(data stored in ACNUC8465 zone)

EMBL: CP000529

ID   CP000529; SV 1; circular; genomic DNA; STD; PRO; 4410291 BP.
XX
AC   CP000529; AANM01000000-AANM01000054;
XX
PR   Project:PRJNA13418;
XX
DT   05-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Polaromonas naphthalenivorans CJ2, complete genome.
XX
KW   .
XX
OS   Polaromonas naphthalenivorans CJ2
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Polaromonas.
XX
RN   [1]
RP   1-4410291
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D.R., Brettin T., Bruce D., Han C., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Madsen E.L.,
RA   Richardson P.;
RT   "Complete sequence of Chromosome1 of Polaromonas naphthalenivorans CJ2";
RL   Unpublished.
XX
RN   [2]
RP   1-4410291
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D.R., Brettin T., Bruce D., Han C., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Madsen E.L.,
RA   Richardson P.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f02dc69d4390d88737f312e1a373810f.
DR   BioSample; SAMN02598302.
DR   EnsemblGenomes-Gn; EBG00001020019.
DR   EnsemblGenomes-Gn; EBG00001020021.
DR   EnsemblGenomes-Gn; EBG00001020023.
DR   EnsemblGenomes-Gn; EBG00001020025.
DR   EnsemblGenomes-Gn; EBG00001020027.
DR   EnsemblGenomes-Gn; EBG00001020029.
DR   EnsemblGenomes-Gn; EBG00001020031.
DR   EnsemblGenomes-Gn; EBG00001020033.
DR   EnsemblGenomes-Gn; EBG00001020035.
DR   EnsemblGenomes-Gn; EBG00001020037.
DR   EnsemblGenomes-Gn; EBG00001020039.
DR   EnsemblGenomes-Gn; EBG00001020041.
DR   EnsemblGenomes-Gn; EBG00001020043.
DR   EnsemblGenomes-Gn; EBG00001020045.
DR   EnsemblGenomes-Gn; EBG00001020047.
DR   EnsemblGenomes-Gn; EBG00001020049.
DR   EnsemblGenomes-Gn; EBG00001020050.
DR   EnsemblGenomes-Gn; EBG00001020052.
DR   EnsemblGenomes-Gn; EBG00001020054.
DR   EnsemblGenomes-Gn; EBG00001020056.
DR   EnsemblGenomes-Gn; EBG00001020058.
DR   EnsemblGenomes-Gn; EBG00001020060.
DR   EnsemblGenomes-Gn; EBG00001020062.
DR   EnsemblGenomes-Gn; EBG00001020063.
DR   EnsemblGenomes-Gn; EBG00001020065.
DR   EnsemblGenomes-Gn; EBG00001020067.
DR   EnsemblGenomes-Gn; EBG00001020069.
DR   EnsemblGenomes-Gn; EBG00001020071.
DR   EnsemblGenomes-Gn; EBG00001020073.
DR   EnsemblGenomes-Gn; EBG00001020075.
DR   EnsemblGenomes-Gn; EBG00001020077.
DR   EnsemblGenomes-Gn; EBG00001020080.
DR   EnsemblGenomes-Gn; EBG00001020082.
DR   EnsemblGenomes-Gn; EBG00001020084.
DR   EnsemblGenomes-Gn; EBG00001020086.
DR   EnsemblGenomes-Gn; EBG00001020088.
DR   EnsemblGenomes-Gn; EBG00001020090.
DR   EnsemblGenomes-Gn; EBG00001020091.
DR   EnsemblGenomes-Gn; EBG00001020093.
DR   EnsemblGenomes-Gn; EBG00001020095.
DR   EnsemblGenomes-Gn; EBG00001020097.
DR   EnsemblGenomes-Gn; EBG00001020099.
DR   EnsemblGenomes-Gn; EBG00001020100.
DR   EnsemblGenomes-Gn; EBG00001020102.
DR   EnsemblGenomes-Gn; EBG00001020104.
DR   EnsemblGenomes-Gn; EBG00001020106.
DR   EnsemblGenomes-Gn; EBG00001020108.
DR   EnsemblGenomes-Gn; EBG00001020110.
DR   EnsemblGenomes-Gn; EBG00001020112.
DR   EnsemblGenomes-Gn; EBG00001020114.
DR   EnsemblGenomes-Gn; EBG00001020115.
DR   EnsemblGenomes-Gn; EBG00001020118.
DR   EnsemblGenomes-Gn; EBG00001020120.
DR   EnsemblGenomes-Gn; EBG00001020123.
DR   EnsemblGenomes-Gn; EBG00001020124.
DR   EnsemblGenomes-Gn; EBG00001020126.
DR   EnsemblGenomes-Gn; EBG00001020128.
DR   EnsemblGenomes-Gn; EBG00001020130.
DR   EnsemblGenomes-Gn; EBG00001020132.
DR   EnsemblGenomes-Gn; EBG00001020134.
DR   EnsemblGenomes-Gn; EBG00001020136.
DR   EnsemblGenomes-Gn; EBG00001020138.
DR   EnsemblGenomes-Gn; EBG00001020140.
DR   EnsemblGenomes-Gn; EBG00001020142.
DR   EnsemblGenomes-Gn; EBG00001020143.
DR   EnsemblGenomes-Gn; EBG00001020145.
DR   EnsemblGenomes-Gn; EBG00001020148.
DR   EnsemblGenomes-Gn; Pnap_R0002.
DR   EnsemblGenomes-Gn; Pnap_R0003.
DR   EnsemblGenomes-Gn; Pnap_R0004.
DR   EnsemblGenomes-Gn; Pnap_R0005.
DR   EnsemblGenomes-Gn; Pnap_R0006.
DR   EnsemblGenomes-Gn; Pnap_R0007.
DR   EnsemblGenomes-Gn; Pnap_R0008.
DR   EnsemblGenomes-Gn; Pnap_R0009.
DR   EnsemblGenomes-Gn; Pnap_R0010.
DR   EnsemblGenomes-Gn; Pnap_R0011.
DR   EnsemblGenomes-Gn; Pnap_R0012.
DR   EnsemblGenomes-Gn; Pnap_R0013.
DR   EnsemblGenomes-Gn; Pnap_R0014.
DR   EnsemblGenomes-Gn; Pnap_R0015.
DR   EnsemblGenomes-Gn; Pnap_R0016.
DR   EnsemblGenomes-Gn; Pnap_R0017.
DR   EnsemblGenomes-Gn; Pnap_R0018.
DR   EnsemblGenomes-Gn; Pnap_R0019.
DR   EnsemblGenomes-Gn; Pnap_R0020.
DR   EnsemblGenomes-Gn; Pnap_R0021.
DR   EnsemblGenomes-Gn; Pnap_R0022.
DR   EnsemblGenomes-Gn; Pnap_R0023.
DR   EnsemblGenomes-Gn; Pnap_R0024.
DR   EnsemblGenomes-Gn; Pnap_R0026.
DR   EnsemblGenomes-Gn; Pnap_R0027.
DR   EnsemblGenomes-Gn; Pnap_R0028.
DR   EnsemblGenomes-Gn; Pnap_R0029.
DR   EnsemblGenomes-Gn; Pnap_R0030.
DR   EnsemblGenomes-Gn; Pnap_R0031.
DR   EnsemblGenomes-Gn; Pnap_R0032.
DR   EnsemblGenomes-Gn; Pnap_R0033.
DR   EnsemblGenomes-Gn; Pnap_R0034.
DR   EnsemblGenomes-Gn; Pnap_R0035.
DR   EnsemblGenomes-Gn; Pnap_R0036.
DR   EnsemblGenomes-Gn; Pnap_R0037.
DR   EnsemblGenomes-Gn; Pnap_R0038.
DR   EnsemblGenomes-Gn; Pnap_R0039.
DR   EnsemblGenomes-Gn; Pnap_R0040.
DR   EnsemblGenomes-Gn; Pnap_R0041.
DR   EnsemblGenomes-Gn; Pnap_R0042.
DR   EnsemblGenomes-Gn; Pnap_R0043.
DR   EnsemblGenomes-Gn; Pnap_R0044.
DR   EnsemblGenomes-Gn; Pnap_R0045.
DR   EnsemblGenomes-Gn; Pnap_R0046.
DR   EnsemblGenomes-Gn; Pnap_R0047.
DR   EnsemblGenomes-Gn; Pnap_R0048.
DR   EnsemblGenomes-Gn; Pnap_R0049.
DR   EnsemblGenomes-Gn; Pnap_R0050.
DR   EnsemblGenomes-Gn; Pnap_R0051.
DR   EnsemblGenomes-Gn; Pnap_R0052.
DR   EnsemblGenomes-Gn; Pnap_R0054.
DR   EnsemblGenomes-Gn; Pnap_R0055.
DR   EnsemblGenomes-Gn; Pnap_R0056.
DR   EnsemblGenomes-Gn; Pnap_R0057.
DR   EnsemblGenomes-Gn; Pnap_R0058.
DR   EnsemblGenomes-Tr; EBT00001622939.
DR   EnsemblGenomes-Tr; EBT00001622940.
DR   EnsemblGenomes-Tr; EBT00001622941.
DR   EnsemblGenomes-Tr; EBT00001622942.
DR   EnsemblGenomes-Tr; EBT00001622943.
DR   EnsemblGenomes-Tr; EBT00001622944.
DR   EnsemblGenomes-Tr; EBT00001622945.
DR   EnsemblGenomes-Tr; EBT00001622946.
DR   EnsemblGenomes-Tr; EBT00001622947.
DR   EnsemblGenomes-Tr; EBT00001622948.
DR   EnsemblGenomes-Tr; EBT00001622949.
DR   EnsemblGenomes-Tr; EBT00001622950.
DR   EnsemblGenomes-Tr; EBT00001622951.
DR   EnsemblGenomes-Tr; EBT00001622952.
DR   EnsemblGenomes-Tr; EBT00001622953.
DR   EnsemblGenomes-Tr; EBT00001622954.
DR   EnsemblGenomes-Tr; EBT00001622955.
DR   EnsemblGenomes-Tr; EBT00001622956.
DR   EnsemblGenomes-Tr; EBT00001622957.
DR   EnsemblGenomes-Tr; EBT00001622958.
DR   EnsemblGenomes-Tr; EBT00001622959.
DR   EnsemblGenomes-Tr; EBT00001622960.
DR   EnsemblGenomes-Tr; EBT00001622961.
DR   EnsemblGenomes-Tr; EBT00001622962.
DR   EnsemblGenomes-Tr; EBT00001622963.
DR   EnsemblGenomes-Tr; EBT00001622964.
DR   EnsemblGenomes-Tr; EBT00001622965.
DR   EnsemblGenomes-Tr; EBT00001622966.
DR   EnsemblGenomes-Tr; EBT00001622967.
DR   EnsemblGenomes-Tr; EBT00001622968.
DR   EnsemblGenomes-Tr; EBT00001622969.
DR   EnsemblGenomes-Tr; EBT00001622970.
DR   EnsemblGenomes-Tr; EBT00001622971.
DR   EnsemblGenomes-Tr; EBT00001622972.
DR   EnsemblGenomes-Tr; EBT00001622973.
DR   EnsemblGenomes-Tr; EBT00001622974.
DR   EnsemblGenomes-Tr; EBT00001622975.
DR   EnsemblGenomes-Tr; EBT00001622976.
DR   EnsemblGenomes-Tr; EBT00001622977.
DR   EnsemblGenomes-Tr; EBT00001622978.
DR   EnsemblGenomes-Tr; EBT00001622979.
DR   EnsemblGenomes-Tr; EBT00001622980.
DR   EnsemblGenomes-Tr; EBT00001622981.
DR   EnsemblGenomes-Tr; EBT00001622982.
DR   EnsemblGenomes-Tr; EBT00001622983.
DR   EnsemblGenomes-Tr; EBT00001622984.
DR   EnsemblGenomes-Tr; EBT00001622985.
DR   EnsemblGenomes-Tr; EBT00001622986.
DR   EnsemblGenomes-Tr; EBT00001622987.
DR   EnsemblGenomes-Tr; EBT00001622988.
DR   EnsemblGenomes-Tr; EBT00001622989.
DR   EnsemblGenomes-Tr; EBT00001622990.
DR   EnsemblGenomes-Tr; EBT00001622991.
DR   EnsemblGenomes-Tr; EBT00001622992.
DR   EnsemblGenomes-Tr; EBT00001622993.
DR   EnsemblGenomes-Tr; EBT00001622994.
DR   EnsemblGenomes-Tr; EBT00001622995.
DR   EnsemblGenomes-Tr; EBT00001622996.
DR   EnsemblGenomes-Tr; EBT00001622997.
DR   EnsemblGenomes-Tr; EBT00001622998.
DR   EnsemblGenomes-Tr; EBT00001622999.
DR   EnsemblGenomes-Tr; EBT00001623000.
DR   EnsemblGenomes-Tr; EBT00001623001.
DR   EnsemblGenomes-Tr; EBT00001623002.
DR   EnsemblGenomes-Tr; EBT00001623003.
DR   EnsemblGenomes-Tr; EBT00001623004.
DR   EnsemblGenomes-Tr; EBT00001623005.
DR   EnsemblGenomes-Tr; Pnap_R0002-1.
DR   EnsemblGenomes-Tr; Pnap_R0003-1.
DR   EnsemblGenomes-Tr; Pnap_R0004-1.
DR   EnsemblGenomes-Tr; Pnap_R0005-1.
DR   EnsemblGenomes-Tr; Pnap_R0006-1.
DR   EnsemblGenomes-Tr; Pnap_R0007-1.
DR   EnsemblGenomes-Tr; Pnap_R0008-1.
DR   EnsemblGenomes-Tr; Pnap_R0009-1.
DR   EnsemblGenomes-Tr; Pnap_R0010-1.
DR   EnsemblGenomes-Tr; Pnap_R0011-1.
DR   EnsemblGenomes-Tr; Pnap_R0012-1.
DR   EnsemblGenomes-Tr; Pnap_R0013-1.
DR   EnsemblGenomes-Tr; Pnap_R0014-1.
DR   EnsemblGenomes-Tr; Pnap_R0015-1.
DR   EnsemblGenomes-Tr; Pnap_R0016-1.
DR   EnsemblGenomes-Tr; Pnap_R0017-1.
DR   EnsemblGenomes-Tr; Pnap_R0018-1.
DR   EnsemblGenomes-Tr; Pnap_R0019-1.
DR   EnsemblGenomes-Tr; Pnap_R0020-1.
DR   EnsemblGenomes-Tr; Pnap_R0021-1.
DR   EnsemblGenomes-Tr; Pnap_R0022-1.
DR   EnsemblGenomes-Tr; Pnap_R0023-1.
DR   EnsemblGenomes-Tr; Pnap_R0024-1.
DR   EnsemblGenomes-Tr; Pnap_R0026-1.
DR   EnsemblGenomes-Tr; Pnap_R0027-1.
DR   EnsemblGenomes-Tr; Pnap_R0028-1.
DR   EnsemblGenomes-Tr; Pnap_R0029-1.
DR   EnsemblGenomes-Tr; Pnap_R0030-1.
DR   EnsemblGenomes-Tr; Pnap_R0031-1.
DR   EnsemblGenomes-Tr; Pnap_R0032-1.
DR   EnsemblGenomes-Tr; Pnap_R0033-1.
DR   EnsemblGenomes-Tr; Pnap_R0034-1.
DR   EnsemblGenomes-Tr; Pnap_R0035-1.
DR   EnsemblGenomes-Tr; Pnap_R0036-1.
DR   EnsemblGenomes-Tr; Pnap_R0037-1.
DR   EnsemblGenomes-Tr; Pnap_R0038-1.
DR   EnsemblGenomes-Tr; Pnap_R0039-1.
DR   EnsemblGenomes-Tr; Pnap_R0040-1.
DR   EnsemblGenomes-Tr; Pnap_R0041-1.
DR   EnsemblGenomes-Tr; Pnap_R0042-1.
DR   EnsemblGenomes-Tr; Pnap_R0043-1.
DR   EnsemblGenomes-Tr; Pnap_R0044-1.
DR   EnsemblGenomes-Tr; Pnap_R0045-1.
DR   EnsemblGenomes-Tr; Pnap_R0046-1.
DR   EnsemblGenomes-Tr; Pnap_R0047-1.
DR   EnsemblGenomes-Tr; Pnap_R0048-1.
DR   EnsemblGenomes-Tr; Pnap_R0049-1.
DR   EnsemblGenomes-Tr; Pnap_R0050-1.
DR   EnsemblGenomes-Tr; Pnap_R0051-1.
DR   EnsemblGenomes-Tr; Pnap_R0052-1.
DR   EnsemblGenomes-Tr; Pnap_R0054-1.
DR   EnsemblGenomes-Tr; Pnap_R0055-1.
DR   EnsemblGenomes-Tr; Pnap_R0056-1.
DR   EnsemblGenomes-Tr; Pnap_R0057-1.
DR   EnsemblGenomes-Tr; Pnap_R0058-1.
DR   EuropePMC; PMC2765153; 19700556.
DR   EuropePMC; PMC6015842; 29967598.
DR   EuropePMC; PMC6062779; 29875189.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01725; SAM-I-IV-variant.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02033; HEARO.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP000529.
DR   SILVA-SSU; CP000529.
DR   StrainInfo; 376940; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000361
CC   Source DNA and bacteria available from Eugene L. Madsen
CC   (elm3@cornell.edu)
CC   Contacts: Eugene L. Madsen (elm3@cornell.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4410291
FT                   /organism="Polaromonas naphthalenivorans CJ2"
FT                   /strain="CJ2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:365044"
FT   gene            147..2701
FT                   /pseudo
FT                   /locus_tag="Pnap_0001"
FT   gene            2826..3659
FT                   /locus_tag="Pnap_0002"
FT   CDS_pept        2826..3659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35328"
FT                   /db_xref="InterPro:IPR024975"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI50"
FT                   /protein_id="ABM35328.1"
FT                   /translation="MDWSREEVEAIVADYLQMLTMELAGQSFNKTQHRRWLQGKLNGRS
FT                   DASIEFKHCNISAAMIDLGFPYIRGYQPRSNYQALLAIVAEEQVRGKITLDHAALAAVQ
FT                   QPAVVPTQTDFTKVKSEAPKKQHQAKEAVNPLLFRAVKRDYLEREAQNSSLGLAGEEFV
FT                   VQFEHWRLVGMGQHRLADRVEHVSVSKGDGLGYDVLSFESDGRERLIEVKTTTFGRDTP
FT                   FFVSRGELALSQGAKDQFHLYRLFEFRKSPRLFDLPGSLDQHCLLDPVTYRASFG"
FT   gene            complement(3701..4522)
FT                   /locus_tag="Pnap_0003"
FT   CDS_pept        complement(3701..4522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35329"
FT                   /db_xref="GOA:A1VI51"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI51"
FT                   /protein_id="ABM35329.1"
FT                   /translation="MWLLRKRLFLMIKKAKHRRFPCADSAGAQLIITWLAAGGSASLAR
FT                   RAIRLASKSTRNCSMGLMDRDYMHEKSRRQRPFSPPPERFKLGTLGMALVFVALLFFLY
FT                   KAADWKLNQRPAPQPVAESMPQPARHPIPAPALPTQPAYPNSSNAAAGISQVTKCVVNG
FT                   RTSYGDAACPQGSISSQVTTRANHNLMAAVRPTAAGPAEATATATAQHIVEVQASSFND
FT                   AAAKKTECDWLDSQIKHWDSMARQPQGAQTQDWIREQRKQARDRQFRIHCR"
FT   sig_peptide     complement(4388..4522)
FT                   /locus_tag="Pnap_0003"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.532 at
FT                   residue 45"
FT   gene            4747..4953
FT                   /locus_tag="Pnap_0004"
FT   CDS_pept        4747..4953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35330"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI52"
FT                   /protein_id="ABM35330.1"
FT                   /translation="MTSQQNPHDKQTPHTGKVENDSNKQGKQEPTQLNQGQRTPDSRSD
FT                   REAHVGGSNQSQSRRGPVGSPKR"
FT   gene            5033..5608
FT                   /locus_tag="Pnap_0005"
FT   CDS_pept        5033..5608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0005"
FT                   /product="NnrUfamily protein"
FT                   /note="PFAM: NnrUfamily protein; KEGG: pol:Bpro_0008 NnrU"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35331"
FT                   /db_xref="GOA:A1VI53"
FT                   /db_xref="InterPro:IPR009915"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI53"
FT                   /protein_id="ABM35331.1"
FT                   /translation="MGMLILGLVLFLGVHSTRIVADGWRTAMIGRLGEKRWKGLYALVS
FT                   LVGFGLVIWGFGLARQQPVQWWAPPFATRHLAWLLTALAFILLAAAYVPRNAIKARLHH
FT                   PMVLGVMFWAVAHLLANGNRAHVLLFGSFLVWAGLSFRAARARDRAALAVYPAGTASGT
FT                   LMAVLAGMAAWAVFAFWAHGLLIGIRPV"
FT   gene            5834..6508
FT                   /locus_tag="Pnap_0006"
FT   CDS_pept        5834..6508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35332"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI54"
FT                   /protein_id="ABM35332.1"
FT                   /translation="MHGFNHSRTLSIPTSSLPSPWKQQRFLRAIPSLMVLTTAIAWGTA
FT                   SHAGGLALDGALRNGVNVAAGPALDAGVSAGVGVDASAGVKGAGGMAGVDAAGSAGSGA
FT                   NRNITDEQRMAAMAAVGGDANAQGAAGVEAPGVGRTAGGVRGMGESVGGAAARTGQRAT
FT                   QGVRSEVSGGLKGGANAATNAASGARTGMPGIGKAGAAGARLGAGVDADAGAGLKGVIP
FT                   AR"
FT   sig_peptide     5834..5980
FT                   /locus_tag="Pnap_0006"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.971 at
FT                   residue 49"
FT   gene            complement(6653..6913)
FT                   /locus_tag="Pnap_0007"
FT   CDS_pept        complement(6653..6913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0007"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: pol:Bpro_0018 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35333"
FT                   /db_xref="GOA:A1VI55"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI55"
FT                   /protein_id="ABM35333.1"
FT                   /translation="MASFFSFLLGEKKKTANVAKERLQIILAHERSGRNSHEPDYLPAL
FT                   QRDLIAVIAKYININPNDIKLNLERQENLDVLEVKIELPDK"
FT   gene            complement(6920..7735)
FT                   /locus_tag="Pnap_0008"
FT   CDS_pept        complement(6920..7735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0008"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid a,c-diamide synthase; KEGG: pol:Bpro_0019
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35334"
FT                   /db_xref="GOA:A1VI56"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI56"
FT                   /protein_id="ABM35334.1"
FT                   /translation="MAKIIVVTSGKGGVGKTTTSASFATGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEATLNQALIKDKQCPELFVLAASQTRDKDALTIDGVKK
FT                   VLDDLAAMDFEYIVCDSPAGIETGALMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TQRAIDGGEPIKEHLLITRYNPSRVDQGQMLSLEDIQDILRIKLIGVIPESETVLQASN
FT                   QGVAAVHMQGTDVSEAYKDVIDRFMGEDKPMRFIDAQKPGFFKRLFGGK"
FT   gene            complement(7871..8641)
FT                   /locus_tag="Pnap_0009"
FT   CDS_pept        complement(7871..8641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0009"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: pol:Bpro_0020 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35335"
FT                   /db_xref="GOA:A1VI57"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI57"
FT                   /protein_id="ABM35335.1"
FT                   /translation="MTMTAATLTTFEIKSANFPLVALLLKSTDLAALAREMTLRFGDIP
FT                   DFFDQDALVIDLSPLQNAGQAAAAEIDFRALISLLRSYRLVPIAVKGGNPAQMTAAQKA
FT                   GLVPGQDAHLLTPRPAAASAEQPAPQTQQQQPQLHAPPLGALVIDKPLRSGQQVYARGR
FT                   DLVVLAMVNAGAEVIADGHIHVYAPLRGRAIAGARGNTEARIFALTLEAELLSIAGIYR
FT                   TSENPLPPEVTGHPAQVRLVDGPDGERLVMTPMQ"
FT   gene            8791..9030
FT                   /locus_tag="Pnap_0010"
FT   CDS_pept        8791..9030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0010"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0021 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35336"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI58"
FT                   /protein_id="ABM35336.1"
FT                   /translation="MHEDCAHLETLRTKRDIIPELDELPDPWILFVRLRQPFTAGLHKW
FT                   GALWVYTRRGTGYWGSPKRFGAPSEITCLRLVAA"
FT   gene            9140..9574
FT                   /locus_tag="Pnap_0011"
FT   CDS_pept        9140..9574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0011"
FT                   /product="protein of unknown function DUF296"
FT                   /note="PFAM: protein of unknown function DUF296; KEGG:
FT                   bxe:Bxe_B2660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35337"
FT                   /db_xref="InterPro:IPR005175"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI59"
FT                   /protein_id="ABM35337.1"
FT                   /translation="MNNDPAIHVLRLNPGDDLRAELQSAFNALQARGCRAACVISAVGS
FT                   LSRAVLRHAAQAQASVQNEPLELITLSGTLSPDGVHLHASVADARGEMRGGHVMPGCSV
FT                   RTTAEIVLALLPGWAFSRAHDDRSGFMELVATPASSKNPD"
FT   gene            complement(9620..10642)
FT                   /locus_tag="Pnap_0012"
FT   CDS_pept        complement(9620..10642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35338"
FT                   /db_xref="GOA:A1VI60"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI60"
FT                   /protein_id="ABM35338.1"
FT                   /translation="MPDSRILPQPAPSDSEPGARRRKLTDRPWWPWLRRGATTVFFGLV
FT                   GYLLVSQARTIEWDKVLSSLQDYPLTASWGAVALAAASYLLYSCFDLLGRHYTGHTLRA
FT                   PTVMLLTFVSYAFNLNLGSVVGGVAFRLRLYSRLGLALGTITRIMSFSMLANWMGYLLL
FT                   AGLVFSLKPPALPNSWKIDASQLRLTGLALLAVALAYLGACAFSRQRTLRLRGHDIELP
FT                   SLKLASLQLAMGAGNWLLMSGIVFILLQQRIDFFSVASVLLLAAIAGVITHIPGNLGVL
FT                   EAVFVALLSQRMPRHDLLAGLVAYRVVYYLLPLLVAAVIYLVMEARAKKPGRPGAALKP
FT                   "
FT   gene            complement(10635..11936)
FT                   /locus_tag="Pnap_0013"
FT   CDS_pept        complement(10635..11936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0013"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   pol:Bpro_0025 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35339"
FT                   /db_xref="GOA:A1VI61"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI61"
FT                   /protein_id="ABM35339.1"
FT                   /translation="MTRWVSGNSFQLLENGEAFFPRVFECIAAARNEVVLETFILFEDK
FT                   VGLALHAALLQAASRGVRIDVTVDGFGSPDLSPGFISALTQAGVRVHVFDPAPRLWGWR
FT                   TNVFRRMHRKIVVVDGQRAFVGGINYSADHLADFGPEAKQDYAVEVIGPIVAEIHAFVH
FT                   QALAAGQQGTAKSLGGQLRERFADRAQRLAQRWRQAPGPAGDAAAIFVTRDNRLHTTDI
FT                   ERHYRIAIRAARQRVVIANAYFFPGFRLLNEMRKAARRGVEVKLILQGEPDMAIVKTAA
FT                   NMLYHHLLSAGVQIFEYCERPLHGKVAVSDDEWATVGSSNLDPLSLSLNLEANVIIKDR
FT                   AFNQHLSARLAHLMDNSCKQIRQGDLEESTWWRVVRSFFVFHLLSRFPAWAGWLPAHTP
FT                   RLMLATVPTDTADSADSAGADRVSQADPVGAADA"
FT   gene            complement(12012..12845)
FT                   /locus_tag="Pnap_0014"
FT   CDS_pept        complement(12012..12845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0014"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   pol:Bpro_0026 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35340"
FT                   /db_xref="GOA:A1VI62"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI62"
FT                   /protein_id="ABM35340.1"
FT                   /translation="MQPFIPTPASRPAHPEAAQADQPAPEVHTPYSFKVLTVNIHKGFT
FT                   FFNRKFILSELRDAVRTVGADVVFLQEVAGSHLKHAEKFDNYPEEPHYEYLADSIWEQF
FT                   AYGRNAVYTHGHHGNAVLSKFPIVRFENRDISISGPERRGMLHCELQVPGQSRNVHAIC
FT                   VHLGLVESHRTQQMKLVCDLVRKEIPVRAPVVVAGDFNDWRRRAHAQMAKGANLHEVFV
FT                   QANGQAARTFPARLPLLQLDRIYVRNAIGHSPIVLPSHPWSHLSDHAPLAAEIRL"
FT   gene            13194..13568
FT                   /locus_tag="Pnap_0015"
FT   CDS_pept        13194..13568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35341"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI63"
FT                   /protein_id="ABM35341.1"
FT                   /translation="MFGVAAHAQTAASPARAEVKMDTADFLKTHRWDDNMSVWVLKSGV
FT                   EAPAGVKPRAEVKAERDAFMRTHKWQNDSSTWVPIKTGPRDLGTMTRAQLAAETKQFLA
FT                   THTFDEEKGVYVEKAPRKTK"
FT   gene            complement(13600..14670)
FT                   /locus_tag="Pnap_0016"
FT   CDS_pept        complement(13600..14670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0016"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="KEGG: pol:Bpro_0028 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35342"
FT                   /db_xref="GOA:A1VI64"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI64"
FT                   /protein_id="ABM35342.1"
FT                   /translation="MTEVRKGQAPATLSRTEFHERFMQSFMDPAFRAEDHALSRVEAIA
FT                   WDAYQKGRKAPLTRKAGAGHADPDYALSVEWLQTRERLQKAQATWKDPATPSRVLLVCG
FT                   SSRNDGTCPGEISKTFRMVQWAEETLRQAKLEVDRLDLSLLTSSYRLNIHPCKGCVSTA
FT                   MPLCHWPCSCYPNHSLGQTSDWMAEIYERWTAAHAVIIVTPVYWYQSPSPLKLMIDRLV
FT                   CADGGNPDPTSTHGKNPEEAKALELGGWDYPKHLAGRVYGLVVHGDVAGVEDSRRNLSD
FT                   WLDWMGFIDAGSKARLDRYIGYYEPYATSHGVLDADTALQTEVRNVARAVGQAVAELRA
FT                   GNLSQPGKGLAPPRPK"
FT   gene            complement(14939..15508)
FT                   /locus_tag="Pnap_0017"
FT   CDS_pept        complement(14939..15508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35343"
FT                   /db_xref="GOA:A1VI65"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI65"
FT                   /protein_id="ABM35343.1"
FT                   /translation="MKFALKSLNSLVLATLLVTAGGAMAQGTDAAPAALNPGTSSTATH
FT                   NAKAHHGEHRMGRHDPAQMQARMAKHQAELKAKLKITPAQEGAWTAFTAAMQPPARMMG
FT                   QRPTPEQRAEFDKLTTPERIDKMRALRTQRMTEMNAEMDKRGEATKALYAALSLDQQKT
FT                   FDAEHKKMGRQGGRGHHEGGMMHPKG"
FT   sig_peptide     complement(15431..15508)
FT                   /locus_tag="Pnap_0017"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 26"
FT   gene            15738..16397
FT                   /locus_tag="Pnap_0018"
FT   CDS_pept        15738..16397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35344"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI66"
FT                   /protein_id="ABM35344.1"
FT                   /translation="MSFLSELKSRANALQGLQLGAQRDLVAGTQACEVACRMALVYLQD
FT                   LCAQLNVIQPPAPGVYSLDGKAPFAGSAALVQRNFRCDARRKMLRNAEVFDYIGVGWDL
FT                   LPVTGLVATHTVTVNFPPDLERVTQRLSVGQIQHERKDQRHPETNKLLAYVFDYQTESR
FT                   AFITLTPDHDTGCIAFRVSNVGGFGVHNTSYPGAQVTHRLLDELAKKLVGQPSRFG"
FT   misc_binding    16458..16572
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 85.34"
FT   gene            16663..18579
FT                   /locus_tag="Pnap_0019"
FT   CDS_pept        16663..18579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0019"
FT                   /product="hydroxymethylpyrimidine synthase"
FT                   /note="PFAM: thiamine biosynthesis protein ThiC; KEGG:
FT                   pol:Bpro_0037 thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35345"
FT                   /db_xref="GOA:A1VI67"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI67"
FT                   /protein_id="ABM35345.1"
FT                   /translation="MAKTNLSVDAADLTSRITRTPFPGSRKIYIEGSRPDIRVPFREVT
FT                   LTDTLVAEGSETRREANPPLRLFDSSGVYTDPAASIDITRGLSPLRGAWINERQDTEAL
FT                   PGISSAYGRERLNDPALSALRMAHAPVPRRAKAGANVSQMHYARQGIITPEMEYIAIRE
FT                   NLVRAQLAERLATERVPKTGHSFGASIPKDITAEFVRDEVARGRAVIPNNINHPETEPM
FT                   IIGRNFLIKVNANIGNSAVTSSIEEEVDKLAWSIRWGADTVMDLSTGENIHETREWILR
FT                   NSPVPIGTVPIYQALEKVNGKAEDLTWEIFRDTLIEQAEQGVDYFTIHAGVRLAYVPLT
FT                   ANRLTGIVSRGGSIMAKWCLSHHKESFLYEHFEEICEIMKAYDVCFSLGDGLRPGSIAD
FT                   ANDEAQFAELHTLGELTQIAWKHDVQVMIEGPGHVPLQLVKENVEKQLEACFEAPFYTL
FT                   GPLITDISPGYDHISSAMGAANIGWYGTAMLCYVTPKEHLGLPNRDDVKQGLIAYKIAA
FT                   HAGDLAKGYPGAQMWDNAVSKARFEFRWEDQFRLAIDPDTAMAYHDETLPKENAKVAHF
FT                   CSMCGPKFCSMKISQEVREFARLNPSTTTLAKAPGVIPIQQVSSGFEEKAEEFRKGGNE
FT                   IYS"
FT   gene            18854..19921
FT                   /locus_tag="Pnap_0020"
FT   CDS_pept        18854..19921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0020"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: pol:Bpro_0038 FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35346"
FT                   /db_xref="GOA:A1VI68"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR023209"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI68"
FT                   /protein_id="ABM35346.1"
FT                   /translation="MHSPMNSLHIGIAGAGLAGRTLAWRLLRAGCRVTLFDSRQRAELD
FT                   TASMTAAAMLSPLAELSVSDEVVFQLGRRSMELWPRWVAELAEGGGEPVYFRQKGTLVV
FT                   AHAPDQSSLDHFSGLLHHRLPEACRAEVHTLDAAALAQREPALAGRFGGGLFLESEGQL
FT                   ANDQWMAVLGREIDRLGVTWHEGQAVDRVEEGRIICASGEYAVDVAVDARGVGSKAQWP
FT                   QLRGVRGEVLRVECHGVTLQRPVRLMHPRYALYVAPRPDHQFVVGATELESEDTGPVTL
FT                   RSTLELGSALYSLHPAFGEARVLRLSAALRPALDDHRPAVALRDGVWHINGLYRHGYLC
FT                   APAVVDELAHKLLAT"
FT   gene            19946..20155
FT                   /locus_tag="Pnap_0021"
FT   CDS_pept        19946..20155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0021"
FT                   /product="sulfur carrier protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: hch:HCH_00139 thiamine
FT                   biosynthesis protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35347"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI69"
FT                   /protein_id="ABM35347.1"
FT                   /translation="MTDFEISLNGERIATQAATLQGLLLERGYDLKSAFACAINSGFVP
FT                   RPQWPERSLQGGDRIDVVTPITGG"
FT   gene            20158..20976
FT                   /locus_tag="Pnap_0022"
FT   CDS_pept        20158..20976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0022"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   pol:Bpro_0040 thiazole biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35348"
FT                   /db_xref="GOA:A1VI70"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI70"
FT                   /protein_id="ABM35348.1"
FT                   /translation="MSNPMNSSIAHGSPWSVAGTTLSSRFFLGTSHYPSPQVLGDAVRA
FT                   SGTEVLTVGLRRLQPETGGGSSFWQRIQALGCHILPNTAGCHSAEEAITLAQMAREIFG
FT                   TRWIKLEVIGDDYTLQPDTVATLEAATALAKDGFSVFAYTTDDLVMAQRLHAAGCAAVM
FT                   PWAAPIGTGRGPLNPYALETMRRRLPDAVLIVDAGLGRPSHAAQVMELGFDAVLLNTAV
FT                   AQAGDPVRMARAFADGVAAGRAAYESTPMPERAAAQASTSTVGVPFWHAT"
FT   gene            21038..21679
FT                   /locus_tag="Pnap_0023"
FT   CDS_pept        21038..21679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0023"
FT                   /product="thiamine-phosphate diphosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: pol:Bpro_0041 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35349"
FT                   /db_xref="GOA:A1VI71"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI71"
FT                   /protein_id="ABM35349.1"
FT                   /translation="MTASAPFAPLTGPIGFYPVVHDAAWVQRLLGWGVRTVQLRFKAAG
FT                   HTPAEIEREVNAAVEAGSKVPGAQVFINDHWQLALAAGAYGVHLGQEDLDTADIEALRN
FT                   AGLRLGLSTHTPAELARAHAVQPSYLAIGPIYPTTLKVMPYAPVGLTQLKEWATLAVPY
FT                   PVVAIGGISLERLPGVLACGVDGVAVVSAVTLAANPQQAALQGLALVGKR"
FT   gene            21825..22331
FT                   /locus_tag="Pnap_0024"
FT   CDS_pept        21825..22331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_1824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35350"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI72"
FT                   /protein_id="ABM35350.1"
FT                   /translation="MNLQRLSGFSTPRNRHFTLWALALGCLLLSGCSATGAKFQGLEKP
FT                   DSDAGEIVVYRPDRLVRGGVAYYVHLDGKEVGMLKNAGFVALRTTPGTHVVLMKAGLQD
FT                   FFMKARTAEVVLLAGERKFLRFEPSITGSPIVLPNVAYVPVGFGFIAVPEGQAAIELRD
FT                   LNQSK"
FT   sig_peptide     21825..21935
FT                   /locus_tag="Pnap_0024"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.668 at
FT                   residue 37"
FT   gene            complement(22361..23635)
FT                   /locus_tag="Pnap_0025"
FT   CDS_pept        complement(22361..23635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0025"
FT                   /product="glycosyl transferase, family 51"
FT                   /note="PFAM: glycosyl transferase, family 51; KEGG:
FT                   stt:t3243 monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35351"
FT                   /db_xref="GOA:A1VI73"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI73"
FT                   /protein_id="ABM35351.1"
FT                   /translation="MTARRTFARVMAVLLALSAALVVALYLVVKTLLAPLPGEWATSIR
FT                   LGPVRLQASVPALLRLATAPWLAPLLDGRTVAAYNGPVHLAWQADSQTLAARCAPCAVQ
FT                   APALGGEPVEVDELRLTIQRHGEQLNGEISSGQVKAVWHGDLTKGGLRLRLQLPMTPMA
FT                   DAYALFGASIPELAQARIEGRLALTATLALPGGEFSMTPQIEAFQVSGLGTEALVNARS
FT                   ACSDTASRLTPESWLARAVIAAEDQRFYEHGGYDLAELSAALVQNQDSRPEGRAGRGAS
FT                   TLTQQLAKLLVTGDERSPARKLRELLYAVEMEQTLGKNRILRLYLAHAPWGNGICGAEA
FT                   ASKRYFGRPATALNPSQAAWLAAMLHNPALEAEHWASTGQINVARTQWVLMGMRALPRQ
FT                   QRQRLARQLGEPGHEVWKAQVTKQR"
FT   sig_peptide     complement(23561..23635)
FT                   /locus_tag="Pnap_0025"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.369 at
FT                   residue 25"
FT   gene            complement(23632..24183)
FT                   /locus_tag="Pnap_0026"
FT   CDS_pept        complement(23632..24183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35352"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI74"
FT                   /protein_id="ABM35352.1"
FT                   /translation="MLENTFINRVLHKTLWAVLLPACMLWSAAVASRQPDVLRPTPKIA
FT                   SELPAQWQGRALRPLALSEVEQRFARNFPGTLSRMTDGRQVLVLRSINQPTRMLHPAID
FT                   CYQGLGYRIAAQQLELDSERRLWRCFEALQPGGGQRLRVCERIVDAGGQGFTDTSAWYW
FT                   AAIMGQSPGPWQAITVARPL"
FT   sig_peptide     complement(24088..24183)
FT                   /locus_tag="Pnap_0026"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.683 at
FT                   residue 32"
FT   gene            complement(24208..25053)
FT                   /locus_tag="Pnap_0027"
FT   CDS_pept        complement(24208..25053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0027"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_06497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35353"
FT                   /db_xref="GOA:A1VI75"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI75"
FT                   /protein_id="ABM35353.1"
FT                   /translation="MGAGGGQTPAIRLFQARFPSLPASSGFVRWGVRIDTAPGWLWPLL
FT                   LVAALWPTWLWMGRRMLDRSDDPLGLLALAALGLLVACHRLRLRSSPRLAWFALALAGA
FT                   VAATAAQGLLPALAVALLALLALAAGLAAFLPAGVASAPVVGLSVLALPLLASLQFYAG
FT                   FPLRLITAEASRWLLLASHEVERSGASLRVDGHLVIVDAPCSGVQMAWLGYFTACAVTL
FT                   YLGRGNRAFLTRLPAVGVLVLAGNIVRNTLLVAAEASGNHLSGWAAWWRWRPSAARLPL
FT                   "
FT   gene            complement(25129..27234)
FT                   /locus_tag="Pnap_0028"
FT   CDS_pept        complement(25129..27234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0028"
FT                   /product="Vault protein inter-alpha-trypsin domain protein"
FT                   /note="PFAM: von Willebrand factor, type A; Vault protein
FT                   inter-alpha-trypsin domain protein; SMART: Vault protein
FT                   inter-alpha-trypsin, metazoa; KEGG: sat:SYN_02036 von
FT                   Willebrand factor type A like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35354"
FT                   /db_xref="GOA:A1VI76"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI76"
FT                   /protein_id="ABM35354.1"
FT                   /translation="MESPLSPNARAARWLWLATASLATVCFIALSASPAQAQDNGSAPR
FT                   LKTESPYFFVKSDTPGVDALPLKSTSVDVQISGVIADVTVTQRYKNEGQRAIEARYVFP
FT                   ASTRAAVYGMNVRLADRLITANIREKQQARIEYDAARNEGKTAALLEQHLPNVFEMNVA
FT                   NILPGDDVKVELRYTELLVPQSGAYQFVFPTVVGPRYNSAQSSQALAQWVAQPFLPAGQ
FT                   ASATAFDIKVKLATPIGIKEVSSHSHSIDVTKDGDERAAVSLRSGDKPGNNRDFILDYR
FT                   LAGERIESGVMLYQGTPGNGASGENFFLAMIEPPKQVAAQAISPRDYIFVVDISGSMHG
FT                   FPLDTAKTLMRELIGKLRPSDTFNVLLFSGSNRFLSPASVPATQANIEQAVRTIDEMGG
FT                   GGGTELIPALKRVYAEPKAADVSRTVVVVTDGFVTVEREAFELVRRNLSQANLFSFGIG
FT                   SSVNRHLMEGLARAGMGEPFIITEPSQARAQAERFRRLIESPVLTSVKLRFEGLDVYDV
FT                   EPAQLPDVLGERPVVVFGKWRGTPAGQVIIDGQSATGPYRNAVTVPAQNGQNTAALRYL
FT                   WARHRIASLSDQEALEGGDAHRQRITELGLQYNLLTQYTSFLAVDQVVRNLQPQDATGV
FT                   NQPSPLPQGVSNLAVGEVSIGAAVPGTPEPATWGAVLVLLSVLALLARRERRASRGRPG
FT                   SAARFTA"
FT   sig_peptide     complement(27121..27234)
FT                   /locus_tag="Pnap_0028"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 38"
FT   gene            complement(27624..29060)
FT                   /locus_tag="Pnap_0029"
FT   CDS_pept        complement(27624..29060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0029"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: bur:Bcep18194_B0913 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35355"
FT                   /db_xref="GOA:A1VI77"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI77"
FT                   /protein_id="ABM35355.1"
FT                   /translation="MTKRNRIFIGILLIYAAGIALMLYRVVADIDPRYRESAEESLVET
FT                   SHLLAGLVEQDVRAGAIDTARLEPLFKALYAREFHARIYSVSKTRVEMRAYVADRQGRV
FT                   LFDSLGKSVGADFSQWHDVGLTLEGRYGARSTRDVPDDPRTSVMYVGAPIRWNNEIIGV
FT                   ASVGKPVTSFGQFVSAAREKTLYVGLVSVLAVLLLAVIVSVWLVRPFGLISDYVRYVRA
FT                   QRSFNFPRLGRRALGAIGAAYDEMRDALAGRNYVADYVQTLTHEVKSPLSAIRGAAELL
FT                   QEPSMPQAERQRFLANITREAGRIQEMVDRMMELTALETRRSLDKVQPVALKPLLEELA
FT                   SAAQDAARLRGIRIAVDAPEDAAVEGDGFLLRRAVSNLLDNAVDFSPEGSQVVLSLHLG
FT                   ARTVRVQVRDRGPGIPDYAQDKVFEKFYSLARPHSRKKSTGLGLAFVKEIASLHHGRIE
FT                   LVNADGGGALATLSLPRLAG"
FT   sig_peptide     complement(28977..29060)
FT                   /locus_tag="Pnap_0029"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.485 at
FT                   residue 28"
FT   gene            complement(29057..29905)
FT                   /locus_tag="Pnap_0030"
FT   CDS_pept        complement(29057..29905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0030"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: reu:Reut_A0185 response
FT                   regulator receiver:transcriptional regulatory protein,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35356"
FT                   /db_xref="GOA:A1VI78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI78"
FT                   /protein_id="ABM35356.1"
FT                   /translation="MTARQLFLRLRQRPDTRAARHASATIAAMLNKPRILVVEDESGIA
FT                   DTLQYVLSTDGFAPVWCSTAGQALREFSAGLPALVILDIGLPDLNGFELFKRLQALPGG
FT                   AQVPMLFLTARSDEIDRVVGLELGADDYIAKPFSPRELVARVRGILRRSVRQPLAAPLP
FT                   EPPQPASGATPMAVRMEAAATPFALDEERRQIRFYGRVLELSRYEYGILRLLVLRPGRV
FT                   FTRDELFDQVWTDGSGSLDRTIDAHIKTLRAKLKAVAPHAEPIRTSRGSGYALSEALPA
FT                   A"
FT   gene            complement(29940..31055)
FT                   /locus_tag="Pnap_0031"
FT   CDS_pept        complement(29940..31055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0031"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   pol:Bpro_0063 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35357"
FT                   /db_xref="GOA:A1VI79"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI79"
FT                   /protein_id="ABM35357.1"
FT                   /translation="MPSLFDTVQAGDLQLANRIVMAPLTRNRAPDAIPTPLMAEYYAQR
FT                   ATAGLLITEATAISHQAQGYADVPGLYGTEQLDGWKRVTGAVHDAGGKIVVQLWHVGRV
FT                   SHNELQPDGGKPVAPSAITARTKTVLIKDGLPVFVPTSEPRALDAEELPEIVHTYRAAA
FT                   LNAVLTAGFDGVEIHGANGYLLDQFLKNGSNQRTDDYGGPIRNRARLLLEVTRAIVDAI
FT                   GGGRTGIRLSPVTLSNDAFDSDPQPLFEHVVKQLARLDLAYLHIIEGATGGARDLPERP
FT                   FDYAALKAAYRAAGGKGAWMVNNGYDKAMAEQAVKDGADLVAFGKPFIANPDLVHRLRS
FT                   NAPLNQPDPATFYGGGAEGYTDYPDYEELVN"
FT   gene            31502..31687
FT                   /locus_tag="Pnap_0032"
FT   CDS_pept        31502..31687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0032"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   pol:Bpro_0066 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35358"
FT                   /db_xref="GOA:A1VI80"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VI80"
FT                   /protein_id="ABM35358.1"
FT                   /translation="MIKYAIIFAVISLIAGALGFSGVAAGAAGIAKVLFGLFLILAVIF
FT                   IVLAALGVGAAKKMMK"
FT   sig_peptide     31502..31582
FT                   /locus_tag="Pnap_0032"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.659 at
FT                   residue 27"
FT   gene            31692..32006
FT                   /locus_tag="Pnap_0033"
FT   CDS_pept        31692..32006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0033"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35359"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI81"
FT                   /protein_id="ABM35359.1"
FT                   /translation="MKPPAKVPSGTAMSRIKERLFQNWSHRDDPKDEPTTHLPAIKPQR
FT                   EVGFPSSIAEFLLVFRLKARRRSLLSADILERAVRVVFVTCKNWFSGADSHHAKPRRHD
FT                   "
FT   gene            32075..32929
FT                   /locus_tag="Pnap_0034"
FT   CDS_pept        32075..32929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0034"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   pol:Bpro_0068 transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35360"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI82"
FT                   /protein_id="ABM35360.1"
FT                   /translation="MHTSLLDCLLEYEVSGPAHFLFNIEAAFHEGQEVVEERLTITPSM
FT                   KVRHFCNERSGNRFIRLDAPKGILSVNYHARVQLHPAPVPLHLDESPVTALPDEVLHDL
FT                   MPSRYCESDSMRRIAQQLFGHLPQGMSRVRAVESWIHESIEYQPGFTQSTTTAQDVFVQ
FT                   RVGVCRDFAHLGITLCRALNIPARLVVGYVHFAEPPQDFHAVFEAWLDGRWVLFDATRS
FT                   APIDRLVRIGTGRDAKDVAFATIFGDVKMLRKDITVEEGDMPPADDSEAAQPLAVVAGT
FT                   AGL"
FT   gene            complement(33135..34937)
FT                   /locus_tag="Pnap_0035"
FT   CDS_pept        complement(33135..34937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0035"
FT                   /product="Ankyrin"
FT                   /note="TIGRFAM: Ankyrin; PFAM: Amidase; KEGG:
FT                   reu:Reut_B4882 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35361"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI83"
FT                   /protein_id="ABM35361.1"
FT                   /translation="MTQAHISLGIGSLQQAYRDGAFTPLHMVEQVLAAIGDDPNKAWIH
FT                   RIDAATLRAQALALMARGPEGLPLWGIPFAIKDNIDLAGVPTTAGCPDYAYTPEASATV
FT                   VQRLLDAGAIAIGKTNLDQFATGLNGTRSPYGACRNAFNPDYVSGGSSAGSAVSVALGH
FT                   ASFSLGTDTAGSGRVPAGFNHLVGLKPSLGLLSTQGVVPACRSLDVVSIFALTADDAQQ
FT                   VFAVAHGYDAQDAYSRPAQPHGFDFGRAAQWRVGVPRAGQLQFFGDSAYARCYADACAH
FT                   AQALGAELVEIDFEPFAQTARLLYEGPWVAERYQAIRAFIDARPESVFPVTHEITLGGA
FT                   KPLAADAFAAQYRLRALAQRCAVVWSGIDCMLLPTSPTIHSIQTMLAEPIARNSDFGYY
FT                   TNFVNLLDYCAIAVPAGFRPDGLPCGVTFVAQAHQDQPLLHLAQRWQRALQGRAATLGA
FT                   TGHAAVPFEAAAAVPSGQVQVAVCGAHLQGQPLNHQLTSRGARLVQRTTTAPEYRLYAL
FT                   PDGRRPGLVRVAEGGAAIEVEVWELPASQFGSFVDGIPAPLGIGRTVLADGRAVAGFIC
FT                   EPAGLQGARDITALGGWRAWLAAA"
FT   gene            complement(34934..38545)
FT                   /locus_tag="Pnap_0036"
FT   CDS_pept        complement(34934..38545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0036"
FT                   /product="biotin carboxylation domain protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; biotin
FT                   carboxylation domain protein; PFAM: biotin/lipoyl
FT                   attachment domain-containing protein; Allophanate hydrolase
FT                   subunit 2; Allophanate hydrolase subunit 1;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   biotin carboxylase domain protein; KEGG: reu:Reut_B4883
FT                   allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35362"
FT                   /db_xref="GOA:A1VI84"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI84"
FT                   /protein_id="ABM35362.1"
FT                   /translation="MFDTVLIANRGAIACRVIRSLKALGLRSVAVYSEADADSLHVAMA
FT                   DASVCIGPAPAAQSYLDPQRILDAARATGAGAIHPGYGFLSENPDFAQACEDAGIAFIG
FT                   PTPAQMRAFGLKHTARALAEAQGVPLLPGSGLLSDLAQARSEAARIGYPVMLKSTAGGG
FT                   GIGMRLIRNDAEMAPAFEAVQRLAQANFKDAGLFLEKFVERARHIEVQLFGDGRGQVVS
FT                   LGERDCSAQRRNQKVIEETPAPGLDEATRAALQQTAVRLAEAVHYRSAGTVEYVLDADT
FT                   GAFYFLEVNTRLQVEHGVTEQVTGVDLVAWMLRLARGDDFALQVPAPRGASIQVRLYAE
FT                   DPARNFQPCAGGLTEVVFPADARIETWVATGSEVPPHYDPMIAKLIVTGSDRADAVAKL
FT                   QAALAATRLGGIETNLRYLRSVAAGPVFVQGRMVTRSLADLHYQPQALEVLEPGVQTSV
FT                   QDHPGRVGYWAVGVPPSGPMDDLAMRLANRLVGNAEHAAALECTLSGPSLRFHHDTVIA
FT                   VCGAAMAVSVDGVALAPWQSHTVKAGSVLKLGAVQGFGARTYLALRGGLDVPLYLGSRS
FT                   TFTLGQFGGHAGRTLRTGDMLHIGTDAVAEPLAALPLDVVPVYQNHWDIAVLYGPHGAP
FT                   DFFTDDDVRMFFGTDWQVHYNSSRTGVRLIGPKPEWARRDGGEAGLHPSNIHDNAYAIG
FT                   AIDFTGDMPVILGPDGPSLGGFVCPAVVLASERWKMGQLRPGDGVRFRCVTADEALALH
FT                   AAQESRIAGLAWSPPDVPQRTEAVGSPILAQREAQGERPALVLRQAGDRYVLVELGDAV
FT                   LDIALRLRVHGLMQSLQAQQLPGIVDLTPGIRSLQIHFEPLALTVPALIAAIFIADDAL
FT                   GDTDDLVVPSRTVYLPLSWDDSATRLAIEKYMQSVRPDAPWCPSNIEFIRRINGLQSIE
FT                   EVQRTVFDASYLVLGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTPENAVGIGGAYM
FT                   CVYGMEGPGGYQFVGRTLQMWNRWRDASSGAPAFEPGKPWLLRFFDQIRFYPVGEEELL
FT                   RIRRDFPAGRYPLRVEDGTFSLHDYRAFLKENASGIAAFRALQGQAFEEERERWRVAGQ
FT                   AEYVSEAELLDAAVSADDLPPGARSVATAVPGSVWKLLVAEGDSVDEGDALLVIESMKM
FT                   EFTVFAPCAGQVLRMACREGSAVAAGQDVVVIQGETA"
FT   gene            complement(38686..39339)
FT                   /locus_tag="Pnap_0037"
FT   CDS_pept        complement(38686..39339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0037"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35363"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI85"
FT                   /protein_id="ABM35363.1"
FT                   /translation="MSKLLESTLNPAHAVLDQTCLAGEPWMATVRAGQTLRILDLEGNQ
FT                   AVDTLFYSALDAQERYSAADTIARNGQLYLGLGSRLYSSAGRVMLSITADTCGRHDTLG
FT                   GACSSESNTVRYALDKRAMHSCRDSFMHAICHCHEAGVLGLGKRDIAPNINFFMNVPVT
FT                   PEGHLSFADGISGAGKYVELKAEMDVVVLISNCPQLNNPCNGYNPTPIRLLVWD"
FT   gene            complement(39336..40070)
FT                   /locus_tag="Pnap_0038"
FT   CDS_pept        complement(39336..40070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35364"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI86"
FT                   /protein_id="ABM35364.1"
FT                   /translation="MNAIPADRLLWEESLPGGNHWSGRLRRGTALRLTDLQGGANVSAL
FT                   FYNAGQPLERYSMPDTLKSQHTGFLTAGHVCQSDMGRVLCSITADSLGWHDSWCGVSDA
FT                   AMVLARYGEKRYQQHRNAMHRNGRDNLLIELAKWGLGARDLVPGVNFFSKVVPDADGAL
FT                   SHVGGHSVAGSFVDLRFEMDTLVVLSSAPHPLDARADYAPADVQLAAWRADPVGADDAC
FT                   RTQCPQNGRAFTNTERYCGAAA"
FT   gene            complement(40067..40897)
FT                   /locus_tag="Pnap_0039"
FT   CDS_pept        complement(40067..40897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0039"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: reu:Reut_B4886 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35365"
FT                   /db_xref="GOA:A1VI87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI87"
FT                   /protein_id="ABM35365.1"
FT                   /translation="MKIECKNVWKYFGQTTALQDVSLGIADNEFITLVGASGCGKSTLL
FT                   RTLAGLETHSKGDVLVEGKAITGPGQDRAMVFQHYSLYPWLRVSENIRFCRQLGAQTHN
FT                   RSSADVEAASGRADALLRLMGLTASAQAYPNQLSGGMQQRVAIARALMGKPQILLMDEP
FT                   FGALDAQTREVMHDLILHVHRLERTTIVFVTHDVEEAIYLGHRVVLMAPRPGRIDSIYD
FT                   VPLPARREQDMKLAPEFLRLKRQLLDRIRETSGMKTDLDQLQRLTQVAEERNPV"
FT   gene            complement(40903..41682)
FT                   /locus_tag="Pnap_0040"
FT   CDS_pept        complement(40903..41682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0040"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: reu:Reut_B4887
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35366"
FT                   /db_xref="GOA:A1VI88"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI88"
FT                   /protein_id="ABM35366.1"
FT                   /translation="MWSIRLAISRRSYGLLALVGLLVPLLGWALLSAFAGVSPVFLPGP
FT                   DKVVTRIGTWAMEDDLMGDAFISTMRVVTGWALSALLAIPLGLLIGSWRAVQALLEPLT
FT                   DFIRYMPAVAFIPLVMLWVGIDEGAKVAIIFIGTFFQMVLMVAEDVRRVPMAQIEAAQT
FT                   MGATRREVLEKVILPSAKPALLDTLRITMGWAWTYLVVAELVAANSGLGFAILKAQRFL
FT                   QTDKIFAGILLIGFIGLAIDQLFRLLHRKAFPWLHGR"
FT   sig_peptide     complement(41575..41682)
FT                   /locus_tag="Pnap_0040"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 36"
FT   gene            complement(41693..42709)
FT                   /locus_tag="Pnap_0041"
FT   CDS_pept        complement(41693..42709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0041"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; PFAM: NLPA
FT                   lipoprotein; Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: reu:Reut_B4888 ABC
FT                   transporter, substrate-binding protein, aliphatic
FT                   sulphonates"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35367"
FT                   /db_xref="GOA:A1VI89"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI89"
FT                   /protein_id="ABM35367.1"
FT                   /translation="MSSHFFSLFTISHAFKRSVAGACLVLAGVGAASVPMPAAAEVKVG
FT                   VSDWPGWVAWYVAEQKGFFKKNGADVKLVWFANYTDSIGALSSGQLDANSQTWSDTLGP
FT                   LAKGLPLKAILVNDNSAGNDALMVGPKITSFAQLKGKKVALEQFSISHFVLATALAKNG
FT                   MKLDDVKIVNLSAGDAAAAFISGKVDAAVLWNPWVNQIEKSGKGKALFTSRDMPGLVPD
FT                   LLVAQDKAIQTKRKELVGMIKAWFETEKFIREQPAEAAKIMSKVVSMSPEEYTVFLPGT
FT                   RFFDAAANTRAFDAKQALSLSSTAPTIAAFLTQYKLIEGKPDAAKGIDGTLLQDALK"
FT   sig_peptide     complement(42587..42709)
FT                   /locus_tag="Pnap_0041"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 41"
FT   misc_feature    complement(42765..42882)
FT                   /note="ykkC-yxkD element as predicted by Rfam (RF00442),
FT                   score 69.07"
FT   gene            complement(43159..43542)
FT                   /locus_tag="Pnap_0042"
FT   CDS_pept        complement(43159..43542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0042"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: bxe:Bxe_A3256 methylglyoxal synthase; TIGRFAM:
FT                   methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35368"
FT                   /db_xref="GOA:A1VI90"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI90"
FT                   /protein_id="ABM35368.1"
FT                   /translation="MKIALIAHDHKKDDIVLLAREFTPFLSACQLMATGTTGRRLHDEA
FT                   GLTVECLLSGPFGGDLQIGARLAVGDVDVVVFLRDPMTAQPHEPDINALVRACDVHNVP
FT                   CATNLAGARILLRGLILQGCVHP"
FT   gene            complement(43586..44605)
FT                   /locus_tag="Pnap_0043"
FT   CDS_pept        complement(43586..44605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0043"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: gka:GK1971 C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35369"
FT                   /db_xref="GOA:A1VI91"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI91"
FT                   /protein_id="ABM35369.1"
FT                   /translation="MTFLRRTVIAAAAAVALSASFSALAQDIKPRLIRFGYGLNEQSNQ
FT                   GRAAKVFADEVAKASGGKMKVRAIGAAALGPDTQMQQALIGGAQEMMVGSTATLVGITK
FT                   EMALWDTPFLINNTKEADALLDGPIGEKIKDKLQDKGLVGLVYWENGFRNLTNSKRPVT
FT                   KVEDLDGIKLRVMQNNVFLSSFKTLGANAIPMAFSELFGALETKTVDGQENPYNTILSS
FT                   KFYEVQKYLTVTNHVYSPWIVLVSKKWWDQLSKAEQKVLMDAAKTSRDYERKDTREEAS
FT                   KAMADLKAKGMLVNELAPAEADRMRNKLTRVYAEIGTEVGMDLWIATQNELLKIRGKK"
FT   sig_peptide     complement(44528..44605)
FT                   /locus_tag="Pnap_0043"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(44646..45938)
FT                   /locus_tag="Pnap_0044"
FT   CDS_pept        complement(44646..45938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0044"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: sme:SMa0250 conserved
FT                   hypothetical DedA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35370"
FT                   /db_xref="GOA:A1VI92"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI92"
FT                   /protein_id="ABM35370.1"
FT                   /translation="MSNEGLAFIVFSAGMLLLMGIGMNMGLALVLTGAGMAAVLGFWDT
FT                   QLLAQNLVAGVDSFPLLAVPFFILAGELMNSGGISSRIIAMAQAWVGHIRGGLGFVAIA
FT                   AAVMMASMSGSALADTAALATILLPMMRQQGYPMHTSAGLIASGGIIAPIIPPSMPFVI
FT                   YGVTTNTSISALFISGIVPGIIMGIGLIIAWKLVLRKMDLPQGQPLPMKERLRATAKAF
FT                   WAMLMPIIIIGGMKTGIFTPTEAAVVAAFYALFVALFVHREMKLAEIHGVLVRAGKTTA
FT                   IVMFLCAGAQVASYMITLADLPGTLTGWLGPLVESPKLLMAVMMIVLVIVGTALDLTPT
FT                   ILIFAPVMLPIAVKAGIDPVYFGLMFVLNGAIGLITPPVGTVLNVVAGVGRMPLHRVIQ
FT                   GVNPFLITYVLILVMFVIFPQIVTAPVAWMR"
FT   sig_peptide     complement(45825..45938)
FT                   /locus_tag="Pnap_0044"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.522 at
FT                   residue 38"
FT   gene            complement(45944..46456)
FT                   /locus_tag="Pnap_0045"
FT   CDS_pept        complement(45944..46456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0045"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component; KEGG: pol:Bpro_2839 tripartite
FT                   ATP-independent periplasmic transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35371"
FT                   /db_xref="GOA:A1VI93"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI93"
FT                   /protein_id="ABM35371.1"
FT                   /translation="MTTETLIEAPKSRFQRISNLLLAICLGVMAVAVFVNVVLRYGFGS
FT                   GVPASEELSRLLFVWMVFIGATAAYPAGEHMAFTSLVGLLKNQPRLMLAMTIFIRLLVL
FT                   LGCALIGWGAWQQVVVGLDSHSVVLNYPTALLPLPAFLCATAIGLMALFEIINRTPLDL
FT                   GHGAEVE"
FT   sig_peptide     complement(46349..46456)
FT                   /locus_tag="Pnap_0045"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.767 at
FT                   residue 36"
FT   gene            complement(46453..46962)
FT                   /locus_tag="Pnap_0046"
FT   CDS_pept        complement(46453..46962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0046"
