKTNNKATSSDKHHSQKEKTSPILAFGADIPAFMLV
FT                   KTRS"
FT   gene            complement(627797..628570)
FT                   /locus_tag="BARBAKC583_0609"
FT   CDS_pept        complement(627797..628570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0609"
FT                   /product="NAD(+)/NADH kinase"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45492"
FT                   /db_xref="GOA:A1USG4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG4"
FT                   /protein_id="ABM45492.1"
FT                   /translation="MTPLPSRFHFISSETEEAIKATNKLISIYGHSSLEETDIIVAIGG
FT                   DGTMLQTVRNVMNTQKPIYGMNRGSVGFLMNKFHEKKLPNRIAAAHKKNIHPLRMIAKS
FT                   ECKEHIEALAINEVSLFRQSYQAAKIRISVDDKVRIEQLSCDGILVATPAGSTAYNLSV
FT                   QGPILPLMAPLMALTPVSPFRPRYWRGALLPDTATVRFDMLEFDKRPVNAAADNVEVKS
FT                   VHSVTISSATDITVSILFDPNHSWDERILSEQFRY"
FT   gene            628819..628895
FT                   /locus_tag="BARBAKC583_0610"
FT   tRNA            628819..628895
FT                   /locus_tag="BARBAKC583_0610"
FT                   /product="tRNA-Arg"
FT   gene            complement(629272..629346)
FT                   /locus_tag="BARBAKC583_0611"
FT   tRNA            complement(629272..629346)
FT                   /locus_tag="BARBAKC583_0611"
FT                   /product="tRNA-Val"
FT   gene            complement(629441..629803)
FT                   /locus_tag="BARBAKC583_0612"
FT   CDS_pept        complement(629441..629803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0612"
FT                   /product="response regulator"
FT                   /note="identified by match to protein family HMM PF00072"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44957"
FT                   /db_xref="GOA:A1USG5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG5"
FT                   /protein_id="ABM44957.1"
FT                   /translation="MKRILLAEDDNDMRRFLVKALERAGYEVVDFDNGASAYECLQEKP
FT                   FSLLLTDIVMPEMDGIELARRATEIDPDLRVMFITGFAAVALNSNNDTLPDAKVLSKPF
FT                   HLRELVNEIGKILIAA"
FT   gene            629983..630096
FT                   /locus_tag="BARBAKC583_0613"
FT   CDS_pept        629983..630096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0613"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45357"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG6"
FT                   /protein_id="ABM45357.1"
FT                   /translation="MRNALKIGIRIEYFELFCHSKFEKVLSFYHVIKLWIC"
FT   gene            630537..631001
FT                   /locus_tag="BARBAKC583_0614"
FT   CDS_pept        630537..631001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0614"
FT                   /product="Hsp20/alpha crystallin family protein"
FT                   /note="identified by match to protein family HMM PF00011"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44842"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG7"
FT                   /protein_id="ABM44842.1"
FT                   /translation="MRQVDFSPFYRSTVGFDHLFNWFDSRVQPNDVSSYPPYNIERLSE
FT                   DSYRISMAVAGFSLNEIDIEIHCNQLTIKGEKMLENEDDGREFLYRGIASRAFERRFHL
FT                   ADHVKVIGAELSDGLLHIQLKREMPAELKPKKIAIQASSSIAKNSLDKTV"
FT   gene            complement(631217..631293)
FT                   /locus_tag="BARBAKC583_0615"
FT   tRNA            complement(631217..631293)
FT                   /locus_tag="BARBAKC583_0615"
FT                   /product="tRNA-Pro"
FT   gene            631806..632165
FT                   /locus_tag="BARBAKC583_0616"
FT   CDS_pept        631806..632165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0616"
FT                   /product="putative FeS assembly scaffold SufA"
FT                   /note="identified by match to protein family HMM PF01521;
FT                   match to protein family HMM TIGR00049; match to protein
FT                   family HMM TIGR01997"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44597"
FT                   /db_xref="GOA:A1USG8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG8"
FT                   /protein_id="ABM44597.1"
FT                   /translation="MSRCLVISLTEAAINRVKNIMETKDAHGILIGVKKGGCAGMEYTI
FT                   TLVKEEVRDTSADIVEINGARVFIARDAVLFLLGTQLDYEETALRSGFIFNNPNQISAC
FT                   GCGESVEIRPISQNS"
FT   gene            complement(632257..633162)
FT                   /locus_tag="BARBAKC583_0617"
FT   CDS_pept        complement(632257..633162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0617"
FT                   /product="bacterial lipid A biosynthesis acyltransferase"
FT                   /note="identified by match to protein family HMM PF03279"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45356"
FT                   /db_xref="GOA:A1USG9"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:A1USG9"
FT                   /protein_id="ABM45356.1"
FT                   /translation="MYHIKIIIKKSFDLLWSYLLIGFLAVLRYLPAKVGLSFFSWLATI
FT                   LGPLVSRHQIALANLKAAYPEKTEQELHKIAIEMWKNMGRLLAEYVFLDKIFDFDPKAD
FT                   QLSVVEVVGAEIFQRLKDEKKPHIFFTAHTGNFELLPVCAQSFDLNITVLFRPPNNPYI
FT                   AKRVLKARQTSMGHLVPSQAGAALALAEQLAQEKNVGMLIDQKFRRGISGTFFDRPVKT
FT                   NPLIIKLARQYECDIYPARCIRLAGGRYRLELYERIELPLNEKNEVDINASVQKLNDIV
FT                   ESWVCEYPEQWMWFHKRWDE"
FT   gene            complement(633193..634221)
FT                   /locus_tag="BARBAKC583_0618"
FT   CDS_pept        complement(633193..634221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0618"