FT                   /product="gluconate kinase, SKI family"
FT                   /EC_number="2.7.1.12"
FT                   /note="TIGRFAM: carbohydrate kinase, thermoresistant
FT                   glucokinase family; PFAM: shikimate kinase; KEGG:
FT                   rfr:Rfer_0956 carbohydrate kinase, thermoresistant
FT                   glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35372"
FT                   /db_xref="GOA:A1VI94"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI94"
FT                   /protein_id="ABM35372.1"
FT                   /translation="MTDSLVIMGVAGCGKSSLGAAVAQATGLALVEGDDFHSEASRAKM
FT                   SQGIALLDADRDGWLGVLGEQLRAHPEGLVLTCSALKLSYRERLRQAAPGLRFVFLDIS
FT                   REQAQARVAARAAQHFFSTTLVDSQFATLEAPTGEAGVLRVDALKSLDQLQAEVTEWLT
FT                   AKKEQA"
FT   sig_peptide     complement(46891..46962)
FT                   /locus_tag="Pnap_0046"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.674) with cleavage site probability 0.293 at
FT                   residue 24"
FT   gene            47101..48171
FT                   /locus_tag="Pnap_0047"
FT   CDS_pept        47101..48171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0047"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: rfr:Rfer_0957
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35373"
FT                   /db_xref="GOA:A1VI95"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI95"
FT                   /protein_id="ABM35373.1"
FT                   /translation="MRASAPYHSVVSLGFMTPARLRPRATGRVTLTDVAQAAGVSPITV
FT                   SRALRGERAVDPALVERVQAAARSLGYVPDPAARALASQRSSHVAVLIPMLSNALFVDL
FT                   LEAVQRSLRPAGYQTLMGVTHYNADEEEQLLREQLLQRPAGLVVTGLERSDAARALIAQ
FT                   SGVPCVHVMEMSSVPGVYSVGFSQADAGAELTRHLLARGRRRIAFVAAQLDARTLQRLE
FT                   GWRRELLAAGLHDPALEWLDPAPSSIALGARLFERIIGEQPDVDAVFFCNDDLAQGALL
FT                   AALRLGVAVPERVAVAGFNDLTGSDQMLPPLTTVRTPRSEIGHAAARMLLALMNGETVA
FT                   SPCVDLGYELVVRAST"
FT   gene            48364..48840
FT                   /locus_tag="Pnap_0048"
FT   CDS_pept        48364..48840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0048"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; KEGG: rfr:Rfer_2851 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35374"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI96"
FT                   /protein_id="ABM35374.1"
FT                   /translation="MQKVLHINPEKCTGCLQCEMACSFDNYGVFAPAKSRIKVFDFHDT
FT                   GKKVPYTCTQCDEAWCLHACPVEAITLDKLTGAKVVNDSTCVGCKVCTIACPFGTINYV
FT                   QETGKVQKCDLCGGEPACAEACPTGAITFIDANWTGLGRMQQWADKLGNQPSAS"
FT   gene            48852..50699
FT                   /locus_tag="Pnap_0049"
FT   CDS_pept        48852..50699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0049"
FT                   /product="phenylacetaldehyde:ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.-"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase-like; KEGG: rfr:Rfer_2850
FT                   aldehyde ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35375"
FT                   /db_xref="GOA:A1VI97"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI97"
FT                   /protein_id="ABM35375.1"
FT                   /translation="MSWAGKILRVNLSAGTVAAEPLNMDWAHSYLGSRGLGSKYLVSEV
FT                   DPKVDPLSPENKIIWATGPLTGTMASTGGRYTVITKSPLTGAIACSNSGGYWGAELKMA
FT                   GWDMVIFEGKSPTPVYLYINDDTAELRDAAHLWGKSVWETEPLIKQSLQDPLIRVSCIG
FT                   KAGENGVLYAAVINDLHRAAGRSGVGAVMGSKNLKAIAVRGTKGVGNLRDPKAFMKVTY
FT                   EKKKILRDNAVTGQGLPTFGTQVLMNVINEVGALPTRNHQDVQFEGAKDISAEAMATPR
FT                   ATDGKAQLITNQACFGCTIACGRISKMDAGHFTVSNKPQYWGASGGLEYEAAWALGAAN
FT                   GVKDLEALQYATMLCNEEGIDPISFGATLGAVMELYEMGVLSKEQLGIEAPFGSAAALA
FT                   FLAEETVHSRGFGKEIGQGSKRLTAKYGHPDLSMSSKGQEFPAYDGRAIQGIGLAYATS
FT                   NRGGCHLRGYTVASEVLGIPVKTDPLEHEGKPELVKAFQDATAVFDSAGICVFTSFAWG
FT                   LADVAPQLQAACGEQYTTEELEKIGERIWNMEREFNNAAGFTKADDSLPKRLLTEAAKT
FT                   GPAKGKVNMLAEMLPKYYAARGWDSEGVPTAATRERLGL"
FT   gene            50775..52064
FT                   /locus_tag="Pnap_0050"
FT   CDS_pept        50775..52064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0050"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rfr:Rfer_2849 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35376"
FT                   /db_xref="GOA:A1VI98"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI98"
FT                   /protein_id="ABM35376.1"
FT                   /translation="MTHHVILGAGPAGVIAAETIRKQAPNDRITLVGDEAEPPYSRMAI
FT                   PYLLMGNIDEPGTYLRKSPSHFADLKINQLFAHAASVDVATKTIALSSGESLAYDRLLI
FT                   ATGSRPASPPVAGIDSAGVHTCWTLEDARKIMALARPGARVLQMGAGFIGCIIMEALMQ
FT                   RGVQLSVVEMGDRMVPRMMGPMAGGMIKGWCEARGVQVFTGTRVDGIEAGKPLKVRLSN
FT                   GQTVEADLVISATGVKPNIGFLENSGITCLQGVLTDEHLQTSVPGVYAAGDCAEAFDKV
FT                   SGTTIVSAIQPNAAEQARVAALNMVGQRVELRGVTQINVLDTLGLISSSFGNWQGVPGS
FT                   EQVELTDRQADGGKGRHLSLQFKDDVLVGCNSVGWTEHVGVMRGLVEGAVRLGPWKDVL
FT                   KSDPTRLMQAYLASAQAQGQWNGAGDGRRR"
FT   gene            52061..52315
FT                   /locus_tag="Pnap_0051"
FT   CDS_pept        52061..52315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0051"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: rfr:Rfer_2848
FT                   thiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35377"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="InterPro:IPR027798"
FT                   /db_xref="UniProtKB/TrEMBL:A1VI99"
FT                   /protein_id="ABM35377.1"
FT                   /translation="MKITFKLFATLTDYLPLAARRGNLIELDVAPQATINQVIEPFGLP
FT                   PKLVHLVLVNGRYIEPEKRLTTTLLEGDVLAIWPPIAGG"
FT   gene            52320..52619
FT                   /locus_tag="Pnap_0052"
FT   CDS_pept        52320..52619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35378"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA0"
FT                   /protein_id="ABM35378.1"
FT                   /translation="MQAHYAETFERDMGCTEAEWLGWLPAALGDHAWQRSGPSVQARIG
FT                   PGSLQIDWRPAAPRVLGSARIPRLLVRFAFAGLDDGQRHAFMKRFDVYMQRGGG"
FT   gene            52725..54020
FT                   /locus_tag="Pnap_0053"
FT   CDS_pept        52725..54020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0053"
FT                   /product="acetyl-CoA hydrolase/transferase"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   dar:Daro_0283 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35379"
FT                   /db_xref="GOA:A1VIA1"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA1"
FT                   /protein_id="ABM35379.1"
FT                   /translation="MSVQTLYQQKRMSAADAIGVVMNGDTVVVPTAVGEPPALLTALSD
FT                   ARREFRNVSVSQILPVRKYGYFDPDTTAHVRHVAYFFSGISRAGGQEGWTDFISANFSE
FT                   LPDLLNRKLIPADVVFSMASPMDEHGFFSLSLAPDYTMAAIAQARAVVLEVNPNVPFAN
FT                   GNCHIHVSQVTALTESEDALLEVGLPKIGPVQEAIGKYVADMIPDGATLQIGYGGIPDA
FT                   VVMQLTHKHDLGVHTEMIGDGIMTLVEAGAVTNRKKNYLPGKMLATFALGSNKLYQFLH
FT                   RNPAVEMHPVGFTNDPYLAGQNDNLHAINATMQIDFMGQCGSESLGFTPYSGTGGQTDF
FT                   VRAANRSNGGKAFIVLPSTAKHDTISRIVPVLSPGTHVSTSKNDINYVVTEFGVAQLRG
FT                   KTAQQRCEALIAIAHPDFRGELRDAAKRMKLL"
FT   gene            54110..55105
FT                   /locus_tag="Pnap_0054"
FT   CDS_pept        54110..55105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spn:SP1772 cell wall surface anchor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35380"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA2"
FT                   /protein_id="ABM35380.1"
FT                   /translation="MRHVLTLAAASAMLVACGGGSDSAPAATPTPAATQATLTSANYVA
FT                   VAQESLSSSAYLANTTGLVTGAQVSDSEALIRFGQDQLPKLPRWLADAPVQAVGAVQSQ
FT                   TENCAGGGTLTISANDANGNRLVDAGDSVSLTANNCSFEGQLLNGQLTLTINSLTGNPD
FT                   HYPYSLSVTLGFNNLATQSASLRTVGNGSLALSIDARAANDQSLVLRTSSLNLSSTYGT
FT                   TTYSKTLTGYATSVELRPAGTGFTSTTSVDGTLSSSAFESRSISIATPVSFVRTSGQTY
FT                   PSSGQLVITGAAGGKIRVTVTSATTVLIELDADANGSYEASTSKLWSDML"
FT   sig_peptide     54110..54181
FT                   /locus_tag="Pnap_0054"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.837 at
FT                   residue 24"
FT   gene            55153..55944
FT                   /locus_tag="Pnap_0055"
FT   CDS_pept        55153..55944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35381"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA3"
FT                   /protein_id="ABM35381.1"
FT                   /translation="MAGALLSALSGAAAAMPCGAPALGALAGVERSQWEEFDAQGKSLV
FT                   RERGTLQVAGLQALGRCGAVDWSAQWTRSQGQRGYDGITSTQAPLQTQSQLRAQALGIA
FT                   AWLPVSGSWAVGSQLGYRQVRRDIASVGNVLGYPERFDYLQAALGVRYQAALGERVRLS
FT                   ASGWLGGGPGGHVKVDLPRADPVTLPLGSSRLLALGLELDGGASAQPGWSWRAGVLYRR
FT                   EQTGAGDAQALTRNGVTVGAALQPRFVQRHLGATAVLAYRF"
FT   sig_peptide     55153..55227
FT                   /locus_tag="Pnap_0055"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.504 at
FT                   residue 25"
FT   gene            complement(56052..58742)
FT                   /locus_tag="Pnap_0056"
FT   CDS_pept        complement(56052..58742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0056"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; ATP-citrate
FT                   lyase/succinyl-CoA ligase; KEGG: rfr:Rfer_2352 GCN5-related
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35382"
FT                   /db_xref="GOA:A1VIA4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA4"
FT                   /protein_id="ABM35382.1"
FT                   /translation="MDKHYLTPLFSPQSIVVFAGQADDPDRLTSRARVLHQALRAQKYT
FT                   GTLQFLDIHTTGTLADLAQTGADLAIIALPPQEVAAALEIAGRLTCRSALVITSGINAD
FT                   GAAELKRIARREGIFLLGPNGLGLQRPHLQLNASAAGPMAKPGSLALVSQSGALTASIL
FT                   DWASKNGVGFSSVVSLGPNTSVDIAQVLDFLANDRQTQSIVIYLEGISSARRFMSALRS
FT                   AANAKPVVVLKAGRRPAGNEAAQTHSGAIVGSDDVFDAALRRAGAVRVRSFVELFSAAK
FT                   CLASRYRPVGNRLAIVTNGGGPGVLAADWVNEIHLQLGKLSPESSSALKPLLPELASLC
FT                   DLIDLSEEATPAHYKAAIEAAGNDRQIDGVLAIFSPKEGVDASEVARALADVKRSMGKP
FT                   LLSCWMGDASVVIGREILNEAAIPTFRTPEAAVGAFGNIASFYQNQQLLQQTPPPLSTL
FT                   AKPDIEGARLIIEHVLAERRKVLTEMESKTLLSAFHIPVTQTILARSATEAMMIATQLG
FT                   FPVALKIDSPDISHKSDVEGVALNILNATGVRDTFTEMMQTVSRLKPNARINGVTVQTM
FT                   ARAKRGREVCVGLVTDDPFGPVIAFGAGGTMIELIDDRAMELPPLNQFLARHLISRSRV
FT                   AETLGAWRGASPADMNALEQILLRVSEMVCELPQLREMDINPIIVDESGAVAVDARIVI
FT                   DNAPQAINGRANPYNHLSILPYPARYEQVWPLRGGGEYIVRPIHPDDAQMLQEMMSHLS
FT                   QESRYFRFISSIVELPPSMLARFTLIDYDREMALVAVFKERRPGANGEALETERIVGVS
FT                   RYVTNPDQSSCEFALVVADDFSGKGLGSRLMLSIMDVAREKGLSEIEGLVLAQNPGMLK
FT                   LMKGLGYTIKPFAEDPDFKLVTHTL"
FT   gene            complement(58751..59677)
FT                   /locus_tag="Pnap_0057"
FT   CDS_pept        complement(58751..59677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0057"
FT                   /product="histone deacetylase superfamily"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   bxe:Bxe_B1514 putative histone deacetylase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35383"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA5"
FT                   /protein_id="ABM35383.1"
FT                   /translation="MLPAYITHPDCALHEMGAHHPECPERLGAINDMLLVKGLLDYMHP
FT                   YDAPLATPEQLAHAHSSLYVSELMAASPAEGYHKVDPDTDMNPFTVRAALRAAGSVVLA
FT                   TDLVLTGDAPSAFCCVRPPGHHAQRDAAMGFCFFNNVAVGIRHALTQHGLQRVALIDFD
FT                   VHHGNGSEDIFRGDERVLMCSIFEQGIYPFTGENATGPNMVNVGLPSRSGSDKFREAVT
FT                   SHWLPALDAFKPELIYVSAGFDGHREDDMGNLALVEADYEWVTKKIMAVAERHCQGRVI
FT                   SCLEGGYVLSPLARSVAAHVKVLIGAD"
FT   gene            complement(59940..61100)
FT                   /locus_tag="Pnap_0058"
FT   CDS_pept        complement(59940..61100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35384"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA6"
FT                   /protein_id="ABM35384.1"
FT                   /translation="MTNQFAGTSFICVMGAMFSLPSIAQDLHSGTPEIPRTSWMLSATA
FT                   SEESIGQGLPVLALDRDDWPRYRSGQSSQPRAWRSLQAELSATHPGGWRFGALARAEAW
FT                   LQASPDAVTVAALDAINSRPETARSYDLNASSQSWQGQGLRVGTPWLKLDAADRWRWQA
FT                   DAQLLRLQKFRTVDLSGKLSYQSSDVYDFNVHSQRSNPNITGPYLSASGRSGLGSSLSV
FT                   AVQGEPAAGWQVQLRADDLLSRLDWPELATDNAVLNSQVTSRAPDGSLDYAPLIKGQKT
FT                   LRHITRRIGVHWQAKVSWSAFGPQSQPGAISLQLDRRAGLNQAWLGWDSGDAGRSRPRW
FT                   SLAIEPVRRVASLGLGWHGWQALLATDGKGTNSEFRYLRLGWQGEF"
FT   sig_peptide     complement(61026..61100)
FT                   /locus_tag="Pnap_0058"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(61169..63475)
FT                   /locus_tag="Pnap_0059"
FT   CDS_pept        complement(61169..63475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ade:Adeh_0897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35385"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA7"
FT                   /protein_id="ABM35385.1"
FT                   /translation="MKSTKIVAALAVAALITGCGGGSGNGSAVDTPQNTSLSIQGDAIK
FT                   GPMAQAKISLYKTTADGKQGDLLQETTSDNNGHYSVTLNGYSGIVIAVASVVSGKTTMY
FT                   DEATGQTISPTAGFTLRASFPVESGKTYSAQINPFTDLATAAAMAKSGGLTTINVEQAN
FT                   SDLAAALTFNPLTTTPTFNAGKPTNSAAAVLVAVSQMALSGELGCITGDQAAKVACVTT
FT                   TLSTKGLADAGVKSALQAKINLVVDAAGLPALLIGGAPGTPVSTATPLEQTKAFMATLR
FT                   SNAKALDAADLSLQTELQKVADDMKSRTAPIASSSITALNVARLGVQLWNDVIKGGAPF
FT                   VTGRTFYKGYEYLGGCSFYSDTNYNTLATSKTDAKYVACQAATQQIPPTDANGEYKPCY
FT                   AVGQWCATQWSYRVRLHPDAADVHKFTIYTQTREAKITVKTVSPATFDETRTPYGAAFP
FT                   GNAATLATQHDGSGQVTALNLSGELSPAFSITSNFASYFDTTLNRWVYKPNTVATVLGD
FT                   KHNVTLSAALTKVGTLDNLALSGSMELIKAGALETRLELSAGSYLQARQDAAGNYEAQD
FT                   GSQEMLLKLKGGTAGSTLTGDLKISAFKLDASGTSYIPTLVAFNGSVQRNGIAFFEGAL
FT                   TGEALNYASFNSTLPRSGTNVQTLRAGLMGKVTIPNRPVLSISLSATQNDKGSSASNTT
FT                   ALSGQYVQGLLTINMSGAASATANIITLESTSGVKLVIDKSQPVYPLTKSGQAVGQYST
FT                   LTNRITYTDSSYEQF"
FT   sig_peptide     complement(63389..63475)
FT                   /locus_tag="Pnap_0059"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 29"
FT   gene            complement(63703..64887)
FT                   /locus_tag="Pnap_0060"
FT   CDS_pept        complement(63703..64887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0060"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: pol:Bpro_1577 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35386"
FT                   /db_xref="GOA:A1VIA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA8"
FT                   /protein_id="ABM35386.1"
FT                   /translation="MTREVVVVSGVRTAIGTFGGSLKDTPPTELAALVVRESLARAGVE
FT                   GKDVGHVVFGHVVNTEAKDMYLSRVAAVNGGCAEGTPAFNVNRLCGSGLQAIISASQSI
FT                   LLGDADIAIGGGAENMSRGPYASLATRFGARLGDSKLVDMVVGALHDPFHTIHMGVTAE
FT                   NIAAKWGITREEQDALAVQSHNRAQKAIEAGYFKEQIVPVMLKSRKGEVAYDTDEHFRP
FT                   NCTLADMAKLKPVFVKENGTVTAGNASGINDAAAAVVLMEAGVAEARGLKPLARLVAYA
FT                   HAGVDPKYMGIGPVPATQMALKKAGLTVNDLDVIEANEAFAAQACAVTRDLGLDPAKVN
FT                   PNGSGISLGHPIGATGALITVKALHELKRIQGRYALVTMCIGGGQGIAAIFERM"
FT   gene            65095..65376
FT                   /locus_tag="Pnap_0061"
FT   CDS_pept        65095..65376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0061"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: gox:GOX1500
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35387"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIA9"
FT                   /protein_id="ABM35387.1"
FT                   /translation="MYKTVILYKTPMHTVSLSEFRANASAMLDRVEQGETVRILRHGKP
FT                   VAELVPVQPAAPEKLPSWKRPIHPLEYQRADGKSLAQLIMDERESARY"
FT   gene            65380..65799
FT                   /locus_tag="Pnap_0062"
FT   CDS_pept        65380..65799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dge:Dgeo_2717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35388"
FT                   /db_xref="GOA:A1VIB0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB0"
FT                   /protein_id="ABM35388.1"
FT                   /translation="MKLLFDSSAIAKRYKRESGHDAVERLLMGADTVVLAAHCKVEIAS
FT                   CLSREVHDHSIDMDQYAYAMGEVAQDFVDFEVRPISPEIEALALAVMAQNRLRAMDALH
FT                   IGTAQVARVDLFVTADRKQALAAQAAGLKTELIEA"
FT   gene            65801..67804
FT                   /locus_tag="Pnap_0063"
FT   CDS_pept        65801..67804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0063"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: pol:Bpro_0073
FT                   glucose inhibited division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35389"
FT                   /db_xref="GOA:A1VIB1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIB1"
FT                   /protein_id="ABM35389.1"
FT                   /translation="MFYPQEFDVIVVGGGHAGTEAALAAARMGCKTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDAMGGAMALATDEGGIQFRILNGSKGPAVRATRAQADRILY
FT                   KAAIRRMIENQPNLWLFQQAVDDLMVEGDRVVGAVTQVGIKFRARTVVLTAGTFLDGKI
FT                   HVGLNNYPAGRAGDPPAVSLSARLKELKLPQGRLKTGTPPRIDGRSIDFSKCGVQPGDG
FT                   MPGGTPGPVPVFSFMGGNVPHPKQVPCWITHTNERTHDIIRSGFDRSPMFTGKIDGVGP
FT                   RYCPSVEDKINRFAGKDSHQIFLEPEGLTTHEIYPNGISTSLPFDIQYALVRSMAGMEN
FT                   AHILRPGYAIEYDYFDPRALKTNFETRAIGGLFFAGQINGTTGYEEAAAQGMFAGINAA
FT                   LQCQEKEAWLPKRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLMLREDNADMRLTEK
FT                   GRELGLVDDARWDAFNRKRDIVSRETQRLRALWINPNNLPASEAERVLGKAIEREYNLA
FT                   DLLRRPDVNYAGLMSLDGGRYANPEIPTGNEDVSRETSTDSALPADLVKSVIEQIEITA
FT                   KYAGYIDLQKVEVERASHYENLKLPADLDYLQVSALSFEARQMLSKHRPETLGLASRIQ
FT                   GITPATISLLLVHLKKNLWKNTTPLKSAEAEA"
FT   gene            67804..68469
FT                   /locus_tag="Pnap_0064"
FT   CDS_pept        67804..68469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0064"
FT                   /product="16S rRNA m(7)G-527 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: pol:Bpro_0074
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35390"
FT                   /db_xref="GOA:A1VIB2"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIB2"
FT                   /protein_id="ABM35390.1"
FT                   /translation="MAATEQNLRSTLKVGLEALQLQLSEQQINQLLAYQAMIAKWTQVY
FT                   NLTSVRDPAEMMTHHLLDSLAAVPALQRYLHRSGLEQGSRLLDVGSGAGLPGVVIAICC
FT                   PQVAVTCVDTVAKKAAFIKQAALALRLPNLTGLHARVESITESFDVICSRAFASLADFT
FT                   KWSAGALAPQGVWMAMKGKHPADELLALPENIAMFHVEQLKVPGLDAERCILWLRPVS"
FT   gene            68499..69125
FT                   /locus_tag="Pnap_0065"
FT   CDS_pept        68499..69125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0065"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35391"
FT                   /db_xref="GOA:A1VIB3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB3"
FT                   /protein_id="ABM35391.1"
FT                   /translation="MPGSFVGVADYGAFVVAILVFLAIPGPGNLALITSTGKGGIAGGM
FT                   GATLGVIAGDQVLLWAAVAGVSAVMAAYPAAFHVVQWLGAIYLAWLGLRMLLAKPGSAP
FT                   ILQIKPRHYFRQALLITLLNPKAIVFYLAFFPLFVDPAQHQGLKTFGVMAATIAVLTFL
FT                   YGLMAVLLTWKLAARLRANPKISATLEKAAGMFLIAFGIKLALSR"
FT   gene            69180..69944
FT                   /locus_tag="Pnap_0066"
FT   CDS_pept        69180..69944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0066"
FT                   /product="chromosome segregation ATPase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   pol:Bpro_0076 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35392"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB4"
FT                   /protein_id="ABM35392.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTTVNLAAGLVQVGQRVLMVDLDPQGNA
FT                   TMGSGVDKRKLAMTVYDVLLEAASIVDARVHSEKSGYDVLGANRELSGAEIELVPLERR
FT                   EKRLKQALAKVDKDYDFILIDCPPSLSMLTLNGLCAAHGVIVPMQCEYFALEGVTDLVN
FT                   TIKQVHANLNKDLQIIGLLRVMFDPRITLQQQVSEQLKGHFGDKVFNTVIPRNVRLAEA
FT                   PSYGLPGVIFDPSSKGAQAFVAFAQEMVGRLL"
FT   gene            70070..70612
FT                   /locus_tag="Pnap_0067"
FT   CDS_pept        70070..70612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0067"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   pol:Bpro_0077 protein of unknown function DUF1234"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35393"
FT                   /db_xref="GOA:A1VIB5"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB5"
FT                   /protein_id="ABM35393.1"
FT                   /translation="MNPRNVLILPGWQGSGPDHWQSRWERAYGYTRVTQHDWMRPLRGD
FT                   WIARLEDVLLSCDEPAVLVAHSLGCQHVAAWAAHSRNTHLVKAALLVAPPDVEREELRA
FT                   QLPSWSPVALGRLPFATRLFASSNDPFCSPERARQFAAAWGADLIDAGPRGHLNADSGL
FT                   GDWPQAHEQLQQLMRDA"
FT   gene            70682..71617
FT                   /locus_tag="Pnap_0068"
FT   CDS_pept        70682..71617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0068"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_0078 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35394"
FT                   /db_xref="GOA:A1VIB6"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB6"
FT                   /protein_id="ABM35394.1"
FT                   /translation="MVTKKQKGLGRGLEALLGPKVDESPEAANALIAASSPGLPASLLL
FT                   DDLVPGQYQPRTRMDEGALYELAESIKVQGIMQPILVRRLKSGSNSGKYEIIAGERRFR
FT                   AARLAGLDSLPVLIRDVPDESAAAMSLIENIQREDLNPLEEAQGLQRLVKEFGLTHELA
FT                   AQAVGRSRSAASNLLRLLNLADPVQTMLMAGDLDMGHARALLALDRATQITAANQITAK
FT                   KLSVREAESLVKKLGSEFSLTPNKAPPEKSRDTRRVEEELADLLMAEVQVRIKKQVKRN
FT                   GKREDVGELAIQFASLDEVNGLIERLRRTA"
FT   gene            complement(71660..73081)
FT                   /locus_tag="Pnap_0069"
FT   CDS_pept        complement(71660..73081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0069"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35395"
FT                   /db_xref="GOA:A1VIB7"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB7"
FT                   /protein_id="ABM35395.1"
FT                   /translation="MNAPLPKHLLPGILQRETPQALIAALKNRFAERCSTALVVREQHG
FT                   RDESSFAAPPPAAVVFAESTQDVADAVRLAGQYSVPVIPFGVGTSLEGHLLAVQGGISI
FT                   DVSRMNRVLAINPEDLTVTVQPGVTRRQLNEEIKSTGLFFPIDPGADATLGGMSATRAS
FT                   GTNAVRYGTMRENVLALEVVTASGEIIRTGTRAKKSAAGYDLTRLMVGSEGTLGVITEV
FT                   TVKLYPLPEAISAAVCSFPSIEAAVRTTIEIIQLGVPIARVELIDAHTVRMVNAHSRLA
FT                   LREEPMLLMEFHGTPNGVKEQAELVQELASGHGGNAFEWASTPEERTRLWTARHNAYFA
FT                   AIQSKPGCRAISTDTCVPISRLADCLLESVAEAEASGIPYFLVGHVGDGNFHFGYLIDP
FT                   DNAQERDAAEALNHQLVARALSLEGTCTGEHGIGLGKMDFLLSETGGGAVDMMRAIKRA
FT                   LDPQNIMNPGKIFTL"
FT   gene            73261..73854
FT                   /locus_tag="Pnap_0070"
FT   CDS_pept        73261..73854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0070"
FT                   /product="ATP:cob(I)alamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP--cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pol:Bpro_0113
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35396"
FT                   /db_xref="GOA:A1VIB8"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB8"
FT                   /protein_id="ABM35396.1"
FT                   /translation="MANRLSQIATRTGDNGTTGLGDNTRVSKDSLRVHAMGDVDELNSN
FT                   IGVLLCEDMPGGVREVLVEVQHQLFNLGGELSIPGFELLKPEAVALLDEALETYNAQLP
FT                   RLAEFILPAGSRAASLAHVCRTVARRAERAVVALDKVETLKEAPRLYLNRLSDLLFVLS
FT                   RVLNRMNGGDDVYWKSERMVRMAREDQKDQDSQP"
FT   gene            complement(73873..74817)
FT                   /locus_tag="Pnap_0071"
FT   CDS_pept        complement(73873..74817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0071"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A2466 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35397"
FT                   /db_xref="GOA:A1VIB9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIB9"
FT                   /protein_id="ABM35397.1"
FT                   /translation="MNFQQLRSVRETVRCGFNLTDVATALHTSQPGVSRQIRELEEEIG
FT                   IELFVRAGKRLTGLTEPGAHVLPIVERLLLECSNLKKAGQEYMAQQNGLLSIAATHSQA
FT                   RYALPPAVQEFRAQFPHVKLHLHQGSPKQVAEMLLSGEVDVGIATEALNGYPELVALPC
FT                   YRWTHSVIVPPGHALLSGPLTLERLAQFALITYDNGFTGRTHIDQAFAQHQLMPNIVLT
FT                   AMDADVIKTYVELGMGVGIVASIAYEAERDTALRALDAGALFGINLTKLAVRRGSYLRS
FT                   YVYAFIESFAPTLNRAIVEQTLSGAPGGDHYDI"
FT   gene            complement(74868..75176)
FT                   /locus_tag="Pnap_0072"
FT   CDS_pept        complement(74868..75176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35398"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC0"
FT                   /protein_id="ABM35398.1"
FT                   /translation="MVTFFWRSKRKLLAAGQPPASPTQKSQPSKQPNSRPSNRPKPHQT
FT                   TQAFKIQPFKLFAHANHAQVAINSIAISIHQGSLDTPLHQRLKHFSHVEQTNQSFLK"
FT   gene            complement(75670..77220)
FT                   /locus_tag="Pnap_0073"
FT   CDS_pept        complement(75670..77220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0073"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="PFAM: acetyl-CoA hydrolase/transferase; KEGG:
FT                   dar:Daro_2807 acetyl-CoA hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35399"
FT                   /db_xref="GOA:A1VIC1"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC1"
FT                   /protein_id="ABM35399.1"
FT                   /translation="MSFADRVQNPALRTKIMSADEAAALIPAGANVGMSGFTGAGYPKA
FT                   VPQALARRIESLHAAGEEFRIGLWTGASTAPELDGALAKVHGIEMRLPYQSDPTCRRQI
FT                   NAGEMQYTDMHLSNVAQFVWFGFLGKLSVAVVEVAGILPDGRLIPSSSVGNNKTWLDQA
FT                   DQIILEVNTLQNPGLEGMHDIYYGTRLPPHRQPIPLTGPGDRIGEPYLTCDLDKVIAVV
FT                   PTSQPDRNSAFAAPDENSQRIASHIIEFLQQEVKLGRLPAELLPLQSGVGNIANAVLAG
FT                   LNDGPFKDLTAYTEVLQDGMLDMLRSGTLAMASATALSFSPVALADFNENIDFYRERIV
FT                   LRPQEISNHPEVVRRLGVIAMNAMIEADLYGNVNSTHIMGSSIMNGIGGSGDFARNAYL
FT                   SFFMTPSVAKDGAISCIVPMASHVDHTEHDVEIIVTEQGLADLRGLSPTQRARLIIEKC
FT                   AHPDFRPALLDYFERSLKTAAGKHTPHLLDEALSWHSRYLKTGDMRPVAAVQEALHLV"
FT   gene            77560..78861
FT                   /locus_tag="Pnap_0074"
FT   CDS_pept        77560..78861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35400"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC2"
FT                   /protein_id="ABM35400.1"
FT                   /translation="MTRTRQWLLGAGVAAGMLALLAALLLSLVPSDEELAARASAELEA
FT                   ALGVPVRVGALHWRLRPTPTVVIEEVATGQPQPIEIKRLTAHLNTSALWQRRMKVDLAV
FT                   VQGAVLPQLSLRGLGRKPAAAEAGPAREFTLDEVPMARIEFGDVTWISRHGIRVVYEGE
FT                   ADFDAAWRPRTARLRRPQTSPPADLALARKGQDDRWEVRSHIGGGTADGELLLHTSGQG
FT                   GLRLTGQLQPRHIEVASALQAFNRRAIIAGKASGETTLSASGATAGELARSLHTTTSFS
FT                   MGRSTLLRFDLDKAIRSLGQAHAGQTPLDSVTGQIDTQNTPQGMVVTFSRLQARSGAFS
FT                   ASGKARVAELRIQAELAVDLVDGVVGVPLTLSGPLDKVQVSVPASALAGAAAGTAVLPG
FT                   IGTAIGARIGAAIGKLFGSEPEPAAGPRPAPGKQ"
FT   sig_peptide     77560..77628
FT                   /locus_tag="Pnap_0074"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 23"
FT   gene            78921..79361
FT                   /locus_tag="Pnap_0075"
FT   CDS_pept        78921..79361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0116 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC3"
FT                   /protein_id="ABM35401.1"
FT                   /translation="MFLQGSAKLDAFSLLFNTPTMSQHPTALFTPTSLERALDQNEAIQ
FT                   ETVEQSAAELCVINAVLQQEVPEHVKTGDVAQALQKTDELESRIQTSAENLEQVNQALK
FT                   EEIQVRADLERQLAATQAELDQVQNSAQNHAQAGAQGRSSSC"
FT   gene            complement(79407..80693)
FT                   /locus_tag="Pnap_0076"
FT   CDS_pept        complement(79407..80693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0076"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: pol:Bpro_0117
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35402"
FT                   /db_xref="GOA:A1VIC4"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC4"
FT                   /protein_id="ABM35402.1"
FT                   /translation="MGMLDWTEKSSAVLRQGGVIGPDERLPWPQTALMGVQHVIAMFGS
FT                   TVLAPLLMGFDPNIAILMSGIGTLIFFAVTGGKVPSYLGSSFAFIGVVIAATGYAGKGP
FT                   NANIGLALGGIIACGAVYAAIGALVQAVGTRWIERFMPPVVTGAVVAVIGLNLASIPVK
FT                   NMAASNFDAWMQVVTFVSVALVAVLARGMLQRLLILIGLIASSLVYALLTNGLGLGKPI
FT                   DLSSMAKADWFGMPGFTTPVFSTSAMLLIVPVVIILVAENLGHIKAVTAMTGKNLDRYM
FT                   GRAFIGDGVATMVSGSLGGTGVTTYAENIGVMAATRIYSTAVFVFAALIAVALGFSPKF
FT                   GALIQAIPLPVMGGVSIVVFGLIAVAGAKIWVDNRVDFSDNKNLLVAAITLVLGTGDFT
FT                   LKFGQFALGGIGTATFGAILLHALLDRKK"
FT   gene            complement(80771..81925)
FT                   /locus_tag="Pnap_0077"
FT   CDS_pept        complement(80771..81925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0077"
FT                   /product="twitching motility protein"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: lpp:lpp2271 twitching
FT                   motility protein PilU"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35403"
FT                   /db_xref="GOA:A1VIC5"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC5"
FT                   /protein_id="ABM35403.1"
FT                   /translation="MPLPAQAAPSPSPSPSDPDDLGRYLALMVAHGASDLFLSAEVAAS
FT                   LKIQGRIRRLPEPPLTGTHIKRLAYSVMRDSQVREFEADLECDLAIAMDALGRFRVNVF
FT                   RQRGEVAVVVRHINSTIPTLESLKLPPVLKTLAMLKRGLVLVVGAAGSGKSTTLAAMLD
FT                   YRNNMASDHILTVEDPMEFEHSHKKCIVDQREVGLDTRSFDEALRRAMREAPDVIMIGE
FT                   IRDRETMQHAMAYAETGHLCVSTLHANNANQAIQRVLNFFPETAQRQVLMDLSLNLKGV
FT                   VGQRLLAGAAGKRVPAVEVMLLSPYVADLIQKGQTDEIKAVMAKSVELGMATFDQSLYE
FT                   LYVRGDITHEQAIEHADSKTDLSLRIRLASGRRPDTEALQVLRD"
FT   gene            82107..82568
FT                   /locus_tag="Pnap_0078"
FT   CDS_pept        82107..82568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0078"
FT                   /product="putative transposase, IS891/IS1136/IS1341"
FT                   /note="KEGG: pol:Bpro_5398 putative transposase,
FT                   IS891/IS1136/IS1341"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35404"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC6"
FT                   /protein_id="ABM35404.1"
FT                   /translation="MSTLRAYRFQLRCKPEQERALRRSAGCARWIWNQAISEQRWRYAA
FT                   GEKYAGYAEMCKWLTTWRNAPETIWLSEAPIPPQQQALKRLHEAYQRFFAKAGGYPSFK
FT                   RHGEEPGLRFPAAAHFQIDQPNQRIKVMKLGWLRIKQSQGINGTPRTSR"
FT   gene            82622..83347
FT                   /locus_tag="Pnap_0079"
FT   CDS_pept        82622..83347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0079"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   transposase, IS605 OrfB; KEGG: pol:Bpro_5398 putative
FT                   transposase, IS891/IS1136/IS1341"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35405"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC7"
FT                   /protein_id="ABM35405.1"
FT                   /translation="MPAAGLEPSLAIDVGLTVFAATSAGVKIKPLLALKRQARYVRRAQ
FT                   KSVSRKVKGSANRKKAICKLGDLHRRIARQREDWLHKLTTELADRHPVIAIEDLRIKNM
FT                   SASAKGTKDAPGKNIRQKAGLNRLILDAAWGEFGRQLQYKLQWRGGQLVLVEPAYSSQT
FT                   CAACDHVAAENRKSQAFSAWPVATLKTPTSTPHRCSCSERRNNGPRGTRHRLENLLQPR
FT                   PVERWSDVGQRASAPMQPL"
FT   gene            83455..84699
FT                   /locus_tag="Pnap_0080"
FT   CDS_pept        83455..84699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0080"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   ade:Adeh_3412 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35406"
FT                   /db_xref="GOA:A1VIC8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC8"
FT                   /protein_id="ABM35406.1"
FT                   /translation="MKPLFKWGVGALLVLAVAGAAVLASRRGTPVQLVPVARTGIVQSV
FT                   VATGRLNAPARMDIGAEVTATVLEVRVREGDRVRAGALLLRLSDAEARAALQQASAALV
FT                   EARGRATQQATVAAPVAGQAVVQAEAAFTSAERDFQRARELVAQGFFSQQKLDDARRAL
FT                   DTARSALQSARVQAQANQPSGVERTLAASRVDQALAAVDIAQARLARLSIASPVDAIVL
FT                   TRSVEPGSMAQPGHVLLTLAAQGGTRIDANVDEKNLRLLTPGMPAKAVADAYPGQSFDA
FT                   QLNYIAPAVDPQRGTVEVRLAVPNPPPFLRPDMTVSVELVGGLKKDALVLPSGAVRDAD
FT                   REAPWVLALQDGLAVRVPVKLGLRGVGSIEITEGLKEGDAIIPQTEKAIAGDRVRPGPV
FT                   VAPVKGMETPSFISR"
FT   sig_peptide     83455..83529
FT                   /locus_tag="Pnap_0080"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.594 at
FT                   residue 25"
FT   gene            84719..85981
FT                   /locus_tag="Pnap_0081"
FT   CDS_pept        84719..85981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0081"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ade:Adeh_3411 ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35407"
FT                   /db_xref="GOA:A1VIC9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIC9"
FT                   /protein_id="ABM35407.1"
FT                   /translation="MLSRHRPALSSWTRWMPFELLVALRFLREGRMQSVLILAGVTGGV
FT                   AVIIFLTQLINQLQSTIIDRVLGSQAHVVIRPLEEVTQRVVTPSEDRAVAAVVQPRDQR
FT                   LRSVDQWERIAGLAAATPGVLAVSPVVSGPAFASRGNSNKSVALLGVQPDAYRRVVRMD
FT                   DYMTRGRFDVTGSNTLIGVDLASDLGVTVGDKLRVTSASGRTETLDITGLFDMGNRDLN
FT                   RRWVFVTLKLAQTLLDLPGGVSNIDLTVKDLFGANQVADALRAQTGLTVDSWMQTNSGL
FT                   LNALSNQTVSNNLIRSFVVIIVALGISSVLVVSVVQKQREIGILRAMGAGRRRIMTVFL
FT                   LQGGLVGLAGSVLGSALAFGLLVVFSHVFKSPDGGSLFSAQLDPMLVLLASVVACGVGL
FT                   AAAAIPARSAARMDPVQAIRA"
FT   gene            complement(86106..86903)
FT                   /locus_tag="Pnap_0082"
FT   CDS_pept        complement(86106..86903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35408"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID0"
FT                   /protein_id="ABM35408.1"
FT                   /translation="MTSKVPPDKFSPDLGDWRLMTAGWITAINNVSLDEPKSYRGSTWF
FT                   QDKNGTDVSFPTPSAAALHLNAAWKASKRAQAIKDGLMVHLFNANGMPSMQASEERIPA
FT                   LFDYFEEMIAVAFNSFGAIEAFCNQTVVEKGGTAVTVVVKKKMKVSKTPEEIEREHSTD
FT                   EKLGRIVPELLEIRTPRGMATWDTYLAIKQIRDAVTHFKRRDQMRHADQSNEPTALLAL
FT                   YRIDCFKLPEDAMKVLRHFQPIGSVQRWMMNPAWKRDASIPAV"
FT   gene            87202..87432
FT                   /pseudo
FT                   /locus_tag="Pnap_0083"
FT   gene            87552..87908
FT                   /locus_tag="Pnap_0084"
FT   CDS_pept        87552..87908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0084"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   eba:ebD100 hypothetical prophage protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35409"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID1"
FT                   /protein_id="ABM35409.1"
FT                   /translation="MVIKVEEYIREDSSNPYKHWFDGLPSQAAAKVTVAKLRMELGNTS
FT                   SIKWFDGMGEYVIDWGPGYRIYLAKEGDTLIVLFGGGTKRGQQRDIDKAKELLTEYKAR
FT                   KKAMTTKSTGKHKR"
FT   gene            87914..88234
FT                   /locus_tag="Pnap_0085"
FT   CDS_pept        87914..88234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0085"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: cch:Cag_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35410"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID2"
FT                   /protein_id="ABM35410.1"
FT                   /translation="MALTRNFKETVIQRVQSDTSFAQALLDEAATLFLNGEPETARLIL
FT                   RDLVNATIGFEQLATLTAKPSKSLHRMLSSTGNPSMDNLAAIFQAVRQRLQVSLQAHSV
FT                   AV"
FT   gene            88241..88936
FT                   /locus_tag="Pnap_0086"
FT   CDS_pept        88241..88936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0086"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rpb:RPB_3881 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35411"
FT                   /db_xref="GOA:A1VID3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID3"
FT                   /protein_id="ABM35411.1"
FT                   /translation="MTTPPAPILRLTDIHRSYNVGTEVETEVLHGISLSLQPAEFVALK
FT                   GPSGSGKSTLLNIIGLLERPTSGTLEIAGQPTGSLDDAGLTQLRGATIGFVFQFHHLLP
FT                   AFTALENVLLPSIIAHGTATLDAEANARELLARVGLKGAEYKRPGELSGGMQQRVAIAR
FT                   ALSLRPRLILADEPTGNLDTVSADEVFGLLREFNRDHGSACLIVTHDPRLAARCDRIIE
FT                   LVDGRLVAG"
FT   gene            89356..89646
FT                   /locus_tag="Pnap_0087"
FT   CDS_pept        89356..89646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0087"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:msl5725 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35412"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID4"
FT                   /protein_id="ABM35412.1"
FT                   /translation="MHAVVRSYSGAGARQLFDILQERKADVEATLRKVPGLVSYTLLGT
FT                   DDGGMSVTVCTDKAGADESVKVARDWIQKNASNTHASPPVVAQGPVIVQIT"
FT   gene            complement(89793..90212)
FT                   /locus_tag="Pnap_0088"
FT   CDS_pept        complement(89793..90212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35413"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID5"
FT                   /protein_id="ABM35413.1"
FT                   /translation="MPLRFLALRAITLYQRHLSPSKGFSCAYRVHTGCQSCSVLGYRAI
FT                   RRFGVWRGLGTLRERFERCRAVHRRHPAFPKVPRSQAGFCDASCDLPCDVGVSDCYCPC
FT                   DCPGDCGDWSKSKKSEKEEKPVYIPPRAVRGGRVQ"
FT   gene            complement(90501..92018)
FT                   /locus_tag="Pnap_0089"
FT   CDS_pept        complement(90501..92018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0089"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: CHAD domain containing protein; adenylate
FT                   cyclase; KEGG: rfr:Rfer_2024 adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35414"
FT                   /db_xref="GOA:A1VID6"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID6"
FT                   /protein_id="ABM35414.1"
FT                   /translation="MKKHPLAPSPEEIELKLALPTSSPSGLAGLAKRLAQTPVLARRKA
FT                   TRQQLHNIYYDTPGQRLHQKRVALRLRRVGSDANPSWLQTLKMGGRSDSALSQRGEWEL
FT                   PVPGAELARQALEATPWSKFDPDGSVFKALAPCIVTTFERTSWSVRKRGGSVVEVSLDI
FT                   GQVVAGDRRTPICELELELLAGQPAALFDIARQIARSVAVLPLNASKAERGYALLQDAQ
FT                   SLPLRARPPALTRNMALPLAAQCVLREMFGQFTSNLNTLTRSDDPEVVHQARVGWRRFR
FT                   SAWRLFQPALAAHAAAPAWQSLEPLLMFVGELRDLDVALNDTLPPLAAAYTAGNAQREE
FT                   KWQAMLQALTQAALLQRKSVRHALQTPAVGATLLAITQWLEELPASKGPDDAKAGPDIS
FT                   LRRWARQRITRQHKKMKQALKDTAHPESQHRARILSKRLRYGIEALRPLLPRRQAERWH
FT                   AKATALQTGIGATRDIMQAGVLAVRFEADPGLAEFLRGVAAGQPVPR"
FT   gene            complement(92109..93173)
FT                   /locus_tag="Pnap_0090"
FT   CDS_pept        complement(92109..93173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0090"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: rso:RSp1044 probable
FT                   cobalt-nickel-resistance system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35415"
FT                   /db_xref="GOA:A1VID7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID7"
FT                   /protein_id="ABM35415.1"
FT                   /translation="MSLRSAFPALASALLFGASTPLAKLLAGNMPPLLLAGLLYLGSGL
FT                   GLGMLLLLRRLRERLRGQPVTRLHIARAELPWLLGAIVAGGLLGPALFMLGLAQTSAAS
FT                   ASLLLNLEGMLTAVIAWLAFRENADRRIVLGMLAIALGGVLLSWEPGGATFSPGSLLIA
FT                   GACLCWALDNNLTRKVSANDALLLACLKGLLAGMGNTAIALYGGAVLPAAPALGYAGVV
FT                   GFLGYGLSLSLFVVALRTLGSARTGAYFSVAPLFGVLVSLAIWPDMPGLLFWTAAALMG
FT                   FGVWLHLSERHAHAHTHEPLRHSHAHRHDAHHRHAHDFAWDEKSPHAHEHQHEALTHSH
FT                   AHYPDIHHRHPHPH"
FT   sig_peptide     complement(93102..93173)
FT                   /locus_tag="Pnap_0090"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 24"
FT   gene            93497..96289
FT                   /locus_tag="Pnap_0091"
FT   CDS_pept        93497..96289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0091"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: ana:alr3092 two-component hybrid sensor and
FT                   regulator; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35416"
FT                   /db_xref="GOA:A1VID8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID8"
FT                   /protein_id="ABM35416.1"
FT                   /translation="MQTQMRAHDWSTSGLGSPASWPQPLKTVAGLMLHCRTPVFLAWGP
FT                   ELSLLYNDAYLDILGERHPAALGRPLYEAWAEIRAEIEPLVNQALSGEPVYFEDAVFTL
FT                   RRKGADEQAWFSFSYAPVDGPDGTVAGLYCNLTETTAKVLAEKNRQAETRRLYSLFEQA
FT                   PSFMAVVHGSSHVYELANSAYLRMAGCQDLVGKTFREAVQGIEDQGYVALLDQVYATGQ
FT                   PFIGNRMPVIFSRHADGPPEQCFVDFIFQPITAPDGVVNGIFIEGNDVTEQVRTEDDLR
FT                   KSRIAGLETAQQLNALLQAAPVAIVMADMHGKPLRFNPASRQLWGDHPASESIAGYAER
FT                   KGWWADGSVRHGCRLEAHEWALARALQGEEAPRDTVEIEPFGKPGIRRTILNCGAPVRN
FT                   LDGDIIGSVAAQMDISDRVAIEAALRETVTQYRTITNAIPQIVWATRPDGYHDYFNQQW
FT                   YDYTGVPQDSTVGEGWKGLFHLEDQLQAAKNWRHSLATGEPYEIEYRLRHHSGQYRWNL
FT                   GRALPVRNEQGAIVRWMGTCTDIHEQKLAQEGLLQADRLKDEFLAMLAHELRNPLAPIA
FT                   TAAHLLSTGTLDPEGLSRLSEVISRQAGHMTRLIDDLLDVSRVTWGQVTLDKNPLDMNS
FT                   IVTEAVEQVRPLLQAKSQHLDIQLSPQRNLVSGDRMRLVQVLANVLNNAVKYTPDGGRI
FT                   TLRVVEDDSHLTVCVRDNGIGMSRELLAIAFELFTQGERTSDRTQGGLGIGLALVQTLV
FT                   HLHGGTVRLHSEGAGLGSELTMVLPRLPQDDGPRRFDAGDALAVPARESLRVMVVDDNV
FT                   DAARLLGMFVELLGHEVFVQFHPASAIECAHQVQPDICLLDIGLPDMDGYTLARQLHRI
FT                   PGMENTVLAAVTGYSQPRDKQAAFAAGFNFHFAKPISAQQLESWLADVTRGRESLSASP
FT                   "
FT   gene            complement(96335..96853)
FT                   /locus_tag="Pnap_0092"
FT   CDS_pept        complement(96335..96853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0092"
FT                   /product="flavin reductase domain protein, FMN-binding
FT                   protein"
FT                   /note="PFAM: flavin reductase domain protein, FMN-binding;
FT                   KEGG: pol:Bpro_0126 flavin reductase-like, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35417"
FT                   /db_xref="GOA:A1VID9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A1VID9"
FT                   /protein_id="ABM35417.1"
FT                   /translation="MSPLSPLRKASSPSFSPLEFRASLAMFATGVTIVTARTPAGVLVG
FT                   LTANSFNSVSLNPPLVLWSLSQAASSMAALSTGSHYAINILAADQKELAERFASRREDR
FT                   WTDVAFTEGIGGAPLLDGAAATFECFNRSRYEEGDHVIFVGEVERCSHRAGAAPLLFHG
FT                   GRFYTEHPL"
FT   sig_peptide     complement(96743..96853)
FT                   /locus_tag="Pnap_0092"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.640) with cleavage site probability 0.627 at
FT                   residue 37"
FT   gene            complement(96966..97262)
FT                   /locus_tag="Pnap_0093"
FT   CDS_pept        complement(96966..97262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35418"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE0"
FT                   /protein_id="ABM35418.1"
FT                   /translation="MTQQKSSTSPANTPAQPAAGKGMPAKNPQPQKPLTGRQPDLKDAS
FT                   VEASLELPRDRDQASDMTSGQTSPLIEQAAQDVKDGLKDTSKAPEMDRAYKKL"
FT   gene            complement(97385..98752)
FT                   /locus_tag="Pnap_0094"
FT   CDS_pept        complement(97385..98752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0094"
FT                   /product="D-amino-acid dehydrogenase"
FT                   /EC_number="1.4.99.1"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0148 D-amino-acid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35419"
FT                   /db_xref="GOA:A1VIE1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE1"
FT                   /protein_id="ABM35419.1"
FT                   /translation="MKVVVLGAGIIGVSTAWHLLERGHEVTVVDRQPDAALETSFANAA
FT                   QISVSYCEPWANRDAPLKALKWMLRDDAPLLFRPRLPFGEGWQQWRWGLQFLAQCNDAA
FT                   FERNVQQLVALGAYSHAALKDVVRATGIEYNRLERGIAHYYTEQKSFDTAGDAAALMRK
FT                   YGVARRVVSTAELLKIEPAFSAFADRIVGGTYTASDESGDARVFTQALAQRCAERGVQF
FT                   LYSHDVVRLEKTGNAINSVAIRARGTSIKGQNDAKVTPLTQLKADAVVVACGSYTAPLL
FT                   RTVGVDLPIYPGKGYSATFKLLKPELAPFVSTIDDEVKCAISRLGNELRVAGTIEIGGY
FT                   DLSLDTPVAKARCHMLARRIEEVLPGVCDTRLEEEGGQPQFWTGLRPATPTNIPYIGKT
FT                   KVDRLWVNAGHGTLGWTHGAGSGKAMAELLSGEVPAMAFGFYGFDRTRRQPGLSVA"
FT   gene            98864..99778
FT                   /locus_tag="Pnap_0095"
FT   CDS_pept        98864..99778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0095"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0149 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35420"
FT                   /db_xref="GOA:A1VIE2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE2"
FT                   /protein_id="ABM35420.1"
FT                   /translation="MSTFDPDALECLAAIVEEGGFERAARRLSITQSAVSQRLRALEAQ
FT                   VGTVLIVRSRPLKATSAGQLLLKHTKMLRLLRADLERDLKELAPSSLRGAREDERISIA
FT                   INADSIATWALPALTGLAQQGLPMEIITDDQDFTHEWLRQGQVLGCVTTLKQALRGCKV
FT                   VPLGAMEYVAVATPALARERLGFDALTAHNFREIPFVAFNRKDDMQSEFVGKAFGLKRV
FT                   MLNQLFVPSSEGQVRAVLAGWGASVLPRLLAQERIDQGLLVNLAPACILPIQLYWHCWN
FT                   LESEVLDALTAALIQSAGLALVA"
FT   gene            99880..101130
FT                   /locus_tag="Pnap_0096"
FT   CDS_pept        99880..101130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0096"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_0150 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35421"
FT                   /db_xref="GOA:A1VIE3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE3"
FT                   /protein_id="ABM35421.1"
FT                   /translation="MAYLSFTGLRAATGIAAAMAAMLAFSLPASAQEDPSAAKSAPAHT
FT                   LKIGVIGPFTGASADFGIPMLNGIQQAVDEINAGGGYLGRKIEIVRKDDQANPDVGLKL
FT                   SQELVAEKVAATIGFCNTGVAAKSLEVYQTHQLPLIIPCATGTPLTAKYPGPASYIFRT
FT                   SPSDGIQAPFVVEDIVKRGWDKVAIFADTTGYGEAGLKDVEAALAARQLKPVHVARFEL
FT                   GVKDLGEPLKAARAAGANVVFSYTVGPENAVIARGRQALGWKVPQVGAWTLSFPFFIEG
FT                   GKEATEGALMAQSFIAEPSNERRASFLTSYARKYKVRKIPVPMAAAQGYDAVYVLVHSL
FT                   FGIRDGKLTGPAIKAALESKNRPYYGVIATYEQPFSKQDKEATTQNMLVMGMVKDGAVT
FT                   FAYPEDAKRNLFVQRKQ"
FT   sig_peptide     99880..99975
FT                   /locus_tag="Pnap_0096"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            101249..104923
FT                   /locus_tag="Pnap_0097"
FT   CDS_pept        101249..104923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0097"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pol:Bpro_0151 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: GAF
FT                   domain protein; ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35422"
FT                   /db_xref="GOA:A1VIE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE4"
FT                   /protein_id="ABM35422.1"
FT                   /translation="MLSRLGLRSRLMLLVLAALVPVFSLFSCSAAKNQQAVLALARASL
FT                   QSQALLAAAHQQRLVERVAQLLGDIASGPSIKNPRNRLCVQFLKNLQAQDPGYSNLGVA
FT                   DLDGRLSCDAVNSGAPVNLADRSFFRQVLGGQAFSVGDYVVARSSGRPGMAFGVPVYSG
FT                   EGVLNGVAFAGIAIQEFAAVLAAEPVVEGARLRVIDRNGIVLAAHPPAAGLAGSREPDA
FT                   VVLGALQSLQPEVREAADAGGIEQVYAFAPVSGSQGGLFVAISVPRDVLTAAPRALLLA
FT                   DLAALLGVTAFGMACAWAMGRRLVVNPANAILEEANEIARGNLHARVRLGRWNQDEIGR
FT                   LGLAFNRMAQSLQAQCSERDAALRQADAERAMRDLILNSMSEGVIAVDAGGRFMLFNAA
FT                   ARKIFCVPATDMLFDEWRKINPLRMLDGQIMASDGPLKQTLRGVSIDKLDLVFSSPDSQ
FT                   NRILRMSTRPLLDPQGQQIGALAVFIDVTQTKAAESFALAQENVLVLIAGGAALGESLE
FT                   AIVLLIEKSAPQSLCSILMAEGGQLRHGIAPSLPPDFVRAIDGLPIAEGVGACGTAAFR
FT                   KESVIIEDVTQDARMHGYQELLAAHGLRACWSTPVVAGDGEVLATFAIYRRAPGGPLPA
FT                   DLALIATATRLARLALERARVKAELIGSEANFRELAENIEDVFYNLDIHHGSPRLRYVS
FT                   PRYEKVWGRSCESLYAAPVSRADAVLPEDRHVMVRADARNAAGQNANVEYRILSTDGRT
FT                   RWIRDRSYPMFNDAGEVVRVVGTARDITESKLAEIALISTHRALQMLSRSSIAINRIHD
FT                   EAGLLAEVCRVAVEVGGYRMAWVGYASDDEEKKIQPVAHAGSELGYLDVITLYWRDDLP
FT                   GGQGPAGQAIRTGRPQQVSDISKPGSQFHWTDAAVQRGYHSVLMLPLCSEQRSFGVLCL
FT                   YAGQVQEFAPEEVNLLQELADNLAFGIVSLRTRLERSQAREEILQLNASLEERVEQRTA
FT                   QLRFANQQLEAFSYSVSHDLRTPLSSIDGFSTLLEKSLTRPDSAPLTERSRHCLARIRS
FT                   GARQMGDLIDAMLALAQVSRSSLVWEAVDLSASAGALLSGLHEREPGRIARLQVEPGMR
FT                   VQGDPRLLRQVLDNLLGNAWKFTSGKAETCITVGQMASGEGEKAYFVRDNGAGFDMAYA
FT                   AKLFGAFQRLHTEAEFAGTGIGLATVQRIIARHGGRVWAESVQGEGATFYFTLGAAAA"
FT   sig_peptide     101249..101341
FT                   /locus_tag="Pnap_0097"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.361 at
FT                   residue 31"
FT   gene            complement(105043..105465)
FT                   /locus_tag="Pnap_0098"
FT   CDS_pept        complement(105043..105465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0098"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_0401 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35423"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE5"
FT                   /protein_id="ABM35423.1"
FT                   /translation="MKILLAVDGSSYTKKMLAYLVTHDALFDAKNEYAVLTVQPALPPH
FT                   ARAAVGKEIVDSYYAEETGKVMAPVAEFLKHHGIIAKSDWKVGPAGETIAKFADEGKFD
FT                   LLIMGSHGHGALGNLIMGSVTTQVLAHSKVPVLLVR"
FT   gene            complement(105547..106497)
FT                   /locus_tag="Pnap_0099"
FT   CDS_pept        complement(105547..106497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0099"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pol:Bpro_0155
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35424"
FT                   /db_xref="GOA:A1VIE6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE6"
FT                   /protein_id="ABM35424.1"
FT                   /translation="MAAFMPAAGPAAKARSGTAGRPSRTIDRVNIQLLSDLHLESNPYF
FT                   KATPLPGADLLVLAGDIGSYQRGSLLGSLGIEDFGLARFSPLPVAQGGAGWPTPVLFVP
FT                   GNHEYDGLDFEQADARLRDTCRRLGLIWLERESVVLAGVRFVGCTLWTDFDALTARQAA
FT                   ASPAQADSITLAEQLKAREKAFRAANFYLKKNHALRQGQPMLAEAMREESLKSQAWLRR
FT                   ALAQPFDGPTVAVTHFAPSLLSADPRYGIAPGTAGFCNSLDELLPLARLWLHGHLHCPN
FT                   DYVKHGCRVVANPLGYARKGEQEAFRPSLCIALKP"
FT   gene            complement(106815..107771)
FT                   /locus_tag="Pnap_0100"
FT   CDS_pept        complement(106815..107771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0100"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0158 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35425"
FT                   /db_xref="GOA:A1VIE7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE7"
FT                   /protein_id="ABM35425.1"
FT                   /translation="MTPPNFRTLDLNLLRVFDEVMAERSLTRAARNLSLTQPAVSNALR
FT                   RLRETLGDDLVQRSGQGMAPTPRAVVIWPAVREALRQLQASLIPNEFVAAEATTAFVLA
FT                   MADATAAELIPGLSEILEREARGVSIRVLPLTTRDPRRMLDEQACDLAVGYFPSVVPDL
FT                   TAKEQNGEAMPFFFQRLYDGEYVCVMRKDHPLAGGVLSLDDFCNARHMLVSFSGRPYGF
FT                   IDESLAALGRERRVVLTVNQFFTAGQVVAHSNLLTVLPRHFVRVTGIAEQLALQTLPFA
FT                   VSPVHVDSLWHRRSEQRSAHVWLRQAILRAAEKAFSI"
FT   gene            107919..108440
FT                   /locus_tag="Pnap_0101"
FT   CDS_pept        107919..108440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35426"
FT                   /db_xref="GOA:A1VIE8"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE8"
FT                   /protein_id="ABM35426.1"
FT                   /translation="MTYFINNPYSDHHHGADRVEAVMDAAQHLPEGIAGKRGVALLLGS
FT                   AMAAAVMAVAYEVMDSADESHLLMIWVGLWLALFALLAFFAGALRATGMRFKRSLDAWS
FT                   LALAEARADQRLWASAKADPRIMADLQMAITRSEVQAEANAVPAATARAERALKSRSYS
FT                   ILRAYERHYL"
FT   gene            complement(108552..110420)
FT                   /locus_tag="Pnap_0102"
FT   CDS_pept        complement(108552..110420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0102"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pol:Bpro_0160 phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35427"
FT                   /db_xref="GOA:A1VIE9"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIE9"
FT                   /protein_id="ABM35427.1"
FT                   /translation="MNQPAMQGLNLNTPAYVKNAKLIAWVADMVALCKPDTVYWCDGSD
FT                   AEYQRLCQQLVDAGTFKKLNEAKRPNSYLACSDPSDVARVEDRTYICSAKEENAGPTNN
FT                   WMEPSEMRATLQPLFDGCMRGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMKIMT
FT                   RMGKAVFEVLGTEGDFVPCVHTVGAPLAEGEQDVTWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPEGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFDGWSVTTIGDDIAWIKPAADGKLYAINPEAGYFGVAPGTNMLTNPNCMLS
FT                   VRGNTIFTNVALTDDGDVWWEGMEQDAPGKALPDHLIDWQGKDWTPQIAKETGAKAAHP
FT                   NSRFTVAATNNPALDSAWDDPKGVAIDAFIFGGRRSTTVPLVTEARSWVEGVYMAATMG
FT                   SETTAAATGQAGVVRRDPFAMLPFMGYNMSDYFQHWLDLGKKLAASGATLPKIYTTNWF
FT                   RKGTDGKFVWPGYGENMRVLAWMIDRIEGKGQGEDHVTGISPSYEDLNWTGLDFSADQF
FT                   NTVTSIDKAAWLKELELHAELFKQLEHHLPKELGETKAEIERRLAA"
FT   gene            complement(110417..110683)
FT                   /locus_tag="Pnap_0103"
FT   CDS_pept        complement(110417..110683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0103"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35428"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF0"
FT                   /protein_id="ABM35428.1"
FT                   /translation="MFCISFEGHDVATDGDVLKMALPGNRGENNNDTISRQNQLPRFLH
FT                   EWPPRLEAAQSLISKNVPALTRAKRGHWPAFIEITLFTLEFSR"
FT   gene            complement(111104..112474)
FT                   /locus_tag="Pnap_0104"
FT   CDS_pept        complement(111104..112474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35429"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF1"
FT                   /protein_id="ABM35429.1"
FT                   /translation="MQPANAPMQNSTKRPETWRTHCIKIGKVTKVSCANRCNRHQIIPA
FT                   GRSENNSRTKASSGHNTPQRRKAMCDQNNAKNETDWSVVENIKNLTPYPPAALQSPSQT
FT                   ALGEKGPLLEWGEASGIGDGAFPSVALNKDISLTVHEGGAFNAQLFYNTGPIRGGFGDA
FT                   IPYDSGGYPFIAMNDNGQLVEVHQSGFDLYYRVGKIHQDGTVTWGPSLWFDNGHWSSVA
FT                   INNLGAVIEVHNNGANQLYYNIGTISGDKILWNKKAVNYDNGYTPSITLNNNGLVLECH
FT                   VESLHRRLRNKIGLVKTNENGELKIEWDYNIWYDDGAAPSISINDAGNVVEVHQSGASY
FT                   DLYYRVGQYSDYSGSVAWSDQNGIRYDGGRLPRVAINQNGQIKEVHQSEAAPTIWFRDG
FT                   LIYWPTQDLDRSAVASADVMAALNSIPVIGSVAATSIDPPMIGQQASNAQPDPRGSD"
FT   gene            112533..113192
FT                   /locus_tag="Pnap_0105"
FT   CDS_pept        112533..113192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0105"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein, LuxR; response regulator
FT                   receiver; KEGG: corR; DNA-binding response regulator CorR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35430"
FT                   /db_xref="GOA:A1VIF2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF2"
FT                   /protein_id="ABM35430.1"
FT                   /translation="MPNSFIEPPTVLLVDDHTLFREGMRLMLGSSPLVHAHILDAGNLP
FT                   DALALQQSVDLVLLDIGLPGIGGLEGLLSVRQRWPDAVIVMLSAHDRPELVREALSKGA
FT                   CGFVSKTAQPVQICQEVRRWLYQQRGPEPQPQALPGEAAAGAIPGGDESLTPRQYEVLK
FT                   LLAQGLSNKAIAFKLHLSEHTIRNHVVAILRHFNALTRTEAVMASQRLGLLPATLI"
FT   gene            113225..115198
FT                   /locus_tag="Pnap_0106"
FT   CDS_pept        113225..115198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0106"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: rme:Rmet_4855
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35431"
FT                   /db_xref="GOA:A1VIF3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF3"
FT                   /protein_id="ABM35431.1"
FT                   /translation="MVPGAPGPAATAGTGPQALRHLSVLDSQLQLINANIYAALLGSGL
FT                   TGCLLTWLVWLVNPDPLSGSWIEQGQRFVAWLAAGNYSVSAAGFEGVAVLRLHSASWLL
FT                   AYLLVSLACALIWRYFWRRTGSIYSVEQTYRLLQALALAVGLCWGIGCGWLYQPESSAV
FT                   TLGMVSLMGGLSGGLLSGVGVRARLYWLVSLPMAVGLVGALLYHGGEVNPVLPVALLLL
FT                   LLSNGIFAHNTERHIGSTIELRFKNMFLVEQLREQTRVAEQANLAKSNFLAGASHDLRQ
FT                   PVHALNLFLESLSTTRLDARQETIVTHARAASLASREMLDTLLDFSRIEAGVMEPKPRT
FT                   MPLAGLLRQLEDEYGPQADSKGLVYRSRDCIDHVYCDPSLLSLILRNLVGNAIRYTVRG
FT                   GVLVAVRTRGTDKVVEVWDTGIGIDASHHEKIFHEFHQISNQERDHHKGLGLGLAIVRR
FT                   LVDSLGLELSLASRLGKGSVFSLRLPCASPPCQPAGVNALVSPTFQPGAARHEASSLMG
FT                   LRVLVVDDEVLVREGMRMLLGQWGCFVEVFRTVEGATRYIGDFDGDGPPFDLLITDFRL
FT                   ENGVTGHDVIRAVRAALQKLPDFADFDPPVVIVTGDTDPLRISQARGLGATVLHKPIDT
FT                   QVLHAELAKAFAFKTSKNLLLI"
FT   gene            complement(115233..115898)
FT                   /locus_tag="Pnap_0107"
FT   CDS_pept        complement(115233..115898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0107"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; KEGG: rfr:Rfer_3383
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35432"
FT                   /db_xref="GOA:A1VIF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF4"
FT                   /protein_id="ABM35432.1"
FT                   /translation="MHPEPETPILMAEGLSFSHSQPSAPPLFDQLSLVLAPGVTWVCGD
FT                   EGTGKTTLLQLLAGKLPSTGQLRIQGVCLTQEREAYQRQVAWFDPRATALDQQTARQIF
FT                   AGLPQRHPGCDLDALQAHIDGLSLAPHLDKALFMLSTGSRRKVFLAAALAARAPVTLLD
FT                   QPFMALDRPSIDYLLAVLAEAARQPGRAWVVADYEAPGQVALAAVVKLGEPGPISVPN"
FT   gene            complement(116006..116251)
FT                   /locus_tag="Pnap_0108"
FT   CDS_pept        complement(116006..116251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0108"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35433"
FT                   /db_xref="GOA:A1VIF5"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF5"
FT                   /protein_id="ABM35433.1"
FT                   /translation="MRSGAAAGRLKKVNSGQVFQAFQELLMNPSAQHTTNAAHDSPTPA
FT                   QEQDAVDAIVPIIPIVLPLVGGVLMFLLAFIAIYMA"
FT   gene            116291..116764
FT                   /locus_tag="Pnap_0109"
FT   CDS_pept        116291..116764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF6"
FT                   /protein_id="ABM35434.1"
FT                   /translation="MHTMKSSTRVFSLCAAPALVLVLAGCASSGAGSASARPVLYPNAT
FT                   LNRVGDAQGRMEANACMSRAQASGLSPMQTTNEVGRRAGEGAAIAGVASAVGALITGRG
FT                   GEGMLRAGAAGAAVGGSAGAVSGAFHNDKPNGVYRNFVQRCLSEKGFEVIGWN"
FT   sig_peptide     116291..116401
FT                   /locus_tag="Pnap_0109"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.838 at
FT                   residue 37"
FT   gene            116771..117349
FT                   /locus_tag="Pnap_0110"
FT   CDS_pept        116771..117349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0110"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: MOSC domain containing protein; KEGG:
FT                   rme:Rmet_3580 MOSC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35435"
FT                   /db_xref="GOA:A1VIF7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF7"
FT                   /protein_id="ABM35435.1"
FT                   /translation="MPQLLSVQVGLARRTNIGERSILTAYGKQPVAQAVPVLPLGLLGD
FT                   DQADLSVHGGLAKAVYAYPSEHYAYWQAARRGAGVGEIDASLPHGSLGENLTLQGLLET
FT                   EVWAGDVLKFPGCELRVTLPREPCYKFNAAMGFGRASKLMAQTGFCGFYLAVQTSGTLR
FT                   AGESFEVIPGRRGVGIPALFAAKMSKHLR"
FT   gene            complement(117376..118578)
FT                   /locus_tag="Pnap_0111"
FT   CDS_pept        complement(117376..118578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0111"
FT                   /product="L-threonine ammonia-lyase"
FT                   /EC_number="4.3.1.19"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent enzyme, beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: pol:Bpro_0165
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35436"
FT                   /db_xref="GOA:A1VIF8"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF8"
FT                   /protein_id="ABM35436.1"
FT                   /translation="MLSLTVIEQAAQRLHGHLLDTPCVESRTLSQLTGAQIYLKFENLQ
FT                   YTASFKERGACNKLAQLTESERQRGVIAMSAGNHAQGVAYHAQRLGIRAVIVMPRFTPG
FT                   VKIERTRGFGAEVVLHGDTLDASRAHAMGLAEREKLVFVHPYDDEAIVAGQGTVGLEML
FT                   HAVPELEVLVIAVGGGGLIAGVATAAKALKPGIEIIGVQTSRFPAMVNAIKGTHHPQGT
FT                   STIADGIAVGTPGVIAQAIIAEKVDDLLLVDEGDIEQAMVMLLEIEKTLVEGAGAAGLA
FT                   ALLKYPARFAGRKVGLVLCGGNIDPLLLAAIIERGMVRAGRLARIRVSARDIPGSLAKI
FT                   TATVADAGANIEEVHHQRAFTMLAAQNVEIELVLQTRGRPHIAQVLQALRTAGFEAEEQ
FT                   H"
FT   gene            118782..121151
FT                   /locus_tag="Pnap_0112"
FT   CDS_pept        118782..121151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0112"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: pol:Bpro_0166 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35437"
FT                   /db_xref="GOA:A1VIF9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIF9"
FT                   /protein_id="ABM35437.1"
FT                   /translation="MNKRSLVEHPQQWLLSPGLKEAPVLDLMCSHFVLTLAARQGAKFN
FT                   VRRDLNSLLSLSGRHLVWPLPALQRLREFLNRRCKGNEFWQDHETLSDAEFMARHGVWR
FT                   GPYEEGTLFFYLDEHAKDQPKDLLSVLSATGDWLTLALKKQSTLVEKNIESLASLLQLN
FT                   RAERALLLYGTLARYQRDLRSLLVEFKVNNAPEAYAAIADVAGVKAPEVAEALRPGSRL
FT                   ERIGMVENLISEHNITDLADLMKVSEKLPPVLMRKYRDHSELMAVFTRPATRSRLGLAD
FT                   FAFVEDDAQVLVSLLRHAVAGKEAGVNVLLYGPPGTGKTELAKVVAQAAGLDLFEVEYA
FT                   DRDGNSLSGRDRYRSLQIAQVFLKGSMHSALLFDEVEDVFPPISSEAAQLMARSEQLTA
FT                   PNSHSVSGKAWVNQILESNPVPTLWVTNRIEQIDPAFRRRFAYHLELRSPPPGAREGIV
FT                   RKTLEGVQVSDAFVAKLTARKGLTPAQIRTAVRFARLASAPAKAMDAQVDGAGMQAILA
FT                   GGRPSLMESLIERQLRNADVALGNKAEASGRRNVTTYDLAMLNVESRFEIPRIVEALKS
FT                   RGHGSLCFYGPPGTGKTALAEHIASALEQPLLIKQASDLMSKYVGETEQQMAAMFREAE
FT                   AEKAVLLLDEADSFLQDRRGAQRTYEVTEVNEMLQGMERYAGIFICTTNLLESLDQAAL
FT                   RRFTFKIKFMPLTAGQREAMFVTEALAGDATLLTGELQQRLAQLTQLCPGDFAAVKRQA
FT                   VILDAELSAEEFLAQLEAEHRIKPEVREGRGMGFMR"
FT   gene            121574..121873
FT                   /locus_tag="Pnap_0113"
FT   CDS_pept        121574..121873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35438"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG0"
FT                   /protein_id="ABM35438.1"
FT                   /translation="MLLTVEFPHEPFNAHVRSGKAGEIIGRILETIKPQAAYFTEQDGR
FT                   RGGVFLIDVQNSSDVPSFAEPFFLNFQANCKFRIVMSPEDLQKAGLEALGKKWA"
FT   gene            complement(122049..123968)
FT                   /locus_tag="Pnap_0114"
FT   CDS_pept        complement(122049..123968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0114"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /EC_number="3.6.1.-"
FT                   /note="KEGG: pol:Bpro_0170 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35439"
FT                   /db_xref="GOA:A1VIG1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG1"
FT                   /protein_id="ABM35439.1"
FT                   /translation="MSGPPLSSLPISSAPSDQPTPLDVLGQVFGYSDFRGPQQAIVEHV
FT                   IAGGDALVLMPTGGGKSLCYQIPAIARQNAGHGVTIVISPLIALMHDQVGALLEAGVSA
FT                   AFLNSTQTFEESSQLEKQLLRNELTLLYAAPERINTPRMKGLLASLHERGLLSLFAIDE
FT                   AHCVSQWGHDFRPEYRSLSLLHETFPDVPRMALTATADALTRQDMIERLKLEDARLFLS
FT                   SFDRPNIRYTIVEKTDATRQLLRFIQAEHHGEAGIVYCQSRKRVEEIAGMLEDAGIKAM
FT                   AYHAGLDAKLRQQRQDRFLREDGCVMVATIAFGMGIDKPDVRFVAHLDMPKNIEGYYQE
FT                   TGRAGRDGLPADAWMVYGLQDVVNQRRMIDTSEVASEEFKAVMRGKLDALLTLAEGTRC
FT                   RRVSLLGYFGEASEPCGNCDNCLTPPAVWDATEAARKMLSCIYRVQQASGISFGAGHIM
FT                   DILRGKPTEKVVQYGHDQLSTFGIGADLAEPQWRGVLRQLIASNLVRVNAEAFNTLQLM
FT                   PDARQVLKGEVSVLLRQQAASAKAERTRRGSKSTVKTSVKGMAEATLNAGALERLGRLK
FT                   AWRTDVAREHNLPPFVIFHDATLRAIAEQAPQDLHALSGISGMGVKKLAAYGAEVLRVC
FT                   AEPG"
FT   gene            124205..125260
FT                   /locus_tag="Pnap_0115"
FT   CDS_pept        124205..125260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0115"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pol:Bpro_0172 5-methyltetrahydrofolate--homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35440"
FT                   /db_xref="GOA:A1VIG2"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG2"
FT                   /protein_id="ABM35440.1"
FT                   /translation="MHAMKPITYTRAQQLPALLAQRILILDGAMGTMIQRFRLNEAQYR
FT                   GERFKDFHKDVKGNNELLSLTRPDMIRDIHEGYLAAGADMIETNTFGATTVAQADYDMA
FT                   DLAVEMNYESARIARAACDKFSTPEKPRFVVGALGPTPKTASISPDVNDAGARNTSFEE
FT                   LRKAYYEQTEALVKGGADVLLVETIFDTLNAKAALFAIDEYFENSGERLPLIISGTVTD
FT                   ASGRILSGQTVTAFWHSVRHAEPLAVGLNCALGAALMRPYIQELAKAAPDTFISCYPNA
FT                   GLPNPMSDTGFDETPDVTSRLLHEFAAEGLVNIVGGCCGTTPEHIAAIAQAVAPMDGRR
FT                   LQRNGFYAQAA"
FT   gene            complement(125288..125872)
FT                   /locus_tag="Pnap_0116"
FT   CDS_pept        complement(125288..125872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0116"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: pol:Bpro_0173
FT                   cyclic nucleotide-binding domain (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35441"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG3"
FT                   /protein_id="ABM35441.1"
FT                   /translation="MFKNIFKKPLLPADGRHQDKAGGSGSADLAAEMLIAPTALMQLSL
FT                   EEARVVVLYMQPQLVAKGTIFIREGDGRDTGFMMLLLDGEVTVETVVVSRAQPIIITVM
FT                   GPGSLIGELGFLDAQPRYASCIAATPLRCAILTREALNRLMLENAPVAAKLMLALSLRI
FT                   GVRLREITDKLKMYVQLTQAMEQEIASRITP"
FT   gene            126045..128864
FT                   /locus_tag="Pnap_0117"
FT   CDS_pept        126045..128864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0117"
FT                   /product="methionine synthase (B12-dependent)"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: pol:Bpro_0174
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase, DHPS; Methionine synthase, B12-binding module,
FT                   cap domain protein; Vitamin B12 dependent methionine
FT                   synthase, activation region; cobalamin B12-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35442"
FT                   /db_xref="GOA:A1VIG4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG4"
FT                   /protein_id="ABM35442.1"
FT                   /translation="MSSIQFSHEVPPMKLSGLEPVTIGSDSLFVNIGERTNVTGSKAFA
FT                   RMILNGDYEQALTVARQQVENGAQIIDINMDEAMLDSQAAMVRFLNLIAGEPDIARVPI
FT                   MIDSSKWSVIEAGLRCIQGKGIVNSISMKEGVDAFKHQAKLLKRYGAAAVVMAFDEKGQ
FT                   ADTYERKISICERAYRVLVDEIGFPPEDIIFDPNIFAIATGIDEHNNYAVDFIEATRWI
FT                   KANLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGMMGVYDEL
FT                   EPVLRERVEDVVLNRQPVYKPGEAHLTPGERLIEVAETAKSGARDDSKKYEWRALPIRA
FT                   RLSHALVHGNNEFITEDTEEVWQAIKAEGGRPLHVIEGPLMDGMNVVGDLFGQGKMFLP
FT                   QVVKSARVMKQAVAHLLPYIEAEKLLLEAAGGDVKTKGKIIIATVKGDVHDIGKNIVTV
FT                   VLQCNNFEVVNMGVMVPCHEILALAKAEGAHIVGLSGLITPSLEEMQYVAAEMQKDDHF
FT                   RLNKIPLMIGGATTSRVHTAVKISPHYEGPVVYVPDASRSVSVAQSLLSEQAAKYIAEL
FT                   NADYDKVRTQHANKKQTPMWPLAKARANATPIDWTNYTPPVPKFIGRRVFKNFDLAELA
FT                   QFIDWGPFFQTWDLAGPFPAILTDEVVGVEATRVYEDAQKMLKRLIEGRWLTASGVMAL
FT                   LPANSVGDDIEIYTDETRTEVAMTWHGLRQQTEKTAVDGVMRPSRCLADFVAPKVLTPE
FT                   LIAARTRAASAKGQNDLKIADYIGVFAVTAGLGADKKEKAFQADHDDYSSIMFKSLADR
FT                   LAEAFAEALHQRVRRDLWGYAPAESLGHDALIAEQYQGIRPAPGYPACPDHSVKKEMFE
FT                   LLHAGDIGMALTESLAMTPAASVSGFYLSHPQSTYFSVGKIGDDQLQDLARRRGAKAED
FT                   LARLLAPNL"
FT   gene            129037..130506
FT                   /locus_tag="Pnap_0118"
FT   CDS_pept        129037..130506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mma:MM1677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35443"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG5"
FT                   /protein_id="ABM35443.1"
FT                   /translation="MLFSWALPRCRTALRCLIGALWLGAAAAFAAPLAYLADRNQNTVS
FT                   VVEMTTYSRLTTISLGAAQASPVELVANEASGKVFVALGTGVAIIDPRTQALAGEIPLA
FT                   LIKAMAVSPDGKKVYALTPGSVSVIDTDSKSVTATLAVDPSAVSLAIDADGETIYVAHT
FT                   GLEPGTENALGAAGITLINGLTPEIENVVSTKDFRPERLAVNPGDDRLYMLGNVGLAAD
FT                   EHAYRMLDPVTSAITRIALVMPPQTPPIPGFTSLAFNQDGSRLYLGGHSFGVTTIPVLE
FT                   VDTAAGTVARVLRVPPGFADEHTALKLATSFANDKFVLIVFVKERLNSAMFEPGRRAVF
FT                   MEVAGGLIVSDFQAPSPGDTDLLTGDILDSAPAPTQGKVPTSTVLQANANPPLRPTLPV
FT                   TFMATVTGNNPTGKVVFRFTARGDHHRMVQKVRVPLNGGVATLALAACNTAWDNAALQK
FT                   IACSPEFKVVAKFRGDPFNARSKSEALHESY"
FT   sig_peptide     129037..129129
FT                   /locus_tag="Pnap_0118"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 31"
FT   gene            complement(130589..132136)
FT                   /locus_tag="Pnap_0119"
FT   CDS_pept        complement(130589..132136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0119"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: pol:Bpro_0181 Mg chelatase-related protein;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase, ChlI subunit; ATPase associated with various
FT                   cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35444"
FT                   /db_xref="GOA:A1VIG6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG6"
FT                   /protein_id="ABM35444.1"
FT                   /translation="MSLSLVHSRALLGLQAHPVCVEVHLANGLPSFTLVGLADTEVKEA
FT                   RERVRSAIQNAGLEFPGNKRITVNLAPADLPKDSGRFDLPIALGILAASGQIDARKLAG
FT                   YEFAGELSLGGDVRPVRGALAMSLAIARPAHGGTARKLPRLVLPEGSAQEAALVPDAEI
FT                   YRAHHLLDVVRQFLPGDAVPEVADGWMRVASAAPSRQPAYADLADVKGQAAARRALEIA
FT                   AAGGHSLLMVGSPGSGKSMLAQRFAGLLPAMTTEEALETAAVASLGGRFTLDHWAVRPT
FT                   CAPHHTASAVALVGGGSPPRPGEISLAHRGVLFLDELPEFPRAALEALREPLESGSITI
FT                   SRAASRAEFPARFQLIAAMNPCPCGYLGSSLRACRCSPEQVSRYQGKLSGPLLDRIDLH
FT                   VEVGALAAGELVNTPPGEATETIRSRVVQARERAMSRQGSANQALQGQAIDAQCQLDAT
FT                   AAKFLNTAATRLGWSGRGIHRCLKVARTIADLAGAKTVQLTHVAEAVQYRRALKAAH"
FT   gene            132475..132813
FT                   /locus_tag="Pnap_0120"
FT   CDS_pept        132475..132813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0120"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pol:Bpro_0183 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35445"
FT                   /db_xref="GOA:A1VIG7"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG7"
FT                   /protein_id="ABM35445.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSGMGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVPDELVDRVIEAIETSARTGKIGDGKVFVYDLEQVVRIRT
FT                   GETGKEAL"
FT   gene            132847..134412
FT                   /locus_tag="Pnap_0121"
FT   CDS_pept        132847..134412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0121"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: pol:Bpro_0184 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35446"
FT                   /db_xref="GOA:A1VIG8"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG8"
FT                   /protein_id="ABM35446.1"
FT                   /translation="MKKLIASLLLGLSLLGTGATAWAQAPAEAPAATASAPAEAKPDAA
FT                   AAPASAPADTAAPAAAAPAPAAEASAAAAPAPVPNKGDTAWMMVSTILVILMVVPGLAL
FT                   FYGGLVRSKNMLSVLMQVMVTFSLIVVLWFIYGYSLAFTEGNAFIGGFDRLFMKGIWDN
FT                   AAGTFANAATFSKGVVIPEIVFAAFQATFAGITCTLIVGAFAERIKFSAVLAFMVIWFT
FT                   FSYAPMAHMVWFWMGPDAYTGKEVVDAMTGKAGYIWQTGALDFAGGTVVHINAAVAGLV
FT                   GAFMVGKRIGYGKEAMAPHSLTLTMVGASLLWVGWFGFNAGSALEANGFAALAFINTLG
FT                   ATAAAVLAWCVGEALLKGKASMLGAASGAVAGLVAITPAAGNVGIAGGLAIGFIAGFAC
FT                   LWGVHGLKKILGADDSLDVFGVHGVGGIVGALLTGVFNSPALGGPGYVADWVTAAMVTT
FT                   ADYSIMSQVWIQAKAVLITIVWSGVVSLVAYKIVDLTIGLRVSEEDEREGLDITAHGET
FT                   AYNR"
FT   sig_peptide     132847..132918
FT                   /locus_tag="Pnap_0121"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 24"
FT   gene            134558..135484
FT                   /locus_tag="Pnap_0122"
FT   CDS_pept        134558..135484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0122"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pol:Bpro_0186 senescence marker protein-30 (SMP-30)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35447"
FT                   /db_xref="GOA:A1VIG9"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIG9"
FT                   /protein_id="ABM35447.1"
FT                   /translation="MTWQTAISQPSELGESPFWHPDEQRLYWVDITACQICRADAATGM
FT                   VERWTVPSEPGCIAPARTGGQNSGLVMALRDGIYRARQWGGELALLAPAQHDPATLRFN
FT                   DGKADALGRFWAGTIYEPRGAARAQLFSLDGRGGRAPVLEAKAADATTANGLAWSPDAA
FT                   TLYWADTPRHLVRAWDWDAAGNTLSHERVFRQWPVKPEGWQAGMPGYGGRPDGAAVDSQ
FT                   GNYYVAMYEGARLLKLSPAGELLAEFAVPAQCPTMPCFGGADLKTLYLTTARHGRPAAE
FT                   LQAWPDSGCIFSMRVDVPGLPVNFFRD"
FT   gene            135697..136845
FT                   /locus_tag="Pnap_0123"
FT   CDS_pept        135697..136845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0123"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rfr:Rfer_0480 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35448"
FT                   /db_xref="GOA:A1VIH0"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH0"
FT                   /protein_id="ABM35448.1"
FT                   /translation="MNADTDMTTLMAARVRDAAQAGTPLRIRGGGSKDFYGQALAGDVL
FT                   DLSGHAGVISYEPSELVVTVRGGTPLAELEALLAGQGQCLPFEPPHFGPNATVGGMVAS
FT                   GLSGPARASSGAVRDYLLGVVLLNGKGESLTFGGQVMKNVAGYDVSRLMAGTLGTLGVL
FT                   LEISLKVLPVAPAEATLACRLPQQKALDLLNRWGGQPLPLNASCWVHDDSAAPGQDFLF
FT                   VRLRGAVAAVEAACPRMMADVQAAGGQAARMDQAQAGADWNACREQTLPFFARPPALDA
FT                   CLWRLSVPQTTLALDLPFPQLIEWHGGLRWLWAPASAAAQLRRLAAQAGGHATVFRRAA
FT                   QTPAELPVFAPLSPVQSRIAQALRKEFDPAGVFNPGRMSMDR"
FT   gene            136854..137618
FT                   /locus_tag="Pnap_0124"
FT   CDS_pept        136854..137618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0124"
FT                   /product="protein of unknown function DUF1275"
FT                   /note="PFAM: protein of unknown function DUF1275; KEGG:
FT                   bur:Bcep18194_C7065 protein of unknown function DUF1275"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35449"
FT                   /db_xref="GOA:A1VIH1"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH1"
FT                   /protein_id="ABM35449.1"
FT                   /translation="MRRLRHLTGQHRTASINRLLGAVLAFNAGAINAGGFLVVHMYTSH
FT                   MTGFASLLADNLVLGNMRLVLGAIGALLAFTFGAAFTAIQVNWARQHGLRSEYALPLLV
FT                   EALLLLLFGLMGATLNRQTPFAVPLTVLVLSFTMGLQNALVSKVSSSQIRTTHMTGIVT
FT                   DIGIELGKLFYWNRIEGPFESRVRANRIKLRLLCILLGAFVAGGIVGAAGFKYVGFIWV
FT                   VPLALLLLALCLPPLYSDLLRTFRRKLLRQGT"
FT   sig_peptide     136854..136955
FT                   /locus_tag="Pnap_0124"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.764 at
FT                   residue 34"
FT   gene            137627..138874
FT                   /locus_tag="Pnap_0125"
FT   CDS_pept        137627..138874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0125"
FT                   /product="protein of unknown function DUF224, cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin, iron-sulfur binding domain
FT                   protein; protein of unknown function DUF224, cysteine-rich
FT                   region domain protein; KEGG: pol:Bpro_0188 protein of
FT                   unknown function DUF224, cysteine-rich region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35450"
FT                   /db_xref="GOA:A1VIH2"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH2"
FT                   /protein_id="ABM35450.1"
FT                   /translation="MQTQLAPEFQNTPDGRQAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGETPTRKTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKLVDE
FT                   RVPRPVGERAVRWALKEGLPSPLFAPAMKIGQAVRGLLPESLKAKVPPKQPAGQWPTRS
FT                   HARKMLMLEGCVQPAMMPNINSATARVLDAAGIEVVTAAKAGCCGAVKFHLNDQDGGKL
FT                   EMRRNIDAWWPYVEQGVEALVMNASGCGVTVKEYGYILKDDAAYAEKAARISALTRDLS
FT                   ELLPVIAESLQASRPDLAGKIAAGAPRLAFHPPCTLQHGQQLRGGVEQHLGALGFDIKV
FT                   SGNEAHLCCGSAGTYSVLNPEIAYQLRDRKLANLDAMAPEVIVSANIGCITHLQSGTTT
FT                   PVRHWVEVLNEALLNQ"
FT   gene            139116..139478
FT                   /locus_tag="Pnap_0126"
FT   CDS_pept        139116..139478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35451"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH3"
FT                   /protein_id="ABM35451.1"
FT                   /translation="MTSSNQGSGNQGGNQAGNQGNQGSSSGGTRGGTPQQHAEAGRQSH
FT                   KNDDQQSGKQSGNASQGGGSSQQNAEAGRQGQKGDDRGGQQGSSGGSASSSGGTRGGTP
FT                   GQHAEAGRQSHKNDNK"
FT   gene            complement(139586..140629)
FT                   /locus_tag="Pnap_0127"
FT   CDS_pept        complement(139586..140629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0127"
FT                   /product="poly (3-hydroxybutyrate) depolymerase"
FT                   /note="KEGG: cvi:CV0172 poly (3-hydroxybutyrate)
FT                   depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35452"
FT                   /db_xref="GOA:A1VIH4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH4"
FT                   /protein_id="ABM35452.1"
FT                   /translation="MSLPRSIASLVLLSLTAAQALAQPAAPVSLPAYGANPQQTSVSGL
FT                   SSGAFMAVQMQVAYSGSIIGAGVVAGGPYYCAANNMMYATTICMGNGMPIYPPLLVSAA
FT                   QSFADAGLIDPLKNLNQRRVYVFSGTDDTVVRQPVVDATVEFFKEVGVQTAQLQYVNKM
FT                   PAGHAVITPSYGNDCAANADPYISHCSVETKGYDQAGALLQHIYGALQPRVDTPSGTIV
FT                   SFNQRTYASAATGMAGTGFVYVPKSCSTTGANCKVHVAIHGCKQSVESVGNQFITDTGY
FT                   NNWADNNKLMVLYPQVNKSWSPLNPDGCWDWWGYTGTNYAYKSGSQMKAIKAMVNQLAQ
FT                   QPKKSRT"
FT   sig_peptide     complement(140561..140629)
FT                   /locus_tag="Pnap_0127"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(140744..141229)
FT                   /locus_tag="Pnap_0128"
FT   CDS_pept        complement(140744..141229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0128"
FT                   /product="Glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="PFAM: glutathione peroxidase; KEGG: pol:Bpro_0190
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35453"
FT                   /db_xref="GOA:A1VIH5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH5"
FT                   /protein_id="ABM35453.1"
FT                   /translation="MSTVYDFKARQINGQDIALSEFRGKVMLIVNTASECGFTPQFGGL
FT                   EELHKTYAGQGLVVLGFPCNQFGAQDPGNDSEIATFCQVNYGVSFPMMSKIDVNGAAAH
FT                   PLYQWLTAEAPGLLGSKAIKWNFTKFLVGKDGRVLKRYAPLDKPASLARDIEAALAA"
FT   gene            complement(141352..142260)
FT                   /locus_tag="Pnap_0129"
FT   CDS_pept        complement(141352..142260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0129"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_0191 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35454"
FT                   /db_xref="GOA:A1VIH6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH6"
FT                   /protein_id="ABM35454.1"
FT                   /translation="MAGLHPARAAHGRTAALAVGALVLNALVWGVSWWPFRQLQDHGLH
FT                   PLWATALMYLLIVAGLLAVQFKAWRGFAAHPQLWLLGLAAGLTNIGFNWAVTVGDVVRV
FT                   VLLFYLMPAWSVLVAWLLLGEKPTAASLFRLLLAMSGVLIVLKAPGSAWPLPQGAADWL
FT                   AIAGGFSFAVTNCLLRKFADAPGNTCMLAMFGGSGLMATLAALLGMSLQVVPGPALQAA
FT                   GIPVLLGLSLAFMASNAALQYGAARLAAGATAIVMLTEILFASGSAAALGAAQFTPRIL
FT                   LGGSLIVLAAVLAATAPSAKE"
FT   gene            complement(142260..143540)
FT                   /locus_tag="Pnap_0130"
FT   CDS_pept        complement(142260..143540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0130"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0192 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35455"
FT                   /db_xref="GOA:A1VIH7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH7"
FT                   /protein_id="ABM35455.1"
FT                   /translation="MKRGFYTIMAAQFFSSLADNALFVAAVELLKTNGAPKWQPAALVP
FT                   MFALFYVILAPFVGAYADARPKGNVMFVSNAIKVIGCLMMLFGSHPLLAYAIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTISSIILGVLLGGQLVGHAVSGQLLAIDLPI
FT                   IDTGIDTPPEAAISLLILLYIIAAWFNLRIPDTGVEMRPMPRNKFELLPDFWNCNAALW
FT                   RDKLGQISLATTTLFWGVSGNLRYIVLAWSAAALGYSTTQASSLVGVVAIGTAAGAILA
FT                   SMRMRLDQATKVMPLGIAMGVLVIGMNFITNVWVAAPFLILLGGLGGFLVVPMNALLQH
FT                   RGHNLMGAGRSIAVQNFNEQACILSLGAGYSLSTGMGLSAFGAITGFGIVVAGNMWLIQ
FT                   RWHKSNTVKHKLQLDHLISIARSDKSH"
FT   sig_peptide     complement(143484..143540)
FT                   /locus_tag="Pnap_0130"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.799) with cleavage site probability 0.750 at
FT                   residue 19"
FT   gene            143732..144829
FT                   /locus_tag="Pnap_0131"
FT   CDS_pept        143732..144829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0131"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35456"
FT                   /db_xref="GOA:A1VIH8"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIH8"
FT                   /protein_id="ABM35456.1"
FT                   /translation="MPRPILATIHLAALSHNLARVRTAAPDAKVWAVVKANAYGHGIER
FT                   VFDALRSADGFALLDLDEARRLRALDWRGPILLLEGCFEARDLELCSRLGLWHTIHCQE
FT                   QIDMLAAHKTQLPHRVFLKMNTGMNRLGFTPERFRAAWIRLNALPQVDEISLMQHFPDA
FT                   DGPKGITAQLQAFDAVTHDLPGERTLSNSAAILRHTGALAGRSDWVRPGIVLYGSAPDF
FT                   PEHSASDWELQPTMTLSSRIIGLQTLAAGDTVGYGSSFVAEGPMRIGVVACGYADGYPR
FT                   HCPTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPRAGMGSEVTLWGRASKGGAMLPIDE
FT                   VARAAGTVGYELMCAVAPRVPVAVD"
FT   gene            144826..145665
FT                   /locus_tag="Pnap_0132"
FT   CDS_pept        144826..145665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0132"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Dmel_CG32611; CG32611 gene product from
FT                   transcript CG32611-RB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35457"
FT                   /db_xref="GOA:A1VIH9"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIH9"
FT                   /protein_id="ABM35457.1"
FT                   /translation="MKNLSNWRSVRLLESRLEHDLRQRHVFWLHGLFIGLVTLGLTWGA
FT                   SHAQMLLGVESLALRYLVSLGLGYLGYLLMLRLWAGALVRQHRQRDGWGNLDGGWPGGE
FT                   GGGGSGSASARLPSLRSGEGGDFGGGGASGDFSGAVDAPGILESADAAGGAGKMVSGAL
FT                   EAAGSADEAAVVVVPVVAIFLIGCAVFFGAGSLVLMYFGWEALLAVAVELAFSYVSARV
FT                   AVRVVREGWLSAALRLTWKPLLGAVLCAVLLGATVDHFVPAAHSLPQALRLVSGPAR"
FT   sig_peptide     144826..144972
FT                   /locus_tag="Pnap_0132"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.611 at
FT                   residue 49"
FT   gene            145719..146114
FT                   /locus_tag="Pnap_0133"
FT   CDS_pept        145719..146114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0133"
FT                   /product="DNA polymerase, beta domain protein region"
FT                   /note="PFAM: DNA polymerase, beta domain protein region;
FT                   KEGG: neu:NE2224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35458"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII0"
FT                   /protein_id="ABM35458.1"
FT                   /translation="MNRKALLDMLCSRVPDLLAIYAFGSRMQGTAGPQSDLDLAVLVAG
FT                   YADPLALWELSGDLADLAGCPVDLLDLRAASTVMQHQIITTGQRWWVWDAQAALYEAAI
FT                   LSEKTALDTARAGLLDDIQKRGRVYGR"
FT   gene            146104..146532
FT                   /locus_tag="Pnap_0134"
FT   CDS_pept        146104..146532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0134"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   neu:NE2225 protein of unknown function DUF86"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35459"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="InterPro:IPR037038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII1"
FT                   /protein_id="ABM35459.1"
FT                   /translation="MADDVLINKAATIERCVRRAREEYDRDPATFATDFTRQDAAILNI
FT                   QRACEAALDMGQHLIRREKLGVPQSARDVFALLAQGGWINAALADGLKRMVGFRNIAVH
FT                   DYQALQLPITVAIIQKHLDEFLHYSQGVLLRDAGQAAT"
FT   gene            complement(146529..147503)
FT                   /locus_tag="Pnap_0135"
FT   CDS_pept        complement(146529..147503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0135"
FT                   /product="ketopantoate reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: pol:Bpro_0197 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: NADP
FT                   oxidoreductase, coenzyme F420-dependent; NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein;
FT                   Ketopantoate reductase ApbA/PanE, N-terminal domain
FT                   protein; Ketopantoate reductase ApbA/PanE, C-terminal
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35460"
FT                   /db_xref="GOA:A1VII2"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII2"
FT                   /protein_id="ABM35460.1"
FT                   /translation="MKACIYGAGAIGGWIGSGLARAGCSVSVLARGATLDALQLHGLRL
FT                   HDGKQITSQAVASSDTPAELGVQDLVVLAVKAPSLPEVARQIRPLLGPDTLVMTAMNGV
FT                   PWWFLQGFGGALAGRRLTSVDPDGMLAETLPLHHIIGCVVHASCSVDEPGQVQHHFGKQ
FT                   LIVGEPSGEQTTRAQQLAALLEKAGFEAVVSAQIQKDIWFKLWGNMTVNPISALTGATI
FT                   DRIMDDELVRGFISRVMLEAKEIGARLGISIDQQPEDRHQITRKLGAVKTSMLQDVEAG
FT                   KALELDALVAAVRELGQLTGVQTPYTDALLGLARLKARVKGLY"
FT   gene            complement(147617..148684)
FT                   /locus_tag="Pnap_0136"
FT   CDS_pept        complement(147617..148684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0136"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0198 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35461"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII3"
FT                   /protein_id="ABM35461.1"
FT                   /translation="MINAALASPPAVWHFPVCPPTLPEEITMSLSRRHLIQSTGAAALL
FT                   AGIGRQAWAQAIDSARVVAGFAPGGTADIVSRRVADKLHPTYARSAVVENKTGAGGQIA
FT                   VQFVKTAAPDGSVMLLTPMSMLGIYPHTYKKLPYDPVADLTPVSAAAIFDYGFAVGPMV
FT                   PASVKNVPDFLAWCKATPMQANFGSPAAGSSPHFIGALLGRAGNVDLRHVAFRGTQPAV
FT                   LDMVGGQIAAVSGPTGEFTQHVAAGKCRLLSTSGPRRGKFTPGTPTLVEQGFKDLAFTE
FT                   WFGFFLPARAPQEVVQRLNAAIRSALASQEVADGLAVSYLEVLPTSPAQLAAMLKADTE
FT                   RWGPLVKAVGFTPEG"
FT   gene            complement(148739..149176)
FT                   /locus_tag="Pnap_0137"
FT   CDS_pept        complement(148739..149176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0137"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: pol:Bpro_0199 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35462"
FT                   /db_xref="GOA:A1VII4"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII4"
FT                   /protein_id="ABM35462.1"
FT                   /translation="MHLPTPGFLTGIFMPHLNIEYTANLEASADMGALCTTLAATLVAL
FT                   RHDDGSALFPVAGTRVMAWPAPHFAVADGQPGRAFIYLNLRITPGRNAAMIQRAGDAVL
FT                   ASAKAHLAQVFSEHAVGLTLQIDEGAPVYEGKHNNLASHLA"
FT   gene            149206..150633
FT                   /locus_tag="Pnap_0138"
FT   CDS_pept        149206..150633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0138"
FT                   /product="DNA replication and repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0200 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35463"
FT                   /db_xref="GOA:A1VII5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII5"
FT                   /protein_id="ABM35463.1"
FT                   /translation="MQPGCPMMRSGQYTSRMAKEKTIYTCTECGGTSPRWLGKCPHCTA
FT                   WNTLIESSAENPAAGKNRYSPQFQSLAKACEVTALADIEATDMTRTPTGHEELDRVLGG
FT                   GIVEGGVVLIGGDPGIGKSTLLLQALDSLQRAGLNTLYVTGEESGAQVALRSRRLGLDG
FT                   SQVKVMAEIQLDKILATLEVTQPAVAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRA
FT                   AKSSGVCIVLVGHVTKDGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNE
FT                   IGVFAMTEKGLKGVSNPSAMFLSQHSEPVPGSCVMVTLEGTRPLLVEIQALVDDGGPNP
FT                   RRLSVGLDRDRLAMLLAVLHRHAGVACMDQDVFVNAVGGVRISEPAADLAVMLAIASSL
FT                   RGKALPKGFLAFGEVGLAGEVRPAPRGQERLKEAAKLGFSVAVVPKANAPKKPIEGLTI
FT                   HAVERIEQALDLVRSLQ"
FT   gene            150668..151450
FT                   /locus_tag="Pnap_0139"
FT   CDS_pept        150668..151450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0139"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pol:Bpro_0201
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35464"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII6"
FT                   /protein_id="ABM35464.1"
FT                   /translation="MKFAIISDIHGNLPALQAVLADIARQGVDQTLNLGDILSGPLQPL
FT                   ETADLLMAHDFPTIRGNHERQLLALLDPPAGVIDPATSDGYAASQISAAQAAWLKALPV
FT                   SLELDSDIWLYHGTPRSDLEYWLETAVPGFAQGNGPGVRAATPAEVAERMGSATHPVML
FT                   CGHTHVPRLVQCGGVLVVNPGSVGLPAFDDDHPYPHVVENGAPHARYALLEKTRHGWQV
FT                   TFCAVPYDHLAQAQVAASRRFPDWAHALATGFMPRLAA"
FT   gene            151598..152002
FT                   /locus_tag="Pnap_0140"
FT   CDS_pept        151598..152002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0140"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35465"
FT                   /db_xref="GOA:A1VII7"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII7"
FT                   /protein_id="ABM35465.1"
FT                   /translation="MNFQKILIPVAGVAAVALAYRQYGWAGVAAVATGLVMWMLLHFTR
FT                   MMTVLKRAANRPIGYVGSAVMLNAKLKPGMTLMHVIAMTRALGQLQSEKDAQPEVFRWT
FT                   DGTDSHVTCTFVGGKLAHHELFRPEEPAPQ"
FT   sig_peptide     151598..151678
FT                   /locus_tag="Pnap_0140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.589 at
FT                   residue 27"
FT   gene            complement(152045..152521)
FT                   /locus_tag="Pnap_0141"
FT   CDS_pept        complement(152045..152521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0141"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1"
FT                   /note="KEGG: sme:SMb21046 putative transposase of insertion
FT                   sequence ISRm10-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35466"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII8"
FT                   /protein_id="ABM35466.1"
FT                   /translation="MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDG
FT                   PLNGPAFRAWVEQFLVPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDF
FT                   NPIEQVFAKLKAMLRKTQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG"
FT   gene            complement(152541..152999)
FT                   /locus_tag="Pnap_0142"
FT   CDS_pept        complement(152541..152999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00143 probable insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35467"
FT                   /db_xref="GOA:A1VII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII9"
FT                   /protein_id="ABM35467.1"
FT                   /translation="MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARR
FT                   ERLGQTGPGAQHNHMPLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMF
FT                   KTLRRFGLTLKKNHPARGRANAARRRPGPPGLERQTTKPAGRSADLPR"
FT   gene            complement(153075..153602)
FT                   /locus_tag="Pnap_0143"
FT   CDS_pept        complement(153075..153602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0143"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   bxe:Bxe_B0341 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35468"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ0"
FT                   /protein_id="ABM35468.1"
FT                   /translation="MRHPSSRPPARKIPVLPSALFLLLATAGPAQAGSCTVGSSGLAFG
FT                   AYQPLTFAGKLTSSAVTSNASISVVCTGIASGGAYSIALGPSTTGSGDRISTRYLGNSN
FT                   GGDDMSFNIYTSASYSTVWGNGTTGGLVGGSIPVGDSNQSQPVYGRIAASQNTLRAGSY
FT                   SGSLTMTLTYNP"
FT   sig_peptide     complement(153504..153602)
FT                   /locus_tag="Pnap_0143"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 33"
FT   gene            complement(153605..155980)
FT                   /locus_tag="Pnap_0144"
FT   CDS_pept        complement(153605..155980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0144"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: pol:Bpro_0610 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35469"
FT                   /db_xref="GOA:A1VIJ1"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ1"
FT                   /protein_id="ABM35469.1"
FT                   /translation="MDTPLSAESAPAPRLPPVTRRVAPGQGKKNAQKPQAPQPEVLLLD
FT                   VRINSQPLADVVRVEQWPDGALLLPAEAWAEARLSPLAQARALSDGTPAYALNTVPGTT
FT                   YRINRQSLSLEINAPASAFVGSTLALQGAQTEPPPRPQPGVLLNYDLSVAHGGSGGPLT
FT                   SGALLEAVVFSRFGNLVSSALVLDDGLRRHATRLDTFWRYDLPQRMETLVVGDAVGVGG
FT                   GWSRPARYGGIRWGRDFGMRPGFVTLPQLTLNGEAALPSTVEVLVNNARRLSQPMPSGP
FT                   FELSNVPIVTGAGEINLVVRDLLGRETVIRQSYYASPRLLAPGLSDFSFEAGWLRTGYG
FT                   ESSAYGDSFGAATWRQGLSRSLTGEGRVELQAKRRAAGVELAGLLGDWAAGRVALAASN
FT                   SSTQGMAEHGHLLQLGVERSTPRGGGALQYEHASRGFAPFGEAIGPMAVAQRARARWLA
FT                   SLGGAVWGPVSGGLSYVSQTRWDGDRVKTAGLSFNLPLWQRASLSLSLNKRLDGDGAWR
FT                   AGLSLSLPLDNGISTSARVETASSSRATGAVSASRNPPAGPGLGWRVEGSTQESQRARG
FT                   GVQYNTSQAEFAADVVSDATGQLAVRAGARGTLGLLASMPFASRAVGQGSFAVVDAGGL
FT                   AGVPVMRSHQVVAVTDSRGLAFVPGLLPWQQNQIEIDPVDLPLDVEVGNMVQQVTPYPG
FT                   SGSVVMFAVRRTRQALVVLHQPDGAPVPVGSKVRLLPDGPEFMAGRRGEVWLTDLAAER
FT                   QRLQVRWPGDGCELELMVPAAADGATPGKIGPLACTKE"
FT   gene            complement(156232..157020)
FT                   /locus_tag="Pnap_0145"
FT   CDS_pept        complement(156232..157020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0145"
FT                   /product="P pilus assembly protein chaperone PapD-like
FT                   protein"
FT                   /note="KEGG: bur:Bcep18194_A4396 P pilus assembly protein
FT                   chaperone PapD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35470"
FT                   /db_xref="GOA:A1VIJ2"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ2"
FT                   /protein_id="ABM35470.1"
FT                   /translation="MMLNALVHRSLCAGVLLAGMLGLPASSYAAGLSISPVVVEIDSPR
FT                   RAVAVTVTNQGDQAVTFQTEAMVWQQVNGVDQFEPTDELLVVPPIVEVPPNASQIFRVT
FT                   LHVPRPSPVERTYRLILEDVSEDQAPTGQASVAFKFAHNLPVMVAPSGNVSNAVRWKPC
FT                   PPEASATAASALAKPTTARSPEACVRLLNAGNRRVKVQTLTLTGDNWQQALPLKNGVNV
FT                   LAGAEREWRVPLQAGQTGALRGMQVNTARGETLQAEAGGF"
FT   sig_peptide     complement(156931..157020)
FT                   /locus_tag="Pnap_0145"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 30"
FT   gene            complement(157017..157703)
FT                   /locus_tag="Pnap_0146"
FT   CDS_pept        complement(157017..157703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0146"
FT                   /product="Spore coat U domain protein"
FT                   /note="PFAM: Spore coat U domain protein; KEGG:
FT                   ade:Adeh_3602 spore coat U"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35471"
FT                   /db_xref="GOA:A1VIJ3"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ3"
FT                   /protein_id="ABM35471.1"
FT                   /translation="MFSSRQCPDAQTLAGNQASSQCPFRVLWLMAVLGGAILPRVFFDK
FT                   RFGMNTTMNKLALAIGALVMAGGAMAADDNANLAVSATVLTNCAIGPGTLAFPANLQLG
FT                   VTKGLGTKAANPANADSDSGTSISVTCTNGSSAAITAGAGANTAGVVATTRALKSGSNY
FT                   IDYELYTDTNRTTVLDGTNSISYTGTGLTEIDKTTIFGRILGADIATAKAGAYADTVAM
FT                   TITYTP"
FT   gene            158095..159036
FT                   /locus_tag="Pnap_0147"
FT   CDS_pept        158095..159036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0147"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase, class IV; KEGG: pol:Bpro_0203
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35472"
FT                   /db_xref="GOA:A1VIJ4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ4"
FT                   /protein_id="ABM35472.1"
FT                   /translation="MTPAAPSMENRDGKIWMDGQMVEWRDAKIHVLTHTLHYGCGAFEG
FT                   VRAYKMPDGGTAIFRLEEHTERLFNSAKILRMKIPFTPQEVMDAQLAVVRENKLESGYI
FT                   RPLTWIGSEKLGVSPKGNTIHLMVAAWTWGAYLGEEGMKRGIRVKTSSFTRHHVNITMI
FT                   HAKAVSNYTNSILANMEATDEGYDEALLLDPQGFASEGAGENLFIVRKGVVYTPDSSAG
FT                   ALNGITRNTVFSICKDLGIEIREKPITRDEIYISDEAFFSGTAAEVTPIRELDRIEIGS
FT                   GSRGPITEKIQAAFFDIVNGRNPEYASWLTRV"
FT   gene            159071..159280
FT                   /locus_tag="Pnap_0148"
FT   CDS_pept        159071..159280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0204 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35473"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ5"
FT                   /protein_id="ABM35473.1"
FT                   /translation="MSKSSTIELLASDLNHQGCVTCPSPKADMKVWNSHPKVYLDVART
FT                   GEAKCPYCGEIYKLKAGEHFGSGH"
FT   gene            159398..160423
FT                   /locus_tag="Pnap_0149"
FT   CDS_pept        159398..160423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0149"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase, family 9; KEGG: pol:Bpro_0205
FT                   lipopolysaccharide heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35474"
FT                   /db_xref="GOA:A1VIJ6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ6"
FT                   /protein_id="ABM35474.1"
FT                   /translation="MSSTKPEMSNALVIAPQWIGDAVMTEPLLRRLHARGERLTVGALP
FT                   WVAPVYRAMPQVAEVIEFPFAHGGLQFKARRAIAKRIEGQFGKAYVLPNSLKSALLPFL
FT                   ASIPERIGYLGEARVGLLTHRLKNPKNKPPMVAFYSALSGEGDLASDRPELHISAADIA
FT                   LTLHELGLRQGGYVVFAPGAEFGPAKRWPARHFAELAARLDLPVVLLGSGKEAALCDEI
FT                   AAPVNAAQAGKCLNLAGKTSLPQALALIAASRSIVSNDSGLMHVAAALGVPQVAIFGSS
FT                   SPLHTPPLSDKARVLWLKADPAYQPPLDCAPCFERECPLGHTRCLNDIGAQQVLQALSS
FT                   H"
FT   gene            complement(160648..161892)
FT                   /locus_tag="Pnap_0150"
FT   CDS_pept        complement(160648..161892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0150"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   KEGG: pol:Bpro_0207 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35475"
FT                   /db_xref="GOA:A1VIJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ7"
FT                   /protein_id="ABM35475.1"
FT                   /translation="MSKQIWARFTSHLYVRIWLAVVATVMVLTFLVGAAWRLSADPPQL
FT                   PIREVLVHNAAGEVIGKGQTKPDRQRGDDIEFDVVTTDGQTLNLLLPRPQRPPGSPWNR
FT                   PPFGFGWMLGLVGLAVALGAYPVMRRLTLRLEALQRGVERWGAGDLSARINTEGRDEVA
FT                   FLARRFNHAAERIETLMESHKSLLANASHELRSPLARIRMGLELMGVDKSSPQRMEISR
FT                   SIGELDQLIDEILLASRLDTKQADAEPFETLDLTGLAAEECARVNAELQAELQTGPDAD
FT                   HSLTLQGSPRLLRRLIRNLLENARRYSHGDISLELAQSGTGSGQRAIVKVHDRGPGVPA
FT                   GQRERIFEPFYRLPGASEREGGVGLGLALVKSISERHGGSVRCEERPGGGASFIVELPM
FT                   DRPGPAAARDTGSFN"
FT   sig_peptide     complement(161788..161892)
FT                   /locus_tag="Pnap_0150"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.661 at
FT                   residue 35"
FT   gene            complement(161900..162625)
FT                   /locus_tag="Pnap_0151"
FT   CDS_pept        complement(161900..162625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0151"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: pol:Bpro_0208 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35476"
FT                   /db_xref="GOA:A1VIJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ8"
FT                   /protein_id="ABM35476.1"
FT                   /translation="MTQQLLMIEDDTRLASMVGEYLRQSGYGFAHAATGTAGLEALQAT
FT                   PPDLVILDLMLPDMDGLEVCRRIKGRGGDAARTAVLMLTAKGDPMDRIVGLEIGADDYL
FT                   PKPFEPRELLARIRAVLRRGGNSNGNGGGAPADGHKVMRFGSLEIDRDARAVTVSGNPC
FT                   ELTSYQFDLLVALAERAGRVLSRDQIMEAVRGRELEAFDRSIDVHMGRIRSAIEADAKD
FT                   PKRILTVRGVGYVFAKQQD"
FT   gene            complement(162786..164186)
FT                   /locus_tag="Pnap_0152"
FT   CDS_pept        complement(162786..164186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0152"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0209 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35477"
FT                   /db_xref="GOA:A1VIJ9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIJ9"
FT                   /protein_id="ABM35477.1"
FT                   /translation="MSDKTTSTLASLPLVSERAVAHQAPSPAPAAPAKPGWREVWRVYS
FT                   EAATLRMLLLGFSAGLPLLLVFGTLSFWLREAGIDRTTIGYLSWVGLAYGFKWAWAPLV
FT                   DRLPIPLLTRWLGRRRSWLLLSQAVIMVALVCMALTDPRLALLPMVWCALAVAFGSATQ
FT                   DIALDAYRIESAAIERQAALAAAYQTGYRMAMIWSGAGALWIAARAEIVGVTAYQPGAW
FT                   QTAYLVMAASMLLGVVTVLFSPEPQRRELPPSKNAADWLKGALIEPFADFLRRYGKQAL
FT                   LILALIAMYRISDVVMGIMANPFYVDMGYTKDEVATVTKIYGVIMTLVGAFLGGGLAMR
FT                   FGVMKVLMLGAVLSAGSNLLFAWLGTRGHDVTSLIFVISADNLSSGIASAAFIAYLSSL
FT                   TNINYSATQYALFSSMMLLLPKTLAGYSGAYVDTFGYGNFFTASALLGVPVLLLIGLAS
FT                   RSKTAPAQ"
FT   sig_peptide     complement(164121..164186)
FT                   /locus_tag="Pnap_0152"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.960 at
FT                   residue 22"
FT   gene            164219..165061
FT                   /locus_tag="Pnap_0153"
FT   CDS_pept        164219..165061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0153"
FT                   /product="peptidase M48, Ste24p"
FT                   /note="PFAM: peptidase M48, Ste24p; KEGG: pol:Bpro_0210
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35478"
FT                   /db_xref="GOA:A1VIK0"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK0"
FT                   /protein_id="ABM35478.1"
FT                   /translation="MCFLCDVKHSAWHSRRGFLQAAAGATALAVSTPLLAQVDVGKSSG
FT                   LRNLVPAEELESASTQEYAKLLAEAKAQGALAPPGHPQLQRLHAISKRLIPQAAQWNDR
FT                   AKQWRWEVNLIGSKQINAFCMPGGKIAFYTGILEQLKLTDDEVAMIMGHEMAHALREHA
FT                   RARIAKSQGTGTLLSLGAQLLGLGQLGDLAANVGTELLTLRFSREDESDADLVGLELAA
FT                   RGGYNPQAAVSLWQKMAQAGGGAGGPNFLSTHPSGPQRIQELQANVPRVQGLYERARR"
FT   sig_peptide     164219..164329
FT                   /locus_tag="Pnap_0153"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.950 at
FT                   residue 37"
FT   gene            complement(165117..165452)
FT                   /locus_tag="Pnap_0154"
FT   CDS_pept        complement(165117..165452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35479"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK1"
FT                   /protein_id="ABM35479.1"
FT                   /translation="MKKPTLLLILIFCSGGVLAQVNIDRIPLGSGTPGNDGVENAVEWD
FT                   LNLYHAPQYMPGHPTASTIFPRAISVLCMEKETGLHCKGYNWLPEMGRTEYLMIRPMIV
FT                   KEFPAQN"
FT   sig_peptide     complement(165393..165452)
FT                   /locus_tag="Pnap_0154"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            complement(165477..166067)
FT                   /locus_tag="Pnap_0155"
FT   CDS_pept        complement(165477..166067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0155"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_3538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35480"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK2"
FT                   /protein_id="ABM35480.1"
FT                   /translation="MNKINSILALSASMCMLMNANGQALTSGATSAPVASSSAGNQDFY
FT                   QGITFNSPGETHQYIESGGTQTIKNVPSVAGPNLTTSNDTCMGSSSGSMNGPGFGVSIG
FT                   STWSDANCKLLKNSRELWNMGMKAAAMALMCTDAANRDALEMTGFECPQTSRNKKIAQQ
FT                   ASAVNPPSSGDQEHITDPYIRARMGLAALQAKN"
FT   sig_peptide     complement(165999..166067)
FT                   /locus_tag="Pnap_0155"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.692 at