FT                   /product="oxidoreductase, zinc-binding dehydrogenase
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44438"
FT                   /db_xref="GOA:A1USH0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH0"
FT                   /protein_id="ABM44438.1"
FT                   /translation="MRALQLFNERQVGITHIALPPPPSPGEVTVRIKAVALNHIDVWGW
FT                   RGMAFAKRKMPLTIGAEASGEIIQLGNGVDNLQLGQLVSIYGAHTCGLCQACHKGHDNL
FT                   CSHVKGVHGFHLDGFACELINLPARLLVPAPSECDEIQAAVAPVTFGTVEHMLFDNAKL
FT                   QIGETILIHAGGSGIGSAAIQIAKSMKCTIITTVGSDNKIAKAQSLGANYVINYRKDRF
FT                   EGVVRKLTQKKGVDVVFEHVGADTWAGSMLCMKQGARLVTCGSTSGVSAPMNLMQLFQQ
FT                   QLKIFGSFGCRMENMANAMQKMAQGIIHPIIDTIVHFDDIDVALKRMEKRDVFGKIILK
FT                   ID"
FT   gene            complement(634249..635547)
FT                   /locus_tag="BARBAKC583_0619"
FT   CDS_pept        complement(634249..635547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0619"
FT                   /product="putative 3-oxoacyl-(acyl carrier protein)
FT                   synthase"
FT                   /note="identified by similarity to PDB:1J3N_A; match to
FT                   protein family HMM PF00109; match to protein family HMM
FT                   PF02801"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45157"
FT                   /db_xref="GOA:A1USH1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH1"
FT                   /protein_id="ABM45157.1"
FT                   /translation="MMKYNDHLGRPLVAITGAGVITSLGQGKQENWQKLINGVSGIHKI
FT                   TRFPVEGLNTHIAGTIDFLKESTIGAAALSEKLAYLSAEEALEQSGLDKKNFDGPLFLA
FT                   APPVELEWKARFALDQLETFNIEPSYAHLLEICSRNPQKELFETTQFGAIAENLQEKFG
FT                   TKKLPITLSTACASGATAIQLGVEAIRRGETDRALTIATDGSVSAESLIRFSLLSALST
FT                   HNDPPEKAAKPFSHDRNGFVMAEGSGTLVLESLESALNRKAKILGILAGCGETADDFHR
FT                   TRSKPDASPATEAVRKALADAKMTINEIDYINAHGTSTPENEKMEYLALSAIFGDILKH
FT                   IPVSSNKSMIGHTLTAAGAIEAVFSLLTIQSGILPPTINYDDPDPAIPLDVVPNYSRNT
FT                   RVNAILSNSFGFGGQNSSLVITAYKEKFFHKKN"
FT   gene            complement(635563..636132)
FT                   /locus_tag="BARBAKC583_0620"
FT   CDS_pept        complement(635563..636132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0620"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase domain
FT                   protein"
FT                   /note="identified by similarity to RF:NP_770449.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44721"
FT                   /db_xref="GOA:A1USH2"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH2"
FT                   /protein_id="ABM44721.1"
FT                   /translation="MQNQAVFITGIGLISSLGEGVDHHWNKLNDPTVTPNLDCINFSPY
FT                   TVHKLTSVDWNQQIPKRSDQRQTDQTNRKKKPLKDTISKMLKMMKAQSSFAISAASGFN
FT                   EITKIEQNILDDANISYRGVTTLFGYLREAQFPLALALAAIAVKKKSSFPTLSTHEKSF
FT                   LKEVHEVFVTTIGIKRAEGMARLTAV"
FT   gene            complement(636143..636427)
FT                   /locus_tag="BARBAKC583_0621"
FT   CDS_pept        complement(636143..636427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0621"
FT                   /product="putative acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45478"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH3"
FT                   /protein_id="ABM45478.1"
FT                   /translation="MSSTFNKVADIISEISEIDRSVITPKSHTIDDLGIDSLDFLDIVF
FT                   AIDKAFGIKVPLEQWTQEVNEGSVATEKYFVLKNLCEKIDELVILKRAN"
FT   gene            complement(636621..638954)
FT                   /gene="dme"
FT                   /locus_tag="BARBAKC583_0622"
FT   CDS_pept        complement(636621..638954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dme"
FT                   /locus_tag="BARBAKC583_0622"
FT                   /product="NAD-dependent malic enzyme"
FT                   /EC_number="1.1.1.39"
FT                   /note="identified by similarity to SP:O30807; match to
FT                   protein family HMM PF00390; match to protein family HMM
FT                   PF01515; match to protein family HMM PF03949"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44714"
FT                   /db_xref="GOA:A1USH4"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH4"
FT                   /protein_id="ABM44714.1"
FT                   /translation="MSKKQNSNGSLQEDEFNSAALFYHQYPEPGKLKIQATKPLGNQRD
FT                   LALAYSPGVAAPCLAIHNDPKLAAQYTSRSNLVAVISNGTAVLGLGNIGPLASKPVMEG
FT                   KAVLFKKFANIDVFDIELDAPNIEQMVEIVSSLEPTFGGINLEDIKAPECFEIEEKLRA
FT                   KMNIPVFHDDQHGTAIIVSAAVLNGLNFSGKKIEDAKIVTSGAGAAALACLNLLVHLGA
FT                   KVENIWLSDLEGVVYEGRKTLMDRWKVKYAQKTDARTLSEIIENADIFLGLSAGHVLKP
FT                   EYLKKMASNPLILALANPTPEIMPEEARAVRPDAMICTGRSDYPNQVNNVLCFPYIFRG
FT                   ALDVGAIAINEEMKVAAVHAIANLAREESSDVVARAYSKEAPSFGPDYLIPSPFDPRLI
FT                   LRIAPAVAEAAIKTNVAVRPIKDISAYHDTLKRFVFRSGLTMKPVFAAAKAAKRKRVIY
FT                   ADGEDERVLRAAQIVLEEQTAIPLLIGRPHVIEARLKRFGLKILPGIDFELINPENDPR
FT                   FRDYVNLFLQYTARCGVSPEVAKTIVRTSTTAIAAIAVMREEADAMICGLEGHFERNFQ
FT                   LIEQIIGLDSNISHFSSVSLLISPDRVLFLTDTYVNENPSAEEIAEMTVLAAQEVEAFG
FT                   ITPKAALLSHSNFGSKDTESARKMRRATEILAKLYPDLEADGEMQGDAALSKIFRDRIF
FT                   PDSRLKSEANLLVFPTLDAANITLNIVKHLTDSLHVGPILIGAARPVHILTPSVTSRGV
FT                   VNMTALAVLAANRKKFHNKINKDK"