FT                   residue 23"
FT   gene            complement(166129..166545)
FT                   /locus_tag="Pnap_0156"
FT   CDS_pept        complement(166129..166545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0156"
FT                   /product="putative glycine-rich signal peptide protein"
FT                   /note="KEGG: rso:RSc0443 probable glycin-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35481"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK3"
FT                   /protein_id="ABM35481.1"
FT                   /translation="MTSGTVSSLSATAGNAVAAGGATANASANSTASANYASGPIGGGA
FT                   AGIAASQTNNSVATAAGPGGGVAVITRTAGTASGYLAGAASLSTPAGTLVGSTANSGSL
FT                   SNTTTPVNASIGNAGTFSNSPATSGGAAAWSNAH"
FT   sig_peptide     complement(166489..166545)
FT                   /locus_tag="Pnap_0156"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.611 at
FT                   residue 19"
FT   gene            166550..166822
FT                   /locus_tag="Pnap_0157"
FT   CDS_pept        166550..166822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35482"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK4"
FT                   /protein_id="ABM35482.1"
FT                   /translation="MPITPAAPTETGPIVVAPPAAAPVAVALDTAVWLLNAAPLPELAA
FT                   ADIVAVDPPVAVETAAFELVAVATPAASRTANARILFFMIFRLTY"
FT   gene            166913..167155
FT                   /locus_tag="Pnap_0158"
FT   CDS_pept        166913..167155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35483"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK5"
FT                   /protein_id="ABM35483.1"
FT                   /translation="MFQSAGKTPVFDCDAIRFPVVQKLINIFLFMNKQEFLLCAVFFFS
FT                   LHGSNFLVHITVADAAVCAGLLRSIIIYCADSTTP"
FT   gene            167736..168044
FT                   /locus_tag="Pnap_0159"
FT   CDS_pept        167736..168044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35484"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK6"
FT                   /protein_id="ABM35484.1"
FT                   /translation="MSAPWFSKPLGDGVWAYSLSNQARDAFEPLFVLAGRPLEMAVFTR
FT                   HQSAGRLHCEVTAYFSPAAATVAHVLDARPCGAPSRGNLDLLAGDPACWPVIFPDGE"
FT   gene            complement(168106..169476)
FT                   /locus_tag="Pnap_0160"
FT   CDS_pept        complement(168106..169476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0160"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: rru:Rru_A0462
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35485"
FT                   /db_xref="GOA:A1VIK7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK7"
FT                   /protein_id="ABM35485.1"
FT                   /translation="MAYQSTNPYDGKVLQTFEQISDAQLEEKLTQAASCFESDWRHKSF
FT                   AERAAVLARAATLLRERAQSFAELVTLEMGKLIAQSLGEVALSAAILDYYAENAERFLA
FT                   PEKLSTPRGEALVESSPIGVLFGVEPWNYPYYQIARFAAPNLMAGNVVMVKHASSVPQC
FT                   AQAFERLMIDAGAPAGAYTNLFISKEQVARVIDDTRIRAVALTGSEAAGAVVAARAGQN
FT                   LKKTTMELGGSDAFIVLDDADLDKAVKSAVSGRMGNSGQACTASKRIIVVDSLADRFLE
FT                   KFQAALENFQPGDPMDKQTTLAPLSSVDALKNLLGQVEGAVAGGARVLTGGGRIEGQAG
FT                   AFMQPTILTDIDKSNPAYMQEFFGPVALFFRVADEDAAVALANDSPFGLGGSVFTQDIE
FT                   RGKRLARRIDTGMVFINSGASSSPELPFGGVKNSGYGRELSGAGIQEFVNKKLIRVS"
FT   gene            complement(169633..170742)
FT                   /locus_tag="Pnap_0161"
FT   CDS_pept        complement(169633..170742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0161"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   rso:RSc1202 probable flavoprotein NADH-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35486"
FT                   /db_xref="GOA:A1VIK8"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK8"
FT                   /protein_id="ABM35486.1"
FT                   /translation="MLNQLLSPLKIGQTTLANRVVMAPLTRSRAGQPGDVPNALNTEYY
FT                   TQRASAGLIVTEATQISRQGQGYALTPGIYTDAQEAGWKQVVQAVHAQDGHIALQLWHV
FT                   GRISHSLLQENGAAPVAPSALVAKGAQCFVIQPDGTPANVPTETPRALATEELPGIVEQ
FT                   YRQAAVRGKQAGFDFLELHAANGYLLHQFLSTNSNQRLDGYGGSLENRARLTLEALDAL
FT                   IGEVGAAQVGVRLSPHFAGHDMADAEAEASALYLARAFSERGIAYLHIAEPDWAGGPEL
FT                   SDAFRAQLRMAFNGALIFCGNYTAADAQALIAQGIADAVAFGRPFIANADLVERFRQGA
FT                   ELNTPDRTTFYGGGAHGYTDYPTLALQPA"
FT   gene            complement(170874..171479)
FT                   /locus_tag="Pnap_0162"
FT   CDS_pept        complement(170874..171479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0162"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: bcn:Bcen_3964
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35487"
FT                   /db_xref="GOA:A1VIK9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIK9"
FT                   /protein_id="ABM35487.1"
FT                   /translation="MSNEHTDVKQHILDTGRSIILGKGFSAVGLNEILSTAQVPKGSFY
FT                   HYFKSKEAFGEALVDGYVADYLAQVDRLLQDDGAPAAERLMRYWRSWMTPADSQSAECN
FT                   CLVVKLSGEVSDMSEAMRAALLRGTNLIIERLGNCIAQGLADGSLTGTLEAQHTALTLY
FT                   ELWLGAALLTKVRRERSALDAAMAATCSLLKLPQPVSA"
FT   gene            171564..172418
FT                   /locus_tag="Pnap_0163"
FT   CDS_pept        171564..172418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0163"
FT                   /product="protein of unknown function RIO1"
FT                   /note="PFAM: protein of unknown function RIO1; KEGG:
FT                   pol:Bpro_3868 protein of unknown function RIO1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35488"
FT                   /db_xref="GOA:A1VIL0"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL0"
FT                   /protein_id="ABM35488.1"
FT                   /translation="MAGMKAPPRLQSLVEEGLIDTVVRQLMSGKEAMVYVVRCGDETRC
FT                   AKIYKEADQRSFRQAVDYTENRKVKNTRQARAMAKGTKFGRQASEAAWQSAEVDALYRL
FT                   ADAGVRVPQPHNFCDGVLLMELVTDAHGDAAPRLNDVDFTPEQARRHHATLITEVIRML
FT                   CAGIVHGDLSEFNILLAEDGPVIIDLPQAVDAAGNNHASRMLLRDVANLRNFFGRFAPD
FT                   LLTIDYGNEMWDLYQRGVLYPETVLTGHFRRKTGPVDVGGVLREIDDASAEEAARRMRM
FT                   AQS"
FT   gene            complement(172430..174193)
FT                   /locus_tag="Pnap_0164"
FT   CDS_pept        complement(172430..174193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0164"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter, transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: bbr:BB2407
FT                   putative ABC-transporter membrane-spanning ATP-binding
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35489"
FT                   /db_xref="GOA:A1VIL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL1"
FT                   /protein_id="ABM35489.1"
FT                   /translation="MRILWTYLRPHRALAALALLLAAISQVLALVDPIIFGRIIDDYAI
FT                   GRAGKSEAELVSGVLSLLGLAVGVAVLSRLAKTLQDYATRLVVQKFGTQIFNDGLRQVL
FT                   RLKFQEFEDLRSGETLSLLQKVRADSERFINAFINTLFAAIVGIAFLSWYSVTRHWLLV
FT                   PVFLVGVLLMGGLTGLLSREIKTQQRSIVRETNRNSGFITESLRNIELIKSLGLTFPEI
FT                   RRLQAQTMKIFALEMKKVRRIRLLSFLQGSTLSLLKLAILFALLWLIFRDVLSTGELIA
FT                   MQFISVAIFAPLQELGNVIVAYREVETSLLNFDALMNKPVERRPESPVKIGPVTEVRFT
FT                   DVSFRHKGASDNALESLSFSAGLGDTIAFVGPSGSGKSTLVKLLVGLYTPASGQVFYNG
FT                   IATRDLRYNEVRRQIGFVTQETHLFAGTLRENLLFVKPDASDREIIAAMEQAACAYLLE
FT                   QSPDGLDTAIGEMGMKLSGGEKQRLSIARALIRQPRLLIFDEATSALDSITEEQITRTV
FT                   RHLSISSTRITLLIAHRLSTIMHASTIFVLEKGCIVESGTHAALLEAKGLYYAMWRQQI
FT                   GERPAKRVALE"
FT   sig_peptide     complement(174104..174193)
FT                   /locus_tag="Pnap_0164"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 30"
FT   gene            complement(174784..176160)
FT                   /locus_tag="Pnap_0165"
FT   CDS_pept        complement(174784..176160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0165"
FT                   /product="putative transposase"
FT                   /note="KEGG: bja:blr1916 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35490"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL2"
FT                   /protein_id="ABM35490.1"
FT                   /translation="MAVGGISMDTVIPVRTNWPEDFQEWLQPFLAVFTRSEQRCWAPLY
FT                   LQGLLGPGARKSVAPMAERVCPGQTQQLHHFVSSSTWSTAPLEQVLRKKADALVGGKDA
FT                   VLIVDDTALPKQGKHSVGVKRQHCGVLGKQANCQVLVSLTLARKEVPVPIALRLYLPED
FT                   WAQDEARRAAAKVPESITFETKGDIALAQIDAALADGVRFGMVLADAGYGSSAGFRAGL
FT                   TQRGLRWAVGVQPTQKVYPADVRLDVPADPPVGRPAKHPRPSTPSVSVVQMIETLGSKA
FT                   LRRCSWRSGTKGMLSARFAAVWVCVADGALVSHWQHLPGQAAWLVCEVRSSGERKYYFT
FT                   NHPADTPRRTLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLTMMAFGYL
FT                   QHRRLDSVLQAGKKTGIQCTGTATATIIASGTPGHSRRALSGNLRSVSSLRRHDKPASA
FT                   "
FT   gene            176615..178423
FT                   /locus_tag="Pnap_0166"
FT   CDS_pept        176615..178423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0166"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: gsu:GSU0255 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region,
FT                   ATPase domain protein domain protein; histidine kinase A
FT                   domain protein domain protein; PAS fold-3 domain protein;
FT                   PAS fold domain protein; SMART: PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35491"
FT                   /db_xref="GOA:A1VIL3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL3"
FT                   /protein_id="ABM35491.1"
FT                   /translation="MLFQQLYWIAMPQNLKAILKTDGSRFALGTGVLYAVLGLLWIIAS
FT                   DAAISSISTDPAWLVTAQRYKGFFYVGVTSVGLIFLVNAGYRRLWNALSRAEATELQIG
FT                   DLFLQHPKPMWVYDRDTLEFIAVNDAATRYYGYSREAMLAMNLADICPEEDISRLHALM
FT                   HSPQDRHRDIGVVRHCKRSGEVVFVHLTAHAVEFMQRKAEMVMAIDVTADILSKHALER
FT                   QEAQFRQLHQSLASILWIASADGRTMLYVSPALERVYGFAPEAMQANPDLWLQVVHPDD
FT                   AHIAKASSVELMTEGEASCEYRIRATSGEIKWVSDRKRLIVDAEGLVTMMGGILEDITA
FT                   AKEHEALRARTHVELERLVTERTAELVRVNAELDAFARTIAHDLKAPLVSVIGFSQLLQ
FT                   NRHADTLKEDGVRLIARIGRSARQMASLVNDLLALSRVSKTVLVIEDIDLVPLAHEIIE
FT                   ELREQEPHRQVRFESPASLQVRADPGLVRPLLTNLLGNAWKFTGKRDDACVQLLLAGAA
FT                   PEATFCVRDNGVGFDASSSELLFKPFQRFHTLSEFSGTGIGLTTCERIVARHHGRIWLE
FT                   STVGEGTSVFVTLAPPAPDLPHLAPA"
FT   gene            complement(178441..179400)
FT                   /locus_tag="Pnap_0167"
FT   CDS_pept        complement(178441..179400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0167"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pol:Bpro_0216 exodeoxyribonuclease III (xth);
FT                   TIGRFAM: exodeoxyribonuclease III; exodeoxyribonuclease III
FT                   Xth; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35492"
FT                   /db_xref="GOA:A1VIL4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL4"
FT                   /protein_id="ABM35492.1"
FT                   /translation="MFKLTSLNLNGIRSAASKGLQEWVAQSMPDCICVQELKAQAADLS
FT                   GRFEAIAGHKGYFQFAEKKGYSGVGIYTRHEPSDVIVGYGSTEFDAEGRYVELRFDRPG
FT                   RRHSPKLSIISCYFPSGSSGEERQAAKFRFLAELYPHLAALKRCGGDNREFVLCGDINI
FT                   AHQEIDLKNFKGNKKNSGFLPEERAWMTELLAPTLPTACGSLPPEGAAAPAARQSRLRG
FT                   PGLQEASAAVDAAPALDSSAQGGGMVDVYRRLHPATTDEAYTWWSNRGQAYAKNVGWRL
FT                   DYHLATPGFGATAHSASIHKAQRFSDHAPLTIEYDWAL"
FT   gene            179453..180166
FT                   /locus_tag="Pnap_0168"
FT   CDS_pept        179453..180166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0168"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: pol:Bpro_0217 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35493"
FT                   /db_xref="GOA:A1VIL5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIL5"
FT                   /protein_id="ABM35493.1"
FT                   /translation="MPAEGSLAQEFVQFAVESGVLRFGQFKTKAGRMSPYFFNAGLFDD
FT                   GAKLGRLAQFYARQLLAEEQRSGLAFDMIFGPAYKGIPLAAAVAIELARLGRNLPFAYN
FT                   RKEAKDHGEGGTLVGAKLQGRVLIVDDVMSAGTAVRESIALIQAAGATPHAVAIALDRQ
FT                   EKATENGLDVEHSAVQYVTRQLGLQVCAIARLSDLLQYLSEKSDSPSGGETLDGQRLKD
FT                   HYQSVLAYRERYGVN"
FT   gene            180176..180847
FT                   /locus_tag="Pnap_0169"
FT   CDS_pept        180176..180847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35494"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL6"
FT                   /protein_id="ABM35494.1"
FT                   /translation="MRLPSPITLGLAGLALLCGGAAVAQDIYSCVDARGRTITADRPIP
FT                   ECSDRTQRELSRNGLLKRQIGPSLTAHEQAAQDEKDRQAAEIRAREAEDKRRDRALLLR
FT                   YPTRAVHDQERTAALLQIDEVIKASIKRRGELADQRKAIASELEFYAKDLSRAPASLKR
FT                   RLEENEGSVAVQQKFIADQEQEKKRVNLRFDEELAKLKQLWPMVSPPIRPGASASKVGK
FT                   N"
FT   sig_peptide     180176..180250
FT                   /locus_tag="Pnap_0169"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            complement(180938..182395)
FT                   /locus_tag="Pnap_0170"
FT   CDS_pept        complement(180938..182395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0170"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB/Yqey domain protein; GatB N-terminal
FT                   region; GatB, central domain protein; KEGG: pol:Bpro_0219
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35495"
FT                   /db_xref="GOA:A1VIL7"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL7"
FT                   /protein_id="ABM35495.1"
FT                   /translation="MSKTTKSLLVQGYEVVIGFETHTQLTTQSKLFSRAPIAFGAEPNT
FT                   QASAVDFALPGALPVMNKGAVQRAIEFGLAVNAHIAEKSIFARKNYFYPDLPKGYQISQ
FT                   FEIPVVQGGVVEFFLDGEKKSVRLVRAHLEEDAGKSLHEDFIGMSGIDLNRAGTPLLEI
FT                   VTEPDMRSTAEAVAYAKELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGEPLGTRREI
FT                   KNLNSFKFMQQAMDYEVRWQIEQIEDGHEIQQATVLFDPDTGETRSMRSKEDAADYRYF
FT                   PDPDLPPLVIGRDWVEKTRSEMSELPRVMAARFVADYGLPEYDAGQLTQSKATAAYFEA
FT                   VATASKSPKLASNWVMGELSRRLNAEEKSIEASAVSALQLAALIGRIADGTIANNAARQ
FT                   VFDALWTGEGLDVDALIEAKGLKSMSDTGELETIIDGVLAANAKNVEEVKAGNAKAFNA
FT                   LVGQAMKATKGKANPAQVNELLKKKLG"
FT   gene            complement(182392..183924)
FT                   /locus_tag="Pnap_0171"
FT   CDS_pept        complement(182392..183924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0171"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="KEGG: pol:Bpro_0220 glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35496"
FT                   /db_xref="GOA:A1VIL8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIL8"
FT                   /protein_id="ABM35496.1"
FT                   /translation="MSSIPLTPSNLDLHDLGVAQLAAKLAAGDISSVEVTQHFLNRIGQ
FT                   HAGLGAFLALDADVSLAQARAADARLAAGERTPLLGVPLAHKDVFVTRDFPTTAGSKML
FT                   ANYRSPFDATVVSRLGVGPGGAGMVTLGKLNCDEFAMGSGNENSAYQKVQNPWDTSRVP
FT                   GGSSGGSAAAVAARLVPAATGTDTGGSIRQPASLTGITGIKPTYGRCSRYGMVAFASSL
FT                   DQAGPMARSALDCALLLSAMAGPDPDRDSTSLDMPAVDYATDLIAARTDGTSAKPLKGL
FT                   RIGLPTQFFGAGCAPDVLAAVRGALSEFEKLGATLVDVSLPLTELSIPVYYVIAPAEAS
FT                   SNLSRFDGVRYGHRAAHYTDLTDMYKKSRSEGFGDEATRRIMIGTYVLSHGYYDAYYLK
FT                   AQKIRRLIAQDFQTAFAQCDVIAGPVSPTVAWKIGEKSDDPVASYLADIYTLSSSLAGL
FT                   PGMSVPAGFGAGGMPVGLQLIGNYFKEAQLLGAAHQFQLATDWHQKAPGISA"
FT   gene            complement(183921..184220)
FT                   /locus_tag="Pnap_0172"
FT   CDS_pept        complement(183921..184220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0172"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /EC_number="6.3.5.-"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: pol:Bpro_0221 glutamyl-tRNA(Gln)
FT                   amidotransferase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35497"
FT                   /db_xref="GOA:A1VIL9"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIL9"
FT                   /protein_id="ABM35497.1"
FT                   /translation="MALTFKDIERVANLARLELRPDETEHTLSQLNGFFALVEQMQAVN
FT                   TDGVEPLAHPAALLGEVALRLREDIASEPNQREASQASAPAVERGLFLVPKVIE"
FT   gene            184476..185564
FT                   /locus_tag="Pnap_0173"
FT   CDS_pept        184476..185564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0173"
FT                   /product="rod shape-determining protein MreB"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: pol:Bpro_0222 cell shape determining protein,
FT                   MreB/Mrl family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35498"
FT                   /db_xref="GOA:A1VIM0"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM0"
FT                   /protein_id="ABM35498.1"
FT                   /translation="MLQRSFAHAPTGFLNMFEAFRRYFSTDLAIDLGTANTLIFARDKG
FT                   IVLDEPSVVAIRHEGGPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITE
FT                   QMIKQFIKMVHPRRLLTPSPRIIICVPCGSTQVERRAIKDAAEAAGAAAVYLIEEPMAA
FT                   ALGAGLPVSEASGSMVVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNY
FT                   GMLIGEPTAEVIKKTIGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEILEALTDPLN
FT                   QIVSAVKNALEQTPPELGADISDRGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTC
FT                   VVRGCGIALERMDRMGSIFTTE"
FT   gene            185644..186564
FT                   /locus_tag="Pnap_0174"
FT   CDS_pept        185644..186564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0174"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: pol:Bpro_0223 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35499"
FT                   /db_xref="GOA:A1VIM1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM1"
FT                   /protein_id="ABM35499.1"
FT                   /translation="MALGTLDRSLPPFFNQGPSVYSKLVFFGALSLFLMVADARFNVTQ
FT                   PIRAVIATALYPVQWLAVQPVHAVQGASEYFTSLSQAQSESAEARKKLALQSLRAGQVE
FT                   ELMQENNRLRKLLELKEQITTPVMAAEVLYDAADSYTRKVIIDKGQAHKVDLGSPVLDE
FT                   SGVLGQVTRVHPLVSEVTLVVDRELAIPVLNVRTGARSVAYGDPTVGGSGMELRFMGSN
FT                   ADVQQGDLLTTSGVDGVYPPGLPVARVSRIEHRAESAFSKIYCVPEALTAGARHVIVVK
FT                   PVTSDVALRPPVAAPVVPAKRGSAK"
FT   gene            186561..187079
FT                   /locus_tag="Pnap_0175"
FT   CDS_pept        186561..187079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0175"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="PFAM: Rod shape-determining protein MreD; KEGG:
FT                   pol:Bpro_0224 putative rod shape-determining MreD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35500"
FT                   /db_xref="GOA:A1VIM2"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM2"
FT                   /protein_id="ABM35500.1"
FT                   /translation="MIMRSGQQLLLPASPVFIWCTLIAALLLDMLPLGRIPWMPEFLAL
FT                   VLVFWSVHQPLKVGIGIAFMFGLAIDVHQTSLLGQHAFSYTMLSFLAAMIQRRLLWFTV
FT                   PLQALQVLPLFAAAHGAEIILRLLGGGVFPGWIVLLAPLAEALLWPVASVLLLVPQLRT
FT                   PDRDENRPL"
FT   gene            187285..189336
FT                   /locus_tag="Pnap_0176"
FT   CDS_pept        187285..189336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0176"
FT                   /product="cell elongation-specific peptidoglycan
FT                   D,D-transpeptidase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase;
FT                   Penicillin-binding protein, dimerisation domain; KEGG:
FT                   pol:Bpro_0225 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35501"
FT                   /db_xref="GOA:A1VIM3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM3"
FT                   /protein_id="ABM35501.1"
FT                   /translation="MTELRNVEADLSRFRTRVLVAGLVVFLCFSLVASRLVYLQVYRHE
FT                   DLRAQAESNRTAIVPIVPNRGLILDRNGIVLASNYSAYTLEITPSKVENLDETIAALEK
FT                   LVDIQPRDKRRFKRLREESKSFESIPLRTRLSDEEVARFAARRFAFPGVDIKARLFRSY
FT                   PYGELGSHVVGYIGRINQLEKDAIEEREEEGNYRGTDYIGKLGVEQSFEQQLHGQTGVE
FT                   QMETSAGGRALRKLATSPATPGNTVMLSLDIGLQKLVEDMFGTRRGALVALDPRNGEVL
FT                   AFVSKPTFDPNLFVDGIDQESWQALNESIDKPLLNRALRGTYPPGSTYKPFMALAALQT
FT                   GTRSPGAIIHDPGFYMFGGHRFGSPENERGGAMDMNRAIVESSNVYFYSLANELGVDAI
FT                   HDFMAPLGFGQLTGIDINGEVRGVLPSQAWKRGYFKRVEQQKWFAGETISLGIGQGYNS
FT                   FTMLQLAQATATLANNGLRHKPRLVMGTQDTVTRALHPLPADPPVDLGYKPENVAIVRK
FT                   ALVGVTQGGTSTKVFAGAQYLSGGKTGTAQAVTIGQKDKYNKSRMEEHQRDHAVYMAFA
FT                   PADNPKIALAVIVENAGWGAGVAAPIARRVFDYVLMGQYPSEEDMLAVQAGRAAAPIGK
FT                   PRLAAEMNALLVDDTPGGSPSAAPQKAEPPAVAARTRPFSRQNRPRPP"
FT   gene            complement(189398..190156)
FT                   /locus_tag="Pnap_0177"
FT   CDS_pept        complement(189398..190156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0177"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pol:Bpro_0226 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35502"
FT                   /db_xref="GOA:A1VIM4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM4"
FT                   /protein_id="ABM35502.1"
FT                   /translation="MELLLVSIASLLAGFVDSIVGGGGLILVPALFAVFPTTHPATLFG
FT                   INKGASVWGTAVATTQYARRVQLRWSALLPAAAAGFFGSLAGAWLVTVIDPGFLRKALP
FT                   FVLVAVLAYTLVKKDMGRHHTPRFTGRTETGIACCIGLVIGFYDGFFGPGTGSFLVFLF
FT                   VRWLGYDFLNASASAKLLNTATNVAALGLFAYKGHVWWHFALTMAVANVAGSLLGTRLA
FT                   LKHGAGFVRLVFIVVVSALILKTGFDAFLK"
FT   gene            190631..192079
FT                   /locus_tag="Pnap_0178"
FT   CDS_pept        190631..192079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0178"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: bxe:Bxe_A4189 ammonium
FT                   transporter; TC 1.A.11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35503"
FT                   /db_xref="GOA:A1VIM5"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM5"
FT                   /protein_id="ABM35503.1"
FT                   /translation="MHAMRWIAVSLFFWLCLGLVTQQARAQAPAGAPTAALAAPALAVS
FT                   APPNDASVANAVMPVAPAALTQPGLVGAETLNGADTAWMMTSTALVLLMTLPGIALFYG
FT                   GMVRRKSVLNVMACVVGTCAIVSLLWFAVGYSIAFTPGSGALGHLLGGTDRLWFAGFDY
FT                   IKDAQKVAVSHIAPNIPESVYSMFQLSFAIITASLVVGAFVERMRFSATLIFMALWTVV
FT                   VYAPIAHWVWEPNGWLARLGALDFAGGSVVHINAGIAGLVCAYALGPRKGYGTEPFSPF
FT                   NLGLTMAGAGMLWVGWFGFNAGSAVAADGRAGLAMTVTHIAASAGALSWMAAEWLSRGR
FT                   PSLLGVCSGLVAGLVAITPGAGYVSPGSAVIFGLVAGVACYWGATGLKRLLNADDSLDV
FT                   FGVHGIGGIVGSLLTGVFASKTISGVEGSVWIQFVGAASVMLYSLVMTGLLLWITSLCV
FT                   GLRVSETAEIDGLDIDQHAERMGT"
FT   sig_peptide     190631..190711
FT                   /locus_tag="Pnap_0178"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            192110..192517
FT                   /locus_tag="Pnap_0179"
FT   CDS_pept        192110..192517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35504"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM6"
FT                   /protein_id="ABM35504.1"
FT                   /translation="MSMSSNEKLAIAAHLHVLLRRKTGRVTDTEWMASNPVYAAEVIRL
FT                   AHEKAAEGGHDDLGLLADRLEAAMAFPDAPVYKPLAQRVSDAAKAHSAKAWSAKAAAPP
FT                   APGADSAFGDIPAGLDGMPRPNSPRYVKGLR"
FT   gene            complement(192546..194282)
FT                   /locus_tag="Pnap_0180"
FT   CDS_pept        complement(192546..194282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0180"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: pol:Bpro_0229
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35505"
FT                   /db_xref="GOA:A1VIM7"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM7"
FT                   /protein_id="ABM35505.1"
FT                   /translation="MSEHRFDYIIIGAGTAGCLLANRLSADASKRVLLIEAGRKDDYHW
FT                   VHIPVGYLYCIGNPRTDWLFTTEPDAGLNGRSLRYPRGRVLGGCSSINGMIYMRGQARD
FT                   YDQWAQLTGDSAWTWDNALPHFKLHEDHYKGADALHGARGVAPELMQDKTNPYQKILRH
FT                   RNAGGEWRVEKQRLRWDILDAFAEAASQAGIPATPDFNRGSNEGVGYFEVNQKNGWRWN
FT                   TAKAFLRPTCLGRPNFELWTNAQVSKLVIEPQPDGSQRCTGAEVWTGQERVTALATRDS
FT                   GHMGEVLLCAGSIGSPHLLQLSGIGPAGLLRQHGIAVVQDLPGVGANLQDHLQIRSVYK
FT                   IQGEQGRRRWGLSLNTMADSLWGKARIGLEYALRRTGPMSMAPSQLGAFTRSSPDQPYP
FT                   NIEYHVQPLSLDAFGEPLHRFNAFTASVCNLNPTSRGSVRLKTGRFEDAPAIAPNYLST
FT                   PEDRQVAADSLRITRKIVSQGALAKYQPEEFKPGVQFQTDEDLARLAGDIATTIFHPVG
FT                   TTKMGRADDPMAVVDSHLRVRGVRGLRVVDAGVMPLITSGNTNSPTLMIAEKAAQWIQG
FT                   GV"
FT   gene            194426..195370
FT                   /locus_tag="Pnap_0181"
FT   CDS_pept        194426..195370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0181"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: bxe:Bxe_A0014 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35506"
FT                   /db_xref="GOA:A1VIM8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM8"
FT                   /protein_id="ABM35506.1"
FT                   /translation="MSLNFDPQTLRAFVAVARHGNVSRAAERLHLSQPAVSLQLKGLAA
FT                   NTGLTLFTRTPQGLTLTRDGAALLPQAEKALAALADFAQAALGLHSSVRGTLRIGTILD
FT                   PEFTRLGAFLKELVEAAPQIDTELRQGMSGNVLAQIVRGDLDVGFYLDRPEKSEANQGF
FT                   VQDGRAQAAIDFEVMELTRFTYRVIAPAGWGQQVQGRDWKALAALPWLATPPASVHHRL
FT                   LSRVFGAASLTGLEPRRVALVDQEASMLDLVKSGVGLSLARDSIAIRESQAHGLVVADR
FT                   VSLDCVLSFICLKARVAEPVVASAWGALAQAWR"
FT   gene            195478..196626
FT                   /locus_tag="Pnap_0182"
FT   CDS_pept        195478..196626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0182"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   pol:Bpro_0230 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35507"
FT                   /db_xref="GOA:A1VIM9"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIM9"
FT                   /protein_id="ABM35507.1"
FT                   /translation="MPMEDSPPRIEVQHGPEGRVLLQGAWTAANLTQKPLWDALAAQLK
FT                   ALRAQTASSASPAALRWSLSPLEKLDYLGAQVLWSAWNHHWPAGLQIEPEQRAMLETVE
FT                   KFTVRPLPPPRPSWLEPVLMLGERLLSLLSHAKGMLRLLGQLLLDMGRLVRHPQQGPWR
FT                   DLSGHLYNFGATALPITALVGFLIGVVLAYLISQQLRQFGADAFIVNILGISLIRELGP
FT                   VLAAILIAGRSGSAITAQIGVMRVTEELDAMRVMGIARGFRLVMPRAMALALVMPLISV
FT                   WTTIAALLGGMLAADISMGVTPSFFFNALPAAVKVSNLVLATAKSVVFGLLIALIGCHY
FT                   GLRVKPNTESLGQGTTASVVTSITVVILVDALFAVLFKSVGI"
FT   gene            196623..197420
FT                   /locus_tag="Pnap_0183"
FT   CDS_pept        196623..197420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0183"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0231 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35508"
FT                   /db_xref="GOA:A1VIN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN0"
FT                   /protein_id="ABM35508.1"
FT                   /translation="MTVKTEPVVEIRKLWTIFQNDDKEAVIHKDLDLTVERGAIMSLVG
FT                   GSGTGKTVLLRQMLGLETPARGEITVLGKPAAELGKRGAAMRVGMLFQQGALFSAFTVL
FT                   ENIAFPLRELKCLPGELIREAAMVKLQMVGLPPDAADKMPSDLSGGMIKRVALARALIM
FT                   DPPLLLLDEPTAGLDPESADSFCELLRSLHQGMCLTVVMVTHDLDTIFELSTRVAVLAQ
FT                   QKVIINDTPQKVVAFEHPFIREFFLGERGQRAMALLTPASSPI"
FT   gene            197434..198366
FT                   /locus_tag="Pnap_0184"
FT   CDS_pept        197434..198366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0184"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: pol:Bpro_0232 mammalian cell entry related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35509"
FT                   /db_xref="GOA:A1VIN1"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN1"
FT                   /protein_id="ABM35509.1"
FT                   /translation="MENKAHALIAGAFVVVVAALLALLGVWLTRDDTQRDLYEMSTAET
FT                   ISGLQPQAVVRFRGVPVGKVERIGFDDKVKGNVLIRVSIDRAAPMMQSTFATVASQGVT
FT                   GLGFIQLDDNGESTQRLVPNDDDPPRIPLKPGTLDKLLKQSDAIFTQAEQAATRINQLL
FT                   SRQNEEAINTAVTQLAEAASSINRLAKGLEPTVATLPALSRDSSATMKALKSASDEVGL
FT                   TARRLNEKGGPLDKLRDGGTALAAGVETFSAATLPKLGEVADETARTMRQLRRTVNAVD
FT                   DNPQALIFGNGPAVPGPGEAGFSADGVKK"
FT   sig_peptide     197434..197511
FT                   /locus_tag="Pnap_0184"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.863) with cleavage site probability 0.321 at
FT                   residue 26"
FT   gene            198363..199067
FT                   /locus_tag="Pnap_0185"
FT   CDS_pept        198363..199067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0185"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pol:Bpro_0233 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35510"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN2"
FT                   /protein_id="ABM35510.1"
FT                   /translation="MMLLKSIHVTIKTIAASACQSCAKPVFGLIFALGLVAGCSVVDKP
FT                   TRAALYDFGPGELPTQAAATPAPALPPLAIADIATSGGALDNQAVLYRLGYLDAQQLRP
FT                   YSQARWSMPPAQLLRQRLRERLGQQRAVFNAREGVALNRSQNANLLMLRLELEEFSQLF
FT                   SAPDASVGLIRLHATLVEITPAGERLVAQRNLSVQRPATRADAAGGVRALTAATDAAID
FT                   ELDQWLRQMPAR"
FT   gene            complement(199168..199800)
FT                   /locus_tag="Pnap_0186"
FT   CDS_pept        complement(199168..199800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0186"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   proteins; KEGG: pol:Bpro_0238 multiple antibiotic
FT                   resistance (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35511"
FT                   /db_xref="GOA:A1VIN3"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN3"
FT                   /protein_id="ABM35511.1"
FT                   /translation="MDFKPLVTLLAIVNPLAIVPFFIHYTQGFSTPQRQRTVVVASFSA
FT                   FVVIAVSALLGLQILEFFGISLASFQVGGGLLLLISAMNMLNAQPAEAKPLTNEYEDGA
FT                   EKAARGASIAVVPLTIPLLTGPATMSTVVIYAEKAKTFLQLGTLVGYGMVIGLATALCF
FT                   SLAEPISRVLGKTGINVMTRLMGLILAALAVEVMADGLGKLFPILRH"
FT   gene            199954..200559
FT                   /locus_tag="Pnap_0187"
FT   CDS_pept        199954..200559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0187"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pol:Bpro_0240 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35512"
FT                   /db_xref="GOA:A1VIN4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN4"
FT                   /protein_id="ABM35512.1"
FT                   /translation="MSTTVDYYFTPQSPWTYLGHARFAQIARAAGAAVRVLPIDLGGKV
FT                   FPISGGLPLGQRAPQRQAYRLLELRRHADFLGLPLHVKPKFFPVSGDDASRLIIAVDLH
FT                   DGVEAAMKISGAIFTALWAQERHIASEKVLAELLNECGLDAARLEQSYSQAVQERYEDN
FT                   TAQAIQAGIFGAPSYLIEGELFWGQDRLDFVERRLKPA"
FT   gene            200608..201297
FT                   /locus_tag="Pnap_0188"
FT   CDS_pept        200608..201297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0188"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: pol:Bpro_0241
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35513"
FT                   /db_xref="GOA:A1VIN5"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN5"
FT                   /protein_id="ABM35513.1"
FT                   /translation="MGQFTTLTAADGFTLSAYVATPVGKPRAAIVVLQEIFGVNSHIRS
FT                   VADRFAAEGYLAVAPATFDRVKPGVELGYTEADMNAGFELKTAVDALPGAGVLQDIQAA
FT                   IDHAGRASGGKVGIVGFCWGGLLTWKAACLLKGLSAAVPYYGGGITGEGEIARQPQCPV
FT                   MAHFGDQDHWIPMDGIEAFQKAHPEVEVHVYPASHGFNCDQRASYNEAAAKLARERSLA
FT                   FLADKLG"
FT   gene            complement(201305..201871)
FT                   /locus_tag="Pnap_0189"
FT   CDS_pept        complement(201305..201871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0189"
FT                   /product="protein of unknown function DUF1003"
FT                   /note="PFAM: protein of unknown function DUF1003; KEGG:
FT                   tbd:Tbd_1949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35514"
FT                   /db_xref="GOA:A1VIN6"
FT                   /db_xref="InterPro:IPR010406"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN6"
FT                   /protein_id="ABM35514.1"
FT                   /translation="MSILSRIHAGPGATQASADDLTRDNVESMRRVEEQAMAKRSRADR
FT                   IAAFVASFCGSMPFVWLHVLLFFVWLALNSWPGIHHFDPYPFTFLTLVVSLEAIFLSAF
FT                   ILISQNYELRISDRRNQLDLQINLLTEQENTKMLQLLEQIAAKVGVDVSGDAELRFLKQ
FT                   VTHPEKLIAQIEHAQQERPLKTSSV"
FT   gene            complement(201912..202682)
FT                   /locus_tag="Pnap_0190"
FT   CDS_pept        complement(201912..202682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0190"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   pfo:Pfl_2381 protein of unknown function DUF72"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35515"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN7"
FT                   /protein_id="ABM35515.1"
FT                   /translation="MQASLFPDQTLSPGSRIKVGCAGWSLPRALWPGFPAAGTHLQRYA
FT                   ARLNAVEINSSFYRPHQEATYARWAASVPDDFRFSVKLPKTITHQRRLADCTGLLDTFL
FT                   GQVGGLGGRLGCLLVQLPPSLAFDAATVTSFLRALRERHGGPVALEPRHASWFSAPADA
FT                   LLDAWQVGRVLADPVVHEAGRIPGCFAGLVYVRLHGSPRMYYSAYDRAVLDALIIRLEL
FT                   AARSGANVWCLFDNTAEGAAVADALYTLQGLAVR"
FT   gene            complement(202703..203818)
FT                   /locus_tag="Pnap_0191"
FT   CDS_pept        complement(202703..203818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0191"
FT                   /product="Mg2+ transporter protein, CorA family protein"
FT                   /note="PFAM: Mg2+ transporter protein, CorA family protein;
FT                   KEGG: pol:Bpro_0244 Mg2+ transporter protein, CorA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35516"
FT                   /db_xref="GOA:A1VIN8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN8"
FT                   /protein_id="ABM35516.1"
FT                   /translation="MRVFTINSGSQGVIETDALPAELPPHGFIWIACARREFEVMLAPI
FT                   QAALQRLCGTQLVDLHVSDLLNNQLPSHYDYTSQYDMLVFRRLAAGQTETDLSQPGEPL
FT                   HQPARRSGPPVLKRIDTSPVGFAVFDRVLLTVHPAGCSVREAYALKLLNATSPEARANG
FT                   VKLPASPADLMLRIVNQMVDGYLALRRELTRQMDHWQYELLNPNARFNNWSAVLDARLA
FT                   LHLLDEICEDQRAALQDWLDSIETWPDAGTPGAQRERELLKVRSRDVLEHIERVVHHVR
FT                   RMEQSAETAVQMHFSAQSHRTNDIMRTLTALTAVFLPLNLVTGFFGMNFEFLPAIHSSA
FT                   GFWWTFSLMLLLVIVVVSVFWRKQYLARTSR"
FT   gene            complement(203930..204946)
FT                   /locus_tag="Pnap_0192"
FT   CDS_pept        complement(203930..204946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0192"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number="4.2.1.24"
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   pol:Bpro_0245 porphobilinogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35517"
FT                   /db_xref="GOA:A1VIN9"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIN9"
FT                   /protein_id="ABM35517.1"
FT                   /translation="MTLHASNFAPFPMGRPRRLRRDSFTRNLVRENALTAHDLIYPVFV
FT                   LAGQHRREPVASMPGVERLSLDLLLPVAEECVKLGIPVMALFPVIDASLKTEDGREALN
FT                   PEGLVPHVVRELKRRFPELGVMTDVALDPFTSHGQDGLPDANGYILNDETLELLVGQAL
FT                   TQAEAGVDIVAPSDMMDGRIGAIRAALESQDLIHTRIMAYSAKYASAFYGPFRDAVGSS
FT                   GNLGKADKKVYQMDPGNSDEALREVAMDIAEGADMVMVKPGMPYLDVVRRVKDEFQVPT
FT                   FAYQVSGEYAMLKAAAQNGWLDHDAVMLESLLAFKRAGADGVLTYFAIDAARKLRQG"
FT   gene            205309..205737
FT                   /locus_tag="Pnap_0193"
FT   CDS_pept        205309..205737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0193"
FT                   /product="conserved hypothetical protein 701"
FT                   /note="PFAM: conserved hypothetical protein 701; KEGG:
FT                   pol:Bpro_0246 conserved hypothetical protein 701"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35518"
FT                   /db_xref="GOA:A1VIP0"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP0"
FT                   /protein_id="ABM35518.1"
FT                   /translation="MLWVKSFHIVFIASWFAGLFYLPRIFVNLAMVPPHSIAERERLIL
FT                   MAGKLMRFTTLLAIPAVALGLWLYLGYGIGRGPGNGWMHAKLAVVALVIGYHHACGRML
FT                   AKFVAKRNTHSHVWLRWFNEVPVLLLVAAVILVVVKPF"
FT   gene            205816..207012
FT                   /locus_tag="Pnap_0194"
FT   CDS_pept        205816..207012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0194"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: pol:Bpro_0247 VanZ
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35519"
FT                   /db_xref="GOA:A1VIP1"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP1"
FT                   /protein_id="ABM35519.1"
FT                   /translation="MSRPLQGGAELHAAKRSEDVGGVPYSSVGDGQKTTAWPLALVLVC
FT                   LIIYASLYPFSEWRNQGISPLRFLTSPLPKYWTGFDVGTNLLGYAPLGFLLALSALRSR
FT                   RVAWAVSVSVLGAALLSLAMESLQSYLPSRIPSNVDLALNTLGAWLGACCALALERSGL
FT                   VGRWGRVRARWFSPDARSVLVLLLLWPLALLFPAAVPMGLGQVFERLETALADALADTP
FT                   FLEWMPMREVELQPLVPIAELVCVALGVLIPCLLGYCVVRTLWQRAVFAAATIALGLGA
FT                   SALSAALSYGPEHAWAWLDAPVRVGIGLAVVLAVLLLALPRRVAAALALLALAIHLSLL
FT                   NQAPADPYFAQTLQIWEQGRFIHFYGLVQWLGWLWPYAALTCLVARLSSHEPQAAAEK"
FT   gene            207022..207393
FT                   /locus_tag="Pnap_0195"
FT   CDS_pept        207022..207393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0195"
FT                   /product="ferredoxin-like protein"
FT                   /note="KEGG: pol:Bpro_0248 ferredoxin-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35520"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP2"
FT                   /protein_id="ABM35520.1"
FT                   /translation="MTLAATQTTSSDAAKPDSYYERHIFFCLNQRTGEPCCADQGAQQA
FT                   FDRCKSLVKAAGLAGPGKVRVNKAGCLDRCAGGPVAVVYPEAVWYSYVDASDIDEIVES
FT                   HLLNGQVVERLLTPPHLGR"
FT   gene            207513..208157
FT                   /locus_tag="Pnap_0196"
FT   CDS_pept        207513..208157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0196"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_0249 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35521"
FT                   /db_xref="GOA:A1VIP3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP3"
FT                   /protein_id="ABM35521.1"
FT                   /translation="MNSKTQKSSIAGPAGALDIALDLPAGESRGIAVIAHPHPLFGGTL
FT                   DNKVVQTLARAFVQTGWTAVRFNFRGVGGSAGSHDEGRGELEDFLAVVQHVAPAGEGQA
FT                   ALALAGFSFGAFVTTHAFERLHAGRPIEKLVLVGTSVSRAPAAPVDAAAHNKTLVVHGE
FT                   QDDTVLLSAVMDWARPQALPVTVVPGVGHFFHGQLPLLKNLVIRHLASPAV"
FT   gene            208232..209440
FT                   /locus_tag="Pnap_0197"
FT   CDS_pept        208232..209440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0197"
FT                   /product="penicillin-binding protein 6, Serine peptidase,
FT                   MEROPS family S11"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11, D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: pol:Bpro_0250 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35522"
FT                   /db_xref="GOA:A1VIP4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP4"
FT                   /protein_id="ABM35522.1"
FT                   /translation="MQCFLKAPAGLRGLAATFVLLVSVALPAAHAQAPQVPEIAARSYL
FT                   LLDVTANQILAAKDIDSPVEPASLTKLMTEYLVFDALKSKKITLQQTFGVSQRAWKMPG
FT                   SRMFIDPKMQVPVEDLIKGMIVQSGNDATMALAEGVGGTAEHFVELMNQQAKALGMKST
FT                   SYKNPEGLTEAGHITTARDLSILSTRLMSDFPDYIGYSAIKKYRYPGTPATNDTNRNTL
FT                   LFRDPTVDGLKTGHTNAAGYCMIATAKREFPNLGAAGKPGGRRLLAIVLGTTSDSARAT
FT                   ESQKLLNWGYTAFEAVKLFDAGQAVVTPAVWKGKDAVVKLGRPEAIVVAVTAGSASRLK
FT                   TQVARPEPLVAPFKKGQPVGSLKIMLGDNPAPMAEVPLVALETVEEAGIMGRAWDSIRL
FT                   WIK"
FT   sig_peptide     208232..208327
FT                   /locus_tag="Pnap_0197"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            209585..209962
FT                   /locus_tag="Pnap_0198"
FT   CDS_pept        209585..209962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0198"
FT                   /product="SSU ribosomal protein S12P"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: pol:Bpro_0251 ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35523"
FT                   /db_xref="GOA:A1VIP5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP5"
FT                   /protein_id="ABM35523.1"
FT                   /translation="MPTINQLVRQGREVEKIKSKSPAMENSPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEIISYIGGEGHNLQEHSVVLVRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQSRSKYGAKRPKAK"
FT   gene            210173..210646
FT                   /locus_tag="Pnap_0199"
FT   CDS_pept        210173..210646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0199"
FT                   /product="SSU ribosomal protein S7P"
FT                   /note="PFAM: ribosomal protein S7; KEGG: pol:Bpro_0252
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35524"
FT                   /db_xref="GOA:A1VIP6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP6"
FT                   /protein_id="ABM35524.1"
FT                   /translation="MPRRREVPKREILPDPKFGDVDLAKFMNVIMQGGKKAVAERIIYG
FT                   ALEQIEKKNPGKDPLEAFHMAIGNIKPMVEVKSRRVGGANYQVPVEVRPVRRMALAMRW
FT                   LKEAAKKRGEKSMSLRLANELMEATEGRGGAMKKRDEVHRMAEANKAFSHFRF"
FT   gene            210853..212955
FT                   /locus_tag="Pnap_0200"
FT   CDS_pept        210853..212955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0200"
FT                   /product="translation elongation factor 2 (EF-2/EF-G)"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: pol:Bpro_0253 translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35525"
FT                   /db_xref="GOA:A1VIP7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIP7"
FT                   /protein_id="ABM35525.1"
FT                   /translation="MSRATPIKNYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTCFWKGMDSTLGEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYKVPRLAFVNKMDRTGANFFKVVEGMKLRLK
FT                   ANPVPMVIPIGAEENFTGVVDLLMMKAIIWDEASQGMKFEYRDIPADLVDTANEWREKM
FT                   VEAAAEANEELMNKYLEEGDLSEAEIKFGIRARTIASEIQPMYCGSAFKNKGVQRMLDA
FT                   VIEFMPSPIDIPPVKGTDDDEEPVTRMADDSEKFAALAFKLMTDPFVGQLTFVRVYSGV
FT                   LKKGDTVYNPIKGKKERIGRIVQMHANERQEVSEIVAGDIAACVGLKDVTTGETLCDPD
FT                   AIIMLERMVFPEPVIAQAVEPKTKADQEKMGIALQRLAAEDPSFRVKTDEESGQTIIAG
FT                   MGELHLEIIVDRMKREFGVEANVGKPQVAYRETIRKTIEDAEGKFVRQSGGKGQYGHVV
FT                   LKIEPNEPGKGIEFIDAIKGGVVPREYIPAVEKGINEAVTSGVLAGYPVVDVKVTLHFG
FT                   SYHDVDSNELAFKMAAIFGFKEGCRKAGPVILEPMMAVEVETPEDYAGNVMGDLASRRG
FT                   MVQGMEDMVGGGKAIKAEVPLSEMFGYSTTLRSATQGRATYSMEFKHYTEAPRNVSEAI
FT                   MAARAK"
FT   gene            213103..214293
FT                   /locus_tag="Pnap_0201"
FT   CDS_pept        213103..214293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0201"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor,
FT                   GTP-binding; elongation factor Tu domain protein domain
FT                   protein; elongation factor Tu, domain 2 protein; KEGG:
FT                   pol:Bpro_4449 translation elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35526"
FT                   /db_xref="GOA:A1VIP8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP8"
FT                   /protein_id="ABM35526.1"
FT                   /translation="MAKEKFSRTKPHVNVGTIGHVDHGKTTLTAAIATVLAAKFGGEAK
FT                   AYDQIDAAPEEKARGITINTAHVEYETAARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDF
FT                   PGDDTPIIHGSAKLALEGDKGPLGEEAIMKLADALDNYIPLPERAVDGAFLMPVEDVFS
FT                   ISGRGTVVTGRIERGIIKVGEEIEIVGIADTQKTICTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVQRGQVLCKPGSIKPHTHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGAIELPEGKEMVMPGDNVSITVKLINPIAMEEGLRFAIREGGRTVGAGVVAKILA"
FT   gene            214321..214635
FT                   /locus_tag="Pnap_0202"
FT   CDS_pept        214321..214635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0202"
FT                   /product="SSU ribosomal protein S10P"
FT                   /note="PFAM: ribosomal protein S10; KEGG: pol:Bpro_0255
FT                   ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35527"
FT                   /db_xref="GOA:A1VIP9"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIP9"
FT                   /protein_id="ABM35527.1"
FT                   /translation="MATKQKIRIRLKAFDYKLIDQSAAEIVDTAKRTGAIVKGPVPLPT
FT                   RMKRFDILRSPHVNKTSRDQLEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ
FT                   "
FT   gene            214874..215554
FT                   /locus_tag="Pnap_0203"
FT   CDS_pept        214874..215554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0203"
FT                   /product="LSU ribosomal protein L3P"
FT                   /note="PFAM: ribosomal protein L3; KEGG: pol:Bpro_0256
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35528"
FT                   /db_xref="GOA:A1VIQ0"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ0"
FT                   /protein_id="ABM35528.1"
FT                   /translation="MSLSNSLGLLGRKVGMMRLFTDDGDTVPVTVVDVSNNRVTQVKTE
FT                   ANDGYDALQVAFGSRKASRVTKPEAGHLAKAGVEAGEILKEFRVTADVAGKYAAGTVVP
FT                   AADIFAVGQLVDVQGTSIGKGFAGTIKRHKMSSQRASHGNSRSHNVPGSIGMAQDPGRV
FT                   FPGKRMTGHLGDVTKTTQNLDIVRIDEARQLLMIRGAVPGSKGGFVTVRAAIKAKPTAA
FT                   KGAN"
FT   gene            215554..216174
FT                   /locus_tag="Pnap_0204"
FT   CDS_pept        215554..216174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0204"
FT                   /product="LSU ribosomal protein L4P"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: pol:Bpro_0257
FT                   ribosomal protein L4/L1e"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35529"
FT                   /db_xref="GOA:A1VIQ1"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ1"
FT                   /protein_id="ABM35529.1"
FT                   /translation="MQVELLNDQGLSSSKVDVSDTVFGREYNESLIHQVIVAFQANARQ
FT                   GTRAQKDREQVRHSTKKPFKQKGTGRARAGMTSSPLWRGGGRIFPNMPDENFTHKINKK
FT                   MYRAGMASIFSQLAREGRLAVVDSLTVDSPKTKVLADKFKAMNLNSVLVIADQVDENLY
FT                   LASRNLVNILVVEPRYADPLSLVHYKKVLVTKAAMDQLKEMFA"
FT   gene            216171..216497
FT                   /locus_tag="Pnap_0205"
FT   CDS_pept        216171..216497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0205"
FT                   /product="LSU ribosomal protein L23P"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: pol:Bpro_0258
FT                   ribosomal protein L25/L23"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35530"
FT                   /db_xref="GOA:A1VIQ2"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ2"
FT                   /protein_id="ABM35530.1"
FT                   /translation="MSAVNAQTKYDEGRLMQVLVAPIVSEKATMIAEKSNSVTFKVLQD
FT                   ATKYEIKAAVELMFKVNVKAVAVLNIKGKTKRFGKSVGRRDNLRKAYVTLQAGQELNLG
FT                   GESA"
FT   gene            216497..217321
FT                   /locus_tag="Pnap_0206"
FT   CDS_pept        216497..217321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0206"
FT                   /product="LSU ribosomal protein L2P"
FT                   /note="PFAM: ribosomal protein L2; KEGG: pol:Bpro_0259
FT                   ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35531"
FT                   /db_xref="GOA:A1VIQ3"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ3"
FT                   /protein_id="ABM35531.1"
FT                   /translation="MAVIKMKPTSPGMRGMVKISRDHLHKGEPYAPLLEPQFQHSGRNN
FT                   NGHITVRHKGGGHKHHYRVVDFKRNKDAIPAKVERIEYDPNRTAHIALICYADGERAYI
FT                   IAPRGLEVGATILSGSEAPIRVGNTLPIRNIPVGSTIHCIEMQIGKGAQIARSAGTSAT
FT                   LLAREGTYAQVRMRSGEVRKIHIECRATIGEVANEEHSLRRLGKAGVKRWMGIRPTVRG
FT                   VVMNPVDHPHGGGEGKTGEGRHPVDPWGNLTKGYRTRNNKRTQVMIVSRRKK"
FT   gene            217332..217610
FT                   /locus_tag="Pnap_0207"
FT   CDS_pept        217332..217610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0207"
FT                   /product="SSU ribosomal protein S19P"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: pol:Bpro_0260 ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35532"
FT                   /db_xref="GOA:A1VIQ4"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ4"
FT                   /protein_id="ABM35532.1"
FT                   /translation="MTRSLKKGPFVDHHLVAKADKAVTNKDKKPIKTWSRRSMILPEFI
FT                   GLTIAVHNGKQHVPVYITDQMVGHKLGEFALTRTFKGHPADKKVVRK"
FT   gene            217620..217949
FT                   /locus_tag="Pnap_0208"
FT   CDS_pept        217620..217949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0208"
FT                   /product="LSU ribosomal protein L22P"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: pol:Bpro_0261 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35533"
FT                   /db_xref="GOA:A1VIQ5"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ5"
FT                   /protein_id="ABM35533.1"
FT                   /translation="METRATLRGVRLSVDKGRLVADLIRGKKVDQALNILNFTQKKAAG
FT                   IIKKVVESAIANAEHNDGADIDELRVKTIYVEQGATLKRFSARAKGRGNSISKPTCHVY
FT                   VVVGN"
FT   gene            217962..218849
FT                   /locus_tag="Pnap_0209"
FT   CDS_pept        217962..218849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0209"
FT                   /product="SSU ribosomal protein S3P"
FT                   /note="KEGG: pol:Bpro_0262 ribosomal protein S3; TIGRFAM:
FT                   ribosomal protein S3; PFAM: ribosomal protein S3-C-terminal
FT                   domain protein; KH, type 2 domain protein; Ribosomal
FT                   protein S3, N-terminal domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35534"
FT                   /db_xref="GOA:A1VIQ6"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ6"
FT                   /protein_id="ABM35534.1"
FT                   /translation="MGQKINPTGFRLSISRNWSSRWYANNRDFAGMLAEDIKVREYLKK
FT                   KLKNAAVSRVLIERPAKNARITIFSARPGVVIGKKGEDIEALKKELSRQLGVPVAVNIE
FT                   EVRKPEIDAKLIADSITQQLEKRIMFRRAMKRAMQNAMRLGALGIKIMSSGRLNGIEIA
FT                   RCEWYREGRVPLHTLRADIDYGTSEAQTTYGIIGVKVWVYKGDTLGRNDGTGAKMIEVA
FT                   DEERKPRGPRRDARPGDRPDRGAPRGAPRAPRGNYAPADGSDKPAEAAGADNNTVKRVR
FT                   KAAPAAAADGAKTE"
FT   gene            218874..219290
FT                   /locus_tag="Pnap_0210"
FT   CDS_pept        218874..219290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0210"
FT                   /product="LSU ribosomal protein L16P"
FT                   /note="PFAM: ribosomal protein L16; KEGG: pol:Bpro_0263
FT                   ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35535"
FT                   /db_xref="GOA:A1VIQ7"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ7"
FT                   /protein_id="ABM35535.1"
FT                   /translation="MLQPARRKYRKEQKGRNTGVATRGNSVAFGDFGLKCTDRGRLTAR
FT                   QLEAARRAISRHVKRGGRIWIRVFPDKPISQKPAEVRMGNGKGNPEYYVAEIQPGKIVF
FT                   EIVGVTEELAREAFRLASAKLPLRTTFVSRMIGQ"
FT   gene            219307..219510
FT                   /locus_tag="Pnap_0211"
FT   CDS_pept        219307..219510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0211"
FT                   /product="LSU ribosomal protein L29P"
FT                   /note="PFAM: ribosomal protein L29; KEGG: pol:Bpro_0264
FT                   ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35536"
FT                   /db_xref="GOA:A1VIQ8"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ8"
FT                   /protein_id="ABM35536.1"
FT                   /translation="MNTTELRQKDVDGLKAEVKELQKAHFGLRMQKATQQLTNTSTLRS
FT                   TRRAIARAKTILAETIVKQGAK"
FT   gene            219510..219779
FT                   /locus_tag="Pnap_0212"
FT   CDS_pept        219510..219779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0212"
FT                   /product="SSU ribosomal protein S17P"
FT                   /note="PFAM: ribosomal protein S17; KEGG: pol:Bpro_0265
FT                   ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35537"
FT                   /db_xref="GOA:A1VIQ9"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIQ9"
FT                   /protein_id="ABM35537.1"
FT                   /translation="MTEAKKSLKRTLIGKVVSDKRAKTVTVLVERRVKHELYGKIVSLS
FT                   SKYHAHDEKGEFKTGDVIEITESRPISKTKNWVVTRLVQKAEIV"
FT   gene            219963..220469
FT                   /locus_tag="Pnap_0213"
FT   CDS_pept        219963..220469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0213"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0266
FT                   alkyl hydroperoxide reductase/thiol specific
FT                   antioxidant/Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35538"
FT                   /db_xref="GOA:A1VIR0"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR0"
FT                   /protein_id="ABM35538.1"
FT                   /translation="MIKVGDTLPAATLMEFVEVEGNGCSLGPNPVDVAQASAGKTIALF
FT                   AVPGAFTPTCSAKHVPGYVAKFAEFKAAGVDEIWCLSVNDAFVMGAWARDQKTEGKVRM
FT                   LADGDAAFAQATGLTLDLNGKGLGLRSNRYSMLVKDGKVASLNIEGPGKFEVSDADTLL
FT                   AQVAA"
FT   gene            complement(220539..221027)
FT                   /locus_tag="Pnap_0214"
FT   CDS_pept        complement(220539..221027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0214"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pol:Bpro_0267 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35539"
FT                   /db_xref="GOA:A1VIR1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR1"
FT                   /protein_id="ABM35539.1"
FT                   /translation="MSRPTIQFITPDSPDQLAATRQIFLEYAKQLGVDLCFQNFEAELA
FT                   DLPGEYGEPGGALMLALVDGEIAGCCGLRALDSADYPNAAEMKRLYVRKAFRRFGLGRQ
FT                   LAEAALDAARMAGYHCVLLDTLDDMESARALYAELGFVDIPPYYHNPIPGAHYLKADL"
FT   gene            complement(221085..221771)
FT                   /locus_tag="Pnap_0215"
FT   CDS_pept        complement(221085..221771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0215"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: pol:Bpro_0268
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35540"
FT                   /db_xref="GOA:A1VIR2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR2"
FT                   /protein_id="ABM35540.1"
FT                   /translation="MYSNKTLTKVRVWDLPTRLFHWTLVAAITGLAISGTLGGNAMVWH
FT                   FRFGYGVLALLLFRILWGLVGGRWSRFGAFIYAPQSLIHYLKGKGKPEHSVGHNPIGAL
FT                   SVFAMLGFLVLQVASGLLSDDEIAFSGPLTRFVANATVSLATDYHANIGKWILLGLVLL
FT                   HIGAIVVYLLRKHNLVGAMLHGDKELVVKVPASRDDTASRTAALLLFMLCAGVAYWVST
FT                   LEAAAF"
FT   sig_peptide     complement(221646..221771)
FT                   /locus_tag="Pnap_0215"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.791) with cleavage site probability 0.427 at
FT                   residue 42"
FT   gene            221967..222422
FT                   /locus_tag="Pnap_0216"
FT   CDS_pept        221967..222422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0216"
FT                   /product="cytochrome c, class II"
FT                   /note="PFAM: cytochrome c, class II; KEGG: pol:Bpro_0269
FT                   cytochrome c, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35541"
FT                   /db_xref="GOA:A1VIR3"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR3"
FT                   /protein_id="ABM35541.1"
FT                   /translation="MKAFVCIAAAASLFAWAAPASAQFAKPEDAVKYRQSALSVMGTHF
FT                   GRLGAMVNGKVPFDAKVAADSAELVATMAKLPWAGFGPGTDKDSRSKAMSEVWTEQAKF
FT                   KAGSDKLAAESVKLAAAGKTGNLDALKTAFGATAETCKACHDAFRNK"
FT   sig_peptide     221967..222035
FT                   /locus_tag="Pnap_0216"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.585 at
FT                   residue 23"
FT   gene            complement(222550..223065)
FT                   /locus_tag="Pnap_0217"
FT   CDS_pept        complement(222550..223065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0217"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; KEGG: pol:Bpro_0270
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35542"
FT                   /db_xref="GOA:A1VIR4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR4"
FT                   /protein_id="ABM35542.1"
FT                   /translation="MIKISPVAVCRMVLAGALALGGAAFLAGCSGAQAAPESTFVLLDG
FT                   SKQTTADLKGKVTLVNFWATSCVTCVAEMPKIIATHNKYKTRGYDTLAVAMSYDPPSYV
FT                   VNYAETRQLPFKVAIDNTGANAKAWGDVQLTPTTFLVNKRGQIVKQFVGEPDFAALHQL
FT                   IEKLLAET"
FT   sig_peptide     complement(222961..223065)
FT                   /locus_tag="Pnap_0217"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            223079..223783
FT                   /locus_tag="Pnap_0218"
FT   CDS_pept        223079..223783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0218"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35543"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR5"
FT                   /protein_id="ABM35543.1"
FT                   /translation="MQRRNFNQAGMSALGLLILATWRHAHALSLGDLTNAEASSGLKTA
FT                   LEKGALMAVALLGKPDGFLGNPKVRIPLPGYLEDASKLLKTFGQGRRLDELTTSINRAA
FT                   EAAVPMGKDLLVSAVRGMNVNDAKNILTGGDTSVTAFFADKTRVPLGVKFLPVVNRATE
FT                   KVGLANQYNEFAGKAASFGLVRKEDANIQQYVTGKTLDGLYLMLGEEEKKIRQDPVGTG
FT                   SAILQKVFGALK"
FT   sig_peptide     223079..223162
FT                   /locus_tag="Pnap_0218"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.893 at
FT                   residue 28"
FT   gene            223886..225166
FT                   /locus_tag="Pnap_0219"
FT   CDS_pept        223886..225166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0219"
FT                   /product="O-acetylhomoserine sulfhydrolase"
FT                   /EC_number="2.5.1.49"
FT                   /note="KEGG: rfr:Rfer_1327
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; TIGRFAM:
FT                   O-acetylhomoserine/O-acetylserine sulfhydrylase; PFAM:
FT                   Cys/Met metabolism pyridoxal-phosphate-dependent enzymes"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35544"
FT                   /db_xref="GOA:A1VIR6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR6"
FT                   /protein_id="ABM35544.1"
FT                   /translation="MKIETIAVHGGYTPDPTTKAVAVPIYQTVAYAFDNTQHGADLFDL
FT                   KVAGNIYSRIMNPTNAVLEARMTALEGGIGALAVASGMAAIAYAIQTITEAGDNIVASS
FT                   ALYGGTYNLFAHTFPQMGIEVRFADPRDPGSFAPLIDARTKAVFCESVGNPLGNVTDIA
FT                   ALAGVAHAGGVPLIVDNTVSSPYLCRPFEHGADIVVHALTKYLGGHGTTLGGVIVDSGK
FT                   FPWAEHKARFRRLNEPDVSYHGVVYTEALGAAAYIGRARVVPLRNMGAALSAMAAFQIL
FT                   QGIETLALRMDRICDNALAIAYFLKNHPKVAWVNYAGLPEHRDHALVQQYMGGKASGII
FT                   SFGVKSQADAMAAGSRFQDALQLFTRLVNIGDAKSLACHPASTTHRQLNPAELAKAGVS
FT                   TDMVRLSVGIEHIDDLLADLEQALAAV"
FT   gene            225345..225941
FT                   /locus_tag="Pnap_0220"
FT   CDS_pept        225345..225941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0220"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pol:Bpro_0280 OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35545"
FT                   /db_xref="GOA:A1VIR7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR7"
FT                   /protein_id="ABM35545.1"
FT                   /translation="MKKQLIAAAVLSTLLSGAAFAQQATEGPWMVRARAVHLDSANGDS
FT                   TGLGLSVNNKWMPEVDISYFVNKNVAVELVLTVPQKHTMYSNGVEIGTLKHLPPTLLGQ
FT                   YHFDMNGFKPYVGAGVNFTRFSGVNLLGGVATVDKNSWGPALQVGVDIPLSKGLYLNLD
FT                   VKKVYIRTDVAAAGTKIGEFKVDPLLVGVGLGWRF"
FT   sig_peptide     225345..225410
FT                   /locus_tag="Pnap_0220"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            225998..227326
FT                   /locus_tag="Pnap_0221"
FT   CDS_pept        225998..227326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0221"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   bpe:BP2153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35546"
FT                   /db_xref="GOA:A1VIR8"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR8"
FT                   /protein_id="ABM35546.1"
FT                   /translation="MQAAARQTARLPGMQSPTEIQQHLDSVEDAFRRARLRAMQRVAGG
FT                   LLLLAFAVFCLARSLSGLHPAWGYVEAFAEAAMVGAVADWFAVVALFRHPLGIPVWHTA
FT                   IIANSKDDIGRNLGQFVESYFVTEEGIAQRIRQANPAGLLGAWLLAPGHAAQLGHATAK
FT                   ALKALLNALDDPSMSQLLKDAAAGQLARFDISANAGQLLDLLVAEGKHQQLLNSVLHSL
FT                   GDYLSEETNQQQATDFLIAAFGVENVLYKVGTAAIGPRALRSLSRSAHEVLEDPAHPAR
FT                   ERFNGWVQNFVLHLKDDPQWREFIVRHQQDTLANERVQALLGGLWGRVKARLLDDLGRD
FT                   DPAMARQISVLARKVGQALAQDARLVEGLNGAIESGSVLLVRNYRGEVGHFIEAKLAQW
FT                   TREEMTDRIELAIGRDLQFIRINGTLVGGLVGLAIYSVTRLLG"
FT   gene            complement(227418..228149)
FT                   /locus_tag="Pnap_0222"
FT   CDS_pept        complement(227418..228149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0222"
FT                   /product="putative esterase"
FT                   /note="KEGG: pol:Bpro_0278 putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35547"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIR9"
FT                   /protein_id="ABM35547.1"
FT                   /translation="MANFVLVHGAWHGGWCWQRVTAVLQRGGHRVHAVTLTGLGERAHL
FT                   LSPAITLDTHIDDVINLIEAEELLDVVLAVHSYAGMIGTAVADRLGQRLKHLVYVDAVV
FT                   PKPGESWSSTQSSATQQQRLAAAQASAHFSFPPPDPEVYGLKDDDREWVKRRQTPHPGN
FT                   TYQAPLDFDVQRVAAVPRTFVSCTEPALATIAPSRLRAKDPKFWDGAWLPGASTIELQT
FT                   GHDPMVSEPAALVRILLGCGA"
FT   gene            complement(228149..229396)
FT                   /locus_tag="Pnap_0223"
FT   CDS_pept        complement(228149..229396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0223"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_0281 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35548"
FT                   /db_xref="GOA:A1VIS0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS0"
FT                   /protein_id="ABM35548.1"
FT                   /translation="MNSLNGIRILDLSRVLAGPWCTQTLADLGADVIKIERPGSGDDTR
FT                   TWGPPFLKDDEGAETHEAAYYLGANRNKRSVTCDIAKPDGQALIRELARHCDVFVENFK
FT                   VGDMARYGLDYASLKLLNPRLVYCSVTGFGQNGPYAERAGYDYAIQGMGGLMSVTGERD
FT                   DLGGGPQKVGVAVADLMTGMYATVGILAALRHAEKTGVGQLVDLALLDTQVAMLANLGA
FT                   NYLVSGKVPQRVGNAHMNIVPYQVFEVAPAADGSKDHLILAVGNDAQYVKFCAIAGIPE
FT                   LGVNPLFAKNRDRVHNRAQLVPILESVMKLRGKADWLAALEAAKVPCGAINNLAEVFAD
FT                   PQIEARDMVTHWRHPLKSDLPLVASPIKLSATPVRTPGQGGLPPPLLGQHTEEVLRELL
FT                   DYSDAQLSQLKTARVI"
FT   gene            229582..230601
FT                   /locus_tag="Pnap_0224"
FT   CDS_pept        229582..230601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0224"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein, LacI;
FT                   KEGG: bcn:Bcen_4095 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35549"
FT                   /db_xref="GOA:A1VIS1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS1"
FT                   /protein_id="ABM35549.1"
FT                   /translation="MDLKQLSASLGLSPTTVSRALNGYPEVSERTRERVIEAAKEVGYE
FT                   PNVTARRLARGAVDAIGIVHPTGAGHLDDPRFLEVVDGLTERFSKAGIDLLIASARQKE
FT                   EVATYKRLLQGRRVDGFIVHHTRRVDPRLDYLQECGAPFVAYGRTDTPDSYAWFDFDNA
FT                   LGSSLAVRRLQEFGHRRIAYMHAPLELHFAYQRYQGYLDAMHAAGLPVDPGLVVPAGFG
FT                   RRGGYEAMKTLLDRAEGPTAVIVDNNLCGVGVLRCALDAGLKIGRQLSLIVYDGVPVDS
FT                   VVTSVQVTSIEQPTSYAVGVQLAELMIGVLAGQPVQELQTLWSPRIAAGSSDGPISEH"
FT   sig_peptide     229582..229644
FT                   /locus_tag="Pnap_0224"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.430 at
FT                   residue 21"
FT   gene            complement(230702..231652)
FT                   /locus_tag="Pnap_0225"
FT   CDS_pept        complement(230702..231652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0225"
FT                   /product="raffinose porin"
FT                   /note="KEGG: hch:HCH_06066 hypothetical protein; TC 1.B.15"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35550"
FT                   /db_xref="InterPro:IPR016963"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS2"
FT                   /protein_id="ABM35550.1"
FT                   /translation="MNNLSKTAIALAVTLVTASAAHAAEFNANLELDSTYLNNNRGLSQ
FT                   SGRVEVNAVGKVGSNYFVAGRASLLAKKDGAAATDDMWVQLGSSTADLKLGRFEAADLF
FT                   RLPRDVLVLYATGDGVSSVYRANVLRGRAGSEVFQAAGTVNLGSGLSFELGAIETRATV
FT                   GTLPGAAYVAPKGLRPVLSYEQGPWLLRAGLESIKYNVGGKTRTGFGFTGSYNFSDFTL
FT                   VGNAAANKDASGNKQTSYALIGDTKFGLGGGLIFGNTKLPAGSYKVTTAYAAYTFPLFD
FT                   IKGATVTPAVSFSKAGGVNRSNDETGVRVRFNYNF"
FT   sig_peptide     complement(231581..231652)
FT                   /locus_tag="Pnap_0225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            231975..233042
FT                   /locus_tag="Pnap_0226"
FT   CDS_pept        231975..233042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0226"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein, LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: ccr:CC1137
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35551"
FT                   /db_xref="GOA:A1VIS3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS3"
FT                   /protein_id="ABM35551.1"
FT                   /translation="MKRTQKTSSRSADDATEKGRPQMADLARLAGVSVATVSRALNGSA
FT                   LISKDTRERIEELARSLNYSINIGAKNLRLKQNRTIAVVIPYDRVSRQHISDPFFLAMV
FT                   GSLADAITERGFDMLLSRVDAESLDSAADLYNSGKAIGIILIGQWRHHDQLNQMAAKRM
FT                   PIVVWGTQIPQQLYCTVGGDNMAGGAMATRHLLERGYRRIVFIGDPQLAEVTYRHQGYV
FT                   EALAAYGLQPDPQLLVCVPFDANEARAGINRLCEQGVSFDAVFACSDVMASAASQVLHL
FT                   HGRTVPDAVGVVGYDDIEWASHCNPPLTTVRQPIGAAGAELVDALLCVIDGVVVVPRVL
FT                   PVELVVRSSTRPDPG"
FT   gene            233340..234614
FT                   /locus_tag="Pnap_0227"
FT   CDS_pept        233340..234614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0227"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: atc:AGR_pAT_379 putative sugar transport sugar
FT                   binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35552"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS4"
FT                   /protein_id="ABM35552.1"
FT                   /translation="MKQKYSGFMAALTATLATAMPVQAQTMVTMWVHAGPGPEAVAYSA
FT                   ATDAFNAQNKDIKLDLVKLPEGSYSNQVSAAALARKLPCLLDFDGPNVYNYAWTKKIIP
FT                   LDTFPELVAVKADLLPSLLRQGTYGGKLYSLGQFDSGLGIWGNKKLLEKAGVRIPGSVL
FT                   EAWTLAEFEDALKKLKSSGVAAPLDMKFNYGVGEWFTYGFSPIVQSFGADLIDRKTFKS
FT                   SKGVINGDAAVKALTTLQGWVKAGYVNPATKDDGDFIKGKAALSYVGHWTFKDYKKALG
FT                   DDLVLIPMPAFGAKPVTGAGSWNFGISADCKDPKAAAKVLAHLMSTPEILRVTEANGAM
FT                   PGTNSALAQSRDYGVKGGLNIYVQQVRQGVALVRPETPAYPAISTAFAEALNNIVAGAD
FT                   VQKELDRASKKIDQNIEDNKGYPIK"
FT   sig_peptide     233340..233414
FT                   /locus_tag="Pnap_0227"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            234667..235974
FT                   /locus_tag="Pnap_0228"
FT   CDS_pept        234667..235974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0228"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: atc:AGR_pAT_379 putative sugar transport sugar
FT                   binding protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35553"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS5"
FT                   /protein_id="ABM35553.1"
FT                   /translation="MKNPLELTAGVRAQRACMAFLAFGLACSLPAAAQTLDVWVHAGLG
FT                   PERDAYTASIKAFNEAGRNLGGKAQAVLVPVPEVGYNEAVAKAAADGRLPCVLEFDGPN
FT                   VAAYAAAGHLLPLEKVQSLARIRNSMLASLVRQGTVNGRLYSVAQYDSGMALWGNRNML
FT                   NAAGVRIPARAGDGWTLTEFEDVLKRLKNAGVPSPLDMKFNYGVGEWFTYGFAPIVQGF
FT                   GGDLIERGSMRSAQGVLNGPGAVKAMSALQSWIKAGYVDVMPKDDRAFIEGRSALSWVG
FT                   HWVYKDYKQALGDNLVLMPLPRFGVRPVVGSGSWNFGIAASCKEPQLAIRFIEHLMSSA
FT                   EVLRVTDVNGAVPGTGVAMAFSRHYGPTGELRLYADQLMSGQAQVRPASPDYPAITAEF
FT                   SNAVNRIARGADPQQTLNQAVINIDRKIEKARAARP"
FT   sig_peptide     234667..234768
FT                   /locus_tag="Pnap_0228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            235990..236928
FT                   /locus_tag="Pnap_0229"
FT   CDS_pept        235990..236928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0229"
FT                   /product="carbohydrate ABC transporter membrane protein 1,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_PF00048 probable
FT                   sucrose ABC transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35554"
FT                   /db_xref="GOA:A1VIS6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS6"
FT                   /protein_id="ABM35554.1"
FT                   /translation="MTFIDRQVSVKPPRFTPYQLTPWFFAAPALVLLFVFLILPFALAF
FT                   VFSFTDQRLIGNDELGTSFVGVRNYTRLFEDDSFWAALRNNFFFVCVVAPLQSLSALGL
FT                   ALLVNQALAGTRFFRTIYFMPVATTMAVVAVVWSLLYSPDAGVINRLVGLLSFGAVGPQ
FT                   DWLRDPALVMPAVMVLSIWQGVGFQMLVFLAGLQSISGDLYEAAKLDGATPWKQFRYIT
FT                   LPMLKNTTIFVLVTTTIQAFQLFTQVQIIQASGASAPVDSFRTMVMLMVHEGFGNGKIG
FT                   YASGVSVVFFVIVLTVSLVQRIVLREERAVQ"
FT   sig_peptide     235990..236124
FT                   /locus_tag="Pnap_0229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.765 at
FT                   residue 45"
FT   gene            236925..237821
FT                   /locus_tag="Pnap_0230"
FT   CDS_pept        236925..237821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0230"
FT                   /product="carbohydrate ABC transporter membrane protein 2,
FT                   CUT1 family"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_pAT_376 sugar ABC
FT                   transporter, permease protein; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35555"
FT                   /db_xref="GOA:A1VIS7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS7"
FT                   /protein_id="ABM35555.1"
FT                   /translation="MNTTRNPSQKRGAFLAKVAQYALHALLVAFFLLPLVFMFVSAFKG
FT                   DELQLLGDMGSLMAFVPHGDLSLQNFHDVFDRSPFKLAFFNSVLTVSLTVALGLIVNSM
FT                   LAYALARFQFRGRDTLLAMVVALIIIPFEAVAVPLLLLVNELPWFNGHSVVTGWLDSYH
FT                   VQVIPFIANAFSVYLFYQFFIALPKDLEEAALMDGASRWRIYWSIVMPLSKPVIATVTV
FT                   LQFLARWGDLLWPVMVVRGDTFATLPLAMQTFFGQFPRQWGDVMAFAAMATLPTLLLFI
FT                   VFQRWFVKSAISSGIKG"
FT   sig_peptide     236925..237059
FT                   /locus_tag="Pnap_0230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.866) with cleavage site probability 0.606 at
FT                   residue 45"
FT   gene            237855..238946
FT                   /locus_tag="Pnap_0231"
FT   CDS_pept        237855..238946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0231"
FT                   /product="carbohydrate ABC transporter ATP-binding protein,
FT                   CUT1 family"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: hch:HCH_06906
FT                   ABC-type sugar transport system, ATPase components; TC
FT                   3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35556"
FT                   /db_xref="GOA:A1VIS8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS8"
FT                   /protein_id="ABM35556.1"
FT                   /translation="MASVTLRGIRKRYGGTVDVINGIDMEVRDGEFMVFVGPSGCGKST
FT                   MMRMIAGLEDISEGELRIGNRVANDLPPPHRGVAMVFQSYALYPHMTVAENMGFSLKMA
FT                   GLSKNQIREQVGRAAEILQITHLLDRTPKALSGGQRQRVAIGRAIVRKPEVFLFDEPLS
FT                   NLDAGLRVQMRVELTKLHKELGSTMIYVTHDQTEAMTMGDRIAVFNRGMVEQVGAPMEL
FT                   YQHPVNSFVAQFLGSPRMNLLPATIGRRGNEHILQVPGLGELPVSVPGSLDVSRCAQIG
FT                   MRPESIEVVPAGEAGWAARIDFVERLGDTTLLYARLPDVSQPLCIKLAVACVPWDSGDA
FT                   ISLRAVRGALHLFDGTGACIGIL"
FT   gene            238956..240437
FT                   /locus_tag="Pnap_0232"
FT   CDS_pept        238956..240437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0232"
FT                   /product="alpha amylase, catalytic region"
FT                   /note="PFAM: alpha amylase, catalytic region; SMART: alpha
FT                   amylase, catalytic sub domain; KEGG: atc:AGR_pTi_251
FT                   sucrose phosphorylase SplA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35557"
FT                   /db_xref="GOA:A1VIS9"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIS9"
FT                   /protein_id="ABM35557.1"
FT                   /translation="MKNEVQLITYADRLSGGTLQDLRALLNGPLAGVFGAVHILPFFYS
FT                   IHGADAGFDPIDHTRVDPALGDWSDIKALAQDMDVMADVIVNHMSSDSPQFIDYSKRGA
FT                   ASPYNGLFLTFDAVFPEGATEEDLISVYRPRPGLPFTCMTLANGEKKILWTTFTPKQLD
FT                   IDVQHPQGRSYLESILQALASSGVKMIRLDAVGYAIKKQGDSCFLMPETFDFIDEFAAL
FT                   CRSVGLEVLVEVHSYYRKQIEIAKRVDWVYDFALPPLVLHAFFFKTGKHLKQWIAQRPT
FT                   NALTVLDTHDGIGIIDIGADPSDRVNRPGLVPPQELDRLVEIIHINSGGQSREATGAAA
FT                   SNLDLYQVNCTFYDAMGRDDTAYLLARAIQFFMPGIPQVYYVGLLAGRNDMDLLERTRV
FT                   GRDINRHRYASAEVDSALGRPVVQQLLELIRLRNAHPAFDGAFSVEPTGDSCLHMRWIN
FT                   GPVVAELLVDFTDLRHELLFTDEGGTRRIAFAKAF"
FT   gene            complement(240723..241160)
FT                   /locus_tag="Pnap_0233"
FT   CDS_pept        complement(240723..241160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0233"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rfr:Rfer_2826 UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35558"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT0"
FT                   /protein_id="ABM35558.1"
FT                   /translation="MYQRILLAYDGSAPGQQALLDCHEIAQWSRSELTLIAVMQLPLST
FT                   LGLDGGVYDETLQQEEKDRYQSILNTGLRQLTDAGVSAHGEVVIGDAVSEITRCARRIG
FT                   ADLIVVGHKHLDGWAARWWRGSVSKALIEQSPCSVLVVITH"
FT   gene            complement(241187..241393)
FT                   /locus_tag="Pnap_0234"
FT   CDS_pept        complement(241187..241393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0234"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   pol:Bpro_0507 protein of unknown function DUF1458"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35559"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT1"
FT                   /protein_id="ABM35559.1"
FT                   /translation="MNSHVYKQLELTGSSTVGIEDAVSTAIAKAHETVRNIQWFSITET
FT                   RGHVVDGKVAHWQVSLKIGFTLE"
FT   gene            241592..242113
FT                   /locus_tag="Pnap_0235"
FT   CDS_pept        241592..242113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35560"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT2"
FT                   /protein_id="ABM35560.1"
FT                   /translation="MSRFLSFLTVLLALAACTPAFNWRDVHPEGTRLNLLLPCKPDTAH
FT                   KVVPLGGQPTTLAMLGCDAGGATFAVAVADVGDAARAASVLALWQELTLANMKAAPGSR
FT                   QPFALAIPGASAGVPVTRVQAQGQRADGTAVSGQAAYFAQGSQVFQVVMYAPQIAPEVA
FT                   DTFFSSLKFE"
FT   sig_peptide     241592..241660
FT                   /locus_tag="Pnap_0235"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.900) with cleavage site probability 0.794 at
FT                   residue 23"
FT   gene            242106..243377
FT                   /locus_tag="Pnap_0236"
FT   CDS_pept        242106..243377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0236"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0296 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35561"
FT                   /db_xref="GOA:A1VIT3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT3"
FT                   /protein_id="ABM35561.1"
FT                   /translation="MNEAVTPKDAIALPDRLNAKSATLVFLAFAAAYFCSTLLRAITAT
FT                   LAPVLTQEFSLQAQGLGLLAGGYFLGFAAVQLPLGHWLDRHGPKRVILWFLSLAVLGCL
FT                   AFSAAGSFTGLLMARVLLGMGVGACLMAALTGYRRWFDTPALLRANSWMLMTGSLGMLA
FT                   STLPVQWLMPLIGWRALFWCLAALVVLSMAAIAWLVPRWRVAPAASPSTPALSHEAGYA
FT                   AIWRSRYFRKMAPLAFFNYGGMVAIQTLWAGPWMVRVAGDTPLESATGLFWINASMLVT
FT                   FWSWGLVNPYLARNGWPATRLIAWGVPLSLAVLAGNILAGSATGWPGWALFCVTSSVMG
FT                   LAQPAVGMSFRAALAGRALSAFNLVIFAGVFVAQWGLGLLVDAFSALGLAQGASFQAAM
FT                   TVFLCCSIAAYGYFISVNADNSVQ"
FT   gene            243374..243817
FT                   /locus_tag="Pnap_0237"
FT   CDS_pept        243374..243817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0237"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: pol:Bpro_0297 PTS system fructose subfamily IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35562"
FT                   /db_xref="GOA:A1VIT4"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT4"
FT                   /protein_id="ABM35562.1"
FT                   /translation="MNGILIIAHAPLASAFLQCVLHVFPDHPASVAALDVQPSMPPEET
FT                   LVQAGILLKQLNTPQTLVLTDIFGATPCNVAQQLADGVATKLVTGMNLPMLLRAVSYRN
FT                   ESLDVLVARALAGASQGVMQVAVTAPQNQIRRENDQDPDHHQQ"
FT   gene            243786..244055
FT                   /locus_tag="Pnap_0238"
FT   CDS_pept        243786..244055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0238"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphocarrier HPr protein; KEGG: pol:Bpro_0298 HPrNtr"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35563"
FT                   /db_xref="GOA:A1VIT5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT5"
FT                   /protein_id="ABM35563.1"
FT                   /translation="MIKTRTTISNKLGLHARASAKFTKLAGSFRSEVWMSKGERRVNAK
FT                   SIMGVMMLAAGMGSSVEIETDGADEQAAMDALLALVADKFGEGE"
FT   gene            244239..246014
FT                   /locus_tag="Pnap_0239"
FT   CDS_pept        244239..246014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0239"
FT                   /product="phosphoenolpyruvate--protein phosphotransferase"
FT                   /EC_number="2.7.3.9"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing enzyme;
FT                   PEP-utilising enzyme, mobile region; PEP-utilising enzyme
FT                   domain protein; KEGG: pol:Bpro_0299
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35564"
FT                   /db_xref="GOA:A1VIT6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT6"
FT                   /protein_id="ABM35564.1"
FT                   /translation="MTFSVHGLAVSRGVAIGRAVLVASSRADVSHYFVDPATTDDEIAR
FT                   VRLSRNAVMEEITRLQHDLPRDAPHEIAALLDVHLMLLQDEMLIGGVKHWITERYYNAE
FT                   WALTTQYELIARQFDEMEDPYLRERKADLEQVVERVLCHMKGAASPLQAARQGAVRAGS
FT                   SRKQSQQDLLLDDTLDVPLVLVAHDISPADMLQFKQSLFAGFATDVGGKTSHTAIVARS
FT                   MDIPAVVGARSASQLIKQDDWVIIDGDAGVLIVDPSPIILAEYGFKQRQGELERLRLNR
FT                   LRHTPALTMDRQRIELLANIEMPDDTLGAVEAGAVGVGLFRSEFLFMGRAGKLPDENEQ
FT                   YLAYRKAIEGMQGMPVTIRTVDIGSDKPLDRPTAKAQDGHLNPALGLRAIRWSLADPPM
FT                   FLTQLRAILRAAAHGQVNLLVPMLAHASEIRQTLDLINQARAQLDARGFVYGPVRLGAM
FT                   IEVPAAALTVPVFLKYFDFLSIGTNDLTQYTLAIDRSDESVAHLYDPCHPAVLRLIADT
FT                   IAECNAQKKGVSVCGEMAGDVSMTRLLLGLGLRSFSMHPSQILAVKQQILRADTGKLKL
FT                   WAQEVLQSENPAALL"
FT   gene            complement(246138..246980)
FT                   /locus_tag="Pnap_0240"
FT   CDS_pept        complement(246138..246980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0240"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_0311 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35565"
FT                   /db_xref="GOA:A1VIT7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT7"
FT                   /protein_id="ABM35565.1"
FT                   /translation="MPANLYALGAIALWITLAALGVSLRHIPPFLLTGIALLMGSLLAL
FT                   PAVLQDRKAWSVPAKTLALGVYGLFGFHFLLFIALRHAPPVEANLVNYLWPLFMVVLAP
FT                   LFLAGLKLRAVHVAAALLGFAGAAIAILSASSNATGAVGWSWGFLPALASAFIWASYSL
FT                   LTQRVKPFPTAAIGLFGLVSGLLSLLCHWALEPQAVLSARDWLLLAVMGWGPLGTAFFL
FT                   WDKALKLGDARQIGILSYITPLGSTALLMLVSGRPLSWSIGLAAVMIIGAAVLGTRVK"
FT   sig_peptide     complement(246915..246980)
FT                   /locus_tag="Pnap_0240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.814 at
FT                   residue 22"
FT   gene            247236..247424
FT                   /locus_tag="Pnap_0241"
FT   CDS_pept        247236..247424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35566"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIT8"
FT                   /protein_id="ABM35566.1"
FT                   /translation="MKILAAIVLVLTSLTGCVAYPVPYDNGPPQGHYGGPHRGQGDRDG
FT                   DGVRNRDDRRPNNPYRY"
FT   sig_peptide     247236..247295
FT                   /locus_tag="Pnap_0241"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.981 at
FT                   residue 20"
FT   gene            complement(247458..248456)
FT                   /locus_tag="Pnap_0242"
FT   CDS_pept        complement(247458..248456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0242"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: pol:Bpro_0313 lipoic acid synthetase; TIGRFAM:
FT                   lipoic acid synthetase; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35567"
FT                   /db_xref="GOA:A1VIT9"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIT9"
FT                   /protein_id="ABM35567.1"
FT                   /translation="MSTPEVVREVQSLETYNPLAKQKAAAKLSRIPVKVVQGEILKKPD
FT                   WIRVKAGSPSTRFYEIKQILRENKLNTVCEEASCPNIGECFGKGTATFMIMGDKCTRRC
FT                   PFCDVGHGRPDPLDADEPLNLARTIAALKLKYVVITSVDRDDLRDGGSGHFVECIQRIR
FT                   ELSPGTTIEVLVPDFRGRDDRALEILKTSPPDVMNHNLETAPRLYKEARPGSDYQFSLN
FT                   LLKKFKALHPDVPTKSGIMVGLGETDEEILQVMQDMRDHGINMLTIGQYLAPSTSHLPV
FT                   RRYVHPDTFKMFEEKAYEMGFSHAAVGAMVRSSYHADQQAHAAGVSDKPAE"
FT   gene            complement(248496..249170)
FT                   /locus_tag="Pnap_0243"
FT   CDS_pept        complement(248496..249170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0243"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: pol:Bpro_0314
FT                   lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35568"
FT                   /db_xref="GOA:A1VIU0"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU0"
FT                   /protein_id="ABM35568.1"
FT                   /translation="MTIDTRQLGRVDYLPTYQAMQDFTAARNEATPDALWICEHPAVYT
FT                   QGLAGKIDHLLNPGEIPVVQTNRGGQVTFHGPGQVVVYPLIDLKRAGYFVKEYVYRIEE
FT                   SVIRTLAHFGVTGHRVAGSPGIYVRMDDPFSHAALSGPVHPSDPFRGLGKIAALGIKVS
FT                   RHCTYHGVALNVAMDLEPFSRINPCGYAGLKTTDLSTIGVSASWQEAASVLGQKLATYL
FT                   AP"
FT   gene            complement(249304..250065)
FT                   /locus_tag="Pnap_0244"
FT   CDS_pept        complement(249304..250065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0244"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: xcv:XCVb0013 putative metal-binding
FT                   protein, sec-C motif"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35569"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU1"
FT                   /protein_id="ABM35569.1"
FT                   /translation="MNDFFDYNLRHPLPQQSPRLTEADHDELFKLFGDASLPAATMPAE
FT                   MADGYLTACVVGPVPVPAHEWMEAIFGQPTLPVCADPERQHRLLQLLLQRHRDIAVATA
FT                   VALHDLTPDQLFVPLTSEVDAGERITPYQIDENGNRQGDWDCKDWAEGFRLAMLDHPQW
FT                   DGLTNNPKNFDLLAPIALFAEGYNPDQPELQIDEKANLPALLSLSIYNIRSFWKLHKQT
FT                   HAPALREARKVGRNDPCPCGSGKKYKKCCGA"
FT   gene            complement(250139..250450)
FT                   /locus_tag="Pnap_0245"
FT   CDS_pept        complement(250139..250450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0245"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   pol:Bpro_0316 protein of unknown function DUF493"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35570"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU2"
FT                   /protein_id="ABM35570.1"
FT                   /translation="MSADNDNTPPNPPEAEARKDSLIEYPSLFPIKVMGIKAEGYVHAI
FT                   THIAHQFDPTFDAATIELRESKGGKYLGVTITVTATSREQLDELYRTLSTHPMVKVVL"
FT   gene            complement(250453..251364)
FT                   /locus_tag="Pnap_0246"
FT   CDS_pept        complement(250453..251364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0246"
FT                   /product="branched chain amino acid:
FT                   2-keto-4-methylthiobutyrate aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /note="PFAM: aminotransferase, class IV; KEGG:
FT                   pol:Bpro_0317 aminotransferase, class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35571"
FT                   /db_xref="GOA:A1VIU3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU3"
FT                   /protein_id="ABM35571.1"
FT                   /translation="MQSTSMTTSAASALPDTPCYLNGDFSTLRDAKISVLDRGFIFGDA
FT                   VYEVVPAYAGKLFRFEQHMARLDRSLAELRIANPLTHAQWQGITLKLIADHALSTGTET
FT                   QKDNQLIYIQVTRGVAMRDHPMLPGLTPTVFIMVNPMKLPSDQQRAQGVACVSAGDFRW
FT                   EKAHIKSTSLLGAVFSRQISVDAGALETVMFRGDHLSEAAASNVWVVKHGKVMGPPRDH
FT                   LVLEGIRYGLIEEICRAAGIDFELCRISRAEVLAADELLLSSATKEILPITLLDGQPVG
FT                   NGQPGPIYAKLYAAYQQAKEES"
FT   gene            complement(251459..251902)
FT                   /locus_tag="Pnap_0247"
FT   CDS_pept        complement(251459..251902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35572"
FT                   /db_xref="GOA:A1VIU4"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU4"
FT                   /protein_id="ABM35572.1"
FT                   /translation="MPALMKFLHVLAAIAWLGGISFMLFALRPAAAELLAAQRLPLIAQ
FT                   TLKRFFSLAWAAIIVLLLTGLAMLLGVGMKNAPAGWHAMLGIGLVMFALFGHLYFGPFR
FT                   RLQQAVSAANWPEGGRRVGQIATLATVNLGLGVLAIAAIFFMA"
FT   sig_peptide     complement(251807..251902)
FT                   /locus_tag="Pnap_0247"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.557 at
FT                   residue 32"
FT   gene            252163..252714
FT                   /locus_tag="Pnap_0248"
FT   CDS_pept        252163..252714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0248"
FT                   /product="putative ATP synthase protein I"
FT                   /note="KEGG: rfr:Rfer_0113 putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35573"
FT                   /db_xref="GOA:A1VIU5"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU5"
FT                   /protein_id="ABM35573.1"
FT                   /translation="MADGPAGYPEGAKASARKSAAVATGSGSEEVTDEAQDEGFKPLTR
FT                   EEAKKIRELNPPASLWVVLAGQAGVGILVAVLAWVLTGQARMGWSAGYGALAVVIPAAL
FT                   FARGLSRQKSATHGNAALVGFFIWEMVKIALTVAMLFAAPRLVEGLNWLALLAGFVVTM
FT                   KVYWVAMWLRPVRKKSINNF"
FT   gene            252735..253628
FT                   /locus_tag="Pnap_0249"
FT   CDS_pept        252735..253628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0249"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+-transporting two-sector ATPase, A subunit; KEGG:
FT                   rfr:Rfer_0112 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35574"
FT                   /db_xref="GOA:A1VIU6"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU6"
FT                   /protein_id="ABM35574.1"
FT                   /translation="MAAAEHAGTTGPTSGEYIQHHLHHLQKNFSFENVEQHSIVDFSLF
FT                   NFDSLLYSVLLGVIGCFFLWRAASKATSGVPGRFQAAVEILSELVDNQAKGVIHNAKSR
FT                   KLVSPLALTVFVWIFLMNAMDMLPVDAIPSLWHDAGPALGFNNFMRVVPTADVSTTLGL
FT                   SSSVLLVCLVYNIKIKGLGGWAHELIAAPFGDHWFLYPINFLMQMIEFAAKTMSHGMRL
FT                   FGNMFAGELVFMLIALMGGTWAWQFNPLTGMFWLGFGHVVAGTVWSIFHILVITLQAFI
FT                   FMMLTLIYVGQAHDSH"
FT   gene            253702..253950
FT                   /locus_tag="Pnap_0250"
FT   CDS_pept        253702..253950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0250"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+-transporting two-sector ATPase, C subunit; KEGG:
FT                   rfr:Rfer_0111 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35575"
FT                   /db_xref="GOA:A1VIU7"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIU7"
FT                   /protein_id="ABM35575.1"
FT                   /translation="MENILGLVALACGLIVGLGAIGASIGIALMGGKFLEASARQPELM
FT                   NDLQTKMFILAGLIDAAFLIGVAIALLFAFANPFVLR"
FT   sig_peptide     253702..253770
FT                   /locus_tag="Pnap_0250"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.812 at
FT                   residue 23"
FT   gene            253991..254461
FT                   /locus_tag="Pnap_0251"
FT   CDS_pept        253991..254461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0251"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+-transporting two-sector ATPase, B/B' subunit; KEGG:
FT                   rfr:Rfer_0110 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35576"
FT                   /db_xref="GOA:A1VIU8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU8"
FT                   /protein_id="ABM35576.1"
FT                   /translation="MNINSTLFLQAVVFAILVWFTMKFVWPPITKALDERAQKIADGLA
FT                   AADKAKSELSSANKRVEAELATSRTETATRLADADRRGQGIIEDAKARAVEEANKIIAA
FT                   AQAEAAQQSVKAREALREQVALLAVKGAEQILRKEVNAGVHADLLSRLKTEL"
FT   gene            254483..255022
FT                   /locus_tag="Pnap_0252"
FT   CDS_pept        254483..255022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0252"
FT                   /product="ATP synthase F1 subcomplex delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta (OSCP) subunit;
FT                   KEGG: pol:Bpro_0324 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35577"
FT                   /db_xref="GOA:A1VIU9"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIU9"
FT                   /protein_id="ABM35577.1"
FT                   /translation="MAELATIARPYADALYKAQGSDLATTALWVDKLAAVAGNAQLLQF
FT                   ADSPKVSVDQVFDVVAGVASNANDPLPEAARNFLRLVIENGRLSALPEIASQFRSLKNA
FT                   AGGMTDAVVFSAFPMDEQALNDIAAVLEKRFGRKLGIKVELDPSLIGGIRAVVGDEVLD
FT                   TSVKARLEQMKMALIA"
FT   gene            255082..256635
FT                   /locus_tag="Pnap_0253"
FT   CDS_pept        255082..256635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0253"
FT                   /product="ATP synthase F1 subcomplex alpha subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0325 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35578"
FT                   /db_xref="GOA:A1VIV0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIV0"
FT                   /protein_id="ABM35578.1"
FT                   /translation="MQLNPAEISELIKSRIEGLAASSDIRNQGTVVSVADGIVRIHGLS
FT                   DVMQGEMLEFPATADGTPTYGLALNLERDSVGSVILGEYEHIAEGDTVKCTGRILEVPI
FT                   GPELLGRVVNALGQPIDGKGPINAKLSDVIEKVAPGVIARKSVDQPLQTGLKSIDSMVP
FT                   IGRGQRELIIGDRQTGKTAVAIDAIINQKGKGVSCVYVAIGQKASSIKNVVRSLEQAGA
FT                   MDYTIVVAASASESAAMQYVSAYSGCTMGEYFRDRGEDALIVYDDLSKQAVAYRQVSLL
FT                   LRRPPGREAYPGDVFYLHSRLLERAARVNEKYVEDFTKGAVKGKTGSLTALPIIETQAG
FT                   DVSAFVPTNVISITDGQIFLETSLFNAGIRPAINAGISVSRVGGAAQTKLIKNLSGGIR
FT                   TDLAQYRELAAFAQFASDLDEATRKQLDRGARVTELLKQSQYSPLSVSTMGATLFAVNK
FT                   GFMDDVDVKKVLAFESGLHAWLKDKHAPLMAKLEANKAMDKDAEAELTTAVTAFKKSFA
FT                   "
FT   gene            256691..257557
FT                   /locus_tag="Pnap_0254"
FT   CDS_pept        256691..257557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0254"
FT                   /product="ATP synthase F1 subcomplex gamma subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0326 ATP synthase F1, gamma subunit;
FT                   TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+-transporting two-sector ATPase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35579"
FT                   /db_xref="GOA:A1VIV1"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIV1"
FT                   /protein_id="ABM35579.1"
FT                   /translation="MAAGKEIRGKIKSVENTRKITKAMEMVAASKMRKAQERMRAARPY
FT                   SDKIRNIAAHLSQANPEYTHPFMESNDAKTTGFIVVTTDKGLCGGLNTNVLRLLTTKLK
FT                   DMQAAGEDAQAVAIGNKGLGFLNRIGVKVAAHATQLGDKPHLDKLIGPVKVLLDAYSEG
FT                   KIKAVYLCYTRFINTMKQESVVEQLLPLTADRMQPDKTEHSWDYIYEPDAQTVIDELLV
FT                   RYVEALVFQAVAENMASEQSARMVAMKSATDNAGSVIGELKLIYNKTRQAAITKELSEI
FT                   VAGAAAV"
FT   gene            257597..259021
FT                   /locus_tag="Pnap_0255"
FT   CDS_pept        257597..259021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0255"
FT                   /product="ATP synthase F1 subcomplex beta subunit"
FT                   /EC_number="3.6.3.15"
FT                   /note="KEGG: pol:Bpro_0327 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+-transporting two-sector ATPase, alpha/beta subunit,
FT                   central region; H+-transporting two-sector ATPase,
FT                   alpha/beta subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35580"
FT                   /db_xref="GOA:A1VIV2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIV2"
FT                   /protein_id="ABM35580.1"
FT                   /translation="MAQETLVDTSIQGKIVQCIGAVVDVEFARNQMPKIYDALKMEGSS
FT                   LTLEVQQQLGDGIVRTIALGTSDGLRRGNIVYNTGANITVPVGKATLGRIMDVLGAPID
FT                   ERGPVDQTLTAPIHRKAPAYDELSPSQELLETGIKVIDLVCPFAKGGKVGLFGGAGVGK
FT                   TVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMADSGVVNLDKLEDSKVAMVYG
FT                   QMNEPPGNRLRVALTGLTIAESFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVG
FT                   YQPTLAEEMGRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFAHLDSTVVLSRDI
FT                   ASLGIYPAVDPLDSTSRQLSPAVVGEDHYNTARAVQGTLQRYKELRDIIAILGMDELAP
FT                   EDKLAVARARKIQRFLSQPFHVAEVFTGSPGKYVSLAETIRGFKMIVAGECDHLPEQAF
FT                   YMVGTIDEAFEKAKKM"
FT   gene            259103..259519
FT                   /locus_tag="Pnap_0256"
FT   CDS_pept        259103..259519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0256"
FT                   /product="ATP synthase F1 subcomplex epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+-transporting two-sector ATPase, delta/epsilon subunit;
FT                   KEGG: pol:Bpro_0328 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35581"
FT                   /db_xref="GOA:A1VIV3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIV3"
FT                   /protein_id="ABM35581.1"
FT                   /translation="MNTIHVDVVSAEESIFSGEARFVALPGEAGELGIYPRHTPLITRI
FT                   RPGAVRIEKADGTEEFVFVAGGLLEVQPNCVTVLSDTAIRGKDLDEAKATAAKALAEEA
FT                   LKNAKNDIDIAMAQSELAVMAAQIAALRKYRQKK"
FT   gene            complement(259641..260171)
FT                   /locus_tag="Pnap_0257"
FT   CDS_pept        complement(259641..260171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0257"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0329 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35582"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV4"
FT                   /protein_id="ABM35582.1"
FT                   /translation="MNKLTLLLKHLWLDAADSRRAIPSDLAHRLAERVAASEQRHSGQI
FT                   RICVEAALPASYLWRMDDKNTLGDLIRQRAVMMFSKLRVWDTEHNNGVLIYVLLAEHAI
FT                   EIVADRGLMRHVDATHWQSVVAHMASAFREKRYEDGLTQALEEASTLLVAHFARTDASA
FT                   RHPNELPDTPLLQ"
FT   gene            complement(260180..261112)
FT                   /locus_tag="Pnap_0258"
FT   CDS_pept        complement(260180..261112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0258"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   pol:Bpro_0330 protein of unknown function DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35583"
FT                   /db_xref="GOA:A1VIV5"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV5"
FT                   /protein_id="ABM35583.1"
FT                   /translation="MTLRIFLQALLLAVWLPLASVAAWAQGVQPVPPLTAHVMDSTGTL
FT                   TAAQKAALEARLTAFEQSRGAQVVVLMVPTTQPEDIAAYAQRIGDSWKIGRKSIGDGLL
FT                   LVVAKNDRAVRIETTKALEGAIPDLAASQIIETAITPRFKQGDFAGGLDAGASQIMARI
FT                   TGENLPAPQQGQTHRGSGGGFDWTTLAVFLFFAVPIGGRVLSSVLGRKLGSVATGGAVG
FT                   VLAWVFTSSLVIGAIAAVVGMVFALISGISGLGGMGRGGRSSGWGGPGGFGGGGFGGGS
FT                   FGGSRGGGGGGFSSGGGGNFGGGGASGNW"
FT   sig_peptide     complement(261035..261112)
FT                   /locus_tag="Pnap_0258"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 26"
FT   gene            complement(261125..261724)
FT                   /locus_tag="Pnap_0259"
FT   CDS_pept        complement(261125..261724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0259"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: pol:Bpro_0331 LemA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35584"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV6"
FT                   /protein_id="ABM35584.1"
FT                   /translation="MASSLLRLSFIALLGLLLSGCGYNQFQSLDEQTKSAWSEVLNQYQ
FT                   RRADLVPNIVATVKGEAAFEQDTLTKVIEARAKATSIQVTPETLNDPAAFSKFQAAQGE
FT                   LGSALSRLMVVSERYPDLKANQAFRDLRVQLEGTENRITVARNRYIQTVQEYNVLARSF
FT                   PNNLTAMIFGYKVKPNFAVANEAQISVPPVVDFNKK"
FT   sig_peptide     complement(261650..261724)
FT                   /locus_tag="Pnap_0259"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.439 at
FT                   residue 25"
FT   gene            261839..262285
FT                   /locus_tag="Pnap_0260"
FT   CDS_pept        261839..262285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35585"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV7"
FT                   /protein_id="ABM35585.1"
FT                   /translation="MRKPQAPPGSPENADATEAAFYDALQSGDIEKLMACWSDEDDIVC
FT                   VHPGGARLLGLAAIRGAFDTMFANGAIRAQPLKVRRLQSLGASMHSLLERIEVLTEDGP
FT                   RHAYVVATNVYHLTAQGWRMVAHHASPGTLPELQEASQTPFTLH"
FT   gene            262290..263309
FT                   /locus_tag="Pnap_0261"
FT   CDS_pept        262290..263309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0261"
FT                   /product="hydrolase of the alpha/beta-hydrolase fold-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_0334 hydrolase of the
FT                   alpha/beta-hydrolase fold-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35586"
FT                   /db_xref="GOA:A1VIV8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV8"
FT                   /protein_id="ABM35586.1"
FT                   /translation="MAMNYGAPWWLPDGNTQTIWAALRARRFMGPPPVFRRERWSTPDD
FT                   DFVDVDWLMPRFESAGLAERGAVREAPSVGVPLLVLFHGLEGSSSSHYAQAFADVAGSR
FT                   GWACAVPHFRGCSGEPNLAPRAYHSGDFAEIDWMLRRFAGLNQGPVVAVGISLGGNALM
FT                   RWAGEMGTQAGQVVTAVAAVCAPLDLTASGQAIGQGFNRQVYTRMFLKSMVPKALQKLA
FT                   QHPGLFDRDTLLAARDLHAFDNVFTGPVHGFKGVDDYWSRASAKPHLGRIAVPALALNA
FT                   LNDPFIPAASLPQSADVSPWVTLWQPAQGGHVGFPASNFPAHVRAMPEAVAGFLAAQL"
FT   gene            263367..263927
FT                   /locus_tag="Pnap_0262"
FT   CDS_pept        263367..263927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35587"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIV9"
FT                   /protein_id="ABM35587.1"
FT                   /translation="MDDIVKQAIAKWPNVPDCYGWLGLDARGNWYMRDDRAQSAGPFAL
FT                   VGDADRHAASKGSLLKHDKLIDFIQRNYESDASGRWFFQNGPQRVYVELEATPFIWRVH
FT                   AAAGFSVTAHTGQPARVQRCVLDEDGRLYLETDLGFGLVHTQDMMYAADAVEQGLWVPQ
FT                   EFPAADLPARFGYVRTPRALQNT"
FT   gene            complement(264032..264913)
FT                   /locus_tag="Pnap_0263"
FT   CDS_pept        complement(264032..264913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0263"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: pol:Bpro_0336
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35588"
FT                   /db_xref="GOA:A1VIW0"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW0"
FT                   /protein_id="ABM35588.1"
FT                   /translation="MSANDHTTAHAEAHTGPIKTPKQLLAAVFFSFVVPVFAIIGLVYY
FT                   VASADKPLAGADDAERAVAERIQKVGMVEIRDANRPLRTGEEVYKGQCIACHGTGAAGS
FT                   PKFGDAAAWAPRISTGYDALLHSALKGKGAMAAQSGGDFQDIEIGRAVVYMTTAAGGKF
FT                   AEPAVPAAGAADAPAADAAAATPAAAPVTAVAATPAAATAPAATAKVAATDTGAGEALY
FT                   KQACFACHGAGVAGAPKFGDKAAWAPRIQTGVDALTASAIKGKGAMPPKGGSAASDADI
FT                   HLAVVYMVSAVK"
FT   gene            265115..265190
FT                   /locus_tag="Pnap_R0002"
FT                   /note="tRNA-Arg1"
FT   tRNA            265115..265190
FT                   /locus_tag="Pnap_R0002"
FT                   /product="tRNA-Arg"
FT   gene            complement(265468..265785)
FT                   /locus_tag="Pnap_0264"
FT   CDS_pept        complement(265468..265785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0264"
FT                   /product="High potential iron-sulfur protein"
FT                   /note="PFAM: High potential iron-sulfur protein; KEGG:
FT                   bxe:Bxe_A4333 putative high potential iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35589"
FT                   /db_xref="GOA:A1VIW1"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW1"
FT                   /protein_id="ABM35589.1"
FT                   /translation="MKSNRRTFVIQSVMSAGILATTRLAQAQAPAPLVQDSDPQAVALG
FT                   YKSDATKADKAKYPKYAAGQQCANCALYQGKPTDAAGACPLFAGKQVGAKAWCSAWAKK
FT                   A"
FT   sig_peptide     complement(265702..265785)
FT                   /locus_tag="Pnap_0264"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 28"
FT   gene            266396..267367
FT                   /locus_tag="Pnap_0265"
FT   CDS_pept        266396..267367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0265"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_0596 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35590"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW2"
FT                   /protein_id="ABM35590.1"
FT                   /translation="MKRHFLRTIPALIALSVSPLFAAAQAAWPAKPITLVSPYAPGGTT
FT                   DLLARLLASKLQGVLGQTVIVENKGGAGGNIGTDYVSKSKPDGYTFLVASSGPLVIAPS
FT                   LYPKLPYQPNLDFTPVAPLASAAFVIAVNPGSGLTSVKDIIAKAKAGNLSFASAGSGTP
FT                   QHIIGEMFNVQAGVKIQHIPYKGSGPAMNDLVGGQVPMTFENPVPIMPQVKAGKLKVLA
FT                   VTSAKRSAAFPDIPTVSELGLKGFDAQPWYGVLGPAGVPAEVVERMNKEIRTILASTDV
FT                   KARLFALGAEPMDMTPSAFKSFIAADTKKWTAVVKASGATVD"
FT   sig_peptide     266396..266476
FT                   /locus_tag="Pnap_0265"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.829 at
FT                   residue 27"
FT   gene            267397..267774
FT                   /locus_tag="Pnap_0266"
FT   CDS_pept        267397..267774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3606 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35591"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW3"
FT                   /protein_id="ABM35591.1"
FT                   /translation="MATDLLDAQTLKQACSGSPAGTCVCSLGACRNWESFTEDRWPAKS
FT                   VRRLGTLRDPAIDEPTVEEFHPDGTRYDSADAPLAVAFFPCNRSDAYACGQCGRTLLRY
FT                   TEYGGYYVDHRVREVLPELIV"
FT   gene            complement(267782..269473)
FT                   /locus_tag="Pnap_0267"
FT   CDS_pept        complement(267782..269473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0267"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hch:HCH_04499 long-chain acyl-CoA synthetases
FT                   (AMP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35592"
FT                   /db_xref="GOA:A1VIW4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW4"
FT                   /protein_id="ABM35592.1"
FT                   /translation="MNPVSPDMLALQRLYHWEKAAPHQVTLTQPMGGGVIQDYTWSQVA
FT                   DQVRRMAAHLKAQGWEPGSNVAILSKNCAWWLMSDLAIWMAGHVSVPLYPTLAPDTIAH
FT                   ILTHSEAKACFVGKLDAWENMKPGVPGGLPCISYPLSPPDVLNNHDGWDAICARQAPLQ
FT                   GELVRGAEELATLIYTSGTTGRPKGVMQSFGSFAWALDAGITRIDLTGQDRMLSYLPLA
FT                   HVVERVLVEHGWLRTGMRLYFAESIDTFPADLQRARPTIFFSVPRLWVKFQQGVHHKIP
FT                   PARLQLLLSIPVIGALVRRKVLKALGLDQCRIAAGGAAPMPLALLSWYRKLGLPINEGY
FT                   GLTENLAVSHLTVPGTNQEGTVGPAYPGVEDRIDPETGEIQMRSPALMMGYYKDPVQSR
FT                   AAFTEDGWLRTGDKGQLDARGNLHITGRVKDLFKTSKGKYIAPAPIEDKLVMHEAVEAC
FT                   VVTGANLGRPLGIVMLNAEAVARSRDAAARTELEASLSEHLKGVNATLDPHEQLACLVI
FT                   VTTAWTVDNDIITPTFKVKRNRIEDIYSANYERWEASGKKVIWQAS"
FT   gene            269697..270185
FT                   /locus_tag="Pnap_0268"
FT   CDS_pept        269697..270185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0268"
FT                   /product="putative lipoprotein transmembrane"
FT                   /note="KEGG: pol:Bpro_0388 putative lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35593"
FT                   /db_xref="GOA:A1VIW5"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW5"
FT                   /protein_id="ABM35593.1"
FT                   /translation="MKIVKTVSSLAAAALLMAGCAFRPVQPGMSRDQVLASYGTPMRIV