FT   gene            complement(639489..644120)
FT                   /locus_tag="BARBAKC583_0623"
FT   CDS_pept        complement(639489..644120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_032195.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45325"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH5"
FT                   /protein_id="ABM45325.1"
FT                   /translation="MTSRTKLQTFEVKVEEALEKAMNYDFDGVEIEKMSPDDSTDPTRI
FT                   DDLIERIATAEEEIITENGTSILASNIHDSAVIDGSVVEQLFGPKPTDGLSGGTVHNTL
FT                   LSSHPLPANDDITTPLNSISLKNNSTSRIYWNTTALSALWATGGAFIAQHLAPEGLNSL
FT                   ENIITFITSPTGLAVAAGTAIPIFMSWGFAQLTKRSNELRNIAILITNAAQHLNNDSQN
FT                   LSEKQAIVIGQTIRKEVAAMNEEIEHILGRAIEFEAIIQGEVRSLEHAYSENESRIHTL
FT                   IKELSNERTAILNHANRVQSTIKGTQEQLSDEFSLVTSQIATNVESLARTLSQTLQQQG
FT                   EDLIAKLSHIGNGVTSQLVEKFNATTEQMQQRNEDFFHALGRNLDSFSEHFNDNEKQLE
FT                   KTFNETAVRAEMHIAEIATHIQTATDQTLSRIDDKFKILDQAIIDRHNESLQDFDEKII
FT                   QLDKQANKISSQFDNITSEAIEAFENRLAKVDLSLREHSNSIIDAFICRSQAIEDNAEK
FT                   LELFLEAHTSQINANLEETTANIASTFTRGHDDILLAVDESKKLLREEIAHIDNMIVDV
FT                   IKERSQEFKVQFADQRDMMSEMLSSEKDKIANTLQDKIETLTQSVSNIEKTLIDNVQTI
FT                   DLHAENHVTNVIHCIDKLQETITQSCETTKDALETHTRNIDIRADALRDSLAINSFSLN
FT                   EILADQVNALEERMEGLHNIIAKSDIHVNVALKQQMDLVESAIVDNNKAITETVQNHIK
FT                   NLEDHTEILRDTLSHSNGVLFESLEMRMGSFDEDLENRARQIFEHASMLEETLSQKLSQ
FT                   VCETIQLQTSVLEENSDSLKTSIMLNNEYQKDVQNALDASVDHMRVTLENSVNTVTDSL
FT                   QDKIIQASDIISSTGEQMLSSLHDETDKVQEKLSNFSHELASIIADQVEKSENSILSTG
FT                   HKFISSVSDVAEKAENMILESGNRVVLNIEQTIQDTSQNAQTLFSEVVNTSTTAIEQLL
FT                   AERSGILYNSIQELENNLEYRLTNISNSLEATNNQTAAQISGHVEQLAELTDHLNQVVQ
FT                   HTAESLNNLTQHVGEQLSLSAEESEKRIFAQNQSLVNIITETGSETIQTMTAVKEDLIN
FT                   NISSILKQLNLSICNIHENSDVLISTVQNIDGQFNETANNFFQNTNQVAEYLSDANQEL
FT                   SNNMEILQKFVRNTFEKISDVTNNFGEHAKTLSEVINNLEKSENMLDGTLTKRQNALST
FT                   LSNSLIAKSDEVNQLIEHYENVLNLAFERTDENTRNSTQLLQQTLNQIINEATTCFSGA
FT                   AEDIRRSANEIRLELSKVNNDVNETIQKLPEKVKGTTNTIRYALDEEVTKLKDLANVVQ
FT                   SDNKKKKENRLTPKPLTSLTSNKDNGTSSNLIKKIVPSTSNLQKDQNKINKNKWVSNLL
FT                   ARASSAETSREEMDDNSTLSQVKTEARLMNKSLHSLAASVIKSINHDAIVELWNHYKRG
FT                   QNNIVTERLYTKSGQIIFEKIKQKYMNDPHFKYAVNQYIIDFEKLLRDVSRDTKDMNSA
FT                   RHYLVSDSGKVYTILAHASGRIK"
FT   gene            644989..645228
FT                   /gene="hfq"
FT                   /locus_tag="BARBAKC583_0624"
FT   CDS_pept        644989..645228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfq"
FT                   /locus_tag="BARBAKC583_0624"
FT                   /product="RNA chaperone Hfq"
FT                   /note="identified by similarity to GB:CAA53989.1; match to
FT                   protein family HMM PF01423; match to protein family HMM
FT                   TIGR02383"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44473"
FT                   /db_xref="GOA:A1USH6"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USH6"
FT                   /protein_id="ABM44473.1"
FT                   /translation="MVERSQHLQDVFLKTVRKQEISLTIFLVNGVKLTGIVTSFDNFCI
FT                   LLRRDGHAQLVYKHAISTIMPGQPIKIFEGEGCE"
FT   gene            645286..646659
FT                   /gene="hflX"
FT                   /locus_tag="BARBAKC583_0625"
FT   CDS_pept        645286..646659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="BARBAKC583_0625"
FT                   /product="GTP-binding proten HflX"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR03156"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45150"
FT                   /db_xref="GOA:A1USH7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH7"
FT                   /protein_id="ABM45150.1"
FT                   /translation="MDVNEGCGRFISQVLKRGRTVIFVPVYHGNKNEKIANERSVSSRV
FT                   KEALGLARAIGLDVVHHEIVNITTPHPSTLFGSGKVEEFKQVLSHFNEPRIAVLIVDYS
FT                   LTPVQQCNLEKLWNCKVIDRTALILEIFGDRAQTKEGVLQVELAYLSYQKGRLVRSWTH
FT                   LERQRGGHGFLGGPGETQIEADRRILQDKIVRVRRELKTVIKTRALHRANRKKTCHPVI
FT                   ALVGYTNAGKSTLFNRLSGANILTKDMLFATLDPTLRKITLPYGKTVLLSDTVGFISNL
FT                   PTHLIAAFRATLEEVIEADLIIHVRDISDPDHQFHAQDVLEILSSLGIDINDKGRIIEV
FT                   WNKIDILDQHVLNALQMNTKTLLNPALMVSALTGEGLKQLLITIEKLISGEMQNIEFVL
FT                   RPESMSLIDWFYKNSGKIEQESHDDGSITIKAVLTCEAKKRFDRIKRNYTSKSHLKSY"
FT   gene            646815..647380
FT                   /pseudo
FT                   /locus_tag="BARBAKC583_0626"
FT                   /note="conserved domain protein, degenerate; this region
FT                   contains one or more premature stops and/or frameshifts
FT                   which are not the result of sequencing error"
FT   gene            647530..648606
FT                   /locus_tag="BARBAKC583_0627"
FT   CDS_pept        647530..648606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0627"
FT                   /product="cytochrome oxidase assembly protein"
FT                   /note="identified by match to protein family HMM PF02628"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45618"
FT                   /db_xref="GOA:A1USH8"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="InterPro:IPR023754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USH8"
FT                   /protein_id="ABM45618.1"