FT                   PVGSGTRLQYSRQPAGQSVVMVDLDAAGKVVAVREVMTPQEFARVEPGKWTREDVEREF
FT                   GPPARVDRVASWPGDIMNYRWRENNIQDMFFWVYLDAGNRVQRTGQGMEIPMRMHFKD"
FT   sig_peptide     269697..269789
FT                   /locus_tag="Pnap_0268"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.601 at
FT                   residue 31"
FT   gene            complement(270195..271421)
FT                   /locus_tag="Pnap_0269"
FT   CDS_pept        complement(270195..271421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0269"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0389 drug resistance transporter Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35594"
FT                   /db_xref="GOA:A1VIW6"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW6"
FT                   /protein_id="ABM35594.1"
FT                   /translation="MNPNADQLWRGPRWTLAALLAVLGMLGPFSIDTYIPAFSGMALSL
FT                   GATPVEMQQTLSAYLFGFAFMNLFHGALADSFGRRPVVLWGIAMFTLASAGCALSQNVG
FT                   LLVLFRAMQGLSTGAGIVVSRAVIRDMFPPAQAQQVMSQVTIYFGVAPALAPIVGGWLF
FT                   VHLGWHSIFWFLTGVGLVLWVTNYRFLPETLQPDARQPFEVRHLMRGYWQLGSSPRFLL
FT                   LALASGVPFNGMFLYVLAAPAFLGEHLALQPTQFFWFFVLTISGIMSGAWLSGRLAGKI
FT                   APKKQIRHGFVIMLVTSVLNLVANLLFTAHASWALLPIAVFAFGWALMVPVVTLLVLDL
FT                   YPERRGMASSLQACIGSTANGLVAGVIAPLVMHSTPALAAVSLGMMSIGLVAWVYLHHH
FT                   WPEIGRAVE"
FT   sig_peptide     complement(271329..271421)
FT                   /locus_tag="Pnap_0269"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.653) with cleavage site probability 0.332 at
FT                   residue 31"
FT   gene            complement(271418..272278)
FT                   /locus_tag="Pnap_0270"
FT   CDS_pept        complement(271418..272278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0270"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: pol:Bpro_0390
FT                   protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35595"
FT                   /db_xref="GOA:A1VIW7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW7"
FT                   /protein_id="ABM35595.1"
FT                   /translation="MQHYPQATLYVVATPIGNLADITLRALHVLQLVDAIACEDKRHTQ
FT                   PLLRQYGIDKPLLAVHQHNEAEAAGLVVERLQRGERVAYVSDAGTPAVSDPGARLVAAV
FT                   RAAGFKVMPLPGASSVTTVLSAAGVTRAEGSADNGSSFVFAGFLPSKAGERDQAIALLR
FT                   TDSRATVILEAPHRIEALARALAVLQGRLITVGRELTKQFEEIATLPAQDFAAWLDAGP
FT                   QRTRGEFALVLHASSPHEGVDDSLRVLQLLLAELPLKTAVKLTADITGASRNELYDTAL
FT                   KLKNE"
FT   gene            272329..272790
FT                   /locus_tag="Pnap_0271"
FT   CDS_pept        272329..272790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0271"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   pol:Bpro_0391 protein of unknown function UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35596"
FT                   /db_xref="GOA:A1VIW8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VIW8"
FT                   /protein_id="ABM35596.1"
FT                   /translation="MWFSRKQAVNVAPKSTAGGAAALPKQVTTKSRGDAAESAARAYLV
FT                   GAGLRWIESNYRTPGRGGGEIDLVMRVPDGTLVFVEVRQRSSASHGGAGASISAVKQRR
FT                   IIFAARHYLMRFASLPPCRFDVVLVHGALSGGESPQATIEWLPAAFDAS"
FT   gene            272903..273502
FT                   /locus_tag="Pnap_0272"
FT   CDS_pept        272903..273502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0272"
FT                   /product="phosphoheptose isomerase"
FT                   /EC_number="5.3.1.-"
FT                   /note="TIGRFAM: phosphoheptose isomerase; KEGG:
FT                   pol:Bpro_0392 phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35597"
FT                   /db_xref="GOA:A1VIW9"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004515"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIW9"
FT                   /protein_id="ABM35597.1"
FT                   /translation="MLEQRIEQQFIDSADLKYQAAQVLSKPIAAAVHAILASVTSGNKV
FT                   LACGNGGSAADAQHFAAEFVGRYERERPELGAIALTTDSSIITAIANDYDFSVIFSKQV
FT                   RALGVAGDVLLAISTSGNSANVLAAVEAAHERDMTVVALTGRGGGKMNQALRETDVHIC
FT                   VPHERTARIQEVHSLVIHCICDGVDTQLLGDQESSA"
FT   gene            273499..274164
FT                   /locus_tag="Pnap_0273"
FT   CDS_pept        273499..274164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0273"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region, bacteria; KEGG:
FT                   pol:Bpro_0393 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35598"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX0"
FT                   /protein_id="ABM35598.1"
FT                   /translation="MNHGVMKRLACSVGAAVLLTGALSACVGPLIVGGAMVGGSMVATD
FT                   RRTSGAQLDDEAIELRAASQIRSNLGTRVRVSVTSYNRQVLLTGEVPNLQDKQRVEQVV
FT                   KAVDSVASVVNELAVLNSPSLMDRSSDALLTGRIKAMLLDTSDLQSNAFKVVTERNTTY
FT                   LMGRVTQREADRATEVVRATPGVQKVVRIFEIISEQELKNMDTVPSGMQPAAPKPAGV"
FT   sig_peptide     273499..273576
FT                   /locus_tag="Pnap_0273"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.788 at
FT                   residue 26"
FT   gene            complement(274213..275115)
FT                   /locus_tag="Pnap_0274"
FT   CDS_pept        complement(274213..275115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0274"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: NADP oxidoreductase, coenzyme F420-dependent;
FT                   6-phosphogluconate dehydrogenase, NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase, NAD-binding; KEGG:
FT                   pol:Bpro_0394 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35599"
FT                   /db_xref="GOA:A1VIX1"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX1"
FT                   /protein_id="ABM35599.1"
FT                   /translation="MSPISTKSYEPPHPRKVAFLGLGVMGYPMAGHLALAGHQVTVYNR
FT                   SAAKAQAWSDEFKGASAATPREAAAGADIVFCCVGNDEDLRSVTLGANGAFAGMKPGAI
FT                   FVDHTTASASVARELYSAAKNIGLQFIDAPVSGGQAGAQNGALTVMCGGEAAAFEVVKP
FT                   VGMAFSKAFTLMGEAGAGQLTKMVNQICIAGLVQGLSEAVAFGQKAGLDMKQVLDVIGK
FT                   GAAQSWQLDNRGKTMVADQFDFGFAVDWMRKDLGLVLDEAKRNGARLPVTALVDQFYAD
FT                   VQAMGGQRWDTSSLIKRLK"
FT   gene            complement(275147..277379)
FT                   /pseudo
FT                   /locus_tag="Pnap_0275"
FT   gene            275673..276632
FT                   /locus_tag="Pnap_0276"
FT   CDS_pept        275673..276632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0276"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bte:BTH_II0087 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35600"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX2"
FT                   /protein_id="ABM35600.1"
FT                   /translation="MRKDKHLPSQPKGVYRVKNWPEYNAGLIERGNVSIWMDEEMFAPM
FT                   AGASVQRGRPQAYCDAVIQMLLALKSVYRLPLRALQGFAMSLRRLALPALPVPNYSTLS
FT                   RRAKALRVTLPVLRNAGEAVHLLVDSTGLKLFGEGEWKVRKHGYAKRRSWRKVHLGMDD
FT                   ETGQVCAVLMTHKDVIDASVLPELLAQIPQETKIEVVIGDGAYDTKAARAAIAGCGALA
FT                   VIPPVEGAVHWPASQAGAPERNEAIDHIAQSSKQDWKDKSGYHRRSLVENLMYRFKVLT
FT                   GDRLWARDVDVQDAEVAVRVGIINRMLVLARPKSVRIA"
FT   gene            complement(277439..278071)
FT                   /locus_tag="Pnap_0277"
FT   CDS_pept        complement(277439..278071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0277"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: pfo:Pfl_1398
FT                   cyclic nucleotide-binding (cNMP-BD) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35601"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX3"
FT                   /protein_id="ABM35601.1"
FT                   /translation="MKGLLGLIRQTTPAIAGSGHPDTFFFSTAFTEQGIDATSLVPWEA
FT                   RANEVGARRLPAERGSKLLQALWSKDNYMARLGSDAVPRLEKFFDFATLPANRDVIRQD
FT                   EYGNFMIVLLTGSIAVDREQPWGDRLHLTEARPGDILGEMSLLDSGVRFSVCTSLAECE
FT                   IAVLGAQALDEMMTTDPALAASLIALLARKLSRRLRVVSARLGDHNS"
FT   gene            complement(278104..279147)
FT                   /locus_tag="Pnap_0278"
FT   CDS_pept        complement(278104..279147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0278"
FT                   /product="pilus retraction ATPase PilT"
FT                   /note="TIGRFAM: twitching motility protein; PFAM: type II
FT                   secretion system protein E; KEGG: pol:Bpro_0396 twitching
FT                   motility protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35602"
FT                   /db_xref="GOA:A1VIX4"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX4"
FT                   /protein_id="ABM35602.1"
FT                   /translation="MDITQLLAFSVKNKASDLHLSAGLPPMIRVHGDVRRINIDPLDHK
FT                   EVHAMVYDIMNDTQRKHYEEFLEVDFSFEIDGLARFRVNAFNHNRGAGAVLRTIPSKIL
FT                   TLEQLGCPKIFGDLALKPRGMVLVTGPTGSGKSTTLAAMVNYLNETEYGHILTVEDPIE
FT                   FVHESKKCLINQREVGPHTLSFSAALKSALREDPDAILVGEMRDLETIRLAMTAAETGH
FT                   LVFGTLHTSSAAKTIDRIIDVFPAEEKEMIRSMLSESLQAVISQTLCKTKDGQGRVAAH
FT                   EIMLGTSAIRNLIREAKVAQMYSSIQTGNSVGMQTLDQNLTDLVKRNVISSAEARGKAK
FT                   IPDNFPG"
FT   gene            279280..280515
FT                   /locus_tag="Pnap_0279"
FT   CDS_pept        279280..280515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0279"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase, IS891/IS1136/IS1341 family;
FT                   transposase, IS605 OrfB; KEGG: bur:Bcep18194_C6989
FT                   transposase, IS605 OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35603"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX5"
FT                   /protein_id="ABM35603.1"
FT                   /translation="MLRLQAFKYELVPSGEQTRNMRRFAGARRFVFNKALALQKVNHGE
FT                   GKKFIGYLEMARHLIAWKQEFPWLKESPSQALQQSLKDLDKAWQNFFARRAGFSRPKKN
FT                   GRGESFRFPQGFKIDQSNSRIFLPKLGWMRYRNSRDILGSAKNITLSEAGGKWFASIQT
FT                   ERELEQAVPTTASAIGIDVGIARFATMSDASFVAPLCSFKKHEKRLAKYQRRMSRKTRF
FT                   SKNWHKAKRKVQRIHTDIANARKDFLHKTTSDLSQNHAMVAIEDLQVRNMSKSAAGNAD
FT                   KPGKNVAAKSGLNKAILDQGWFEFRRQLQYKLDWNGGILIAVPAHYTSQTCPCCGHVAK
FT                   ENRQTQARFECVDCGYENHADVVGAMNILARGYRAAACGDDGSGLARKRRAQPASVKQE
FT                   PAEVTMQEATHA"
FT   gene            280508..281287
FT                   /locus_tag="Pnap_0280"
FT   CDS_pept        280508..281287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0280"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   pol:Bpro_0397 protein of unknown function UPF0001"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35604"
FT                   /db_xref="GOA:A1VIX6"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX6"
FT                   /protein_id="ABM35604.1"
FT                   /translation="MRSTVGIPCLKAGEDVKTTIAHHLRLVHDRINVACLAAGRDPCGV
FT                   RLLAVSKTFGADAVADAVAAGQQAFGENYIAEGVEKILALRRWQAEEAARSGVAAAALE
FT                   WHCIGPIQSNKTRPVAEHFDWVQSVDRLKIAQRLSEQRPPGLAPLQICLQVNIDGGANK
FT                   SGLAPEDVLALAEEVARLPRLVLRGLMAIPEPAIDFVAACAIHASAKAIFDHINAAGVL
FT                   AVPMDTLSLGMTADLEAAIHAGSTMVRVGTAIFGGRG"
FT   gene            complement(281293..283803)
FT                   /locus_tag="Pnap_0281"
FT   CDS_pept        complement(281293..283803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0281"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: pol:Bpro_0428 diguanylate
FT                   cyclase/phosphodiesterase (GGDEF & EAL domains) with
FT                   PAS/PAC sensor(s); TIGRFAM: PAS sensor protein; diguanylate
FT                   cyclase; PFAM: GGDEF domain containing protein; EAL domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35605"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX7"
FT                   /protein_id="ABM35605.1"
FT                   /translation="MPPGFIPGRPALTGGQVPTALQQAGHRLAMTERIAHIGSWALDLP
FT                   ALQLLTYSSEFAAILGLPADAPLTWDELADRFAPEYRKRIAALLQQCASHGTAFDEEMQ
FT                   IDTPLCRKWVRMACEAVQNKRGQIKSLQGVLQDISTQKHAQQETLHLAMRLTTTLASIT
FT                   EAFVTLDRQCCFTYLNQKSEQLLRHTTGELLGKEIWLVLVTDKNQRLRQELQRSIATNR
FT                   QLEFEDFYPGLGKWLEVRAYPFAEGLAVYFRDVSKRRKSQEQLMLLETCISRLNDIVLI
FT                   AEAQSGSPKVPYIVFVNQAFEEHTGYSGHEVLGQTPRKLFGPGAVQDELQGMTKMLLRK
FT                   RHARSELLIYRKNGSCFWLELEIVQVAVTADELTHWVAVGRDITQRKVNADAIHQLAFY
FT                   DPLTTLPNRLMLLNRLEQVMAQSAHPRRQGALMFIDVDKLKVLNDTLGHHKGDLLLQQV
FT                   AERLAGCVEDTDMVARLGGDEFVVLLENLGDDAGSAAAHARQLAEKVLEQLREPFDLGG
FT                   HQHYTTSSIGVTSLNAAHGSVSEVLKQADLAMYQAKTTGRNALCFFDPEMQAAVNANAA
FT                   VSSELHIALRKQEFVLHYQPQVDSQGRVNGVEALLRWHHPKRGLVMPTDFIPMAEETGL
FT                   ILPLGRWALATACEQLAAWAAWPQAADLSIAVNVSVRQFRHPDFVDQVMAEIRRTGIKP
FT                   QHLKLELTETLLADGMDVTLARMGTLKALGVTLALDDFGMGYSSLSLLKRLPLDQLKID
FT                   KSFVAEVLTDPADAAISRTIITLAHSLNLKVVAEGVETQAQQDFLVAEGCDQFQGFLFS
FT                   APLPIEALEAYLMAQSPPLKLQTA"
FT   gene            complement(283839..284957)
FT                   /pseudo
FT                   /locus_tag="Pnap_0282"
FT   gene            284971..285249
FT                   /locus_tag="Pnap_0283"
FT   CDS_pept        284971..285249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35606"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX8"
FT                   /protein_id="ABM35606.1"
FT                   /translation="MPALVADVCWYFARTALGVSRFQDENVPADAHAFTLNQRFAFMPA
FT                   GIVCPFVKYQAAIGLWFLSLAGHHCRCAGRVWRRTANLFLFALYQLG"
FT   gene            285312..285641
FT                   /locus_tag="Pnap_0284"
FT   CDS_pept        285312..285641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0429 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX9"
FT                   /protein_id="ABM35607.1"
FT                   /translation="MSALDGLRHCPDVATLKPALHRLCETFGRVARLDVLTAVHEGTRQ
FT                   AICFLRLDSPEQEQALMQTLGVGRFGGEIVFVVDLNSAVDKEVQGPSSQWVEFDSPRSC
FT                   ARPGL"
FT   gene            285691..287121
FT                   /locus_tag="Pnap_0285"
FT   CDS_pept        285691..287121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0285"
FT                   /product="glycosyl transferase, family 2"
FT                   /note="PFAM: glycosyl transferase, family 2; KEGG:
FT                   reu:Reut_B4949 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35608"
FT                   /db_xref="GOA:A1VIY0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY0"
FT                   /protein_id="ABM35608.1"
FT                   /translation="MQLFPIHAFLRNAAGLKRPQAVRAVAAVAAAWLLGAGPAFAQPMP
FT                   TSGRIPSFSEFPLAATLASVLFLIVVIMMLYAVRHFIFTINRLLGEQRHPYLDIAIARW
FT                   PMITVFIAAHNEEKVIAGCIEALLNTDYPADQLKIIPVNDRSTDRTGAIIDRYVARFPS
FT                   RISPFHRTLGKAGKSAALKDALAFAEGDIAIIFDADYVPGRGLLKQLAAPFFDPEVGAV
FT                   MGRVVPVNSGANLLTRMLDLERSGGYQVDQQARMNMNLLPQYGGTVGGVRLSAVEAVGG
FT                   WHDDTLAEDTDITYRLMFNGWKTVYSNRSECYEEVPEEWRVRIKQVKRWAKGHNQVMAR
FT                   YWWQFACSPYLTLAQRIDGLLLLFVFLIPLLMLIGWGLVLGLYFLNAGSMLSQLIPIFA
FT                   LMVYGTLGNFAAFFEIVIAVLLDGHRKRLRLLPLNILGFLVSLFAISGAVVSLALDGLF
FT                   KREMVWEKTIRYRKGAAK"
FT   sig_peptide     285691..285816
FT                   /locus_tag="Pnap_0285"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 42"
FT   gene            287118..288161
FT                   /locus_tag="Pnap_0286"
FT   CDS_pept        287118..288161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0286"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35609"
FT                   /db_xref="GOA:A1VIY1"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY1"
FT                   /protein_id="ABM35609.1"
FT                   /translation="MTVVYAINYITFALVCMLLMLLPFLPAFREWRHPSDAAALPVSPD
FT                   YSSDIDYFARRLQADVAARLGKGPATGYSDFDFVRVPVENMNWLKASKRLISARGIKSP
FT                   MPVRTIQPLYVLGSIHAGAESSFSVLYATGNIELDKKSEIHDWAHADGVVRLGHKSLAL
FT                   RRISAGMAIELGEEAWFERLQAPVLYFGSRTSHALPPVQADQTPASFADLPGAVRQTPS
FT                   LFLIRGDCELPAGNIYCGSLIVTGFLTVGERTTITGDIKSREGISIGQGAWVQGAITCE
FT                   KRVYVFKDARVAGPLISERDILIGANALIGQPDANTSVSARNIIVENGVVVHGAIWAHE
FT                   IGMVKSI"
FT   gene            288158..289177
FT                   /locus_tag="Pnap_0287"
FT   CDS_pept        288158..289177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_0847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35610"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY2"
FT                   /protein_id="ABM35610.1"
FT                   /translation="MRLAPFVASCVLAGLGALGFPAAHAAVAAGAADAPQLDLTGYTEE
FT                   SGVITVLHGGHSFDPYFAMQALLLANENGMDISAPAEKFVNWLVPYQKPDGTFDRFCRS
FT                   AATKWLACKSADADDSLLAMWMKLLETMPAQLKKNPVWMKSYLSSKATLARLFQPSRGI
FT                   YMVSHLYLHGLFMDNLEVWSLKSHQQSSLAPAQRAEADKLARAIRDTFWDPVNQRFLVS
FT                   TQLEQRAEKPAFYPDHVAQIFPLLVDFPLLPAAPKTYYRNWMSAHRADWLSQGKSDYPW
FT                   GLVAVLALRQDDKASARCWMRESGRLRHTSRWAVTDETSWQILSSKGLTPAANTANCN"
FT   sig_peptide     288158..288235
FT                   /locus_tag="Pnap_0287"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.819 at
FT                   residue 26"
FT   gene            289239..290069
FT                   /locus_tag="Pnap_0288"
FT   CDS_pept        289239..290069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0288"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: bte:BTH_II0344 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35611"
FT                   /db_xref="InterPro:IPR030887"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY3"
FT                   /protein_id="ABM35611.1"
FT                   /translation="MFKNTFLVALIILASAETALAQQADPGKDITIPGPPVQVSEEAKR
FT                   SLELTMGSQSLNAGYSNWRDVTLRGTYAQPRNVLQGEVSVTRRFDEDGAFLGVSDTYTF
FT                   NDDWFGSVAVGAGDGAFYLPRYRVDAALYKKWLADRSLVTSVGAGYYNAPDGHTDRSLS
FT                   LGAAYYFTSPWIVEGGVRLNRSSPGSVHTQQKYAAVTYGRDKQDLVSARYTWGGEGYLA
FT                   IAANTQLVNFKSEEASVAWRHWLNSKTGLLISANRYTNPSYHRSGINIGIFHDF"
FT   sig_peptide     289239..289304
FT                   /locus_tag="Pnap_0288"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            290079..290918
FT                   /locus_tag="Pnap_0289"
FT   CDS_pept        290079..290918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35612"
FT                   /db_xref="GOA:A1VIY4"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY4"
FT                   /protein_id="ABM35612.1"
FT                   /translation="MRAATHSIAEQAREHNRIVHKAFTAARQIRERHVKVRPHRAITPL
FT                   KVTPYLLAQTVMLPLAILGLLILTKPFLLDFWRACLIFWSRGLDLPFTIATQLNRAGQY
FT                   AVRLSGGPDNAPMPSTTNLLVTTAVTLAVVVLSLRMKDAKQPLKYPLWILCFVQSTSLI
FT                   YFWLTPWSFPYSIALHCEELMTIGFIVMLATPFMLAMGYYILNLRLSIKIFHTVLILLF
FT                   MAVLVPHQVLAQALIMQEFSVLFMPVLYICFGAVFDALVFVALYSWAVSNVPENATV"
FT   gene            291076..291633
FT                   /locus_tag="Pnap_0290"
FT   CDS_pept        291076..291633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0290"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   pol:Bpro_0430 protein of unknown function DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35613"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY5"
FT                   /protein_id="ABM35613.1"
FT                   /translation="MATPFFGKRDNEIPSSGVRPGSVNSYTGSGSSPSATLHPASPQGV
FT                   VKPLGSEPAASAGHERESGSKLTVGPNIKLKGVEITDCDTLVVEGTVEATMSSRVIQIA
FT                   EQGTFKGSAEIEIAEIRGEFNGNLTVRQKLVIYATGKVTGTIRYGKLVVEEGGQLSGEI
FT                   VFGTQGASSKPALMAKPGLQAA"
FT   gene            complement(291738..292463)
FT                   /locus_tag="Pnap_0291"
FT   CDS_pept        complement(291738..292463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0291"
FT                   /product="LrgB family protein"
FT                   /note="PFAM: LrgB family protein; KEGG: pol:Bpro_0431
FT                   LrgB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35614"
FT                   /db_xref="GOA:A1VIY6"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY6"
FT                   /protein_id="ABM35614.1"
FT                   /translation="MSDFVQLWVYLSATPLFGLTATLLVYVLAHAAYFRAGQAPWANPV
FT                   LWSVIVLACGLLATGVSYPSYFAGAQFIHFLLGPAVVALGWPLWLRRAELRQRWGRLLV
FT                   AALAGGSVAAGSSLLLGRLFGLPQELVLSLVPKSVTAPVAMGIAEQIGGIPALAAVFAV
FT                   ITGLVGALFGKYLFAALRIPTDAEGWAARGFALGTASHGLGAARAMHVNADAGAYAGLA
FT                   LGLQVVLASLLIPLVFKLF"
FT   gene            complement(292456..292839)
FT                   /locus_tag="Pnap_0292"
FT   CDS_pept        complement(292456..292839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0292"
FT                   /product="LrgA family protein"
FT                   /note="PFAM: LrgA family protein; KEGG: pol:Bpro_0432 LrgA"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35615"
FT                   /db_xref="GOA:A1VIY7"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY7"
FT                   /protein_id="ABM35615.1"
FT                   /translation="MNALRGMVWLLVFQSAGELLARGLALPLPGPVIGMVLLLLALRWP
FT                   AVQTPVAECAGFLLSHLSLLFVPVGVGVMTHLSLVSQYGVRMLAVVVLSTLAGLAVTVL
FT                   SLHLLQGRQPLDAASPPAKDGDV"
FT   gene            complement(292879..294381)
FT                   /locus_tag="Pnap_0293"
FT   CDS_pept        complement(292879..294381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0293"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0433 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35616"
FT                   /db_xref="GOA:A1VIY8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY8"
FT                   /protein_id="ABM35616.1"
FT                   /translation="MNAPASPQQLSSLERAERQSQVVRALEAVLPGHALLWNREDTTPY
FT                   ECDGLTAYRERPLVVALPETYAEVQAVLKACHALDVPVVARGAGTGLSGGAMPHTLGVT
FT                   LSLAKFNKILKVDAASRTAVVQGGVRNLAISEAASPFGLYYAPDPSSQIACTIGGNVAE
FT                   NSGGVHCLKYGLTVHNVLKVKGFTIEGDEVEFGSDALDSAGYDLLAIVIGSEGMLAVTT
FT                   EVTVRLIPKPLLARCIMASFDDLRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDFVH
FT                   AGYDLSAAAILLCESDGTPEEVEEEIGRMSAVLERHGATAIAVSQNEAERLRFWSGRKN
FT                   AFPASGRISPDYMCMDSTIPRKRLADILLAIGEMEIKYGLRCANVFHAGDGNLHPLIMF
FT                   DANDADQLHRCELFGADILETSVAMGGTVTGEHGVGVEKLNSMCVQFSAAENEQMFGVK
FT                   RAFDPKGLLNPGKVIPTLHRCAEYGKMLVRGGKISHPDLPRF"
FT   gene            294562..295128
FT                   /locus_tag="Pnap_0294"
FT   CDS_pept        294562..295128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0294"
FT                   /product="protein of unknown function DUF820"
FT                   /note="PFAM: protein of unknown function DUF820; KEGG:
FT                   gvi:gll1561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35617"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIY9"
FT                   /protein_id="ABM35617.1"
FT                   /translation="MGQAAQKIIFTAADYLAWEPAQAERHEYIDGEVFAMAGAEDRHVT
FT                   VSMNLAFALRQHLSSSPCRTYMSDMRLHVAAANSYFYPDVLVTCSALDLASPMVKTEPK
FT                   LIAEVLSPSTGAYDRGVKFSHYRSIASLEEYVLIDLDTRSTDCFRKGEDGLWVLHPFAR
FT                   GEAVSLASVALELSAAQLFAEVPEV"
FT   gene            complement(295225..295557)
FT                   /locus_tag="Pnap_0295"
FT   CDS_pept        complement(295225..295557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35618"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ0"
FT                   /protein_id="ABM35618.1"
FT                   /translation="MDTKIIKGKSPLANDGDLLAALEKNTARSLGGKRMLIGVRNDAGE
FT                   IYRTVKADGIDGFLAAVTIFQNLGMINELQSLTGVQDGFNAIFQPKIVLMPRPVEGEPL
FT                   SASVGI"
FT   gene            complement(295621..296607)
FT                   /locus_tag="Pnap_0296"
FT   CDS_pept        complement(295621..296607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0296"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0437 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35619"
FT                   /db_xref="GOA:A1VIZ1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ1"
FT                   /protein_id="ABM35619.1"
FT                   /translation="MTTAESSPGEPTPPRHVRENPPPQAYAVPIGAAKRIPPIQCLLTF
FT                   EALARLRSVTLSAEELCVTPSAVSHRVKQLEQIIGTKLFGRADFSLTTEGSEYLAHVRE
FT                   GLATLQKFPGAAGQSATPGKRKLRLAVTPTFARSMLIPRLRQFTDAYPEIDLTLQVSIP
FT                   LLDVVAEDSDLVVRFGTGRYADLEHVCLLNDEVTPLASPSFIREHGPFEAAEDLLGENL
FT                   LRSPLEPWRIWFAANNLDWPEPVEGSQFNDIGLMCDCAAAGMGIALVRLKLGAPWLENG
FT                   SLVRLGTNDMFTRKVASPHAHYLCWRTGTMDRWECAAFADWLRKSLV"
FT   gene            complement(296615..297463)
FT                   /locus_tag="Pnap_0297"
FT   CDS_pept        complement(296615..297463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0297"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: pol:Bpro_0438 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35620"
FT                   /db_xref="GOA:A1VIZ2"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ2"
FT                   /protein_id="ABM35620.1"
FT                   /translation="MNHAYILTLSCPDRRGIVHAVSGFLFEHGGNIEEAAQYNDPDTGL
FT                   FFMRVRFACDELAPEALSSQLKTFAEPFEMNWKLHDTTQPMRTVILVSKEGHCLNDLLF
FT                   RWKSGLLPLDVRAIISNHRDFYQLAASYNIPFHHLPVSAATKGQVEARQLEIIEAEGAE
FT                   LVVLARYMQILSNDMCKKLAGRAINIHHSFLPSFKGAKPYYQAHDRGVKLIGATAHYVT
FT                   ADLDEGPIIEQDVARADHSKTVEDLTAMGRDTESQVLARAVKWHSEHRVVLNGHKTVIF
FT                   K"
FT   gene            complement(297499..298380)
FT                   /locus_tag="Pnap_0298"
FT   CDS_pept        complement(297499..298380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0441 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35621"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="InterPro:IPR016773"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ3"
FT                   /protein_id="ABM35621.1"
FT                   /translation="MHLTFRPFLPFRSTWVMAAAASLLLAAGCAGRPEMPILEQTGSRS
FT                   ALETADRLGKLLPADVLLVGEQHDAAEHHRIEQHIVSSLATQGLLAALALEMAEVGVST
FT                   AKLKPSSTEEQTRRALKWDDKAWPWQDYGPAVMTAVRAGVPVLGANLPTDQMQASVNDS
FT                   KLDVQLPGPALKAQQQAIRIGHCNLLPESQITPMTRVQIARDITMADTIHQLVFPGKTV
FT                   LLLAGNGHADRRLGVPQHLRADLKAKSIHLRAGQGQGADTADAFDSVWTTPALPDTDHC
FT                   AKLQAQLPVVTR"
FT   sig_peptide     complement(298285..298380)
FT                   /locus_tag="Pnap_0298"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.461 at
FT                   residue 32"
FT   gene            complement(298517..299653)
FT                   /locus_tag="Pnap_0299"
FT   CDS_pept        complement(298517..299653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0299"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rso:RS03096 putative Leu/Ile/Val-binding lipoprotein
FT                   transmembrane; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35622"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ4"
FT                   /protein_id="ABM35622.1"
FT                   /translation="MKKLLAGLIASATLFAGASVQAVDGVTARQLLIGQSITLEGGKND
FT                   YGTAVLAGMQTYLSAVNARGGVNGRQVVLKTLDDDNKSAKAETNARQLVEKDKVFALFG
FT                   SIEGGPSVAVMKAANELKVPFFGPMAGSPTLRRPYQPLVFPVRAEHREEFFALISHARS
FT                   LGMRKVAFLRSDSETGEQHLANVRLICQRLGMTLVADLPFKSDITDAQLGAMVTQLEQA
FT                   GAQMVFNHGGVGIYEKLIRKARDKAMQTAFYAVNSASAQLVKRLGELSHGMVFTQVVPS
FT                   PWERKSAITREYQTEFARFMPGQEFSYGSLEGYVTAKALVAALRLAGTSPSREGFVTAL
FT                   EGATLDLNGLRASYDSSNHQGLAFVDISMVTRESKFRH"
FT   sig_peptide     complement(299585..299653)
FT                   /locus_tag="Pnap_0299"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 23"
FT   gene            complement(299880..300161)
FT                   /locus_tag="Pnap_0300"
FT   CDS_pept        complement(299880..300161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35623"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ5"
FT                   /protein_id="ABM35623.1"
FT                   /translation="MQLLYDSDSFVVVQIHANAPEACAPQPAVPQLARHGFEIVDKRSG
FT                   KEVYLDGSWAEMFQQRLSAWARDTPTQEEVEDTLEGYSGLAMTPVSLH"
FT   gene            complement(300238..301428)
FT                   /locus_tag="Pnap_0301"
FT   CDS_pept        complement(300238..301428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35624"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ6"
FT                   /protein_id="ABM35624.1"
FT                   /translation="MRSDMLSFSPPMTGQIVPWRTLGLLAVLVLLAHALLLQTRPARLG
FT                   PAPEPVQKRVPALITRSIPPAPAASPLPAVAKPAVQPPPKPAAKPVKKPVFKQNRPFAH
FT                   DQPAQSATNSIAEPVQEPGSAEAPPAPQAPDSLAPLPSAPATETAPEPPADSDTATAAT
FT                   PPASAAAAPSPPQPKQTPVTAMALPASAQLEYKMTGSAKGLTYHARGELSWQNSGGSYH
FT                   ASMTAKALFLGSRTLSSTGQISAQGLAPSRFSDKSRSEVAAHFEPDKGQISFSANTPSV
FT                   PWTQGAQDRVSVFLQLGGMLAGNPAGFPVGATLSTLTVGPRDADHWTFLVEKEELLSLP
FT                   FGDLATLKLSRQPRREYDQKVEVWYAPALGYLPVRNQITQANGDFVDQQLSDLSHP"
FT   gene            301458..302441
FT                   /locus_tag="Pnap_0302"
FT   CDS_pept        301458..302441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0302"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pol:Bpro_0446 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35625"
FT                   /db_xref="GOA:A1VIZ7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ7"
FT                   /protein_id="ABM35625.1"
FT                   /translation="MKLATYKDASRDGQLVVVSRDLSSAHYATGIANTLRQVLDDWRFM
FT                   APQLRDLSDLLNSGKARHAFPFEPGRCMAPLPRACQWVAGQSFISHVERLHKATDAKLP
FT                   KSRYTEPLMRQGGGDGFIGPCDNIVIASDASGIDFEAQVAVITGDVAMGASPEEALDGI
FT                   RLLMLANDVSLRKLMADEQANGLGYLQGKPMTAFSPVAVTPDEVGDAWRQGRLNLTLQT
FT                   TWNGRKVGLCDAGAGMTFHFGQLVSHMCKTRPASAGSIVGSGPVSSTDWSQGYACIAEK
FT                   RAVESVDNGRASTRFMKFGDTLRIEAKGKNGQSVFGAIEQEITPAG"
FT   gene            complement(302530..304749)
FT                   /locus_tag="Pnap_0303"
FT   CDS_pept        complement(302530..304749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35626"
FT                   /db_xref="GOA:A1VIZ8"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ8"
FT                   /protein_id="ABM35626.1"
FT                   /translation="MFATIRRSGSGIFRWLYGAILIFAMGAAQAQNLSKMALLLPDGLA
FT                   VNDVQVTAWTDAAQEQGYQMSILRNADFLLLGAGARTQYSGIIVPDQIQVSMSDALVAT
FT                   IQSYVTQGGNIMLVYDAGALTANGFYAIPKSRFSDLVGVDYVLYDSLLDRTVGLGPVIG
FT                   LESTLRALHIPPGKSIPYTQTATTVTALADTPRAIQVADNGKKAPAGKATADFLPASPA
FT                   NPGGLKGYDHAQYFKSEPGVTEGSKERAKKLKQKIIDNKGKKNEKAIQREAVPGVTPNK
FT                   LSKDALRNLSTSSRIGNPSLGAKRYLTQASPPATDPVHAISGYVYGALTYPSFVTQGTA
FT                   LGATLMSSPDHGLVASSRTVGTGSVLFVNLPLTYLKLYEDSMPMHGFLHLFARGPAKQP
FT                   RLTNVPDGIGGLVFNWHLDSKEAQAPIQTLKNMGVWNYKPFSIHITAGPDTIVPGDKLG
FT                   FDLPNNPTMKQHLKNFVATGHEVGSHGGWIHDYYGDNANETNQAQFQPYLVLNRDAVQA
FT                   AIGKPSTEYSAPQGNNPLWAVTWLQQNGVNSFYSLSHTGSAVTRSYRGGGLPNPTMWAV
FT                   PVTPFGVAATFEEFEELLFTEADINKWYKDLIDFSYANETNRMIYAHPPGAVEFPNVMT
FT                   TLLQYANTQQTAGKFRWYTMTRLRNFMVQRSNTTWQSAIAANGKMRVTASNTTTNLVNL
FT                   TWAYPKTKYAKPVAVSGTMSIVDQGTDWLVRITAGKNATFDAAPL"
FT   sig_peptide     complement(304657..304749)
FT                   /locus_tag="Pnap_0303"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            305021..305269
FT                   /locus_tag="Pnap_0304"
FT   CDS_pept        305021..305269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35627"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIZ9"
FT                   /protein_id="ABM35627.1"
FT                   /translation="MIYINATHAAKSLQIGKPAWGKRAGFGRPGPRDGPIEAKVVKARQ
FT                   KENSVSSAVAGWSRRTGIQDLALNNFPSVIPAKGRYC"
FT   gene            305357..306346
FT                   /locus_tag="Pnap_0305"
FT   CDS_pept        305357..306346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35628"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ00"
FT                   /protein_id="ABM35628.1"
FT                   /translation="MPLAPTGPSGAHSTRRHRAKNRQETLSMSHATTPSFPDFGKLVPG
FT                   FDFLQNLTKQAAGSATQVLPQLPNLGNWIAPTINLEELDKRVQELKAVQFWLDQNAAAL
FT                   KATIQALEVQRMTLATLKGMNFNMGEVANAFKLKVTESMMGGAPKAPEKAKGFAGLEIP
FT                   PSAFQTSRAQAEAQPEPAAKPAAPRAESGEAPAAAGVADPMQWWGALTQQFQTIAAEAL
FT                   KEVAKTTHLDASKNIATGMAKDAVKTATDMATGLAKGMAQTASKTMTSSWPKPAAAKDA
FT                   APVPKKAAAKTGAAKTAAAKPAAKAAVKAKPQAPARKAAGTAARKTTR"
FT   gene            306390..307733
FT                   /locus_tag="Pnap_0306"
FT   CDS_pept        306390..307733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0306"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   pol:Bpro_0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35629"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ01"
FT                   /protein_id="ABM35629.1"
FT                   /translation="MCHIEALDHPLNCPSHLMKLFPYGHATHPQWQMAAGLVLAQLRGY
FT                   LALPEYASAPTLALLYITDHYVPQAQEILDHLSAELPFITDWSGAVGVGIASNNVEYFD
FT                   EPALAVMLCELPHDHYRVFSGVSPLPPARSGLFTAHTALVHADAATPDVAELIAEMAAR
FT                   TESGYVFGGLASSRSAVVQFALSGHGNLKGQGAACGVFSGGLSGVAFARDASGGMGLMS
FT                   RVTQGCKPVSSTYTITACDANVVIELDGQPALEVMLADLGVSLEQPREALARVRNTLVG
FT                   LSRDADFPNDAVRQRSGQFGADVLVRHLIGLDPARQGIAIADTVSVGMKLAFCERNAQA
FT                   ARADLVRICAEIREELEPEEQTLEVASALNLPEAQSAPHPARRIAGAVYVSCAGRGGPH
FT                   FGAPSAELQIVRHALGDVPLVGFFAGGEIARNHLYGYTGVLTVFTSAD"
FT   gene            complement(307738..308469)
FT                   /locus_tag="Pnap_0307"
FT   CDS_pept        complement(307738..308469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0307"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   pol:Bpro_0454 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35630"
FT                   /db_xref="GOA:A1VJ02"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ02"
FT                   /protein_id="ABM35630.1"
FT                   /translation="MSTTADLVALLKKELKTARMTYADLALALGMAESSVKRMLAKGDM
FT                   PLSRIDAICRALKLDFAELARKVADAQPLLAQLSEAQEKAVVADKKLLLVAICVLSQWT
FT                   LEQVTGSYRLSQAECIGYLAQLDRIGIIELKPLNRYRLKLAKTFRWRPHGPVMDYFRDN
FT                   ALLDYFSGGFDGSGEGLLLVHGSISRGLAPSFMERMQRVAQDFAQQHQADQKLADKDRE
FT                   GYTLLLAMRSWEFGAFVALRR"
FT   gene            308593..309492
FT                   /locus_tag="Pnap_0308"
FT   CDS_pept        308593..309492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0308"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35631"
FT                   /db_xref="GOA:A1VJ03"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ03"
FT                   /protein_id="ABM35631.1"
FT                   /translation="MTHSRHELLPPPLVRPRERKLLGVALLMVLFAVAGPFLPQPASFH
FT                   DFADQRAWGAIPHAMDVLSNLPFAAWGVAGLWALARAVRLRAVDGASAGLAGLFLAGLL
FT                   VTAGVSAFYHWQPDDGGLVWDRMGMVLAFAGLLGLAAVQGVSRRAGIALAAAVMLLGPV
FT                   TVQVWAASGNLLPWGVLQIGGMALILGLAALPPAWPAPGLRIRWALVIALYALAKLLEL
FT                   ADHAVFDLTGQLVSGHSLKHVAASFAAWPVVLAVLEAVRMSRERGKIRAESAAPFKARA
FT                   SCPAPSRSNQATKPRSQA"
FT   sig_peptide     308593..308697
FT                   /locus_tag="Pnap_0308"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.803 at
FT                   residue 35"
FT   gene            309489..311465
FT                   /locus_tag="Pnap_0309"
FT   CDS_pept        309489..311465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0309"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_0457
FT                   phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35632"
FT                   /db_xref="GOA:A1VJ04"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ04"
FT                   /protein_id="ABM35632.1"
FT                   /translation="MSVELSTPASAAAMPPPPADAHPNQFALLRQRRFAPFFWTQFSGA
FT                   ANDNLFKFAFTVMVTYQLSVGWLPPALAGLTIGALFILPFLLFSATSGQLTDKFEKTRI
FT                   IRFVKNLEVVIMLIAAVGFVSGNINVQVPVLLGCTFLMGLHSTLFGPVKFAYLPQALSE
FT                   RELTGGNGMVEMGTFVAILLGNIVGGLLVAIPGVGPQYVAVACVGLALAGRAVAQFIPR
FT                   APATDPGLRINWNPVTETWRNLKLAKTNLVVFRSMLGISWMWFFGAVFLSQFPSFAKEV
FT                   MHGDEHVASLLLVVFSIGIATGSLLCEVLSRRHVEIGLVPLGAIGMSVFAIDLYFASRG
FT                   LPPSALMGVGSFMGQPAHWRVIADLALLSLFAGLYSVPMYALIQLRSQPTHRARIIAAN
FT                   NILNALFMIVSAILAGALLKANFSIPQIFLFTGLANAVVAFYIFMLVPEYLLRFVALML
FT                   SRCIYRFKVQGDDHIPAQGAAVLTCNHVSFIDPVLLMAASSRPIYFLMDHRIFKMPVLG
FT                   WLFRLAKAIPVAPRAEDPAAYEAAFEAAAKVLREGDLLAIFPEGGITQDGELQPFKGGV
FT                   MKILDNASRDGLNVPVIPMALTNLWGSFFSRAELVNGQRVAMVRPFRRGVFSRVGLNVG
FT                   KAMVPAEVQPEVLQARVAALIKA"
FT   sig_peptide     309489..309554
FT                   /locus_tag="Pnap_0309"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            311612..312070
FT                   /locus_tag="Pnap_0310"
FT   CDS_pept        311612..312070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35633"
FT                   /db_xref="GOA:A1VJ05"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ05"
FT                   /protein_id="ABM35633.1"
FT                   /translation="MKIQFAPYLIAACALLACASASFDAKAQSEASALSTLSALPVASV
FT                   VAGASTAAGSVLAVPLALSTAGAVLIVRAVESTARGTVYVLERASDGASASIEVVGRAL
FT                   GGVSVVAGASVVVSVVGAGVLLSAAGEAIAFIPNAMGRALLHNERLTY"
FT   sig_peptide     311612..311695
FT                   /locus_tag="Pnap_0310"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 28"
FT   gene            312085..312903
FT                   /locus_tag="Pnap_0311"
FT   CDS_pept        312085..312903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35634"
FT                   /db_xref="InterPro:IPR014547"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ06"
FT                   /protein_id="ABM35634.1"
FT                   /translation="MNTRLNHGLGMALLAGSLILPVAAHAGRSCQARPPTTQSVELGLA
FT                   LAEKTLASLNASGERVVLLARAGQDLSRYGLRYSHFGLAWQVADGQGGNTWHVLHKLNG
FT                   CGTAEAALYRQGLGEFFLDDPWRFEAAWLAPTPQVQARLLALLQDSRRAISLNHRPYSI
FT                   VSYAWGRKYQQSNQWAIETLAAALEPGVTSREKAQAWLQFRGYEPTTLHLGPLTRLGGR
FT                   LTAANIAFDDHPNDKRFADRIETVTVDSVFAWLARAQLSRPGKAPTLVGP"
FT   sig_peptide     312085..312165
FT                   /locus_tag="Pnap_0311"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.745 at
FT                   residue 27"
FT   gene            312927..314201
FT                   /locus_tag="Pnap_0312"
FT   CDS_pept        312927..314201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35635"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ07"
FT                   /protein_id="ABM35635.1"
FT                   /translation="MLDVLQLVSTCHPSKEKFMSPQTDEASRTPLAPPDSFQLTPPEVL
FT                   RPLSDEVARKAVPLPAATQAAVEDQVQRFMDGLMSEDLQSEAFKARLDSAFALGREEIS
FT                   LAASLMQGRFMQRNFVGMEDSAAFKAVQEMRGHLDALNPGKDGDLLQPQKLLGIIPYGN
FT                   KLQGYFRKFQNAGEQMQKSMQKLYAARDDMQRDVVEIEATRGKMWDGMQKLAAAVQFAE
FT                   SLDRQLAAKVDGLKATDPERAKALEQEVLFYVRQNLLDILTQQSVCTNGYLALDVLKKT
FT                   GREMMNGCSRVATTGMSALAVAQTVARATGNQVKVMEMLTGVNSTIENLIAETGRQLNT
FT                   HVEKTTQFASNPLIGIEKMKEMFDQTFKAMDAMDTFRSKMVEVMGQNNTILQEQLARAD
FT                   QYIDRVRQQKAREVTQRTLSGPVAL"
FT   gene            314236..314685
FT                   /locus_tag="Pnap_0313"
FT   CDS_pept        314236..314685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0313"
FT                   /product="YiaAB two helix domain protein"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   pol:Bpro_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35636"
FT                   /db_xref="GOA:A1VJ08"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="InterPro:IPR038972"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ08"
FT                   /protein_id="ABM35636.1"
FT                   /translation="MTTQYVMQRDTGGWRIQVWTSFTLAVLASGTGVMQLPSQELDRAF
FT                   LAIGFFFCLFAAFAAAKTVRDNRDGRVDTNGWIITVWVSFAAAVCLTAWGLWRMNIGDW
FT                   QKGYMVVSWMFLISSTFTLAKTIRDRYEADLMTRSNEPAPETRPA"
FT   gene            complement(314705..315595)
FT                   /locus_tag="Pnap_0314"
FT   CDS_pept        complement(314705..315595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35637"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ09"
FT                   /protein_id="ABM35637.1"
FT                   /translation="MRSSPSIPDGFNFIIHSFAPNQTNAMPEHKNDSRRAYANAPVNQR
FT                   TAPREVAKPPPVHASLKARAQKARQRQLLGPSISDLLARRTSGAPRQHEKLHPGVIAAT
FT                   VCAVAAASALVLIRTGAGLALAAALAALGGASWLWQHRSQRAASETMPMPAGPPPFEPE
FT                   ALRRIDEAFEATAAIVTGPLLAALVSLKAAAVRMALALNGVQADDGFTLDDRMYVIESI
FT                   RRYIPDTLSAYLQVPTAQRPVPGAGEGKSANDLLQGQLALLQSELEQREQRLHGSAVEA
FT                   LRRQQRFLQSKATRG"
FT   gene            315758..316816
FT                   /locus_tag="Pnap_0315"
FT   CDS_pept        315758..316816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35638"
FT                   /db_xref="GOA:A1VJ10"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ10"
FT                   /protein_id="ABM35638.1"
FT                   /translation="MSKSLRLTEKWMQRGLWLVALVFASFLIGLGGTLVGDLPKVEKQL
FT                   TLDDFMDRAASTALRSSIKTTEAAERDADAALEQAQLKRRVTQADSAAARETFNNWLST
FT                   RHATQLSGQDPELVARTRALDGLKDKERAAGMAVEAQQQAALDARQSSVRERRKLAEME
FT                   QAAQKLLNAEYRRIELRVFLYRLALTLPLLVAAGWLFAKKRKSTWWPFVWGFILFALFA
FT                   FFVELVPYLPSYGGYVRYIVGIVVTVLVGRQAILALNRYLEKQKLVEQLPDAQRREELS
FT                   YDTALTRLSKGVCPGCERPVDLKNPEIDFCPHCGIGLFDHCRACNTRKGAFAKFCHACG
FT                   ATGQRAHLPAQA"
FT   sig_peptide     315758..315865
FT                   /locus_tag="Pnap_0315"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.371 at
FT                   residue 36"
FT   gene            316942..318291
FT                   /locus_tag="Pnap_0316"
FT   CDS_pept        316942..318291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0316"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35639"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ11"
FT                   /protein_id="ABM35639.1"
FT                   /translation="MKAHLQAHLRNQVAALFFLLPVATALVALPATVMAQPAAPELRSL
FT                   EVTSDDGLRAGAELEFTVEGTPRSRVGLRINGVRRDIALRETERGVYTGSYTIKRQDRI
FT                   SPANPIRATLRTRNRNIAVNYSFPAGMANPAVAAPLAAPVPPVAVLKIERFSVAPIDKI
FT                   EPGAELKFSLNGPPGGSAEVEIPGVNRVSMREVRPGAYEGAYTLRRMDNLLPSRPIVAT
FT                   LRVGNQSVKSNLTQALTADAKPPVLRNLAPREGEAVVDRAAISVSATFDDAGGVGVDPK
FT                   SVRILLSGRNVTPDSEVTPQFFSYRADLPIGRHTVDVTARDMVGNAMHKTWGFDVVVPV
FT                   SAMPATVPLQITSHANNAIVDGGTTVVRGRTAPGAVVDIRVQAFIPVAALFGVNQEPMT
FT                   QRVQADGNGNFTFSFASQLPLPGTRYEVTMVSHKADLSTESKLVLFQKQG"
FT   sig_peptide     316942..317049
FT                   /locus_tag="Pnap_0316"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 36"
FT   gene            complement(318385..320175)
FT                   /locus_tag="Pnap_0317"
FT   CDS_pept        complement(318385..320175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0317"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase and
FT                   related glycosyltransferases of PMT family-like protein"
FT                   /note="KEGG: pol:Bpro_0463 4-amino-4-deoxy-L-arabinose
FT                   transferase and related glycosyltransferases of PMT
FT                   family-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35640"
FT                   /db_xref="GOA:A1VJ12"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ12"
FT                   /protein_id="ABM35640.1"
FT                   /translation="MSSPEKSPAARLPHHLVWIGLAIAVALGYLFGLGGDHIPRNGDEL
FT                   VYANIARLTAASGHWLPLHSAWDFMRNTKPPLLFWQAMVAGGWGEHWTLLRLRLPSVAY
FT                   TWGIALMVGLLTWKTVRGDAGATSGNAATAAQRNHHAMTMGAIAVLVYLSFFTTYRYGR
FT                   PYLTSAPETFWLFGVFFAIAWSPARLLASSWKFPLIAGLAIGIGCLYKSFVMVAPVGFA
FT                   LALCYQAVGARLAPWKLARPGIVADGVKVLAICALGLAVFGLWFAIDPQPGEVWREFVV
FT                   GENAGKMNSSKGYFQTAFSGSSGILTILTGYFSNALFLLPLSVGCFVAAWRSWRQRQGT
FT                   AQTISDAEKIMWLWLLALALVFMLPTQRSTRYLIPAMPALAVVMALYWHRIGRIWFSLT
FT                   LAVCMIGLLAMGLIGYGAVRATQNPWVFSPLFWLFVAASALACLIGIFKKAWSRPVAAL
FT                   AGFSVLFALAWVTNPFNGELGRFRPETNALLKGQKVQVPSNFNGHFERYEFIIPGAKIV
FT                   DYFAAQPVDYADVEGLFKTSRYVLVQRRIGQPPCTRCRIIDERWDLRSRQDENDGFMAA
FT                   LKTPETYWYAKEYLVEPLAP"
FT   gene            complement(320195..320683)
FT                   /locus_tag="Pnap_0318"
FT   CDS_pept        complement(320195..320683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0318"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: pol:Bpro_0464
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35641"
FT                   /db_xref="GOA:A1VJ13"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ13"
FT                   /protein_id="ABM35641.1"
FT                   /translation="MSRLRTFAEALVHLLPPRFQPMMRWRFIKFGLVGGSGTVINIVVL
FT                   YLAQEHLLRGIADFHTRLNYSIALAITVATISNFYWNRRLTWRDRTRNTPQPALRLFVK
FT                   YVMAAALSIVIQSLLTKWLAGYLHYIVANLIAIVLASVVNFVANDKLTFRRHRPKAPH"
FT   gene            complement(320683..321924)
FT                   /locus_tag="Pnap_0319"
FT   CDS_pept        complement(320683..321924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0319"
FT                   /product="glycosyl transferase, family 9"
FT                   /note="PFAM: glycosyl transferase, family 9; KEGG:
FT                   pol:Bpro_0465 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35642"
FT                   /db_xref="GOA:A1VJ14"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ14"
FT                   /protein_id="ABM35642.1"
FT                   /translation="MNIDLQRWLDRWMGIPLCAAVSGVDALMRRLSPAPRKPAPPRAIV
FT                   VILLSEMGSLVLANDMFARLKRRYPDAPLHALLFRKNREILDLMQVMDPANVHTVDDRS
FT                   LTSLLSSLWTAIRALRRAHVDVAIDCELFSRISSLLSYASGARVRVGFHRHTQEGLYRG
FT                   SHINRPVPYNPYHHISAQFLTLARAIDSTAVPTSKLPVLGIPKPPPHVPLDGALIQGIE
FT                   ARLAQDFPAIGGRPLVLVYPGGGILPIRAWPLASYTALCEGLVADGCAVAVIGLKDDQA
FT                   LARQLVANVQASAPASPVIDLTGYTRSISELLALFHVARLLVTNDGGPGQFAALTPIWT
FT                   LMLFGPETPGLYAPLTPHCYSFYSQWPCSPCLTAYNHRTSFCDGDNQCLKVIEPAAVLA
FT                   KARECLVAPLNTTA"
FT   gene            complement(321928..323091)
FT                   /locus_tag="Pnap_0320"
FT   CDS_pept        complement(321928..323091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0320"
FT                   /product="tRNA-guanine transglycosylase"
FT                   /EC_number="2.4.2.29"
FT                   /note="KEGG: pol:Bpro_0466 queuine tRNA-ribosyltransferase;
FT                   TIGRFAM: tRNA-guanine transglycosylases, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35643"
FT                   /db_xref="GOA:A1VJ15"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ15"
FT                   /protein_id="ABM35643.1"
FT                   /translation="MLEFEVLKTDPATVDSEGAYLGSYARRGQLTLNHGVVQTPIFMPV
FT                   GTYGTVKGVTPQSLHDMNAQIILGNTFHLWMRPGLDVVAQFGGLHKFESWHKPILTDSG
FT                   GFQVWSLGEMRKISEEGVKFASPVNGDKLFLTPEISMQIQTLLNSDIVMQFDECTPYDT
FT                   KGHITTEGEARSSMELSRRWAKRCEIEFDKLENPNALFGIVQGGMFENLRQESLDALVE
FT                   MDFPGYAVGGVSVGEPKEEMLRIMAHTPHRLPAHKPRYLMGVGTPEDLVEGVASGVDMF
FT                   DCVMPTRNARNGHMFTRFGDLKIRNARYKSEEAPVDSTCGCYTCRNFSRAYMHHLDRCG
FT                   EMLGPMLSSIHNLHYYLNLMQEVRGALDAGRFGEFVRQFKADRQRGV"
FT   gene            complement(323114..324172)
FT                   /locus_tag="Pnap_0321"
FT   CDS_pept        complement(323114..324172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0321"
FT                   /product="S-adenosylmethionine--tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine--tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: pol:Bpro_0467
FT                   S-adenosylmethionine"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35644"
FT                   /db_xref="GOA:A1VJ16"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ16"
FT                   /protein_id="ABM35644.1"
FT                   /translation="MKTTFSLSDFDFTLPDELIAQHPAAERSASRLLDGRGDAIADRRF
FT                   ADLPDLLLPGDLLVFNDTKVVKARLFGQKLSGGRLELLIERVLSPHLDAGHEVAAHMKV
FT                   SKKPLPGAMLQMDGGFTATLLGRWPEAHGPLYRFRLSSDPYALMAQHGHVPLPPYITHT
FT                   DSADDEQRYQTVFAKNPGAVAAPTAALHFDEAMLEKLQARGIARASVTLHVGAGTFQPV
FT                   KTETIAEHHMHFERFDVPQATHEAIAACKARGGRVVAVGTTTVRALESAAKFGPDCCDT
FT                   NIFITPGFDFKVVDVLLTNFHLPKSTLMMLVSAFSGHGHIMALYRHAIEARYRFFSYGD
FT                   AMLLARQAPPAL"
FT   gene            324192..326339
FT                   /locus_tag="Pnap_0322"
FT   CDS_pept        324192..326339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0322"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: pol:Bpro_0468 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: helicase
FT                   domain protein; nucleic acid binding, OB-fold,
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35645"
FT                   /db_xref="GOA:A1VJ17"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ17"
FT                   /protein_id="ABM35645.1"
FT                   /translation="MMLPAASALDPAPKTALPMAGAADKPAAKAPAKSPAQKAMEKLGL
FT                   RRDIDLALHLPLRYEDETRITRLADARDGEVVQFEGEVTHSEVLIRSRRQLLVTVDDGS
FT                   DTCVLRFLNFYPSHQKTLSVGAWVRVRGELRGGFLGREMVHPHFKLAGGELPGALTPVY
FT                   PTSAGLPQVYLRKAVLSGLARADLSETIPAPFLSKNMPLRLSSLREALQFLHHPTPDVA
FT                   LQTLEDRSHPAWQRLKAEELLAQQISQLQSRRVRAAMRAPALNGPAMRGTHCTLQEQLL
FT                   ERLPFRLTGAQQRVSAEIEVDLKKNVPMHRLLQGDVGAGKTVVAALAAARCIDAGWQCA
FT                   LMAPTEILAEQHFSKLISWLEPLGIKTARLTGSQKPKERREMLALVESGEAGLVIGTHA
FT                   VIQSKVKFKNLALAIIDEQHRFGVAQRLALRSKMTHEGQEPHLLMMTATPIPRTLAMSY
FT                   YADLDVSTLDELPPGRTPIVTKLVNDARRDEVIARIQAQIAQGRQIYWVCPLIEESESI
FT                   DLVNATQTHAALSEALPGVMVGLLHSRMPPAEKKAVMSLFTEGVMAVLVSTTVIEVGVD
FT                   VPNASLMVIEHAERFGLSQLHQLRGRVGRGAAASACVLLYSTGDAPRLGEVARARLKAM
FT                   VETNDGFEIARRDLDIRGPGEFLGARQSGAAMLRFADLQTDAGLLAWAREVAPLMLDQY
FT                   PDLAERHVLRWLGGKAEFLKA"
FT   gene            complement(326359..326760)
FT                   /locus_tag="Pnap_0323"
FT   CDS_pept        complement(326359..326760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0323"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35646"
FT                   /db_xref="GOA:A1VJ18"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ18"
FT                   /protein_id="ABM35646.1"
FT                   /translation="MLVPIAVSAYFAIYITFCLWAHYDDFTNRNSASWFAIVEMASNVF
FT                   LLLAALSFWLPSLRAIPSSLLFALFAFGCMVFFVQGIVVGRKHAKDQGLSSAGKVFTVF
FT                   SGAVLGVLVTGPLLYWGWQSTVRIIHAET"
FT   gene            326904..327860
FT                   /locus_tag="Pnap_0324"
FT   CDS_pept        326904..327860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0324"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_0472 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35647"
FT                   /db_xref="GOA:A1VJ19"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ19"
FT                   /protein_id="ABM35647.1"
FT                   /translation="MTLTELKYIVAVAREKHFGRGAEACHVSQPTLSVAIKKLEEELQV
FT                   KLFERNANEITVTPLGEEIVRQAQSVLEQADSIREIARRGKDPLAGSLRLGVIYTIGPY
FT                   LLPDLVRQIIEKTPQMPLMLQENFTVKLLEELRTGEIDCAILAEPFPDTNLAIAPLYDE
FT                   PFMAAVPSSHPLAARTSVTAEELKKETLLLLGTGHCFRDHVLEVCPEFARFSTSAEGIS
FT                   KSFEGSSLETIKHMVAAGMGITLVPRLGVPKSALALSGQDTSADQPSYIRYLPFEGHVP
FT                   TRRVVLAWRRSFTRYEAIAALRNAIYACELPGVIRLS"
FT   gene            327973..328497
FT                   /locus_tag="Pnap_0325"
FT   CDS_pept        327973..328497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0325"
FT                   /product="Ferritin, Dps family protein"
FT                   /note="PFAM: Ferritin, Dps family protein; KEGG:
FT                   ana:all4145 probable DNA-binding stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35648"
FT                   /db_xref="GOA:A1VJ20"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ20"
FT                   /protein_id="ABM35648.1"
FT                   /translation="MAKSPAKTILKATLQGAPAINIGISEKDRAAIAQGLSRLLADTYT
FT                   LYLTTHNFHWNVTGPMFNTLHTMFMVQYTELWNAVDPVAERIRSLGHPAPGSYAQFSLL
FT                   ATVPDVPVTPPKALEMVRILVQGHEAVARTARELFPMADEARDEPTADLLTQRMTVHEQ