FT                   /translation="MAIKKLNNITLTPLQKQNRKKIQVWLYTILLLCFAIVLVGGATRL
FT                   TGSGLSITEWKPIHGVIPPISINQWQEEFLKYQQIAQYKVLNRDMTLNAFKVIFWWEWG
FT                   HRVLGRFVGLVALLGLVLFWVTKRIEKNIFLQLLTVPILIAMQGIIGWWMVASGLGQSN
FT                   LTSVSQYRLAIHLIAACLVIIFVTYLSRGLAEYSEKPANQGVQHFAGWLVFLILVEIYF
FT                   GALVAGLHAGKVYNTWPLMDGQILPDGLLNYDPVWLNFFENPLTVQFVHRCFSYFLFIT
FT                   AVIHALYVQKSVPHSAHAHRAIFLCIMIVMQAFLGIITLLHEVPISLGLIHQGGALVVL
FT                   CFSVMHWRATKGAYRVVE"
FT   gene            complement(648627..649562)
FT                   /gene="argC"
FT                   /locus_tag="BARBAKC583_0628"
FT   CDS_pept        complement(648627..649562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="BARBAKC583_0628"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM TIGR01851"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45027"
FT                   /db_xref="GOA:A1USH9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1USH9"
FT                   /protein_id="ABM45027.1"
FT                   /translation="MATKIFIDGEHGTTGLQIQKRLAARSDLELLSIPHVDRHNIDLRY
FT                   DYFNQADIAILCLPDDAARETIKLLKNNKKIRIIDSSTAHRTATDWVYGFPEMTAEQKK
FT                   CIQAARYVANPGCYATGAISLLRPLREAGLLDAHYPISINAVSGYTGGGKLLIAQIENQ
FT                   SQQDSLQSNYFVYGLNLKHKHLSEIKIHGWINKTPIFVPSVGRFPQGMIVNLPLHRHLF
FT                   TKSANCSNLREIFKAHYEGQNIVSIASQEETETLTRLDPECLAHKDNMKIFVFGDEREG
FT                   IFNLCAVLDNLGKGASAAAVQNLNLMLLDS"
FT   gene            649870..651168
FT                   /gene="glyA"
FT                   /locus_tag="BARBAKC583_0629"
FT   CDS_pept        649870..651168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="BARBAKC583_0629"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45302"
FT                   /db_xref="GOA:A1USI0"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USI0"
FT                   /protein_id="ABM45302.1"
FT                   /translation="MIKRENDLQQCFFNDTLQTVDAAVFDAVSGELRRQCDEIELIASG
FT                   NIVSRAVLEAQGSVLTNKYAEGYPGKRYYGGCHFVDRIEELAIERAKNLFGAAFANVQP
FT                   NSGSQMNQAVFLALLQPGDTFMGLDLSSGGHLTHGSPVNMSGKWFNRIAYGLRQEDQLL
FT                   DIESVERLAKEHKPKLIFAGGTAYSRIWDWKRFREISDEVGAYLVVDMAHIAGLVAGGV
FT                   HPSPIPHAHIVTTTTHKSLRGPRGGMILTNDEVLAKKINSAVFPGLQGGPLMHVIAAKA
FT                   VALGEALQPAFKDYAAKVVANAKILAENLQNNGFTIVSGGTDNHLLLVDLRNKSLTGKH
FT                   AELALERASIICNKNNIPFDPQLPSITSGIRLGTPAATTRGFAENEFIQISDLISEVLD
FT                   GLTIAKNDDENFLVEAAVKKKVKNITDNFPFYS"
FT   gene            651194..651676
FT                   /gene="nrdR"
FT                   /locus_tag="BARBAKC583_0630"
FT   CDS_pept        651194..651676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="BARBAKC583_0630"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44932"
FT                   /db_xref="GOA:A1USI1"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USI1"
FT                   /protein_id="ABM44932.1"
FT                   /translation="MRCPYCQCEDTQVKDSRPAEEGAVIRRRRVCSVCGGRFTTFERVQ
FT                   LRELLVLKKSGRRELFNRDKLMKSVDLAMRKRNIDPDRIERAISGIVRRLESLGEPEIA
FT                   SEKIGYLVMESLKRIDDIAYIRFASVYRDFRNASDFHDIIDELSKDVADIESCFDE"
FT   gene            651669..652793
FT                   /gene="ribD"
FT                   /locus_tag="BARBAKC583_0631"
FT   CDS_pept        651669..652793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="BARBAKC583_0631"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44868"
FT                   /db_xref="GOA:A1USI2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:A1USI2"
FT                   /protein_id="ABM44868.1"
FT                   /translation="MNKKAQDCRFMAAAIRLAERHVGLTNENPSVGALIVRNDSTGPFI
FT                   VGYGVTALRGRPHAEVQALQMAGPLSKGATAYITLEPCVHYGKTSPCVDSLIDAGIARV
FT                   VIALIDPDERVCGRSIALLQAADIEVVKGVLEKESSEMLSAYLCTKKLKRCEVTLKMAI
FT                   SADNGVGKKGQGGVKISGATSHTYTHILRAQHNAIMVGIRTILADDPQLTCRLQGLEMR
FT                   SPIRVILDKDLRIPMDAKVIQTATQVPTWVICDATLSNQSKKMKLEQYGVCVHSIEISN
FT                   NFMQPLAILQLLCQLGINSVLLEGGAETGEKFLNAGCVDHLICFYASVILGENRIKAPY
FT                   FETYLSEFNEIETKMLENDRLRRWRRKILCSQGL"
FT   gene            652775..653392
FT                   /gene="ribE"
FT                   /locus_tag="BARBAKC583_0632"
FT   CDS_pept        652775..653392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="BARBAKC583_0632"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by match to protein family HMM PF00677;
FT                   match to protein family HMM TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45075"
FT                   /db_xref="GOA:A1USI3"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:A1USI3"
FT                   /protein_id="ABM45075.1"
FT                   /translation="MFTGIVTDIGCVEEIQPLAQGVRLNISTHYDLENLKVGASVACSG
FT                   ICLTVVECASTQKNSHWFAVEAWEETLRLTNLSQWKKGTFVNLERSLRLGDEMGGHLVS
FT                   GHVDGLAEIIDQKNERDMVYFRLQVPEQLAPFIAQKGSVALNGTSLTINYVEDNVFDVL
FT                   IIRHTLEMTTWGQAKVGDQVNLEVDQFARYAARLFNFKIKDE"
FT   gene            653477..653935
FT                   /gene="ribH"
FT                   /locus_tag="BARBAKC583_0633"
FT   CDS_pept        653477..653935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="BARBAKC583_0633"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44740"
FT                   /db_xref="GOA:A1USI4"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USI4"