FT                   TAWMLRSLLEE"
FT   gene            328532..329401
FT                   /locus_tag="Pnap_0326"
FT   CDS_pept        328532..329401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0326"
FT                   /product="4-hydroxybenzoate octaprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: pol:Bpro_0474
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35649"
FT                   /db_xref="GOA:A1VJ21"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ21"
FT                   /protein_id="ABM35649.1"
FT                   /translation="MTAGAPSKFSLYLQLIRWNRPAGWLLLLWPTLSALWLASHGFPGW
FT                   HLVTVFTLGTFLMRSAGCCINDVADRDFDRHVKRTAQRPVTSGAVSVREALGLGAVLAL
FT                   LAFGLVLTTNAVTIAWSFAALAVTLAYPFAKRYVSMPQAVLGVAFSCGILMAFAAVQSR
FT                   VPPLAWALLLGNLFWVIAYDTEYAMVDRDDDLKIGMKTSAITLGRFDVAGVMLSYLIFI
FT                   SIWAFALIQRAQSAIFMIAIALALAQALWHGWLIRKRERDDCFKAFRLNHWLGFTVFAG
FT                   VALSYWGR"
FT   gene            complement(329984..330823)
FT                   /locus_tag="Pnap_0327"
FT   CDS_pept        complement(329984..330823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0327"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="KEGG: pol:Bpro_0475 pyrroline-5-carboxylate
FT                   reductase; TIGRFAM: pyrroline-5-carboxylate reductase;
FT                   PFAM: NADP oxidoreductase, coenzyme F420-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35650"
FT                   /db_xref="GOA:A1VJ22"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ22"
FT                   /protein_id="ABM35650.1"
FT                   /translation="MTPQTTDSSNQHIAFIGGGNMASAIIGGLLKRGLPASQIQVVEPF
FT                   AEQRARLAQQFQIEVSETAGASLARATLAVWAVKPQTFRQAAEQSRAHTQAALHLSVAA
FT                   GIRSSTIAGWLGTERVVRAMPNTPALIGQGMTALFARPAASAADRLAVERVVQTTGQYL
FT                   WLDEEAQLDAVTALSGSGPAYVFYFIEAMIEAGTDMGLSREQAQQLAVGTFAGASALAH
FT                   EATEPPEVLRARVTSKGGTTYAALTSMEQDGIKEKFMQAMHAARQRASEMGDEFGAA"
FT   gene            complement(330919..332412)
FT                   /locus_tag="Pnap_0328"
FT   CDS_pept        complement(330919..332412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0328"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase,
FT                   FGGY; KEGG: pol:Bpro_0476 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35651"
FT                   /db_xref="GOA:A1VJ23"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ23"
FT                   /protein_id="ABM35651.1"
FT                   /translation="MAYLLALDQGTSSSRSIVFDEEGRVVALAQRELPQIYPRPGWVEH
FT                   DPMEIWRGQLATARQALASVGLAAWDIRAMGITNQRETTVLWNRRTGQPVHHAIVWQDR
FT                   RAESTCAQLREQGHEALIQAKTGLLIDAYFSGTKLKWLLDNVAGVRAQAERGELAFGTI
FT                   DSWLIWQLTGGTVHATDVSNASRTMLFNVRTNQWDAELLDLLGIPASLMPEVKPSSAHY
FT                   GEVRPELLGHAIPIGGVAGDQQSALFGQACFRAGMAKNTYGTGCFLLMHTGAQFQASKN
FT                   GLLTTSAAQTTAQTEFALEGSVFVGGAVVQWLRDGLHAIQGSAEVEALAQSVPDSGGVM
FT                   MVPAFTGLGAPYWKPEARGTITGLTRGTTMAHIARAALESIAYQSAALLLAMSRDAVAA
FT                   GAAPLAELRVDGGASSNDLLMQFQADLLGIPVIRPAVTETTALGAAWLAGLSSGVYGST
FT                   DELSSLWRAERTFLPTLSTGRAAELMAQWEHAVRQTVLA"
FT   gene            332614..334200
FT                   /locus_tag="Pnap_0329"
FT   CDS_pept        332614..334200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0329"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   pol:Bpro_0484 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35652"
FT                   /db_xref="GOA:A1VJ24"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ24"
FT                   /protein_id="ABM35652.1"
FT                   /translation="MAIDALPARTRRKNLIDRLAEPRHYDVAVIGGGATGLGVALDAAA
FT                   RGFSVVLVESHDFAKGTSSRATKLLHGGVRYLAQGNISLIREALHERSTLLANAPHLAQ
FT                   PLPFVMPCYKFWESPVYGLGLKMYDTLAGKDGLGDTEFLNRPETLAHLPTLQPQGLKGG
FT                   VKYWDGQFDDARLALALARTAARQGALLVNYCAATKLIHEGGKLVGLCALDRETGHTHE
FT                   LHASCVVNATGVWVDRLRMQDGKAVECTTKPMVAPSQGVHIVVEREFLPTDHALLIPRT
FT                   SDGRVLFAVPWLGKTILGTTDTPRHTLAREPLPFREEVDFLLRESARYLSRAPGRADIK
FT                   SLWVGLRPLVKPTDDAAGSTKTLSREHTVLVSKSGLVTVTGGKWTTYRAMAGDVLEKCF
FT                   AAGLLPARTGMPTDHLKLVGAQRSSVRISEAPGLHLYGSEAGAVQALRGADHELGGGLT
FT                   EAMVRFAARHEYARTVEDVLARRSRLLFLDAALARTLAPAVAALLQQENGMDAKLQSFL
FT                   ALCDQYLSVPA"
FT   gene            334415..334783
FT                   /locus_tag="Pnap_0330"
FT   CDS_pept        334415..334783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0330"
FT                   /product="LSU ribosomal protein L14P"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: pol:Bpro_0485 ribosomal protein
FT                   L14"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35653"
FT                   /db_xref="GOA:A1VJ25"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ25"
FT                   /protein_id="ABM35653.1"
FT                   /translation="MIQTQSKLDVADNTGAKSVMCIKVLGGSKRRYASVGDVIKVSIKE
FT                   AAPRGRVKKGEVYSAVVVRTAKGIRRGDGSLVKFDGNAAVLLNAKLEPIGTRIFGPVTR
FT                   ELRTEKFMKIVSLAPEVL"
FT   gene            334796..335116
FT                   /locus_tag="Pnap_0331"
FT   CDS_pept        334796..335116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0331"
FT                   /product="LSU ribosomal protein L24P"
FT                   /note="TIGRFAM: ribosomal protein L24; KEGG: pol:Bpro_0486
FT                   ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35654"
FT                   /db_xref="GOA:A1VJ26"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ26"
FT                   /protein_id="ABM35654.1"
FT                   /translation="MNKIRKGDEIIVITGRDKGKRGTISLRVDDSYVLVDGINLVKKHT
FT                   KPNPLKGTTGGIVEKSMPIHQSNVAIFNAASGKADRVGIKLLADGKKTRVFKSSGEEIK
FT                   AA"
FT   gene            335119..335658
FT                   /locus_tag="Pnap_0332"
FT   CDS_pept        335119..335658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0332"
FT                   /product="LSU ribosomal protein L5P"
FT                   /note="PFAM: ribosomal protein L5; KEGG: pol:Bpro_0487
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35655"
FT                   /db_xref="GOA:A1VJ27"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ27"
FT                   /protein_id="ABM35655.1"
FT                   /translation="MARLQDQYREKIAPALIEKFGYTTPMQVPRITKITLNMGVSEAVA
FT                   DKKVMDNAVADMAKIAGQKPVVTKAKKAIAGFKIREDLPIGCMVTLRGVQMYEFLDRFV
FT                   TVALPRVRDFRGISGRAFDGRGNYNIGVKEQIIFPEIEYDKVDALRGLNISITTTAKTD
FT                   EECKALLTAFRFPFKN"
FT   gene            335667..335972
FT                   /locus_tag="Pnap_0333"
FT   CDS_pept        335667..335972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0333"
FT                   /product="SSU ribosomal protein S14P"
FT                   /note="PFAM: ribosomal protein S14; KEGG: pol:Bpro_0488
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35656"
FT                   /db_xref="GOA:A1VJ28"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ28"
FT                   /protein_id="ABM35656.1"
FT                   /translation="MAKQALLQRELKRDKLVAKFAKKHAEFKAIANDFKRTDDERALAR
FT                   LELQKLPRNANPTRQRNRCAITGRPRGTFRQFGLARAKIRELAFAGDIPGITKASW"
FT   gene            335991..336386
FT                   /locus_tag="Pnap_0334"
FT   CDS_pept        335991..336386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0334"
FT                   /product="SSU ribosomal protein S8P"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pol:Bpro_0489
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35657"
FT                   /db_xref="GOA:A1VJ29"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ29"
FT                   /protein_id="ABM35657.1"
FT                   /translation="MSMSDPIADMLTRIRNAQMVEKAVVLVPSSKVKVAIAQVLKDEGY
FT                   IDGFSVKANDGKPQLEIALKYYAGRPVIERIERVSRPGLRVYKGHGAIPQVMNGLGVAI
FT                   VTTPQGVMTDRKARATGTGGEVLCYVA"
FT   gene            336411..336944
FT                   /locus_tag="Pnap_0335"
FT   CDS_pept        336411..336944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0335"
FT                   /product="LSU ribosomal protein L6P"
FT                   /note="PFAM: ribosomal protein L6; KEGG: pol:Bpro_0490
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35658"
FT                   /db_xref="GOA:A1VJ30"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ30"
FT                   /protein_id="ABM35658.1"
FT                   /translation="MSRVAKMPVAIPEGVEIAIKDTQINVKGALGALALAQNAHVVIAS
FT                   NDGKLTFVPANDSRQANAMSGTMRQLVNNMVVGVTKGFQKKLNLVGVGFKAQAQGDKLN
FT                   LTVGYSHPVVMAMPAGITVATPTPTEVVIKGSDRQRVGQIAAEVRAVRPPEPYKGKGIR
FT                   YSDEKITIKETKKK"
FT   gene            336956..337321
FT                   /locus_tag="Pnap_0336"
FT   CDS_pept        336956..337321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0336"
FT                   /product="LSU ribosomal protein L18P"
FT                   /note="PFAM: ribosomal protein L18P/L5E; KEGG:
FT                   pol:Bpro_0491 ribosomal protein L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35659"
FT                   /db_xref="GOA:A1VJ31"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ31"
FT                   /protein_id="ABM35659.1"
FT                   /translation="MLTKKEQRLRRSRQTRIRIANQGVARLSVNRTNLHIYASVISGDG
FT                   TKVLASASTAEVEVRNEIGGSGKGGNVAAAQAIGKRIAEKAKAAGVEKVAFDRAGFAYH
FT                   GRVKALADAAREAGLQF"
FT   gene            337339..337857
FT                   /locus_tag="Pnap_0337"
FT   CDS_pept        337339..337857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0337"
FT                   /product="SSU ribosomal protein S5P"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5-like; KEGG:
FT                   pol:Bpro_0492 ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35660"
FT                   /db_xref="GOA:A1VJ32"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ32"
FT                   /protein_id="ABM35660.1"
FT                   /translation="MAKFQAKSQNDAPDDGLKEKMIAINRVTKVVKGGRILGFAALTVV
FT                   GDGDGRVGMGKGKSKEVPAAVQKAMEEARRNMTKVSLKNGTLHHNVFGHHGAANVMMAP
FT                   APKGTGIIAGGPMRAVFEVMGITDIVAKSHGSSNPYNMVRATMDALKNSTTASDIAAKR
FT                   GKSVEEIFG"
FT   gene            337871..338053
FT                   /locus_tag="Pnap_0338"
FT   CDS_pept        337871..338053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0338"
FT                   /product="LSU ribosomal protein L30P"
FT                   /note="PFAM: ribosomal protein L30; KEGG: pol:Bpro_0493
FT                   ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35661"
FT                   /db_xref="GOA:A1VJ33"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ33"
FT                   /protein_id="ABM35661.1"
FT                   /translation="MTKEIKVKVQLVRSPIGTQESHRATVRGLGLRGVNSVSELQDTPA
FT                   VRGMINKISYLVKVI"
FT   gene            338067..338498
FT                   /locus_tag="Pnap_0339"
FT   CDS_pept        338067..338498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0339"
FT                   /product="LSU ribosomal protein L15P"
FT                   /note="PFAM: ribosomal protein L15; KEGG: pol:Bpro_0494
FT                   ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35662"
FT                   /db_xref="GOA:A1VJ34"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ34"
FT                   /protein_id="ABM35662.1"
FT                   /translation="MELNTITPGQGAKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGY
FT                   HKVGFEGGQMPMQRRLPKRGFKSHLLKFNAEVTLTALEQLGLAEVDLLTLKQSGLVGQI
FT                   AKNVKIINTGSLSLAVKLTGISATAGAKTIIEAAGGSIA"
FT   gene            338518..339825
FT                   /locus_tag="Pnap_0340"
FT   CDS_pept        338518..339825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0340"
FT                   /product="protein translocase subunit secY/sec61 alpha"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: pol:Bpro_0495 SecY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35663"
FT                   /db_xref="GOA:A1VJ35"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ35"
FT                   /protein_id="ABM35663.1"
FT                   /translation="MATNSAQIAKTGKFGDLRNRLVFLLLALVVYRVGAHIPVPGIDPG
FT                   QLKELFKGQQGGILNLFNMFSGGALSRFTVFALGIMPYISASIIMQLLTYVVPTFEQMK
FT                   KEGESGRRKITQYTRYGTLGLALFQSMGIAVALESSPGLVLMPGFGFRMTAVFSLTAGT
FT                   MFLMWLGEQITERGLGNGISILIFAGIAAGLPSALGGLLELVRTGAMSILIAIVIVAVV
FT                   VLVTYFVVFVERGQRKILVNYARRQVGNKVYGGQSSHLPLKLNMAGVIPPIFASSIILL
FT                   PATVVGWFSTGESMRWLKDIASTLTPGQPIYVMLYASAIIFFCFFYTALVFNSRETADN
FT                   LKKSGAFIPGIRPGDQTARYIDKILVRLTLAGAVYITFVCLLPEFLILKYNVPFYFGGT
FT                   SLMIIVVVTMDFMAQVQNYMMSQQYESLLKKANFKT"
FT   gene            339911..340024
FT                   /locus_tag="Pnap_0341"
FT   CDS_pept        339911..340024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0341"
FT                   /product="LSU ribosomal protein L36P"
FT                   /note="PFAM: ribosomal protein L36; KEGG: pol:Bpro_0497
FT                   ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35664"
FT                   /db_xref="GOA:A1VJ36"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ36"
FT                   /protein_id="ABM35664.1"
FT                   /translation="MRVSASVKKICRNCKIIRRKGVVRVICTDPRHKQRQG"
FT   gene            340050..340415
FT                   /locus_tag="Pnap_0342"
FT   CDS_pept        340050..340415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0342"
FT                   /product="SSU ribosomal protein S13P"
FT                   /note="PFAM: ribosomal protein S13; KEGG: pol:Bpro_0498
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35665"
FT                   /db_xref="GOA:A1VJ37"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ37"
FT                   /protein_id="ABM35665.1"
FT                   /translation="MARIAGINIPPQKHAEIGLTAIFGIGRTRARKICEACEIDYAKKI
FT                   KDLTDSDLEKIRDHIAQFTIEGDLRRETTMNIKRLMDIGCYRGFRHRRGLPMRGQRTRT
FT                   NARTRKGPRKAAASLKK"
FT   gene            340429..340833
FT                   /locus_tag="Pnap_0343"
FT   CDS_pept        340429..340833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0343"
FT                   /product="SSU ribosomal protein S11P"
FT                   /note="PFAM: ribosomal protein S11; KEGG: pol:Bpro_0499
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35666"
FT                   /db_xref="GOA:A1VJ38"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ38"
FT                   /protein_id="ABM35666.1"
FT                   /translation="MAKSPNNSAAQRVRKKVRKNVADGIAHVHASFNNTIITITDRQGN
FT                   ALSWASSGGQGFKGSRKSTPFAAQVASEVAGRAAIEQGIKNLDVEIKGPGPGRESSVRA
FT                   LGALGIRINSIADVTPVPHNGCRPQKRRRI"
FT   gene            340964..341587
FT                   /locus_tag="Pnap_0344"
FT   CDS_pept        340964..341587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0344"
FT                   /product="SSU ribosomal protein S4P"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: pol:Bpro_0500 ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35667"
FT                   /db_xref="GOA:A1VJ39"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ39"
FT                   /protein_id="ABM35667.1"
FT                   /translation="MARYLGPKAKLSRREGTDLFLKSARRSISDKAKFDSKPGQHGRTS
FT                   GTRTSDYGLQLREKQKVKRMYGVLEKQFRRYFEEADRRRGNTGANLLSVLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAMTVNGQSVNIPSYMVKAGDVIAVRDKSKKQTRIAEALELA
FT                   KQVGLPAWVDVNADKGEGTFKKVPDRDEFAADINESLIVELYSR"
FT   gene            341683..342675
FT                   /locus_tag="Pnap_0345"
FT   CDS_pept        341683..342675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0345"
FT                   /product="DNA-directed RNA polymerase subunit alpha"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: pol:Bpro_0501 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase, alpha subunit domain
FT                   protein; RNA polymerase, dimerisation; RNA polymerase,
FT                   insert; SMART: RNA polymerase, RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35668"
FT                   /db_xref="GOA:A1VJ40"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ40"
FT                   /protein_id="ABM35668.1"
FT                   /translation="MQTNLLKPKTINVEQLGANRAKVTLEPFERGYGHTLGNALRRVLL
FT                   SSMVGHAATEVTIAGVLHEYSSIDGVQEDVVNILLNLKGVVFKLHNRDEVTLSLRKDGE
FT                   GPITAADIQTPHDVEIVNPDHVIMNLSHGGKIDMQIKVENGRGYVPGNVRRYGDESPKS
FT                   IGRIVLDASFSPVKRVSYTVESARVEQRTDLDKLVLEIETNGAVTAEDAVRASAKILVE
FT                   QLAVFAQLEGNELGAIINDPAPRSSQQFDPILLRPVDELELTVRSANCLKAENIYYIGD
FT                   LIQRTENELLKTPNLGRKSLNEIKEVLASRGLTLGMRLESWPPAGLDKR"
FT   gene            342759..343160
FT                   /locus_tag="Pnap_0346"
FT   CDS_pept        342759..343160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0346"
FT                   /product="LSU ribosomal protein L17P"
FT                   /note="PFAM: ribosomal protein L17; KEGG: pol:Bpro_0502
FT                   ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35669"
FT                   /db_xref="GOA:A1VJ41"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ41"
FT                   /protein_id="ABM35669.1"
FT                   /translation="MRHGHGLRKLNRTSEHRLAMLRNMMNSLLQHEAIKTTLPKAKELR
FT                   RVVEPMITLAKTPTLANKRLAFDRLRDRDMVVKLFAELGPRYQTRPGGYTRILKMGFRV
FT                   GDNAPMALVELVDRPDVSEEIKDDAAAAK"
FT   gene            343179..343255
FT                   /locus_tag="Pnap_R0003"
FT                   /note="tRNA-Met4"
FT   tRNA            343179..343255
FT                   /locus_tag="Pnap_R0003"
FT                   /product="tRNA-Met"
FT   gene            343429..343887
FT                   /locus_tag="Pnap_0347"
FT   CDS_pept        343429..343887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00143 probable insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35670"
FT                   /db_xref="GOA:A1VII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII9"
FT                   /protein_id="ABM35670.1"
FT                   /translation="MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARR
FT                   ERLGQTGPGAQHNHMPLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMF
FT                   KTLRRFGLTLKKNHPARGRANAARRRPGPPGLERQTTKPAGRSADLPR"
FT   gene            343907..344383
FT                   /locus_tag="Pnap_0348"
FT   CDS_pept        343907..344383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0348"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1"
FT                   /note="KEGG: sme:SMb21046 putative transposase of insertion
FT                   sequence ISRm10-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35671"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII8"
FT                   /protein_id="ABM35671.1"
FT                   /translation="MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDG
FT                   PLNGPAFRAWVEQFLVPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDF
FT                   NPIEQVFAKLKAMLRKTQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG"
FT   gene            complement(344375..345706)
FT                   /locus_tag="Pnap_0349"
FT   CDS_pept        complement(344375..345706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0349"
FT                   /product="sodium/proton antiporter, CPA1 family"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: pol:Bpro_4288
FT                   sodium/hydrogen exchanger; TC 2.A.36"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35672"
FT                   /db_xref="GOA:A1VJ44"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ44"
FT                   /protein_id="ABM35672.1"
FT                   /translation="MIEGNAFTLGILIIGLLLIIMTMASSFLSRLPLSAAMLYLGVGIA
FT                   IGPLGLGLLQIDALENKVLLERVTEIAVLISLFTAGMKLELPLRDRRWRIPVQLATVSM
FT                   IVTVGLITALGFYGLGLSLGAAVLLGAILAPTDPVLASDVQVSNPGDRDRLRFGLTGEG
FT                   GLNDGTAFPFVMLGLGLLGVHELGEGGWRWWMVDVLWAITAGLGLGYLLGTLVGRAIIY
FT                   LRVRHREALRSDEFIALGLIGLTYGVALLCHSYGFLAVFAAGLALRRIDEGKSARPSEQ
FT                   AEIPESVSGLSPDEQAASGAEAPANMMNAVQRFNSQLESFVEVGIVLAVGVLLATVEFE
FT                   RDALWFVPVLFVLVRPLAVYMGLLGTRVKGSQRNLISWFGIRGIGSLYYLLYAINHGIQ
FT                   PVLADRLLSMALSVVVASVIAHGISVTPLMTHYEARKTARAASP"
FT   sig_peptide     complement(345599..345706)
FT                   /locus_tag="Pnap_0349"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.784 at
FT                   residue 36"
FT   gene            complement(345932..347137)
FT                   /locus_tag="Pnap_0350"
FT   CDS_pept        complement(345932..347137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0350"
FT                   /product="phospholipase A1"
FT                   /note="PFAM: phospholipase A1; KEGG: pol:Bpro_4284
FT                   phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35673"
FT                   /db_xref="GOA:A1VJ45"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ45"
FT                   /protein_id="ABM35673.1"
FT                   /translation="MMTAQPMTFKLLPLNSLLFMAGLLAGGLAQAQTTPAAKPPANRPS
FT                   SLGWQVCQAIKDNASAQLTCFQQWAESQLPANTPPASMTTAPANPATGEPATQILLLPS
FT                   LNTEAPDGKPIGCRNTQYSELSRFWELQRGTDCDTFAIRGYRPISLAFVMSGGVNPPPV
FT                   IGAGSPPDYSHAETKIQLSVRTKIAKGLLKSGDSDEDDQDSLWFGYSQQSYWQLFNGGL
FT                   SRPFRTTDHEPELVYIYPHQIALPGGWNYRLSGVGLVHQSNGQSEPLSRSWNRTYLMGA
FT                   AEKVLGPESSLRLQGRIWDRMHESPADDDNPGIENFIGRAELNATWQINKANTLGVTLR
FT                   HSLHREAKGSTRIDWMMAPAASPNYTGLRYHVQLFNGYGDSLLDYNKRRNVLSVGLSLV
FT                   DW"
FT   sig_peptide     complement(347042..347137)
FT                   /locus_tag="Pnap_0350"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(347159..347731)
FT                   /locus_tag="Pnap_0351"
FT   CDS_pept        complement(347159..347731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35674"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ46"
FT                   /protein_id="ABM35674.1"
FT                   /translation="MASLAPQTLLFDRTALRRDQGLDRPMNSKILRLAIFLVAFSALAA
FT                   CANAQNKPESTCPPAHGMKAEQLHGRWAVRFTDPPPGLPERATMLLKRHAEFSESLAGT
FT                   VSRELGRAAGTAAIAGHSAQAALAGDLDEGMLLLDESSDNISITGTWNGEMKAGSCGQV
FT                   YQGRWKDTSRSAAPDAPEVFFTLTKLP"
FT   sig_peptide     complement(347582..347731)
FT                   /locus_tag="Pnap_0351"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.799 at
FT                   residue 50"
FT   gene            complement(347808..349937)
FT                   /locus_tag="Pnap_0352"
FT   CDS_pept        complement(347808..349937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0352"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: pol:Bpro_4281
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35675"
FT                   /db_xref="GOA:A1VJ47"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ47"
FT                   /protein_id="ABM35675.1"
FT                   /translation="MSSPSPASPIAHGLNLAQQEAVNYLHGPCLVLAGAGSGKTRVITH
FT                   KIGRLIQMGMKPEQIAAITFTNKAAAEMRERAKSLIGKSAKGVLICTFHALGVRMLRQD
FT                   GAALGLKPQFSILDSDDVTSILKDAGGSTDVATARQWQWTISAWKNQGLNAAQAEAQAS
FT                   GDEERLIARVMGHYEERLAAYQSVDFDDLIGLPLKLLKEHEDVRSKWQASLGHVLVDEY
FT                   QDTNATQYEVLKLLVGERGRFTAVGDDDQSIYGWRGATLDNLKKLPQDFPTLKVVKLEQ
FT                   NYRSTSAILRAANNVIGPNPKLFPKTLFSELGEGEPVRVVDCDSEEHEAERVVARIQSL
FT                   RAEGSLLPEGRQYREWKDFCVLYRANHMAKPFEKAFRKANIPYKVSGGQSFFDRAEIKD
FT                   LCSWMVLLVNNDNNQAFIRSIKTPKRGIGHTTLGALNTFADTYKLSLFESLFSNSLGSV
FT                   LPAKAVGSLQEFGRYLNDLEYRAKRCVGAEDARIFLTDWLKEIDYEKHLYDGEDSEKVA
FT                   SARWSNVMDFCDWMSQRCGGQIDDTSGATIEKPTKTMLEVVQTIALLSTISEREGDQNV
FT                   VTLSTLHASKGLEWPHVVLAGVNEGLLPFKLDDDDGQNTDSIALRLQEERRLMYVGITR
FT                   AQRTLAVDWLRKRKKGRDLIAGVPSRFIAEMALDKATIKEDPREKLKALRAEFAKKSAD
FT                   GLAAAAAAKAAYEGR"
FT   gene            complement(350042..351274)
FT                   /locus_tag="Pnap_0353"
FT   CDS_pept        complement(350042..351274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0353"
FT                   /product="acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein; KEGG:
FT                   pol:Bpro_1422 acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35676"
FT                   /db_xref="GOA:A1VJ48"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ48"
FT                   /protein_id="ABM35676.1"
FT                   /translation="MTLENHNTALDAWIDAHFDEEVQFLQALVRVPTDTPPGNNAPHAE
FT                   RTAELLENFGFEVEKYPVPTQAVKDYGLESLTNLVVRRQYGPGPVIALNAHGDVVPPGD
FT                   GWTHDPYGAEIVDGKLYGRASAVSKSDFASYTFAVRALEALGLPLQGGIELLFTYDEEF
FT                   GGELGPGWLLKNRLSRPDLLIAAGFSYQVITAHNGCLQMEVTVHGKMAHAAIPDTGIDA
FT                   LQGATAILTALYLQNQHYQSITSKVEGITHPYLNVGRIEGGTNTNVVPGKVTLRLDRRM
FT                   IPEENPAEVEAEVRRVILDAAATVPGITVEIKRLLMAGAWKPDNRNAALVQALQKHGEA
FT                   VFGEPIPTSGTPLYTDVRLFGAAGIPAAIYGAGPRTVLESNAKRADEHLVLEDLRRATK
FT                   VVARTLLELLQ"
FT   gene            complement(351271..353049)
FT                   /locus_tag="Pnap_0354"
FT   CDS_pept        complement(351271..353049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0354"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: pol:Bpro_1423 amidase,
FT                   hydantoinase/carbamoylase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35677"
FT                   /db_xref="GOA:A1VJ49"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ49"
FT                   /protein_id="ABM35677.1"
FT                   /translation="MTITLDQLNAASQAEFTQLLDGSYEHSPWIAAQAWAQRPFASLAQ
FT                   LKLALVRVVRESGREAQLALIRAHPELAGKAMLSKTLTAESSHEQGKAGLSNCTPAEFA
FT                   RIHQLNANYNAKFGFPFILAVRGPRGLGLAKPEIIATFARRLDNPPDFELAEALRNIHR
FT                   IAEIRLNDKFGHSPDLGNLVWDWAEQLGTHSDPGYAERGELTVTYLTDAHQACARQLAH
FT                   WMRDDCSFDEVSIDAVGNVVGIYHGSDPQARRLLTGSHYDTVRNGGKYDGRLGIFVPMA
FT                   CVRELQRQGRRLPFGLEVVGFAEEEGQRYKATFLGSGALTGHFDAAWLDQKDADGITMR
FT                   EAMTQAGLRIDDIPALRRDPARYLGFVEVHIEQGPVLNALDLPLGVVTSINGSVRYVGE
FT                   IIGMASHAGTTPMNQRRDAATAAAELALYVEKRGGSAENLVATVGMLEVPGGSINVVPG
FT                   RCKFSLDIRATTDEVRDACAADIVHELQALCQRRGLHYRLEETMRAAAAPSARAWQQRW
FT                   ERAVEALGLPVFRMPSGAGHDAMKLHEIMPQAMLFVRGLNAGISHNPLEAITNDDAELC
FT                   VRAFQNLLDQLATEFP"
FT   gene            complement(353046..353999)
FT                   /locus_tag="Pnap_0355"
FT   CDS_pept        complement(353046..353999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0355"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   pol:Bpro_1424 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35678"
FT                   /db_xref="GOA:A1VJ50"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ50"
FT                   /protein_id="ABM35678.1"
FT                   /translation="MPSNYPRDLAGYGRNPPHANWPGRARIAVQFVLNYEEGGENSVLH
FT                   GDAGSEQFLSEMFNPPAFPDRHLSMEGIYEYGARAGVWRLLREFEKRGLPLTVFGVGMA
FT                   LERCPDVAAAFMELGHEIACHGWRWISYQNVDEATEREHMARGMQAIERLTGERPLGWY
FT                   TGRDSPNTRRLVADHGGFEYDSDYYGDDLPFWLQVEKTDGSLAPQLVVPYTLDTNDMRF
FT                   ALPQGFSQGDDFFTYLRDSFDVLYAEGEERPAMLSIGMHCRILGRPGRLRALQRFLDHI
FT                   EQHDRVWVTRRIDIARHWKQVHPFNPETSFVWRACK"
FT   gene            354171..354527
FT                   /locus_tag="Pnap_0356"
FT   CDS_pept        354171..354527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0356"
FT                   /product="Transthyretin"
FT                   /note="PFAM: Transthyretin; KEGG: atc:AGR_C_4223 conserved
FT                   hypothetical protein PA1518"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35679"
FT                   /db_xref="GOA:A1VJ51"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ51"
FT                   /protein_id="ABM35679.1"
FT                   /translation="MGHLSTHVLDTMHGCPAAGMKLTLQRMDGAHVETLKEVVLNQDGR
FT                   SDGGPLLDASAMAAGRYRLLFEVGDYFRARGVALPEPAFIDTVPVDFGIADAQGHYHVP
FT                   LLVSPWTYSTYRGS"
FT   gene            354524..355741
FT                   /locus_tag="Pnap_0357"
FT   CDS_pept        354524..355741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0357"
FT                   /product="protein of unknown function DUF989"
FT                   /note="PFAM: protein of unknown function DUF989; KEGG:
FT                   pol:Bpro_1430 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35680"
FT                   /db_xref="GOA:A1VJ52"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ52"
FT                   /protein_id="ABM35680.1"
FT                   /translation="MMSAYLPYALDWANLLLRWAHVITAIAWIGSSFYFVFLDSSLTRP
FT                   VDPDLVAKGVDGELWAVHGGGFYHPQKYMVAPQQMPDNLHWFYWEAYSTWLTGFALFTV
FT                   LYLFNAATFLVDKNIYDWSAGAAIAAALGFLVAGWGVYDTVCRVFGQKKNGDLIVGAGL
FT                   LVFVVFASWLACQLFAGRAAFLLVGAMLATAMSANVFVWIIPGQRKVVAQLKAGQPVNP
FT                   VYGWRAKQRSVHNTYFTLPVLIAMLSNHYGWLSVGAQNWLVLVLLMLAGALIRHSFVAR
FT                   HKAGVQGRRAPWEYAVAGTVMLAGLVIWMAPAPPSAAAIAAAAKPAGFAEVKSVIDQRC
FT                   VMCHNAQLQNKGIALHTPELLGQNAQAVYQQAVVLRLMPFNNATQITEDERAVIKRWFE
FT                   AGAPVN"
FT   gene            complement(355874..356878)
FT                   /locus_tag="Pnap_0358"
FT   CDS_pept        complement(355874..356878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0358"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5; SMART:
FT                   AAA ATPase; KEGG: bur:Bcep18194_A6396 AAA ATPase, central
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35681"
FT                   /db_xref="GOA:A1VJ53"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ53"
FT                   /protein_id="ABM35681.1"
FT                   /translation="MESIQVVPQAPTFTLPVAKVRSVYQIADVERKLGKLQNSEPREHD
FT                   NLRATYERMLERGPERFQMKPSGIPEMAPLYDALPNFTDVLDDVRRHVALSHDSTDGLE
FT                   VTPMLLLGQPGIGKTHFARQVADLIGTGMNLVSMGSLTAGWLLSGSASQWKGAKPGKVF
FT                   ESLVDGRYANPVIVIDEIDKAASDAQYDPLGSLYSLLEHDTASSFVDEFAEVPIDASQV
FT                   LWITTANDARGIPNPILNRMNVFEIQPLTPGQARHIARRLYQSIRAGHNWGTRFDDAPS
FT                   SDVLDKLATLVPREMRRALMAAFGNARLASRGMLKVDDLPRSAASKGRIGFMQ"
FT   gene            357176..359512
FT                   /locus_tag="Pnap_0359"
FT   CDS_pept        357176..359512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0359"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: pol:Bpro_4276 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35682"
FT                   /db_xref="GOA:A1VJ54"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ54"
FT                   /protein_id="ABM35682.1"
FT                   /translation="MTGSKLIPLSGTVPGTPGRKRSDEAGRASEAQFRLLMDAMPQIVW
FT                   MMRPDGQATYFNQRWLDYSGWSLKDSLGHGWIGLVHPDDSLRVSRLLVQACGGGEPCEI
FT                   ECRLRRADGVYRWMLGRTAAQSDAAGRTTQWLGTLTDIDELKQSREILEKDLAMNRIAG
FT                   RVARLGGWAIELPERRLIWSDENCLIHDVPPGYQPTLEEGIGFFFPEHRAIVARHVQDC
FT                   AEHGIPYEFVLPKRTATGRHIWVRSIAEAVRDEAGKIVSIQGAFQDISEQKEAEARMLA
FT                   LEARLTATLESITDGFCLIDKDWKFTFMNGQAQRMLKRCPEDLLGKILWQEFPEAVGTR
FT                   IERECRLSMQEQRTIRLETFYLPLKTWFHFHIYPTEAGLAVYFQDITQRRTEQAQLRLL
FT                   ETAVSRLNDMVVIMEAEPFDASGRRIVFVNDAFERQTGYSRSDIIGKTPTLLWGANTCH
FT                   PEVERILSAMDNWQPVRAEVVIYTKAGKELWVETDIAPIANVSGKFTHWVAVERDITER
FT                   RQQQQEILSLNGELEERVLLRTAQLATATRELESFAYSVSHDLRSPLNTIHAFSQLLLK
FT                   IDGGQISDKGKHYLDRIGVGVKQMGDLIEGLLALAQLSREQIKSEQVDLSNIARRIEQD
FT                   CREREPQRQAQLRIQDGLSAQGDARLLSAVFQNLLGNAWKFTSRQSLAHIEVGSESGVD
FT                   GDTVFFVKDNGAGFDMAFAHKLFGTFERLHSPGDFSGTGIGLATVKRIIERHGGRVWAE
FT                   SKLNEGARFFFTLGRKDGAQTSRAT"
FT   gene            complement(359491..360561)
FT                   /locus_tag="Pnap_0360"
FT   CDS_pept        complement(359491..360561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN4898 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35683"
FT                   /db_xref="GOA:A1VJ55"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ55"
FT                   /protein_id="ABM35683.1"
FT                   /translation="MRLIQPPSRPMSKQISPAPSPKPIAISIAAPIKIASYVLAFLLCV
FT                   GTLVYGLLPGLLAVCLGYLLVVALAGEGRIRGPRLSPALAAAVVVLLPLIGLGVLLANA
FT                   KGMAFGVVGQYQALLHYLASTVLEIRQKLPADLAIHLPDELTEAQVWLAAYLKSKAQAL
FT                   TGAGTAGLHGFLLAYVGLVVGALIKGTFRMPTSAPLRFEIRMRAGHFIEAFRQIVVAQF
FT                   WIAAVNAFFTAVFLLAVLPLFGVHMPYIAELVTLTFFAGLIPIVGNLICNSVITLVGVS
FT                   VSPAVGLACLVFLILIHKTEYIINAKILGKQTNTAAWELLAAMFVGEAVFGLPGLVAAP
FT                   LYYAYAKKELQVARLV"
FT   gene            360685..361191
FT                   /locus_tag="Pnap_0361"
FT   CDS_pept        360685..361191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35684"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ56"
FT                   /protein_id="ABM35684.1"
FT                   /translation="MKPKRLPGFTSFLCPYKKPENWRKASLQANQGNFYGQIQPQPSVY
FT                   IAWFVVSISLDASHSQPVQSFSSHVMNNSSSLRCSSCGFSVFNRRYPNCERCGAQLPQD
FT                   VAYSREEVAALRKRDMDEELARQAEKRPSPPGKSGDDSWLYFSFSGDSPDSSCSSDGGS
FT                   CSGAD"
FT   gene            complement(361263..363392)
FT                   /locus_tag="Pnap_0362"
FT   CDS_pept        complement(361263..363392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0362"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: pol:Bpro_4265 primosomal protein N'; TIGRFAM:
FT                   primosomal protein N'; PFAM: helicase domain protein; type
FT                   III restriction enzyme, res subunit; DEAD/DEAH box helicase
FT                   domain protein; SMART: DEAD-like helicases-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35685"
FT                   /db_xref="GOA:A1VJ57"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ57"
FT                   /protein_id="ABM35685.1"
FT                   /translation="MSHWLQIVVATPAHSAIAGPLTYRSALLLRPGTLVRVPFGRREVL
FT                   GVVWQVLPDSGGMPEASIRDIAGVLDGLAPLSSTWRRLVAFTAGYYQRSLGEVALAALP
FT                   PQLRDLTTLQLTRRLKRTVVDTSHPQDTTDLIALSAQQACAIAEFDAETSEKQRPALLF
FT                   GATGSGKTEVYLRAAAKVLEQDPEAQVLVMVPEINLTPQLQARFEARFAHLGRERVVPM
FT                   HSGLTPAQRLKGWLAAHSGQARLVLGTRMAVFASMPNLRLLVVDEEHDPSYKQQEGARY
FT                   SARDLAVYRARLETRDREHPHGACRVLLGSATPSLESWQATIVGRYQRLNMNERIGASP
FT                   AGQPGGLPTVRRVDMNHQPKHCVIAPPLLAAIGERVARGEQSMIFLNRRGYAPVLACHD
FT                   CDWKSDCPHCSAYRVFHKIDRTLRCHHCGFTERVPRACPSCGNIDIAPVGRGTERLEEH
FT                   LAELLANVTRPDGGPVRIARIDADSTRLKGSLESQLASVHAGEVDVLVGTQMIAKGHDF
FT                   RHITLVAAINTDSALFSSDFRAPERLFSLLMQAAGRAGRDAQRSAASEMWVQTFHPDHP
FT                   LFEALKRHDYPDFAEQQLAERQAAGLSPFGFSALIRADAKTQEVAQGFLNAAAEAAQTQ
FT                   QLPGHAHVMAYPAVPMTIQRVANIERAQMLVESPSRKALQGFLAAWQPLLFETRRQAEF
FT                   KSLVRWAIDVDPIAI"
FT   gene            complement(363768..364877)
FT                   /locus_tag="Pnap_0363"
FT   CDS_pept        complement(363768..364877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0363"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: pol:Bpro_4264 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35686"
FT                   /db_xref="GOA:A1VJ58"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ58"
FT                   /protein_id="ABM35686.1"
FT                   /translation="MFAPLQNDTFLRACLRQATDHTPVWLMRQAGRYLPEYKATRAKAG
FT                   SFMGLATNTDYATEVTLQPLERYPLDAAILFSDILTVPDAMGLGLSFALGEGPRFATPV
FT                   RDEAAVNKLEVPDMNKLRYVFDAVTSIRKALGGRVPLIGFSGSPWTLACYMVEGSGSDD
FT                   YRLVKTMLYQRPDLMHKMLAINADAVALYLNAQIEAGAQAVMIFDSWGGVLADAAFHTF
FT                   SLAYTARVLSQLKREHKGVTIPRLVFTKGGGQWLESMKQLDCEVLGLDWTVNLAKARAL
FT                   VGENGPNAKALQGNLDPNVLFANPAQIEAEVAAVLNSFGAPHTDLTQTGPTQIFNLGHG
FT                   ISQHTPPESVEVLVRAVHAHSRSLRKQQG"
FT   gene            364982..365347
FT                   /locus_tag="Pnap_0364"
FT   CDS_pept        364982..365347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ59"
FT                   /protein_id="ABM35687.1"
FT                   /translation="MHISDQEYFRSCIARERQLAQLLGHRHIEECYESAGTLWDNNQAL
FT                   PKWTRDWRACGPLMTEYGITVTYGDGPGHGGLARIGATTVHFTDHPTRDRAVMYGIVKE
FT                   LIFLIEHGKVGRPVQAA"
FT   gene            complement(365438..365770)
FT                   /locus_tag="Pnap_0365"
FT   CDS_pept        complement(365438..365770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ60"
FT                   /protein_id="ABM35688.1"
FT                   /translation="MDALQESCPSFGGAVIATPDGLVLVATRLFSGDTPAACAAGVVAQ
FT                   VDDCLSALKAGRVDALMMWTPGGLWFIGRLVNDHVLLLSATDSHCAGAVRLAAQVAVQK
FT                   LNAVLH"
FT   gene            complement(365781..366377)
FT                   /locus_tag="Pnap_0366"
FT   CDS_pept        complement(365781..366377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35689"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ61"
FT                   /protein_id="ABM35689.1"
FT                   /translation="MSRYLLPRPGGVLTWLSVRPPSLERRLFEHLLGAPAAVELNVQAL
FT                   ASALCHPVQAIARALFALNRQASIEVQDGAAPLCAAASPALRAGLRQGIAGLAQDLIDI
FT                   SGGCGEIMLASDDGFCIAQADLSAQRAQALAAHLPRDDGSAMQFRMQLCFADRTLYFCA
FT                   SSRIDLKHPVMLRLGADLVQGCQLQPLQRNHDAEK"
FT   gene            complement(366415..366819)
FT                   /locus_tag="Pnap_0367"
FT   CDS_pept        complement(366415..366819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0367"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   noc:Noc_1488 Roadblock/LC7"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35690"
FT                   /db_xref="GOA:A1VJ62"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR037587"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ62"
FT                   /protein_id="ABM35690.1"
FT                   /translation="MNFDNSSAEVTASKIRAALRSLCASSDTVEAAALVSHDGLIIASV
FT                   MSREVDVDRFGAMCASLLALANRAAKEVRRGDLRQIILDGSLGPMLLTRAGETGVLAVA
FT                   ATPSAKLGQLILDTRTTARAVSELTEPREA"
FT   gene            complement(366906..367313)
FT                   /locus_tag="Pnap_0368"
FT   CDS_pept        complement(366906..367313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35691"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ63"
FT                   /protein_id="ABM35691.1"
FT                   /translation="MSALDNALQKAVTSIPECVAAGYVDLSSGMILSMKSVDSHPGEVF
FT                   DLLAAATTDLFQGPNVSAIENIFRKARGLPDNNEHHYFQEIIVNSDNLIHVFLRGKRQQ
FT                   QVACFVCRKGANLGMVLTKSRMAMPTIESSL"
FT   gene            complement(367341..368777)
FT                   /locus_tag="Pnap_0369"
FT   CDS_pept        complement(367341..368777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0369"
FT                   /product="phosphate ABC transporter ATP-binding protein,
FT                   PhoT family"
FT                   /note="PFAM: Dual specificity protein phosphatase; ABC
FT                   transporter related; SMART: AAA ATPase; protein tyrosine
FT                   phosphatase, catalytic region; KEGG: sit:TM1040_3766 ABC
FT                   transporter related; TC 3.A.1.7.1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35692"
FT                   /db_xref="GOA:A1VJ64"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ64"
FT                   /protein_id="ABM35692.1"
FT                   /translation="MKPVLVLQGFGVAFGTRTILLDMSLSIPSRGCTVLLGPSGTGKST
FT                   LLRSLAGLNDANPSMRTWGQRIYEGEPLSPLHRPAMVAQKADFLMATVQDSLVTKLPQR
FT                   SSLTRARQLDMVRDFLEKTGQAGLTAKLATPVIGLPPHERQIIAILRQVLSAPALLMVD
FT                   EPTANLPPDGAQAVLDLLEILASERAVLMVSHHLAQTRQIAQEVVLMADGVVQESATKD
FT                   DFFLRPQSAAAQHYLRSGSCPEAGIADQTAGDALAAAHEPARQASVKPGLPAMADKVQP
FT                   AASLPARPAMPHWQPDPAAKSAFCGPRGFVWLIEGKLAGTPLPGIVHDTQQDLNALRNA
FT                   GITRLISLTETPFDATLAALYDIQCTALPIRDMNAPTSTQAWFLCESIDRCLQRGEVVA
FT                   VHCKAGLGRTGTVLAMYLIWLGAGQVGGAGAMAQVRRLEARMIQSIEQEKFLEKFAQLV
FT                   AHPPTGKPFSSPAFNAKKPS"
FT   gene            complement(368774..369337)
FT                   /locus_tag="Pnap_0370"
FT   CDS_pept        complement(368774..369337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0370"
FT                   /product="protein of unknown function, ATP binding protein"
FT                   /note="PFAM: protein of unknown function, ATP binding;
FT                   KEGG: noc:Noc_0133 conserved hypothetical ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35693"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ65"
FT                   /protein_id="ABM35693.1"
FT                   /translation="MGPVGSGKTEAIKSISDIEVINTDVRATDDVRKLKSHTTVSMDVG
FT                   VLHLSGHDKLRLYGAPGQDRFDFMWDILLLQAKGVALLLNHASADPLAELDHYLQAIRE
FT                   RAPGNGLPMVIGITHIDEKPERPLSIYEDHLRQEKIVFYGVMPPVIEVDARLRSHVRSL
FT                   LLVMVAQLEMAARFPKVIPRLAAR"
FT   gene            complement(369366..369740)
FT                   /locus_tag="Pnap_0371"
FT   CDS_pept        complement(369366..369740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35694"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ66"
FT                   /protein_id="ABM35694.1"
FT                   /translation="MQTLSNEISFLDSNLQHRILQLASWPPLSELLLDTAPQVTRICAL
FT                   LARKPSVGMLIPAMLDMPPQTTYPLLRKLYDKGHICALGGTATAEPTARPRAEPAKTPE
FT                   LPAATSSFLGKVWQRLTSRK"
FT   gene            complement(369880..371205)
FT                   /locus_tag="Pnap_0372"
FT   CDS_pept        complement(369880..371205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0372"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pol:Bpro_4260 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35695"
FT                   /db_xref="GOA:A1VJ67"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ67"
FT                   /protein_id="ABM35695.1"
FT                   /translation="MPQNHLPKVKSQYEALPYPPRNPQDEPKRLVQTWLEDLPMINHYC
FT                   FAGKQSFSNGFRALVAGGGTGDATIFLAEQLRHTNAEIVHLDMSHASIVVAQERAKIRG
FT                   LTNITWTHYSLLSLPALGLGKFDYINCSGVLHHLADPDLGLRVLLSALKPEGAIGLMLY
FT                   ATTGRTGVYQMQALMRQVNGVGTGQEADDKRKIANTRDLLGSLPASNWFMGSESLYHDH
FT                   KMGDAGIYDLLLHSQDRSYSVGELFDWLGSQHGMHLNFSDVQRGRSPYLPHMVLGAKPP
FT                   AMAAELRQLPLRQQYEMAELMIGNIITHSLYLTPDAACAAPYGDAAYIPFFYHEPLTGE
FT                   IAAQVFGSNKGQPFRLTHQHSGVSVMVNPGKYGAKILRLIDGRKSFGEIFEAFRAGWHG
FT                   QAAAPDNAALFADFAESYDTLNALERLLLRHPAAAATNAQGA"
FT   gene            371606..372061
FT                   /locus_tag="Pnap_0373"
FT   CDS_pept        371606..372061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0373"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_2347 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35696"
FT                   /db_xref="InterPro:IPR025358"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ68"
FT                   /protein_id="ABM35696.1"
FT                   /translation="MERGDDQRTKEDIGKYGCSVMHVFDADGDLPSFAYSIGIQQETGA
FT                   PEAFVIGLKRPMAHSVINEYNRRTREGERFEIGKYYAGFLGGFEVCIGAVPRSTYDEYF
FT                   GQNIDFYDGREFDVVQIIYPTTKGVWPWAPDASEAFIQGQPILAKQG"
FT   gene            complement(372171..372905)
FT                   /locus_tag="Pnap_0374"
FT   CDS_pept        complement(372171..372905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0374"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: pol:Bpro_4259 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35697"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ69"
FT                   /protein_id="ABM35697.1"
FT                   /translation="MREFRGALPLFVFLLAALAGCGSSVLGTRGEAQVAPLRPTELAQS
FT                   DVNRMATLGMRDNLDSLLRIADKLYRRNPAEWRRSGASSREAALAELRQAIDSATPWPE
FT                   LQGKRDIAALSLALSPDFTGDRVAAFVVASADMLVTAHGGKTKLYLIDSLDAQHLYNAA
FT                   RNIEIAVWLLSSRRNAAGQPLLLADDISGLDRNLSFEREFGKVIGRLDLLAEVVTEKYR
FT                   RAVISYVQNLAGGTFLQFLPVR"
FT   sig_peptide     complement(372822..372905)
FT                   /locus_tag="Pnap_0374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.295 at
FT                   residue 28"
FT   gene            complement(372909..373373)
FT                   /locus_tag="Pnap_0375"
FT   CDS_pept        complement(372909..373373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0375"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   pol:Bpro_4258 CoA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35698"
FT                   /db_xref="GOA:A1VJ70"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ70"
FT                   /protein_id="ABM35698.1"
FT                   /translation="MQHLPAAERIPYILNHCRTIAVVGLSPKPHRASFDVARYMQAAGY
FT                   RIIPVNPNAAEVLGEKAYATLQEAARHEKIDLVNCFRNSEDIPPIVDEAIAIGARAVWM
FT                   QLGIAHPEAAARAEAAGLLVVQDHCIKIDHRVLMSSGLLKPLAQPAAPAR"
FT   gene            complement(373443..375590)
FT                   /locus_tag="Pnap_0376"
FT   CDS_pept        complement(373443..375590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0376"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein, transmembrane
FT                   region; KEGG: pol:Bpro_4257 thiol-disulfide interchange
FT                   protein DsbD-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35699"
FT                   /db_xref="GOA:A1VJ71"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ71"
FT                   /protein_id="ABM35699.1"
FT                   /translation="MNFHRILSALFLIAACALPVCANAQNDLIKTSQARPVVTTEQVRA
FT                   ELLAWAPEGVEPGKPVWLGLQLAHQPEWHTYWKNSGDSGLPTMLEWQLPAGVTAGEIAW
FT                   PTPRKIPIGTLANYGYEGTVLLPVPLTVAPGFNAAQLDVKLKAAWLVCRKECIPQEGEF
FT                   TLSLPARGSTAASGALFQAAFDATPKPLPTGGSQIEVSGKALKVSLAGLPAALQGKTLA
FT                   LFPETAGIIEPAAPWRQEWQGALWTAELPLSAQRTDSPARLPLVVALGDAAWRIDAPVS
FT                   GDWPAAASVAVVSPALQAALKANAAAPAAPIQPGQPPLGLLAALLGALLGGLILNLMPC
FT                   VFPVLAIKVVGFASQKSQAARLTSGLAYSAGVLLSFLALGALLLGLRAAGDQLGWGFQL
FT                   QNPAVVAALAALFTLLGLNLAGLFDFGVILPSRVVNLQAKNPSVNAFLSGVLATAIASP
FT                   CTAPFMGASLGYAVGLPALQALAVFGAIGIGMALPYLAASALPAVARALPRPGAWMVTF
FT                   KQLMAFPMFATVAWLVWVLGQQSGIDGAGALLALLVLLALAVWSFSLRGTARRAIATVS
FT                   VALCAFAIWAIGPNIIKPVIPPAAAASARWQDWQPGRVEQLAAQGQSVFVDFTAAWCVT
FT                   CQYNKKTTLANADVLADMDAKNVALLRADWTRRDPAVTKALAELGRSGVPVYVFYKPGR
FT                   APVVLSEILSVSDVRAELAKL"
FT   sig_peptide     complement(375516..375590)
FT                   /locus_tag="Pnap_0376"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 25"
FT   gene            375774..376268
FT                   /locus_tag="Pnap_0377"
FT   CDS_pept        375774..376268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0377"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   plu:plu2740 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35700"
FT                   /db_xref="GOA:A1VJ72"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ72"
FT                   /protein_id="ABM35700.1"
FT                   /translation="MHKMRNTMPAPPLAISNAMATRLGALGQQIRTRRKALRLSATVAA
FT                   EAAGLSRVTLHRMEKGAPAVTMAAYLNVMAALGLDFSLSLPADPAAVAPAADHTGWIPA
FT                   RVRLGDYPQLKQLAWHVQGVDELTPAEALSIYERNWRHIDVAALQPHEQQLVDALRLAL
FT                   T"
FT   sig_peptide     375774..375836
FT                   /locus_tag="Pnap_0377"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.371 at
FT                   residue 21"
FT   gene            376278..376976
FT                   /locus_tag="Pnap_0378"
FT   CDS_pept        376278..376976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH01166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35701"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ73"
FT                   /protein_id="ABM35701.1"
FT                   /translation="MFERPHHQRIAQVLRALNAPLLRENLCLFGGGTAIALRYGEYRES
FT                   VDMDFLVSSLASYRNLRQLLTNPGGIAGIVHAQAAPLEQIKEVRADQYGIRTLLRVDGQ
FT                   PIKFEIILEGRIQLAAPTAKDEVCGVATLSPLDMAASKLLANSDRWGDDGVFNRDVIDL
FT                   AMMKPSLALLRQALLKAHGAYGQAIRQDLDKALLRLQTRQGWLERCMQAMAMVEPKAVV
FT                   WQRLRALRRN"
FT   gene            complement(377049..377372)
FT                   /locus_tag="Pnap_0379"
FT   CDS_pept        complement(377049..377372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0379"
FT                   /product="protein of unknown function DUF167"
FT                   /note="PFAM: protein of unknown function DUF167; KEGG:
FT                   pol:Bpro_2664 protein of unknown function DUF167"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35702"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ74"
FT                   /protein_id="ABM35702.1"
FT                   /translation="MSRGQIRNITGESFFAWDGDVLVVNILGKPSAGKDAIGKPKGTQL
FT                   KVSVTAAPLAGKATDHMVRFLAPLFGVAVADIEVVFGRENVNKQLRIRAPKKLPAVFLP
FT                   PAP"
FT   gene            377538..378107
FT                   /locus_tag="Pnap_0380"
FT   CDS_pept        377538..378107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0380"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: rfr:Rfer_2432
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35703"
FT                   /db_xref="GOA:A1VJ75"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ75"
FT                   /protein_id="ABM35703.1"
FT                   /translation="MNRQSTSHYDALSLAFHWLTAIVVTIAFILGPEGFGRLMRQGIDP
FT                   ATRSDIVWHETLGLTVLALTVLRLLWLALRPAAPQIPMAGWMHISAKLMHAALWALLLA
FT                   LPVTALLALGSESHPLTLLGGVRIDQMPLIANSAIAKLADWGEVHQFLGDAIMWLAGLH
FT                   AAAAIYHHVIVKDGVLLSMLPAKRPR"
FT   gene            378109..378603
FT                   /locus_tag="Pnap_0381"
FT   CDS_pept        378109..378603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gsu:GSU2680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35704"
FT                   /db_xref="GOA:A1VJ76"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ76"
FT                   /protein_id="ABM35704.1"
FT                   /translation="MASVQDRALKTIAAFEGLKGLAAIASGLGLLSLLHHDIRHLALEL
FT                   VGHFGLNPAQHFPSLFLHYVDLLNSTPVSTLMLLLCGYAALRLAEAYALWRERAWGALL
FT                   GALSGGIYIPFEWRHLLHRPSLISAGVLAVNVLIVVFLAYRLWRRRVAIRSSKNSIELW
FT                   G"
FT   gene            378619..378939
FT                   /locus_tag="Pnap_0382"
FT   CDS_pept        378619..378939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35705"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ77"
FT                   /protein_id="ABM35705.1"
FT                   /translation="MMKKVTKGVAKRLIFSLIALSALGGCAVYGPPGPYVYGTDVNGQP
FT                   IYAPAPVNAAPSYYSPYYYDPVYVGPPVFFNFGFYSRGGGFHGGGRGFHGGGRGSHGGG
FT                   HR"
FT   sig_peptide     378619..378735
FT                   /locus_tag="Pnap_0382"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.416 at
FT                   residue 39"
FT   gene            complement(378995..379996)
FT                   /locus_tag="Pnap_0383"
FT   CDS_pept        complement(378995..379996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB1683 phage-related hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35706"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ78"
FT                   /protein_id="ABM35706.1"
FT                   /translation="MSASLSLDLAARLWRCALPRGISKLVLQCFCHHVNNESGLSWPSI
FT                   ARVALMCGLSARAVQGHVRGLVTAGILRPRLRIGHATRYTVHLDGLMPLVFAAAPGAGA
FT                   VDHPAPTPAAFAVTPAENGTPPPQISTPTPAESAPITVLNRQENTEGTGAPALPAALMV
FT                   VDGVNPEVLADFAAIRQAKRTGPVTAAVIEAIGQQARLAGLSLEQALQTCCEPRRRWAR
FT                   FEAGWLQATPGGRAISPAATATTAAAPAPALWKPPVARPAAPEVVAAGRARIAALRQAT
FT                   VGAGLGSSKGCGWAHAAIEKHQSGQPVRRAVLRDACAALRLNPASLAAARMH"
FT   gene            complement(380445..382046)
FT                   /locus_tag="Pnap_0384"
FT   CDS_pept        complement(380445..382046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gsu:GSU0552 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35707"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ79"
FT                   /protein_id="ABM35707.1"
FT                   /translation="MDHGLFSDKVPACFTSIGLAKIASDTLKEIFEETDEAKLKKKIKP
FT                   YSHDYIRYDALRDINIPRHLGIPHPGSYAIQALALSKHWQVIAEHCNQPDPSISRVHVR