FT                   /protein_id="ABM44740.1"
FT                   /translation="MTQKLHINPHLLIVEARFYNEISDELLAGAVSVLQKSGVSYDIIT
FT                   VPGALEIPAAIAFAEKDKTVFYDGYVALGCVIRGETYHFEIVADNSCRALMDLTVHQQL
FT                   AIGNGILTVENEKQAWARAKQGEKNKGDFAAEAALCMIALKKRFGDNR"
FT   gene            653939..654403
FT                   /gene="nusB"
FT                   /locus_tag="BARBAKC583_0634"
FT   CDS_pept        653939..654403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="BARBAKC583_0634"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45613"
FT                   /db_xref="GOA:A1USI5"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A1USI5"
FT                   /protein_id="ABM45613.1"
FT                   /translation="MTNIKYSPCLVNKRGAARLAAVQALYQMDIVGTGVMETAAEYEAY
FT                   RLGKEIDGDQYLDADFQWFRAIIAGVVRDQKKLDPMLHQQLSEEWSLSRLDSILRAILR
FT                   AGLWELINRKEVPVAVIINEYVDIAKAFFEDGEPKLVNAVLDNTAKNSRA"
FT   gene            complement(654480..654836)
FT                   /locus_tag="BARBAKC583_0635"
FT   CDS_pept        complement(654480..654836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0635"
FT                   /product="outer membrane protein, SmpA/OmlA family"
FT                   /note="identified by match to protein family HMM PF04355"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45082"
FT                   /db_xref="GOA:A1USI6"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:A1USI6"
FT                   /protein_id="ABM45082.1"
FT                   /translation="MSQVYKEGYILDQSALDSISIGSSQEQVLLSLGSPSLKAKYDNEV
FT                   FYYISQIRYRRMQFMKTKIVDRKVLAIYFDNNNQVERIANYGLQDGRVFDFITQTTPTS
FT                   SKDQSFLMQFIRGF"
FT   gene            655163..655720
FT                   /locus_tag="BARBAKC583_0636"
FT   CDS_pept        655163..655720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45437"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:A1USI7"
FT                   /protein_id="ABM45437.1"
FT                   /translation="MNIQNVSQMTFVFSYPVSVSSLPVKGIKVHICANQQECAHLAKNH
FT                   DLLEVKFCEGEFQILPWKKRGVYIKGLLRANIIQSCVVTLEPLENNIHENIEVVFVPEG
FT                   SNLLKPEMLEDTGELFLDAEGPDAPEIFYGDKIDIGAIVEEFFELSIDRYPRKENISMN
FT                   ILENSEDIEEKSSPFSILKEWR"
FT   gene            655867..656937
FT                   /gene="plsX"
FT                   /locus_tag="BARBAKC583_0637"
FT   CDS_pept        655867..656937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="BARBAKC583_0637"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45050"
FT                   /db_xref="GOA:A1USI8"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USI8"
FT                   /protein_id="ABM45050.1"
FT                   /translation="MIRISVDVMGGDYGPEVTIAGAAIAQKHLPKVHFLFYGIDEAVEP
FT                   VLKKYPDLLSVSHFYATESYTRMDEKPSQALRVGRGKSSMWHAIEAVKNGEADSCVSAG
FT                   NTGALMAMSYFCLKMIAETERPGIAGIWPTLRNDSIVLDIGATIGASANQLVDFAVMGA
FT                   SMFRSLYNVEKTTIGLLNVGVEEVKGLDEIKKAGIILSKVQFEGLEYKGFIEGNDIGKG
FT                   MVDVVVTEGFSGNIALKVAEGTAQQISELLKSAMRSSIFSRFGYLLSQSAFRKLKQKID
FT                   LDRVNGGVLLGLNGIVVKSHGSASASDFSSAIRIGYEMVNNELLKKIITDLQCFHEKKA
FT                   IFLNNKGESVIDKETI"
FT   gene            656987..657961
FT                   /gene="fabH"
FT                   /locus_tag="BARBAKC583_0638"
FT   CDS_pept        656987..657961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="BARBAKC583_0638"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF08541;
FT                   match to protein family HMM PF08545; match to protein
FT                   family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45195"
FT                   /db_xref="GOA:A1USI9"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USI9"
FT                   /protein_id="ABM45195.1"
FT                   /translation="MIRSVMCGVGSALPKKKLSNDEIAKFVETSDSWIVQRTGIHQRYI
FT                   ASENETTVSLGIEAAQVALTNAGMTIKDIDCIILATSTPNRTFPSSAVEIQHALGMSHG
FT                   FSFDVQAVCSGFIFALTIGDVYLRSGEAKRVLVIGSETFSRILDWKDRTTCVLFGDGAG
FT                   AAILEAREVEGNVAIDRGILSTKLRSNGAHIDKLYADGGPSTTQTIGYLRMKGQEVFKH
FT                   AVGIVTDVIDDCFAAVGMNPSQLDWFVPHQANKRIIEASAKKLGIKTDKVVITVDQHGN
FT                   TSAASVPLALATAVQDGRIKEGDLVLLEAMGGGFTWGAVLIRW"
FT   gene            658038..658349
FT                   /gene="ihfA"
FT                   /locus_tag="BARBAKC583_0639"
FT   CDS_pept        658038..658349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfA"
FT                   /locus_tag="BARBAKC583_0639"
FT                   /product="integration host factor, alpha subunit"
FT                   /note="identified by match to protein family HMM PF00216"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45644"
FT                   /db_xref="GOA:A1USJ0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USJ0"
FT                   /protein_id="ABM45644.1"
FT                   /translation="MTGRTVTRADLASAVCRKVGLSYTESAALVELILSEISDSLVKGE
FT                   MVKLSCFATFQVRSKSRRIGRNPKTGIEAPIPPRRVVTFKAANILKQRILDVHCAKQK"
FT   gene            658534..659040
FT                   /locus_tag="BARBAKC583_0640"
FT   CDS_pept        658534..659040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0640"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45371"
FT                   /db_xref="GOA:A1USJ1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ1"
FT                   /protein_id="ABM45371.1"
FT                   /translation="MDKSPDAFRTISEVAELLGLPQHVLRFWETRFPQIKPLKRGGGRR
FT                   YYRPVDIDFLNGIKQLLYGQGYTIKGVQRLLKENGTAFVIAIGSGDLDAMNVLIEKKHA
FT                   EKFPESIQTQSKKKSAFGLFEFMKGEEEEPVGAVNSHQNKTDKALLQEALFELIECKRV
FT                   LDRIQ"
FT   gene            complement(659071..661047)
FT                   /gene="thrS"
FT                   /locus_tag="BARBAKC583_0641"
FT   CDS_pept        complement(659071..661047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="BARBAKC583_0641"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM PF03129; match to protein family HMM PF07973;
FT                   match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44590"
FT                   /db_xref="GOA:A1USJ2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USJ2"
FT                   /protein_id="ABM44590.1"
FT                   /translation="MSFSISLSFPDGSQRDFPAEITGLELAESISKSLAKKAIAYSLNG
FT                   VIRDLLDPLEQSGQVEIITRDDPRALQLIRHSCAHVLAEAVQELFPETQVTIGPVIENG
FT                   FYYDFARQQPFTLEDLNTIEKKMREIIQRNKFFKKEIWSREKAKKIFSDKGELYKVELI
FT                   DAIPEDQDLKIYYQGDWFDLCRGPHVPSTGQIGNAFKLMKVAGAYWRGDANNPMLTRIY
FT                   GTAFSNENALKAYLNMLEEAEKRDHRRLGREMDLFHFQEEGPGMIFWHPKGWKMFQNLV
FT                   SYMRRRLDEHKYDEVNAPQVLDKSLWETSGHWGWYQENMFKTIPATNDWNDEHVYALKP
FT                   MNCPGHVQIFKHGLKSYRDLPIRLAEFGLLHRYEPSGSLHGLMRVRSFTQDDAHVFCTD
FT                   EQLADECLKINDLILSTYADFGFEEIILKLSTRPEKRVGSDELWDHAENIMMSVLKTIE
FT                   KEAKGRIKTSILQGEGAFYGPKFEYTLKDAIGREWQCGTTQVDFNLPERFEVFYINRDS
FT                   EKCQPVMIHRAIFGSMERFLGILIENFAGHMPLWLAPQQIVVTTITSEANEYAEKITAK
FT                   LKASGLSAVSDLRSEKINYKIREHSLQKVPVILVCGKRESETNSVNMRRLGSMNQISLP
FT                   IDQAIKQLTNEAIPPDLRRFMNS"
FT   gene            complement(661172..661525)
FT                   /locus_tag="BARBAKC583_0642"
FT   CDS_pept        complement(661172..661525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0642"
FT                   /product="conserved hypothetical protein TIGR00278"
FT                   /note="identified by similarity to SP:Q8YH92; match to
FT                   protein family HMM PF01809; match to protein family HMM
FT                   TIGR00278"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45001"
FT                   /db_xref="GOA:A1USJ3"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USJ3"
FT                   /protein_id="ABM45001.1"
FT                   /translation="MIEQHPKQGKIQTRNYAGPWRKTPGRLLGTGLIRLYQITLSNFIG
FT                   NQCRYMPTCSEYTYEAIARHGLWAGAWMGLFRIVCCNPFGTHGFDPVPTSLGSSYYFYK
FT                   PWCYRKISTKHNK"
FT   gene            complement(661518..661955)
FT                   /locus_tag="BARBAKC583_0643"
FT   CDS_pept        complement(661518..661955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0643"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to RF:YP_570374.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45407"
FT                   /db_xref="GOA:A1USJ4"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ4"
FT                   /protein_id="ABM45407.1"
FT                   /translation="MIDNIYSYTILKHAACISKIGRLNNPDATSKKHAHLCGSTVLVDL
FT                   KIDNNIVTDFSHEVNACVLGQASSSILAHHIIGKKTQDIKMLHKIIQYMLIKDGPPPSA
FT                   PFEAFSCLQPIKDYKERHASTMLTFNAVIDCIEQIEEKTND"
FT   gene            662083..662703
FT                   /gene="folE"
FT                   /locus_tag="BARBAKC583_0644"
FT   CDS_pept        662083..662703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="BARBAKC583_0644"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44443"
FT                   /db_xref="GOA:A1USJ5"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1USJ5"
FT                   /protein_id="ABM44443.1"
FT                   /translation="MHSAVEKVAEDLSLSRENLSLEEVEKAIRTLLLWVGENPDREGLL
FT                   ETPKRIAKVYKELFSGYGESVDEILGVVFEEVAGYDEPVIVKDIFFYSHCEHHMIPIIG
FT                   KAHVAYLPDKKIVGLSKIARVVDVFAHRLQTQETMTAQVANSLKKYLKPRGLAVLIEAE
FT                   HMCMAMRGVQKQGAATITTSFHGYYKKDQVAQANFMTITRGIR"
FT   gene            662845..662929
FT                   /locus_tag="BARBAKC583_0645"
FT   tRNA            662845..662929
FT                   /locus_tag="BARBAKC583_0645"
FT                   /product="tRNA-Leu"
FT   gene            663087..664298
FT                   /locus_tag="BARBAKC583_0646"
FT   CDS_pept        663087..664298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0646"
FT                   /product="putative lipoprotein"
FT                   /note="identified by similarity to RF:YP_033582.1; match to
FT                   protein family HMM PF05990"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45603"
FT                   /db_xref="GOA:A1USJ6"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ6"
FT                   /protein_id="ABM45603.1"
FT                   /translation="MVRFDGVTVKYITFLKYSVFFICIALLAACGNKRAVLWHGINATP
FT                   SMIAVQREVEGGPVLPKAIVPVYVATSRKMQNNYSQPYGSERSNQVYYNRVDVGIPQQH
FT                   VKGKVETNTYKPTHDKYFAAAALQKYIDKKHFKQKLNAELAKKKKGKREIFLFIHGYNN
FT                   NFADGTFRAAQFAYDYSLDVVTVHYSWPSAGAIPLYVYDRDSANFARDGLIELLTVISE
FT                   TNADQISVIAHSMGNFVIMEAFRTLALQRKYKPIRRITSFLMAAPDIDIDVFERQLNDI
FT                   KKLPNPTAVLVSRKDKALAVSGRLTGGHSRLGDGLSIEMLRKNGIAVLDVSNVDGGAHN
FT                   VFASSPTLMTLSREGSLSSTIMQGTEFSSSQAMLADSSNVLKETTNFTFYAPIHLFSVV
FT                   DFDP"
FT   gene            664431..664955
FT                   /locus_tag="BARBAKC583_0647"
FT   CDS_pept        664431..664955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44606"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ7"
FT                   /protein_id="ABM44606.1"
FT                   /translation="MVMQKHYTNTSTLVDYLSHYAARLSDIHTILLKIKKNNKDRSPDL
FT                   LRRIDATEKQLGEMGRVLIMEYRQHQENERFLKQILVSISDQLFLLNNDFKETGHLLLQ
FT                   EIRTLQFQTQCSCKGEEKQRFLYDQKSSCSQSKIDEIIKRLQKAREQLSVENPHLFEKE
FT                   IKVKIKNKILY"
FT   gene            complement(665209..667128)
FT                   /locus_tag="BARBAKC583_0648"
FT   CDS_pept        complement(665209..667128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="homology to a family of hypothetical proteins in
FT                   Leptospira interrogans; identified by similarity to
FT                   RF:NP_711581.1; match to protein family HMM PF07598"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45108"
FT                   /db_xref="InterPro:IPR011455"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ8"
FT                   /protein_id="ABM45108.1"
FT                   /translation="MKLKPFLFFFSLLMTIHTSSAAPVPQKKPDDPHDKSIHVKVHTGG
FT                   EYCYAPAFVNGESYVYITYCSSASVKFTRYDLFKRVAWNVNNVWLCMTAPSSVTGIGGQ
FT                   STEDWDYLLLRPCVINDPNQQWIIEGNAFYTADKKFRVKDYKWYAYISKNKNDYYDHTL
FT                   SMMDSWAKIIATPVNSNIKTFIGWKFVSGSSFSTYYITDYGSRSDVFDLYYNPDNGHIF
FT                   RYFPSTGVLSCMTSQQSTSDNWNWVGWKFCDDTVSQTKDIGFWDISQLYGREGPLLDHQ
FT                   GNFLRVTQYGISWGSPYTVKPDYLKQDTQNSPKSEFLFAYDFDRWGRYVNGNLGDTLVY
FT                   CPAPGKKENVVQTSTSKTRSKRSLPPDFTLTDAWIQRLYDIARSSTVAGQEHIAFCGPC
FT                   MLHTLQMLAELQEDNIGGPRQSGGYFFDTHPDRDPFISFRQRFPELAERLQTTENYVNL
FT                   PWHVGEDSYTRTSRVTRSAALMLLPQYNWRPSTMARTEEEMRSRLQDLLTAPPGTAWYV
FT                   SIVRSDRGGSNIIGHVQPILRTNQGLVLIPTNILHILTLDQFRLALTPTTNIDALIHYL
FT                   SIGRTQILHSLITYQMAQLDEIPLSVYISQRNCTGEGENRRGNRQLPRTSLLNQCDSGR
FT                   CAVQ"
FT   gene            complement(667843..667917)
FT                   /locus_tag="BARBAKC583_0649"
FT   tRNA            complement(667843..667917)
FT                   /locus_tag="BARBAKC583_0649"
FT                   /product="tRNA-Asn"
FT   gene            668105..668178
FT                   /locus_tag="BARBAKC583_0650"
FT   tRNA            668105..668178
FT                   /locus_tag="BARBAKC583_0650"
FT                   /product="tRNA-Cys"
FT   gene            668413..669087
FT                   /locus_tag="BARBAKC583_0651"
FT   CDS_pept        668413..669087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0651"
FT                   /product="putative protein-L-isoaspartate
FT                   O-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01135"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44456"
FT                   /db_xref="GOA:A1USJ9"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1USJ9"
FT                   /protein_id="ABM44456.1"
FT                   /translation="MVANFTELRRKMVDNQIRTVDVTNLSILEAFLTVPREDFVPEDVK
FT                   DLSYLDTDILIFPPQGDIPASYLMKPASLAKLLQLAAVKPSDSVLDIGANSGYCAALLS
FT                   KLAKSIIALESNKALSKQAAELLERYQCDNVVVVHGLLEKGCAVKGPYDLIFIEGAVDF
FT                   IPDGIFDQMKEGGRLLVVEGHGNAGIAQIYIKEEGSISARRGFNLSVKPLSEFLRIPDF
FT                   VF"
FT   gene            669141..670427
FT                   /locus_tag="BARBAKC583_0652"
FT   CDS_pept        669141..670427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0652"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01844"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45367"
FT                   /db_xref="GOA:A1USK0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK0"
FT                   /protein_id="ABM45367.1"
FT                   /translation="MFKISKKFQVCLLLTLGTFVSGSAYADTLENALAKAYVYNAKLNY
FT                   ERAATRIANDDVTIARAGFLPQIDGIGNYNRNNATGSYKNSGSIELRINQRLFDFVTQN
FT                   VFLSAQVKMQAQRESFRNAEQNLFLDVIKAYANVYQTRRIAELRRENLAALEELVRSNQ
FT                   AKLDVGEVAQVDFAQAQAARSFAVSEYSLARSEAKSAEAIYQQVVGDYPAKLESPSGAK
FT                   ELPESLDIGYQIAVVTHPAILYAKYLVDASSYNVKAKEGAMFPKLDLSASMSYNRAYGI
FT                   PGGDSVSQSVGLSLSVPIFEGGRTSAQVRQSREQFEQARLQFDLAQSDVKQALASAWFQ
FT                   LEGTRASVVAYRESVRAAEIALKGRMQENRLGQATTLDVLKSRTELINAQISLVTAERN
FT                   AIIASYTVQSSIGRLTASYLGLKATQDTH"
FT   gene            670610..671185
FT                   /locus_tag="BARBAKC583_0653"
FT   CDS_pept        670610..671185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0653"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:CAC46094.1"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44646"
FT                   /db_xref="InterPro:IPR019632"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK1"
FT                   /protein_id="ABM44646.1"
FT                   /translation="MVQSSSALREPSMDEILTSIREIIEENAIQADQISNKVVVTNSSS
FT                   EKSSTVPLEGLDEAALSVDDAIKTLADRIGISSDDEDLSFAHMKNNAEVENNTKYGTVG
FT                   LDMQKMKFSSEEQMSVHKTGQDDTRGSQQGDTISDYVGSSARFVSSAEKIAEDILRPAI
FT                   AEWLQRELPVVLERILREEIVKIIKKLP"
FT   gene            671349..674075
FT                   /gene="valS1"
FT                   /locus_tag="BARBAKC583_0654"
FT   CDS_pept        671349..674075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS1"
FT                   /locus_tag="BARBAKC583_0654"
FT                   /product="valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="identified by match to protein family HMM PF00133;
FT                   match to protein family HMM PF08264; match to protein
FT                   family HMM PF09334; match to protein family HMM TIGR00422"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45516"
FT                   /db_xref="GOA:A1USK2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK2"
FT                   /protein_id="ABM45516.1"
FT                   /translation="MLEKTYNAAAVESRIAKQWETRGAFKAGAGSKSCTEAFCVMLPPP
FT                   NVTGSLHMGHALNATIQDIMVRFQRMHGKNVLWQPGMDHAGIATQMVVERQLAERQEPT
FT                   RQEMGREKFIERVWKWRHEAGNVISSQLRRLGVSCDWSRERFTMDEGLSEAVREVFVRL
FT                   YKQGLIYKDKRLVNWDPKLLTAISDLEVESKEIQGHLWHFRYPLEGKIFDQDDPTTFIT
FT                   IATTRPETMLGDTGIAVNPRDHRYKDLIGKNAILPFVGRKLLIVGDDYADPEEGSGAVK
FT                   ITPAHDFNDFEIGKKNNLPLINIFTQRAKIFLRDNEAFFDGLVVSDQLKELVKNVDQSD
FT                   RFVARDRIVSLMEEGGYLVTVDDHLHTVPHGDRSGVPIEPLLTDQWYVNAAELAKPAIE
FT                   AVHQGKMHFVPDSWKKTYFNWMENIQPWCISRQLWWGHQIPAWYGPDGTIFVEKNEEEA
FT                   LASALSYYGTEVKLTRDQDVLDTWFSSALWPFSTLGWPHKTNELTTFYPTSLSVTGFDI
FT                   IFFWVARMMMMGIHFMGEVPFPIVYVHALVRDAHGAKMSKSKGNIVDPLELIDQYSADA
FT                   LRFTLAIMAAQGRDVKLDPSRIAGYRNFATKLWNAARFAEINNVKHDLAFKPEQTKLAF
FT                   NRWILTELSKTVSIVTSSIENYKFNEAASALYRFIWNALCDWYLEFLKPIFQGGDEDSK
FT                   KEAQACTAWVLDEVYKLLHPFMPHITEELWSLTAMPGTKREDMLALTQWPQIIFSDEEA
FT                   AADVNWLIDVISGIRSIRSEMNIPAAALAPLVIITEGGEEIQERVQRYEAILKRLARVE
FT                   TICFSNKIPEVSAQIILGKETFCLLLGQLIDLDAERARLIKDISKIEQDIEKISIKLNN
FT                   PKFVENAKLEIVESERKRILELHAAREKASVALERLA"
FT   gene            complement(674643..675377)
FT                   /gene="gltL1"
FT                   /locus_tag="BARBAKC583_0655"
FT   CDS_pept        complement(674643..675377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltL1"
FT                   /locus_tag="BARBAKC583_0655"
FT                   /product="glutamate/aspartate ABC transporter, ATP-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P0AAG3; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44608"
FT                   /db_xref="GOA:A1USK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK3"
FT                   /protein_id="ABM44608.1"
FT                   /translation="MIQIKNVSNWYGEVNILKNCTTNIDKGEVVVVCGPSGSGKSTFIK
FT                   TINALVPFQKGEIWINGIPVHSKETNLPKLRSHVGMVFQHFELFPHLSVTENLTIAQIK
FT                   VLKRSKKEALERGLLYLERVGLIEHKDKYPGQLSGGQQQRVAIARALTMDPLVMLFDEP
FT                   TSALDPEMVSEVLDVMTGLAEEGMTMICVTHEMSFAQKVSKRIIFMDQGAILEDCSSEE
FT                   FFSNPQNRTPRAQEFLSKILSH"
FT   gene            complement(675401..676117)
FT                   /gene="gltK1"
FT                   /locus_tag="BARBAKC583_0656"
FT   CDS_pept        complement(675401..676117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltK1"
FT                   /locus_tag="BARBAKC583_0656"
FT                   /product="glutamate/aspartate ABC transporter, permease
FT                   protein GltK"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ABM45316"
FT                   /db_xref="GOA:A1USK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK4"
FT                   /protein_id="ABM45316.1"
FT                   /translation="MIDFMSSNFWSYFPFEFSSFDFSFFTFEIFRSYILSGLLFSVFLT
FT                   FVATIFGLIFGVLLAMMRLSSIKPFSWFAAIYITAMRSIPLVMVILWFFVLLPFLIGTS
FT                   IGANNSAIITFTAFEAAYFAEIMRAGIHSISQGQKQAGHALGMTYWQNMYIVILPQAFR
FT                   NMLPVFLTQVIILFQDTTLVYAISGNSLLNGFDLVSNNFGVKPEAYILAAVFYFGICFT
FT                   LSQIVLYLQKKISIIR"
FT   gene            complement(676119..676871)
FT                   /gene="gltJ1"
FT                   /locus_tag="BARBAKC583_0657"
FT   CDS_pept        complement(676119..676871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltJ1"
FT                   /locus_tag="BARBAKC583_0657"
FT                   /product="glutamate/aspartate ABC transporter, permease
FT                   protein GltJ"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44562"
FT                   /db_xref="GOA:A1USK5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK5"
FT                   /protein_id="ABM44562.1"
FT                   /translation="MDFSFLCLDDLTQMPVAGCLGTSGISHTYLDTLLDGFKNTAVLSI
FT                   SSLILAVFVGVVIGTVRTLPNTSVINNTFRAIGGIWVEIMRNIPLLVQVFLWYFVVPKI
FT                   YPPAMNFSPIILITCALGFFTSARIAEQVRSGIESIPSGQRYAAMAIGFTTYQSYRYIM
FT                   IPRAIRTILPPLTSEAMGIVKNSSIAFAVSIHELMQFQYQTIEEVSHVYENYMLVTILY
FT                   IIISLFIFVMMAIMEKMLKIPNLKTQER"
FT   gene            complement(677017..678399)
FT                   /locus_tag="BARBAKC583_0658"
FT   CDS_pept        complement(677017..678399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BARBAKC583_0658"
FT                   /product="putative glutamate/aspartate ABC transporter,
FT                   permease protein/periplasmic glutamate/aspartate-binding
FT                   protein"
FT                   /note="identified by similarity to SP:P37902; match to
FT                   protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:BARBAKC583_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ABM44909"
FT                   /db_xref="GOA:A1USK6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1USK6"
FT                   /protein_id="ABM44909.1"
FT