FT                   KMGSDSIFKMNYKGSERYQLEEDEINWMAGAQFVVKADVASCYPSIYTHSIPWALHDKI
FT                   TTKKNQKITELAGNLLDKCTQNTRDGQTNGLLIGPHASSIISEIILTKIDTDLQKKYKK
FT                   IVRHIDDYTFFADTFDEAEKFVKDLGLCLRSYEMSLNYKKTSILPLPTPSVEDWIHRIN
FT                   SFDFPKDQEIGFSKIRSFLDLALECSRIAGKSTPLSYAIKILAGNTNSIKLNIRAKRLY
FT                   VLEVMNMALVYPYLVPLLDKAVFDKYGHPGLADKVSKLSTSLIRLGVRKLYFDIIAHAF
FT                   YYALKHNVTLDLKDNEFIEIINLNDCISNVMLFAYATKHNLYEVIKEINNFGKLLKLAD
FT                   SREKDKNWLLIYQLWSVSELNGSGQKFLADLKSINFQFLVVPQPVVEVETPDESIISPL
FT                   DSISIDNQLVNVTEQK"
FT   gene            382417..382674
FT                   /locus_tag="Pnap_0385"
FT   CDS_pept        382417..382674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0385"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35708"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ80"
FT                   /protein_id="ABM35708.1"
FT                   /translation="MPCPAGAKVRSTAALLVYEADRLAINKIAASAYAASTKSRFSLKN
FT                   QPRTASTQRKHRLQRRQQLLQRRRMHGTQALHQPHLVQRA"
FT   gene            382949..383554
FT                   /locus_tag="Pnap_0386"
FT   CDS_pept        382949..383554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0386"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35709"
FT                   /db_xref="GOA:A1VJ81"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ81"
FT                   /protein_id="ABM35709.1"
FT                   /translation="MITTMHTVSETEIFQKYAEGVWLEAERVEFINWIAANPLAGDVVP
FT                   GSNGCRKVRWSRSGRGRRGGARVIYFNELEGRIWLLIVYAKANSTTCRLHFWHNLNTRW
FT                   NMAKPIDAEMEQFQNDLLASVRQMKAGKAARTTVVALTPAADARAKVGMSQSEFAALLG
FT                   VSVRTLQDWEQGRREPSGAAKTLLRIAARTPEAVRLAV"
FT   gene            383746..385404
FT                   /locus_tag="Pnap_0387"
FT   CDS_pept        383746..385404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0387"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: pol:Bpro_4256 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35710"
FT                   /db_xref="GOA:A1VJ82"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ82"
FT                   /protein_id="ABM35710.1"
FT                   /translation="MPSPQAPDSTFSPAIVLATLNAKYIHAALGLRCLLANLDRHGGAG
FT                   LRAVTQLREFTIGQRPVQIVESLLALSPKVIGLGVYIWNVVETTQVVRLLKTLRPDIKI
FT                   VLGGPEVSFETGEQEICRLADHVVTGWGDVSFPKLCRALLDGPQPLMKIIAGEQPPLDA
FT                   LALPYGEYTDEDLAKRLLYVEASRGCPFKCEFCLSSLDKTAWAFELDRFMAEMALLYRR
FT                   GARNFKFVDRTFNLKVDFSVRILQFFLDRMKDEAGAVQAAPGLFVHFEVVPDSLHERLK
FT                   ALIAQFPAGSLQFEVGIQSFNPEVQQRISRKQDNAKTAENLRWLVTQSQAHVHADLIFG
FT                   LPGETLQSFAEGFDRLHELAPHEIQFGILKRLRGTPITRHTLDFAMAYDPQTPYTILQT
FT                   STIDFATMQRIQRFARYWEMVANSGRFSAALRLLLRDGPEVAGSAFHHFLDFSDWLWRT
FT                   TAKTHEFALEKLVDVLFEHLTAVRGLNDDAVRAALLADYRASGARGRPQCLADLLAAGR
FT                   ADLPAGAAKPRSERQGRHVSQQTHRDAIQQAAAAA"
FT   gene            385516..385935
FT                   /locus_tag="Pnap_0388"
FT   CDS_pept        385516..385935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0388"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ilo:IL0085 uncharacterized conserved coiled
FT                   coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35711"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ83"
FT                   /protein_id="ABM35711.1"
FT                   /translation="MKKSLSVIGLVLVVAAASVACDKIKSPMPELQKSPAPSGQASPPE
FT                   GERTAFAQAAQKELDELKVTIAEFKAKAEASGAQTKTRLGEEVKKLEADLGEAQQRLAA
FT                   LKAATVESWNQVKASFSSSLEQLKRGVENFRKNPV"
FT   sig_peptide     385516..385578
FT                   /locus_tag="Pnap_0388"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            385951..387585
FT                   /locus_tag="Pnap_0389"
FT   CDS_pept        385951..387585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0389"
FT                   /product="thermosome subunit"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rfr:Rfer_3009 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35712"
FT                   /db_xref="GOA:A1VJ84"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJ84"
FT                   /protein_id="ABM35712.1"
FT                   /translation="MKPKQLIFHDAARGKIWRGVEALAEAVKVTLGPRGRTVILERDFG
FT                   PPQIVNSGVLVAKSIELEDRFENMGAQLLREVAARTSEMAGDGTTTATVLAHGMIQEGL
FT                   RYLAGGMNPMDLKRGIELAIDTVVAELQRMAKPCASSQEIAHVAAISANNDRSIGDLLA
FT                   SAIDKVGREGAISIEDGSGLVSVLEVVEGMQFDRGFLSPYFINNAERQSAVLEDVSILL
FT                   CEGRLTSLNDLLPLLEEVVKAGRPLLVIAEDVDSDSLAALVINTMRGTLKTCAVKAPGF
FT                   GDRRKAMVQDIAVLTGGTVVSDEVGLTLGKVRLQDLGRATRAEITKESTTLIGGAGKPQ
FT                   AIRDRIATIRKERELAASDYDREKLDERAAKLSGGVALIKVGAATETELKERKLRVEDA
FT                   LHATRAAVEEGIVPGGGVALLRARRTLAGLTGGTLDETSGIRLVSRALEEPLRRIVSNA
FT                   GDEPSVILNRVDESPDPAFGYNAATRAYGDLLQMGVIDPAKVTRLALQNAASIASLILT
FT                   TDCMIATAPKPSSEEGALNPEGSSPMF"
FT   gene            387609..388067
FT                   /locus_tag="Pnap_0390"
FT   CDS_pept        387609..388067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35713"
FT                   /db_xref="InterPro:IPR019291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ85"
FT                   /protein_id="ABM35713.1"
FT                   /translation="MEKTWILIANAERARCFERHGADHSLTELSDFVHPQASLEGQAGG
FT                   GDLTGAAGKGHGRTGHAGTQFEPHTEAHAKERASFARQLADHLNEGIAGQQCHAIVLIA
FT                   TSPMLGEIRPCLSPAADKAVKRSVASDLTRYQGLDLKQRVDDALQLPD"
FT   gene            388119..388547
FT                   /locus_tag="Pnap_0391"
FT   CDS_pept        388119..388547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0391"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: rpa:RPA3434
FT                   universal stress protein (Usp)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35714"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ86"
FT                   /protein_id="ABM35714.1"
FT                   /translation="MLKILIAVDGSEHADRAIEAVAAMARSSLELEATLLCVSPEPLFY
FT                   GSYTAATIQKIEDEQIVQQNAILAKAMEHARVAGLKVVAPARAYGVIANEIVRIAKDRQ
FT                   VDQIALGTRGMGAVGNMLLGSVAQRVLHQSPVPVLLVK"
FT   gene            complement(388540..390396)
FT                   /locus_tag="Pnap_0392"
FT   CDS_pept        complement(388540..390396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0392"
FT                   /product="membrane protease FtsH catalytic subunit"
FT                   /EC_number="3.4.24.-"
FT                   /note="KEGG: pol:Bpro_0723 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase, central domain protein;
FT                   peptidase M41, FtsH extracellular; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35715"
FT                   /db_xref="GOA:A1VJ87"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ87"
FT                   /protein_id="ABM35715.1"
FT                   /translation="MPGEMEVDPKQSWNLGYWVLALALLLLFQNVWQSASEALPVPYSE
FT                   FEKALSEGRIAEVSVTDRTLIGRLKTAEGKKTTLLSTRVEPDLAARLERYNVPYTRVVE
FT                   NTFFRDLLSWTLPTLIFFGVWFFLFRRFADKQGMGGFLSIGKSRAKIYVQTDTGVTFAD
FT                   VAGVDEARHELEEVVDFLKHPQEYGRLGAHIPKGVLLVGPPGTGKTLLAKAVAGEAGVP
FT                   FFSISGSEFVEMFVGVGAARVRDLFEQARGMAPAIIFIDELDALGRARGAFPGLGGHDE
FT                   KEQTLNQLLAEMDGFDASVGLIILAATNRPEILDPALLRAGRFDRQVLVDRPDRKGRTD
FT                   ILKVHVRKVKLDPGLDLGNVAALTPGFSGADLANLVNEATLVATRRKADLVTLADFTAA
FT                   VERIVAGLERRNRVLNPKEREAIAFHEMGHALVALAQPGTDPVHKVSIIPRGIGALGYT
FT                   IQRPTEDRYVMTRPELEQKIAVLLGGRAAEKLVFGVLSTGAADDLAKATDMARDMVTRY
FT                   GMDDNLGYVAFEPRRQQMLDVPADLMQPHSPAVSEHTQRRIDDAIRTIVMDGFARASAI
FT                   LGANRPVLERGAHALLEKETLDEAAIRALAADLRPSERQALT"
FT   gene            390553..390900
FT                   /locus_tag="Pnap_0393"
FT   CDS_pept        390553..390900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35716"
FT                   /db_xref="InterPro:IPR021734"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ88"
FT                   /protein_id="ABM35716.1"
FT                   /translation="MARGRDMSICASRVNPCQRFRETAMKYIVSWTLPPASYNAAVARF
FT                   LETGGAPPQGVEMLGRWHGMNGQGFAITESSDAKAMFLFQAQWADVIAIVVTPCVEDAD
FT                   AGAVLATLGKR"
FT   gene            390986..391855
FT                   /locus_tag="Pnap_0394"
FT   CDS_pept        390986..391855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0394"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: pol:Bpro_4255
FT                   creatininase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35717"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ89"
FT                   /protein_id="ABM35717.1"
FT                   /translation="MAQNTRMTFAPPAPPALPRFWADLKSPDFARLELDRCIAVLPVAA
FT                   IEQHGPHLPLNVDATLVDGVIASALPHLPASLPVLFLPTQSIGFSPEHTRFAGTLTLKA
FT                   ETILRLWTELAESVASTGVKKLVLLNSHGGQVGLMDVVARDLRTRLGMLVYSVNSFNLP
FT                   LVDERGDSVAARFSAHEHRFGIHAGEIETSMMLALRPGQVDMAKAQDFHSTSQDRSERF
FT                   GILGDGRSAKLGWQMQDYNPHGAVGNALAATAEKGHALLSAMGRSLAQLLAEIDQLPPD
FT                   TLRDATAC"
FT   gene            392221..393561
FT                   /locus_tag="Pnap_0395"
FT   CDS_pept        392221..393561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0395"
FT                   /product="L-sorbosone dehydrogenase"
FT                   /note="KEGG: pfo:Pfl_1639 L-sorbosone dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35718"
FT                   /db_xref="GOA:A1VJ90"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ90"
FT                   /protein_id="ABM35718.1"
FT                   /translation="MHSSVFHPRRWRAALYLAMLGGLAACGDTAKLPPTAGMGATPTLP
FT                   PPRSSLIPTVKIAPATGWPEGLAPTAMAGLNVSALATGLEHPRWLYVLPNGDVLVAETN
FT                   APPKPEGGKGIRGWIMKKAMAQAGAGVPSANRITLLRDLDGDGKAETRTVFLQNLNSPF
FT                   GMALVGGDLYIANADALVRVPYQPGQTRISDVPVKVVDLPGGPINHHWTKNVIASPDGS
FT                   KLYVSVGSNSNVAENGIEAETGRAAIWEVDVKSGSHRVFATGLRNPNGMGWAPETGALW
FT                   TVVNERDEIGSDLVPDYLTSVKDGGFYGWPWSYYGQHVDVRVKPQKPEMVARAIAPDYA
FT                   LGSHVAPLGMAFSEGNALPASLASGVFVGEHGSWNRKPRSGYKVVFVPFAKGRPAGLPI
FT                   DVLTGFVNAEGKAHGRPVGVAMDKRGALLVADDVGNVVWRVAGTATR"
FT   sig_peptide     392221..392304
FT                   /locus_tag="Pnap_0395"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.716 at
FT                   residue 28"
FT   gene            complement(393640..394308)
FT                   /locus_tag="Pnap_0396"
FT   CDS_pept        complement(393640..394308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0396"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pol:Bpro_4246
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35719"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ91"
FT                   /protein_id="ABM35719.1"
FT                   /translation="MGTLYLVRHGQASFGSDDYDVLSPLGQRQSLRLGEYFKGKGVTFE
FT                   AALTGTLKRQHQTFAGICEGLGVELQAMPWPGLNEYDSAAVIGAIHPQPLVRPDTPELY
FT                   KHHFRLLKDGLAQWMAGVASPRGMPSYNGFVAGVTSALDHIRSHYGGHVLLVSSGGPIA
FT                   TAVGQVLGASLEATIELNLGIRNCSVTEFAFTPQRHRLVTFNTLPHLDAPEHASWVTFA
FT                   "
FT   gene            complement(394345..396612)
FT                   /locus_tag="Pnap_0397"
FT   CDS_pept        complement(394345..396612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0397"
FT                   /product="integral membrane sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase A domain protein domain protein; KEGG: ade:Adeh_2956
FT                   periplasmic sensor hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35720"
FT                   /db_xref="GOA:A1VJ92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ92"
FT                   /protein_id="ABM35720.1"
FT                   /translation="MLKIRTYLVLMAVAILLPVVVFSTVALQMLRDGEREAALRGLQET
FT                   ARATALTVDRELASSVTALELLARSPHLESGDLQAFYKQAALLNKRPTSWTVLLDKNAQ
FT                   QLVNTARPFGEALPLPRDPGRVQEVMETQNSLASDLTVGQVTQKRVTVMYVPVPAHGGT
FT                   RYVLAQVFAIEFFNNTVFQPNTPINWVIAIIGRDGRFIARNLNAQERVGKPASADLMKA
FT                   AGAQDHGLIRHDTLDGTDAYNAFTHSAISGWTIGVAAPVNNIEATAGRAVAIATLGLLI
FT                   AITCAMMMAAFLGRRLVHSIAAATDAAAAMGHGTKPELTRSNVLELDQLHTALMQAGVI
FT                   LELAQASSAQAEEERECLLQDAYKARLRAEAESTAKDQFLAMLGHELRNPLAAIGGAIA
FT                   LSERHGHGSATAAEARAIIQRQSGHLAHLIDDLLDVSRMVGGKITLKPQPVDLGKKARS
FT                   CLESLRATRHMTGYELKVTTEPVWVNADPTRLEQMLNNLLVNAFKFTPPGGLVEVTVSA
FT                   CAQEAVLSVKDSGMGISPELLPHVFEMFVQGSASLDRAQGGLGIGLALVRQLASLHGGT
FT                   VSADSAGPGQGSTFVVRLPRIAAPVALPAAALPASSPHQRWRILLIEDNDDARHMMRRL
FT                   LDMEGHEVLEAATGTAGLRLASQQKPDLAIVDIGLPEMTGYEVAEHLRGDAETRSMGLI
FT                   AMTGYGQQEDRKHALAAGFDVHLVKSVDIDHLLKVIDQCGQAALLRKPGTGTAPIEGAS
FT                   HG"
FT   sig_peptide     complement(396541..396612)
FT                   /locus_tag="Pnap_0397"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.529 at
FT                   residue 24"
FT   gene            complement(396843..397241)
FT                   /locus_tag="Pnap_0398"
FT   CDS_pept        complement(396843..397241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0398"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_0882 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35721"
FT                   /db_xref="GOA:A1VJ93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ93"
FT                   /protein_id="ABM35721.1"
FT                   /translation="MALKVFLVEDSAAQRAYLAQALRAEAKVEIVGIAETEHQAIHWLD
FT                   NNADQWDIALVDLFLGEGSGAGVIQHCHDRRPDQSVFVMTNHSQNEALLHHCKLLGADA
FT                   VYHKATELENLLALLQESAHSNSRCVAQ"
FT   gene            complement(397480..398220)
FT                   /locus_tag="Pnap_0399"
FT   CDS_pept        complement(397480..398220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0399"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35722"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ94"
FT                   /protein_id="ABM35722.1"
FT                   /translation="MTLQNPAHPSLQAIALGAEFSDLEEGARYALLQRLAPALQHHMMG
FT                   KFQSMDMIAAMMERRLKSADPDLASIREDCASLSSVSRIAVKSIMDLMTWIEPKTASTV
FT                   KFDAGVVECLGLLATEFRFKGFVIVNEAREIDVKLSSRALRSVLSAALIALSDLSKVSA
FT                   TLVIRAQAMPDRVELTIDLRPTERDTKRAYVTDSRALKWRDVEILALAESVQLERSDTG
FT                   AQLTFALPAANADLPGDLFVGTGI"
FT   gene            complement(398447..399379)
FT                   /locus_tag="Pnap_0400"
FT   CDS_pept        complement(398447..399379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0400"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   pol:Bpro_4242 phenazine biosynthesis PhzC/PhzF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35723"
FT                   /db_xref="GOA:A1VJ95"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ95"
FT                   /protein_id="ABM35723.1"
FT                   /translation="MTPRLFKQVDVFTSTPYLGNPLAVVLDGSGLDDEAMQRFARWTNL
FT                   SETTFLLPPADASADYRVRIFTPGGELPFAGHPTLGSCHAWLQAGGQPKSRDFIVQECQ
FT                   VGLVKVRREGPRLAFAAPPLRRSAPSPMLLPRVAAALGLKAHQILAVQQLDNGPVWLGL
FT                   LLDSPDTVLQLNINHLALQALQVHIGVAAVYPAAEAAPLIARANREARAFGQTPLPTAT
FT                   LAQAPDLEVRAIVASTTVYEDPVTGSLNAGLAQWLMADGHMPERYLASQGLCLGRAGQV
FT                   HLERDAQGQVWVGGDSVTCIDGQVMLGSN"
FT   gene            complement(399420..400640)
FT                   /locus_tag="Pnap_0401"
FT   CDS_pept        complement(399420..400640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0401"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase, class I and II; KEGG:
FT                   pol:Bpro_4240 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35724"
FT                   /db_xref="GOA:A1VJ96"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ96"
FT                   /protein_id="ABM35724.1"
FT                   /translation="MKWTQARRAQKMNPSVIREILKVTEKPGIISFAGGLPSPKTFPVS
FT                   AFSAACEKVLREDGHAALQYAASEGYAPLREMVASMLPWNVDPALVLITTGSQQGLDLI
FT                   AKVLIDEGSRVLVETPTYLGALQAFTPMEPEIVSVASDDGGVDIADLAAKAEGARFFYV
FT                   LPNFQNPTGRTMPEERRAALSAEAARLGLPLVEDNPYGDLWFDTPPPLPLTARNPEGCV
FT                   YLGSFSKVLAPGLRLGFMVAPASIFPKLLQAKQAADLHSPGFNQRLVAEVMKDGFLDRH
FT                   VPTIRALYKSQRDAMLAAMVREMPEGVEWNTPAGGMFLWVRLPEGMNAIELLPRAVERN
FT                   VAFVPGWAFYADQPDARTLRLSFVTSSVAQIDIGIAALAGAIREMRAGSSASVAGAAPQ
FT                   LEAQPQT"
FT   gene            complement(400694..401629)
FT                   /locus_tag="Pnap_0402"
FT   CDS_pept        complement(400694..401629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0402"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane; KEGG: pol:Bpro_4235 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35725"
FT                   /db_xref="GOA:A1VJ97"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ97"
FT                   /protein_id="ABM35725.1"
FT                   /translation="MTQRRADITRGLWLGLLGIVVFAVTLPMTRLAVGTPEAPQMSGLF
FT                   IAMGRALVAAALSAVFLVATRAPWPRRQDVPPLLLTAAGVVLGFPLLTSIAMRHVEAVH
FT                   ASVIVGVLPLATAAVGALLHRQRPSAGFWLCAGLGSALVVAFTMLRSGAPGGGLSIQLA
FT                   DLLLLAAMLCAAVGYGYGARLSQHLRAEHVICWALVMALPLTLPLSLANWPATPLKATA
FT                   WWGFAYLAVFSMWLGFFAWYRGLALGGTVRVSQVQLVQPFLSMLFAVPLLGERLDAVTA
FT                   GFGLAVIGVVFIGKKMPVNALPLASLPSRP"
FT   sig_peptide     complement(401531..401629)
FT                   /locus_tag="Pnap_0402"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.716 at
FT                   residue 33"
FT   gene            401856..403277
FT                   /locus_tag="Pnap_0403"
FT   CDS_pept        401856..403277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0403"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH;
FT                   aminotransferase, class I and II; KEGG: pol:Bpro_4233
FT                   transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35726"
FT                   /db_xref="GOA:A1VJ98"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ98"
FT                   /protein_id="ABM35726.1"
FT                   /translation="MLMKTASQSLTEQLCARFADRIRNRLLAPGARLPSVRLCAEQQGV
FT                   SVSTVVAAYDQLQAQGLVVAHKNRGFFVRDLASNMPFVHAGKAQLAIKTIANTPVDAAA
FT                   LIRGMFHPISDKPQPGMGVFPAQWLESSFMPAAVRKATGASALRDLSLNYGEPKGDSGL
FT                   RRALSQRLGALNIHADPSQIITTVGATHALDIISRTLLRAGDYVMVEEPGWAVEFARLD
FT                   ALGMRILPVPRRADGPDLEVMAQYCQLHSPRLFVSVSVFHNPTGYCLAPGSAHRLLQLA
FT                   SQHNFHIAEDDTYSHLAPDHATRLCALDGLQRTIYVSGFSKILAPGWRVGFMAAPPELV
FT                   ERLLNTKLLATLTTPALLEKALAWCIEQGQLRRHAERIRTRLDQARARSVKLALAHGCT
FT                   FAAEPAGLFGWVETGVDTDALAQRMLDEDYLIAPGALFHAVRKPSTLMRINFATTQEAA
FT                   FWAVFARLRDGAYRL"
FT   gene            403967..404509
FT                   /locus_tag="Pnap_0404"
FT   CDS_pept        403967..404509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0404"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35727"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJ99"
FT                   /protein_id="ABM35727.1"
FT                   /translation="MAQPTVAASKAAASAAAPAVVKAVSVELTQFKVVKDAKGVEQLVA
FT                   APSVMPGDVIEYKVTYKNTSTKSVGGLVADLPIPEGLEYLPKSAKPGAALVKAAAKDGE
FT                   YAAEPLMRKLPGNKSEPVPYNEYRALRWSLGELPAGGVAAVTARAKVEAVVPTPPKTAP
FT                   ASVPSSAVTVKPASAAR"
FT   sig_peptide     403967..404038
FT                   /locus_tag="Pnap_0404"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.709) with cleavage site probability 0.315 at
FT                   residue 24"
FT   gene            404675..407608
FT                   /locus_tag="Pnap_0405"
FT   CDS_pept        404675..407608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0405"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG: sme:SMc01711
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35728"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA0"
FT                   /protein_id="ABM35728.1"
FT                   /translation="MIIHKPTHRTGAKPAATWAGAAALSLGFLFGSPAAFAVAPLANTV
FT                   IGNQASASYTDPNGITQLASSNLVQTTVQQVGSFNLDARTSNTTDVINTKTGAAGITVY
FT                   APHVLTNTGNGADGFNISITSPAAGFSRVEVFADANGDGLPDNTSALCTAVPAATCSVP
FT                   TQTVAGNNGVFQFVVAYSIPTTATTATTPTTPFNVGTVTAVVVPSSPVLASYSSTTAAD
FT                   VDNVNLTTVAAFNATKAIGSPAVAWSANGGVWPVATSTGPRSVTGCALTNAGAAAPAAG
FT                   CVYTTYTLNLSNTGGAVGTMAVSDTLPSGFTYVPGSAVWSNAPGTALTDAALGDTTGID
FT                   FRATGNTVTAVVAALNPNVTQSVSFVVLVNETALIGTSTTTNTATYNPVDAPAATSTAP
FT                   GTLGSSTNPAAYTVTASYSIVLGATASTAVTAKDTVAGTPNGTTADLTIQPSVSPGGSV
FT                   LFTQTVYNTGNATDTVNVTALASTFPAGTTFQFFDAGGVVALLDTTGDGIVDTGPISAS
FT                   GSVNIIIRANVPAGVTAAGPFVVNVRGVSANDTSKIDATQDQATALVAPSSLIDLTNTA
FT                   VGTGIGNVGSGDLGAGPSPSPTTTVSTPAGSSALFTLFLKNNDTTANSYNLLASQTAAF
FT                   PGSLPTGWTVKYVAGGATCSAAAVTQPVAVAVGAQVQVDACVTPPVTQTPVTAQPMYFR
FT                   VTSTAVATTGAIVSDTKLDAVTVTTAMTFGATLTPDNNGQVAAGGSVVYAHTLTSTGAQ
FT                   SCGAYTLAASPTSADITLGWTTVIYVDVNGDGQLDAGDTLYSGSSLSLATGATQKLLVK
FT                   VFAPGGAAAGAADVATVTATFAANCGAPSATDTSTVITGQIRLVKTQVLNAAVAGTCPA
FT                   VPATPAFSAAPIMAAKPGDCIVYRVVATNEGAAPVSNLAINDAIPAYTGLTGATQPTVQ
FT                   CTSTGITAALTTANYASTAVAVSCGSATNTVIPGGSATMTFSVKINN"
FT   sig_peptide     404675..404788
FT                   /locus_tag="Pnap_0405"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 38"
FT   gene            407611..414867
FT                   /locus_tag="Pnap_0406"
FT   CDS_pept        407611..414867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0406"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG:
FT                   pcr:Pcryo_1046 protein of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35729"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA1"
FT                   /protein_id="ABM35729.1"
FT                   /translation="MATLLRRLRASRSPGAKHTLLSVCFALFSVPPATATPSGGTEKSQ
FT                   FFLNTNAGLAQRGPRKVSDVLFSSCIQRFIAALALGLAMLLAHVPAQAIPAQAGTVIRN
FT                   VASATYVPAGFTQVETADSNHVLVTVQAVEALSLTQDQNVVRPPSVQVTLNHLLTNTGN
FT                   VRSGYTIGFVGNGAGCPTQILNLSALRVLHDLNNNGVADAGDPVVTLGASGSITLQPGE
FT                   TAGLLVQGTLPASSAGSACVALTATTTAQATTASNRDIITVSNAAVLSLTKTASYPGVV
FT                   VPGTTRIDFTVTGTNIGAQDAQPVGTAAPANTAIVVNGAPINLVLIRDMIPAGTQYMPG
FT                   TLQTTAAGAIRLFRLAGDTAFSYRTEDDASAVEVAIGIPAAVVRNGTVALQFAVRAKAD
FT                   LSGEIRNIAQSYYHDGASPAVSPSNTVIIASSQGRIGVAKAASAPLLNQAANGELDGTA
FT                   TVRFSVLIRNYGSTALYSVQAPDVLEGAGATQFGSYTSNVVPAANQYTIVPGSLVIAKP
FT                   NGSVAGTVAAINPAFNGTAAAQNLLAAGALLPAGADITVQFDARINFTGRTGTLYNTVR
FT                   GQASVSPGDTPGIFDDSSNGTNPDVNGNGNPNDDSLPTPVSTLLPALSIIKTVSLPRRV
FT                   SLGVYEFDYTFKVTNTGQAEAPHVRVIDNLNCTFDMDKAEGAIASWELVTRPIVKHGNL
FT                   KTSASFTGRATCNRNQLNSTDPYLLPTEVVLSLVDGSRPLAPGQSEEVTLTLRVTEKPA
FT                   SIGSHLTLTNKAWAAAFGQNTVNVTPSLLVAAGSNSVRSLLLDPEGTVYNSITRQPVAG
FT                   ALVTYSRLSCSSGAGGPVTAAEIYGSGTGVYTFNANGTVSMTTGADGAWQFFLQSPPVT
FT                   NLCTYGITVAPPVGSGYVASQLIPVTPGSFDSCGAIVPNEAPPQNGEPTTHYFVLRAGV
FT                   NPDNSSCEAIHNHIPLDPGNLMGLVLRKDGSKKTAEFGDFIDYALTLTNKTGFPVTGAT
FT                   FNDFLPAGFAYVPNSARLNGAATANPAGGAGPQLVFSFPSLSLGVDQSATVRYRLRIGV
FT                   GAPTSGDAVNRAQASSGPMQSNQASWRVRVTGGVFSDEAFAFGTVHMECRRDGKEADGL
FT                   KNGGEEIGIPGVRLFMEDGTSVVTDIEGKWSLYGLKPVTHVLRVDETTLPPGAQLDLLD
FT                   NRNANNPASRFVDLKKGEFHKANFIVGNCDAPGVFQDVAARRKSLADRPDAEGEAAVRV
FT                   RLDPEAKAISVGDTRSLPATGQSSLTGAAGITVPASQALIQLPTGTANTNTFIGGVASA
FT                   GALNGTLGQAQQAGAFSPLIPLAGNNEVNGRSGFLLPAAQPLLQQAVPSSIELEKVMHS
FT                   LDNSAGFIDLKDQDTVASQTLNVRVKGAAGTQLRLHVNGQPIDDRRVGKKVVLPSASLG
FT                   AWEYIGVQLKPGINTLRLDVVDDYGVTRGTQQITLVAPDKLSLIQIDAPETAQADLRTP
FT                   VLIKVRLTDASGIPVTGRMQVTLEADRGRWLENDLNPSEPGAQVFIEGGVAEFRLLPPG
FT                   EPGDMRVRVSAGTFVKEARVALLPELRPMIGVGIIEGTLDFTKRSALTLGQMPAGAAFE
FT                   TELSGFASDGTSSSRGAARSAFFFKGAVQGDYLLTAAYDSDKTTKDRLFRDIRPDEFYP
FT                   VYGDSSVRGFDAQSTQKFYVRIDKNRSYLLYGDFTTASSSEVRQMSQSSRTLTGIKNVY
FT                   ESDTVRATSYASRTAQTQRIEEFPALGISGPYHLNAGNGDLLANSEKIEILVRDRNQPN
FT                   IVLQTTSVARFTDYTIEPLTSRLLFTRPIASVDTNLNPQSIRVTYEVDSGGAKFTVAGT
FT                   DVQVKLGEKLQVGMVASTDENPENKRKLGALTAIAHIAESTTVAAELVRTETDLKGTGS
FT                   AGRIEVRHHDEKLGAVAQIAKTSASFDNPGSAFSAGRTEAVARAQYKLDDTTQVRGEAI
FT                   YSKDALTTGDRKGVAVGVQKKLSETLLGEVGVRHGENSSPTASMFDYNQVSSSSALGAG
FT                   SLGNSVTSLGASAAAAGTSNQDITTVRGRLTTVVPHLPQAQVFVEAEQDINHGDRHVLA
FT                   AGGNYAITDKTRAYGRYEFISSLDGPYSLNNSSSRNIGILGIESNYMEGGRVYNEYRLA
FT                   DSLDGRTGQAAMGVRNTFKLNEQWRLTAGIERTKSIGSSASGIVGRGNSTAIVTGAEYL
FT                   SDRVKASGILEARQGDDSNSYLSSLGVGYKIDTDWSLLARSIISESKGQGTNAGNDRLL
FT                   SRQQIGIAYRPVDQDKWNALARYEHKTERVNGAGSVLGAVNSSSVFGSNAPGTYSADIV
FT                   SSHFNYNPQRGTYLTGRYAGKVSSADDGFLGSSYWAHLVQGRYTRDLSRDWDVGLQAGL
FT                   LYGKGGALQKTAGVELGYQVAKDLWVSAGYNVVGLKDRDLTAGEYTSEGVYIRLRFKFD
FT                   ENIFSTALPAVTK"
FT   sig_peptide     407611..407718
FT                   /locus_tag="Pnap_0406"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.950 at
FT                   residue 36"
FT   gene            415038..418895
FT                   /locus_tag="Pnap_0407"
FT   CDS_pept        415038..418895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0407"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain; KEGG: mmu:239611
FT                   mucin 19"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35730"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA2"
FT                   /protein_id="ABM35730.1"
FT                   /translation="MVNTSFELPALGGSACYGFTSSASMPGWTSTEPTAADLSGSCTGE
FT                   TAGANAIEIWRSNFNGVLAFSGSQHVELNAHSPRRLSQTICMQTGDTVSWAYSHRARVN
FT                   PGNVIDVANFSVGNPTNTVNIARTDTNGVVSSTAADCRSSSSITSPICSGSTSSSWGRY
FT                   TGTFTWQGSGGNQDIGFEATTGTSFGNFLDDVQFTLKPVIEFSSATLTSAESGGTVNFQ
FT                   LRIAGIVPSGGIAVPFTITGTATGGGVDYTLPSTFTVPAGDYDVGSLVNVPVTLINDSL
FT                   PEATETVIVTITPPAGSAPYRLGSTVTCGGTAIGTATLSITDDDVSVTLNKALVPVSNS
FT                   GLFNLSITGGSPSPTGGTNPANNQGNGGSTGAVKVNPSSVITLTETAGTSTSLANYSTA
FT                   LSCVDASAASVTVTGSGTSRSITTPALTASAAARTITCTYTNTSTQATITLQKSLAGDR
FT                   MAVSDQFSVAIRTGGVSGTVVSSATTTGTMATVTTGTTGSYSAAVGTTYTLTEAAAAGD
FT                   LANYSAALSCVDTAGVQTGLPSGVAFNPAVGYAVTPVAGAALSCTITNTPILVHPAAAP
FT                   VISCSSDGNIFNTAYNGNPAGPAKTSGLDNLWERGATFGALEPTSWTLANVATTNPGWS
FT                   AYSAFPASRFITHQANTDHTPLGNVDLWYRYVFTMDSSVVLSSFRLAMDFYADNSVQAI
FT                   YVNGVPQSVAGVPDGNPYFALHYNLGNALSANLTNNWQAGTNTILVRVSSGPNAIGFMA
FT                   KNAISAVCQSKVSLQKALGGLGRLAVADQFTVDIRTGGALGTVVNSTTNSTTLGSGATV
FT                   TAGSGNTGVYSGIAGTAYTLNEAMASGSTSTLTSYTRTLSCTNVGGTTNVSSFSSLPLT
FT                   FSPLSGDNVLCTVTNTPAGASITGRVFLDNGVSSGTANDGLINGGEAGLAGITVRLTNC
FT                   AATVHASGMTGGTGAYNLAVPTGTATGAALCVEQTNQGTRISTGASVDSTALPSGTATP
FT                   VASTTYTYTRTSTPDRIAFTYNGTRHSDLNFGDVDTGTFATNGSKSGLPDTTVSYPHTF
FT                   TAGTGGSVSFAISAANPAPTLTGWSEKIFADPGCTGTLQAGAAQLYPPAAAATTVVFGQ
FT                   KVCVIMQEFIPGTAQMSYSNDATVQANFSYSNASPALATASYTLHDITNVGNGTLELKK
FT                   EVRNVTQGVLTFGINNLAKSGETLEYRISYTNNAATPISNLVVNDTTPVYTSFVASSTG
FT                   TTPATLTTCTKNTPFNPLPQPAVSCATAQAAGNTGSISWKFTGSLSPSGTGEVLFQVKV
FT                   D"
FT   sig_peptide     415038..415109
FT                   /locus_tag="Pnap_0407"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.684) with cleavage site probability 0.489 at
FT                   residue 24"
FT   gene            complement(419056..419238)
FT                   /locus_tag="Pnap_0408"
FT   CDS_pept        complement(419056..419238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0408"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35731"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA3"
FT                   /protein_id="ABM35731.1"
FT                   /translation="MRALLLQVFYSNPVAHAWDELREKFFHNRVLHSLYALEEQLTLTL
FT                   NTLELDPGRVNSIVS"
FT   gene            complement(419263..419430)
FT                   /locus_tag="Pnap_0409"
FT   CDS_pept        complement(419263..419430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0409"
FT                   /product="transposase, IS4 family"
FT                   /note="KEGG: reu:Reut_C5975 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35732"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA4"
FT                   /protein_id="ABM35732.1"
FT                   /translation="MRGADTFAESPFTLHRLDDFVPGNHSLRPIRQTVNEAQVLMDALF
FT                   AGMYEADIKG"
FT   gene            complement(419901..420377)
FT                   /locus_tag="Pnap_0410"
FT   CDS_pept        complement(419901..420377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0410"
FT                   /product="putative transposase of insertion sequence
FT                   ISRm10-1"
FT                   /note="KEGG: sme:SMb21046 putative transposase of insertion
FT                   sequence ISRm10-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35733"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII8"
FT                   /protein_id="ABM35733.1"
FT                   /translation="MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDG
FT                   PLNGPAFRAWVEQFLVPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDF
FT                   NPIEQVFAKLKAMLRKTQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG"
FT   gene            complement(420397..420855)
FT                   /locus_tag="Pnap_0411"
FT   CDS_pept        complement(420397..420855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_PB00143 probable insertion sequence
FT                   transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35734"
FT                   /db_xref="GOA:A1VII9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VII9"
FT                   /protein_id="ABM35734.1"
FT                   /translation="MSWRNGQAYAQDLRDRVLAAPGVLREVAERFGVSQAYVCRARARR
FT                   ERLGQTGPGAQHNHMPLRLAALEGALREQVARAPAQTLRELRQWVRAEHGIEVGTTTMF
FT                   KTLRRFGLTLKKNHPARGRANAARRRPGPPGLERQTTKPAGRSADLPR"
FT   gene            complement(421048..422730)
FT                   /locus_tag="Pnap_0412"
FT   CDS_pept        complement(421048..422730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0412"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   pol:Bpro_4230 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35735"
FT                   /db_xref="GOA:A1VJA7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA7"
FT                   /protein_id="ABM35735.1"
FT                   /translation="MQTPAALRPCPVPTAPAPRLHRARQWLCLVFLSFWVTGCASLPST
FT                   VDRPVSTALANPMETRLGRLVQARADKAGTHNDSGFALVGNAELAFTSRMTLIKAAQKT
FT                   LDIQYYAIFADDTTERMFDALRDAAGRGVRIRILLDDFNTSGKNAQVLKLAFEKNFELR
FT                   LFNPLPGGRGSMMLRILSNLKDVARMQRRMHNKIFVADNAVAITGGRNLGETYFGQSEG
FT                   TNFVDIDVLAAGRIARDLSRSFDQYWNNPLAYPVQSLMTAKEIELLKPKLAAASPEAPS
FT                   GTPQPMAVAASPTLAKTLTAAPNEATALPDSTDLSLLTWTWAPSVLLVDQPSKIAADAD
FT                   DVAEAQETAVDGLLQLMSQAKTDLLIVSPYFVPGELMMGQFAELRRRGVRVRLLTNSLA
FT                   SNDAPAAHVGYARYREALLAMGIELYEMRAEQEGTVRSFRWGAGSTGGSTSGSRASLHA
FT                   KVVVMDSRLLVVGSMNLDLRSKLQNSEVAIIIRNRTLSQEATRMIEPALTSGAYRVERV
FT                   NGQLVWRAPQGSGLKDSTSEPDASLTLRLLLKLIGPFAPDEML"
FT   gene            complement(422891..424816)
FT                   /locus_tag="Pnap_0413"
FT   CDS_pept        complement(422891..424816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0413"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4229 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35736"
FT                   /db_xref="GOA:A1VJA8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA8"
FT                   /protein_id="ABM35736.1"
FT                   /translation="MALITLLDAQLAFGHVALLDHADFSLETNQRIGLIGRNGTGKSSL
FT                   LKILAGLEKPDDGTLQLQQNLRIAYVPQEPSLDPHATVFIAASAGLARTKHVVELYLAA
FT                   DEHTDLDALQSEIEALDGWTWEQRVEETLHRLHLDKDAIVGSLSGGTKKRVALAQALVA
FT                   KPDVLLLDEPTNHLDLDSIAWLEELLVNFNGSIITITHDRSFLDQVANVIVELDRGKLR
FT                   SYPGNFAQYLIQKEDQMAQEAVIFAKADKLLAQEEVWIRKGVEARRTRSTARIGRLEAL
FT                   RENRSARRDAVGRVNLDVSSGDKSGKIVAELTDVSKSFGHPGAEKTIVSHFSATLLRGD
FT                   KVGLLGPNGAGKSTLLKLILGELQPDATTPPGKIRQGANLQVAYFDQMRDALDLDATLE
FT                   DFISPGSEWVEINGQKKHVKSYLTDFLFSPSRANSPVRTLSGGERNRLLLARLFARPAN
FT                   VLVLDEPTNDLDIDTLELLEDLLQNYEGTVFLVSHDRRFLDNVVTSTIAYEGTPDNPGF
FT                   WREYEGGVTDWLTQSKRAAQITGSNKAPAASSTKNTGKNAVEPNKDIREQLSKKKLSYK
FT                   EQRELDGLPALIQQLESQQKAIGQELYDGTLYASNAKRAAELTARNAKLEEELMEALQR
FT                   WETLSA"
FT   gene            425434..426956
FT                   /locus_tag="Pnap_R0004"
FT   rRNA            425434..426956
FT                   /locus_tag="Pnap_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            427076..427152
FT                   /locus_tag="Pnap_R0005"
FT                   /note="tRNA-Ile1"
FT   tRNA            427076..427152
FT                   /locus_tag="Pnap_R0005"
FT                   /product="tRNA-Ile"
FT   gene            427181..427256
FT                   /locus_tag="Pnap_R0006"
FT                   /note="tRNA-Ala1"
FT   tRNA            427181..427256
FT                   /locus_tag="Pnap_R0006"
FT                   /product="tRNA-Ala"
FT   gene            427603..430484
FT                   /locus_tag="Pnap_R0007"
FT   rRNA            427603..430484
FT                   /locus_tag="Pnap_R0007"
FT                   /product="23S ribosomal RNA"
FT   gene            430649..430761
FT                   /locus_tag="Pnap_R0008"
FT   rRNA            430649..430761
FT                   /locus_tag="Pnap_R0008"
FT                   /product="5S ribosomal RNA"
FT   gene            431209..431571
FT                   /locus_tag="Pnap_0414"
FT   CDS_pept        431209..431571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35737"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJA9"
FT                   /protein_id="ABM35737.1"
FT                   /translation="MIVVAAWMLDAAACAHMELGAPQASVGALAELHLLLSQRGFRRSC
FT                   AGVFHTCEERHEPSCTRTSPTVDDIGITSAISPTPAEPDPRVPGPSGHGLERTGRRGRT
FT                   AGNAAAAGSRPSNRKE"
FT   gene            431574..433643
FT                   /locus_tag="Pnap_0415"
FT   CDS_pept        431574..433643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0415"
FT                   /product="Recombinase"
FT                   /note="PFAM: regulatory protein, MerR; Resolvase,
FT                   N-terminal domain; Recombinase; KEGG: ret:RHE_PA00038
FT                   probable insertion sequence transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35738"
FT                   /db_xref="GOA:A1VJB0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB0"
FT                   /protein_id="ABM35738.1"
FT                   /translation="MTTSDLLPAAVLRRKAVVYVRQSTQSQVQTNLESQRRQYDLVAQA
FT                   RRLGFAQVEVIDDDLGRSASGMVDRPGFERLVAWLCAGEVGAVLCFDASRLARNGRDWH
FT                   HLLELCGLVEARVIDPDGVYDPCRPNDRLLLGMKGSISEFELGVIRARMFEAARAKAHR
FT                   GELRISVPIGYVWHRQIGLGLDPDMRLQETIRLIFARFRTLGSARQVMLSLAADDVHFP
FT                   RPSDGKKMVSFDWTPIRYRNVISILKNPFYAGVYAYGKSEKRTTLVQGRLRKTYKHGKP
FT                   LDRWDVMIKDHHEAYIDWAEFERNQKQLAVNAYGKVDGTKSGRGGRALLAGMLCCGRCG
FT                   RRLTVAYTGRGVPQPVYRCDRPNLQLAQPRCFTFGARRPDEAIARELLRAVEPLAVEAA
FT                   LQAERRYMQVQADQRRIVELELQQARYEAGLAERRYAACDPDHRLIAAQLEKSWEAALQ
FT                   RVLACEQRLNVARQVQSSARPDLTGLEEDLAAAWDAPGVTMRARQQLLRTLVKDIVADV
FT                   DDQAREVVLTIHWRGGQHSQVRVVKPRTGEHGCRTPDEALAVMRSMAGKWSDEHIAATL
FT                   NRMGLPTGQAKTWTAHRVSSVRRVNDIHAYRSAEKDGQWLTMSEAAAKLGVNNHRIRRL
FT                   IKEGLLPAEQVVPRAPYQIRASDLLEQRVIDAIARTLSPCRAVSEKQMSMFSST"
FT   gene            complement(433656..434240)
FT                   /locus_tag="Pnap_0416"
FT   CDS_pept        complement(433656..434240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0416"
FT                   /product="transposase IS66"
FT                   /note="KEGG: rfr:Rfer_2711 transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35739"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB1"
FT                   /protein_id="ABM35739.1"
FT                   /translation="MGWLKPGNGKTHRAYLWAYAPGAFEDLKAVVHDFCESRAGAHARG
FT                   FLGAWQGTLVCDDYVAYKQLFTQGIMESGCMAHARRHLFELHVNHQSQIAAQALHYIAQ
FT                   LYEIEREVKTLRADERQRIRQARSKPLADALHQWMVLERSQILDGSATAKALDYSLRRW
FT                   GALMRFLDDGQLPIDNNWVENQIRPVAMACS"
FT   gene            complement(434240..434624)
FT                   /pseudo
FT                   /locus_tag="Pnap_0417"
FT   gene            complement(434614..435651)
FT                   /locus_tag="Pnap_0418"
FT   CDS_pept        complement(434614..435651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0418"
FT                   /product="ISXo7 transposase"
FT                   /note="KEGG: xom:XOO_3993 ISXo7 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35740"
FT                   /db_xref="GOA:A1VJB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB2"
FT                   /protein_id="ABM35740.1"
FT                   /translation="MEKENARKQTLEQLHERRKQVVRLHKRAMGVMQIVSMTGLSYPAV
FT                   RRCIDLFDEGGWPAIRPALRGRTQGLGRTLSQAQEDSLQRSIIDQRPEQLKMDFFLWSR
FT                   AAVGQLIEQEYGIELQVRSVGKYLARWGFTPQKPIRRAYEQSPEAVQAWLEGEYPAIEQ
FT                   RARQEGAEIHWGDETALVNTDVRGRSFAPAGKTPVARTVGGTRQKLSMIATVTNQGKTR
FT                   WMIIDDAFDADKLIEFLRALVKDAGKKVFLILDNLRVHHSKIVKAWVANHRDEIELFYL
FT                   PSYSPQLNPEERLNADLKQEMGKRVPARSKAKLRDAANEHMALLERTPERVIAYFQDRR
FT                   VRYAA"
FT   gene            complement(435689..436183)
FT                   /locus_tag="Pnap_0419"
FT   CDS_pept        complement(435689..436183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0419"
FT                   /product="transposase, IS4 family"
FT                   /note="KEGG: eba:ebA6355 transposase, IS4 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35741"
FT                   /db_xref="GOA:A1VJB3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB3"
FT                   /protein_id="ABM35741.1"
FT                   /translation="MCIGDRESDMLEMMVKARDLGYPADYLVRSQHNRVLPSGGKLWDK
FT                   VMAQPPVGRIRFMLPAGRGRKSRTVEQDIRIERVQLSDKAKGAIEVSCLVASEVNAPAG
FT                   VKPVVWRLLSNRVASTLEQASELIDWYRSRWEIELFFLILKEGCRVERLQLSDKDIDPA
FT                   Q"
FT   gene            complement(436531..437613)
FT                   /locus_tag="Pnap_0420"
FT   CDS_pept        complement(436531..437613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0420"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: pae:PA4797 probable
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35742"
FT                   /db_xref="GOA:A1VJB4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB4"
FT                   /protein_id="ABM35742.1"
FT                   /translation="MNATTVAVDLAKSVFQLAVADASWRVVETHRLTRTQFERWFVNRD
FT                   VSLVIMEACGSALHWARWLNGLGIEVRLLPAQYVRAYVKRNKTDAADAAALLEAARASD
FT                   IRPVRIKSVEQQALQGMHRIRSLWMGTRTSRINALRGFCREFGIAIPVGARTGIEAISR
FT                   VLADPHTAVPDLIRGTAKLLIEEIRLLEARIAQLERELASLARLCPACTTLLSIPGIGL
FT                   LTATAMVAATSGDVSHFKDARHFSSWFGLTPKEYSSGNSRYLGRISKKGDRYLRMLLTH
FT                   GARSVLRAAKVAEGSGKEVCGVRRWALDVQTRGNHNKAACALANKLARICYATLRDKEP
FT                   FDEGQRLNKKINRESFVMPA"
FT   gene            complement(437610..438173)
FT                   /locus_tag="Pnap_0421"
FT   CDS_pept        complement(437610..438173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgl:SG2354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35743"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR014735"
FT                   /db_xref="InterPro:IPR014736"
FT                   /db_xref="InterPro:IPR038215"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB5"
FT                   /protein_id="ABM35743.1"
FT                   /translation="MGWGEEEFKTIELGDERLNRRAVLLAERLGQKPSASIPGACQSWA
FT                   ETAAAYRFLRNEEVSWDKVLAPHLQASQARMAQHQVVLCLQDTTELDYHGQDIAGLGPL
FT                   NYEAQRGLYLHPTYVVSPEREPLGVFNAWTWAREFKAADGKRGGPCESTRWIDGMDSPC
FT                   FLRHIGALVFIGVEIRSLNKRSPT"
FT   gene            complement(438226..439050)
FT                   /locus_tag="Pnap_0422"
FT   CDS_pept        complement(438226..439050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0422"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: bxe:Bxe_B1865
FT                   transposase IS66 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35744"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB6"
FT                   /protein_id="ABM35744.1"
FT                   /translation="MVNAQHLDSLSAEQLRALAAELIAQVAQREQAIAAKDGELKYRQA
FT                   KIDQLTHEMAVLKRWRFGRSGERLDPAQLSLLDETIDADIAAIEVELEQLAPTPRAAAQ
FT                   TGPPKRARLPPGLPRVEIHHEPDSDLCATPGCGCTLKRIGEDVSEKLDYTPGVFTVERH
FT                   VRGKWACAKCQSLTQAPVPAQVIDKGIPTAGLLAQVLVAKYADHLPLYRQESIFGRAGL
FT                   AIARSTLGAWVGMCGVQLQPLVDALKAELLSHAVLHADETPVQMLKPIPLHT"
FT   gene            complement(439115..439402)
FT                   /locus_tag="Pnap_0423"
FT   CDS_pept        complement(439115..439402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0423"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: rfr:Rfer_2710
FT                   IS66 Orf2 like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35745"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB7"
FT                   /protein_id="ABM35745.1"
FT                   /translation="MRAGTDTALARVVAVFGAAHPHTAYLFANKRANRMKVLVHDGIGI
FT                   WLAARRLHQGKFIWPSQNTANCRLGREQLDALVLGLPWQRMGEAGIITIT"
FT   gene            complement(439444..439854)
FT                   /locus_tag="Pnap_0424"
FT   CDS_pept        complement(439444..439854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0424"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rfr:Rfer_2709 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35746"
FT                   /db_xref="GOA:A1VJB8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB8"
FT                   /protein_id="ABM35746.1"
FT                   /translation="MLKNSETSRYSTRRTHRTYTAQFKAELVAACGQLGVSIAALAGQH
FT                   AMNANVLHRWLKEHHRSGRHQLAVHSPAAAAAPETASPLVAFIPLQLPAPAQQPETREI
FT                   KVELRRGALSMVVTWPVSAAAELASWTAALVK"
FT   gene            complement(439931..441178)
FT                   /locus_tag="Pnap_0425"
FT   CDS_pept        complement(439931..441178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0425"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bxe:Bxe_C0019 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35747"
FT                   /db_xref="GOA:A1VJB9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJB9"
FT                   /protein_id="ABM35747.1"
FT                   /translation="MEPRPRAPQTGELPRPRLDEQLKMSHPLIRLASLMNWEEIERSFG
FT                   AHFTSSRGRPALRPRLVAGLLYLQHANDASDKAVVATWLENPYWQYFCGETYLQTELPI
FT                   DPSSLTRWRKRIGEEGVEVLLAVTIEAARAAGLIKKSSLNQVIVDTTDSRLLEKSRQHL
FT                   VKLADEHHLQLRQNYNRQAPRMAAQIGRYAHARQFKRMRKMLKALRVRVARVYREVMRK
FT                   LGQLPEQTQSKARDLLHRVGRILNQRTKDKNKLYALHAPEAECISKGKARTPYEFGVKV
FT                   SIASTLREGLVVGMRSMPGNPYDGHTLDETIEQVEILAEKRPGIAIVDKGYRGAQVDGV
FT                   QILRSGQRRSITRTMKAMIKRRSDIEPTIGHMKTDGRLARNPLKGELGDALHAVLCGAG
FT                   HNLRLIINKLKIPCAP"
FT   gene            441484..442551
FT                   /locus_tag="Pnap_0426"
FT   CDS_pept        441484..442551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0426"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_1212 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35748"
FT                   /db_xref="GOA:A1VJC0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC0"
FT                   /protein_id="ABM35748.1"
FT                   /translation="MSNITRVGVDLAKNVFQVHAVDASGNVVTNRMLKRDRFLAWCCDL
FT                   PPGCLVAMEACSGAHHWCRQLRDRGLDARMIAAQFVAPYRIQGKSGKNDANDAAAICEA
FT                   ASRPHMNFVPPKTLAQQGMLCVHRLREGLKQERTACINRIRGLLAEFGIVLPQSPQVLR
FT                   QHLSDLIEDAGNDIAGMARLVLQRAQEHWREIEEHVQWCDQRIAAHQKDDEQVQRAAEL
FT                   KGIGPVTASAVVATVGDFKQFKNAAQFGAWLGLTPKQNSSGGKSSLSSITKRGSNYLRG
FT                   LLIQGAKSVVLVGKHNDDPISQWAQRLRERCGWQKAVVALANKNARILWAVMTKEKRYD
FT                   AFHVSIPPSAIAATA"
FT   gene            442923..443963
FT                   /locus_tag="Pnap_0427"
FT   CDS_pept        442923..443963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0427"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: bxe:Bxe_C0485
FT                   putative transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35749"
FT                   /db_xref="GOA:A1VJC1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC1"
FT                   /protein_id="ABM35749.1"
FT                   /translation="MKITAQLPVVGMDIAKNVFQIHAVDPETGEIERIKLKRAKVAEFF
FT                   ANRQPCLVALEACGGAHHWGRTLAAQGHQVKLLPARQVKAFVLRDKTDARDAQAIWVAA
FT                   QQPHIHEVPVKSEPQQACLALHRMRAQLMKMRIMQTNALRGLLCEFGIVLPEGHRILLQ
FT                   RIPGELAQAQDKLPGVLIESMQEQLSRIERLQQDIDHIDRRLAALGKQDQHMLALQAVP
FT                   GIGPLTATALAATATDISGFHSGRQFAAWLGLTPRQSGTGGKIRQLGISKRGDPYVRTL
FT                   LMHGARAIIARTQRTGWITALLARRPYSVVVAALANKLARTAWAVLTKGKAFDQLRWNP
FT                   AAAVAA"
FT   gene            444129..444617
FT                   /locus_tag="Pnap_0428"
FT   CDS_pept        444129..444617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0428"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3929 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35750"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC2"
FT                   /protein_id="ABM35750.1"
FT                   /translation="MPSGPAGKQACTNRPHIRLQPPLNLYSANACFLGGVHISADYFTN
FT                   HPADTPRITLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLSMIAFGYLQ
FT                   HRRLASALQAGKKTGIQCTGSPATAVIAGGTPRHHRHASSRDLRSVPSLQRHDRPASA"
FT   gene            complement(444542..445519)
FT                   /locus_tag="Pnap_0429"
FT   CDS_pept        complement(444542..445519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0429"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG: gox:GOX2195
FT                   transposase (class III)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35751"
FT                   /db_xref="GOA:A1VJC3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC3"
FT                   /protein_id="ABM35751.1"
FT                   /translation="MSRQCVLAGISRAALYARRKPKRIVQDDELLLRLIDEEYTRHPFY
FT                   GSRKMVVHLGRCGHSVNRKWAQRLMRSLGLAGMAPGPNTSRAHPQHKVYPYLLRGVAIS
FT                   RPNQVWSTDITYIRLARGFAYLVAVIDWYSRRVLSWRISNSMETVFCVDCLEEALRIHG
FT                   KPEVFNTDQGSQFTSEAFTSVLKREGVIISMDGRGRALDNIFVERLWRSVKHEDVYLKG
FT                   YSAMGELLIGLTQYFTFYNGERPHQALKNLTPDVVYQRAQGGGAMIVDKYGAAQSLPMA
FT                   LRSTGTAFDEVRLALLCHVTHADAGLSWRCSEGTERKSRDEAWR"
FT   gene            complement(445572..445871)
FT                   /locus_tag="Pnap_0430"
FT   CDS_pept        complement(445572..445871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0430"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   sat:SYN_03173 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35752"
FT                   /db_xref="GOA:A1VJC4"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC4"
FT                   /protein_id="ABM35752.1"
FT                   /translation="MSETKKRKVHLPEFKAKVELEALRGVKTINEIAQDFGVHPVQVSQ
FT                   WKKEIQEQAGTLFEGKRGPQPVAAHSAPERLYGEIGRLKMELDWLKKKSGISLP"
FT   gene            complement(446057..446986)
FT                   /locus_tag="Pnap_0431"
FT   CDS_pept        complement(446057..446986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0431"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pol:Bpro_4226 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35753"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC5"
FT                   /protein_id="ABM35753.1"
FT                   /translation="MAASSLPSGMHVFERGWLSANNILFADGDHSVLVDSGYCTHSAQT
FT                   LSLVEGVLGNRSLDVLVNTHLHSDHCGGNAALQARYPALQTLIPPGHAQQVAQWDAAAL
FT                   SYVPTGQQCPRFGFDQTLQPGTNLRFGAAQWQVHAAAGHDPHSLVFFEPETRMLISADA
FT                   LWENGFGVVFPELEGSDAFAEVAATLDLIERLNPATVIPGHGRVFMYTPEILAKARQRL
FT                   DFFIANPVKHARHAVKALLVFKLLEVQRQLIDEFTQWTVTTPYFEQIRVRFFREVPMAV
FT                   WVGQLYAELLAAGVATKEGEYIRPGFAR"
FT   gene            complement(446986..447756)
FT                   /locus_tag="Pnap_0432"
FT   CDS_pept        complement(446986..447756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0432"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35754"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC6"
FT                   /protein_id="ABM35754.1"
FT                   /translation="MDTSAQTIRDALQAVSQLRQQHASQPALARAGAEVKRFQARRFQA
FT                   TYADLLHSPRYKTAAAFFLQELYSDKDYASRDQQFARIADTIARLFPQSVVNTAAALAE
FT                   IHALTETLDDLMARAWIADASTTPKSSEPARYVRCWRQLGDRAARQHQLEVVLQLGQSL
FT                   GRLTRTLGLRTLLRMMRRPAAAAGLDSLQQFLETGFDAFARMGGADEFLTLLRQRESEW
FT                   IRALFDDEAAACETRLAHLLAAGSPPEFNNATSF"
FT   gene            447789..448346
FT                   /locus_tag="Pnap_0433"
FT   CDS_pept        447789..448346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35755"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC7"
FT                   /protein_id="ABM35755.1"
FT                   /translation="MVLYRNRRAHAKLRAMQRRTLLALSLASAGVLALAGGAASGLLQP
FT                   GLDAGGRLSAAGRDVFSAVGRAVLDKSLPQEAGARQRALAGLLDRVDALVQALAPHAQA
FT                   ELSQLLSVLASAPGRHALAGLGQPWAQAPVADLQQALQGMRLSALALRQQAYAALHDIA
FT                   TGAYFADPATWPLLGYPGPLDL"
FT   sig_peptide     447789..447896
FT                   /locus_tag="Pnap_0433"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.498 at
FT                   residue 36"
FT   gene            448360..449985
FT                   /locus_tag="Pnap_0434"
FT   CDS_pept        448360..449985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0434"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; KEGG: pol:Bpro_4222
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35756"
FT                   /db_xref="GOA:A1VJC8"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC8"
FT                   /protein_id="ABM35756.1"
FT                   /translation="MSRLNDPIKDGLQRGWKVSGGALGPIPEKIVCDVAIIGSGAGAGI
FT                   TAELLAKAGLQVVVIEEGPLKSSSDFNQKESEAYPSLYQESAARKTEDKAINILQGRCV
FT                   GGSTTVNWTSSFRTPPATLQFWQDQFGLGSYTAEALAPYFAQAERRLNIAPWPVAPNEN
FT                   NELLRRGAVKLGIPAASIARNVKGCWNLGSCGLGCPTNAKQSMLVTTIPAALDLGAQLL
FT                   TETRAERFELANGRVTALVCRNVEPNGAFAQYGRAQTAIKIIAKHYVLAGGAINSPAVL
FT                   LRSGAPDPHGRLGVRTFLHPVLMSSGIFAQQVAAWSGAPQSIYSDHFLQTQPMDGPMGY
FT                   KLEAPPLHPLIFASTVPGFGEGQHALLKAFAHNHTLLALLRDGFHDEAPGGKVRLRGDG
FT                   SAVLDYPLSDYVMDGGRRALLSMMQIQFAAGAQQVLPLHEMAAPYSSWVQARAAVMALP
FT                   MKPRLVKIVSAHVMGGCGLAATEAQGVTRPDGLHWQLDNLSIHDGSLFPTSIGANPQLS
FT                   VYGMVNRLAQGLAKTLTGRDVALA"
FT   gene            450012..450920
FT                   /locus_tag="Pnap_0435"
FT   CDS_pept        450012..450920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0435"
FT                   /product="putative lipase transmembrane protein"
FT                   /note="KEGG: pol:Bpro_4221 putative lipase transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35757"
FT                   /db_xref="GOA:A1VJC9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJC9"
FT                   /protein_id="ABM35757.1"
FT                   /translation="MLASLQRLITLSIIAAAVGWLLYFGRGSPVLGFAGFMAIALAYSV
FT                   FLAIEFILVKQVNKGDPVPQPSWRELLAAWLGESVTAPRVFCWRQPFRPNAVPDQLGPP
FT                   ARVRGRRGVVFVHGFFCNRGLWTPWLKRLQGSGRAFVAVNLEPLLGSIDDYAPQIDDAV
FT                   RRVTEATGQPPLLVCHSMGGLAVRAWLKLMQAEARVHHVVTIGTPHRGTWLARFGQGHN
FT                   GRQMRLLSDWQAQLDHGMPAGRHALFTCWYSNCDNIVFPASTATLPGARNRLVRGAAHV
FT                   QLAFVPRVMQATLALLDERPA"
FT   gene            451228..452340
FT                   /locus_tag="Pnap_0436"
FT   CDS_pept        451228..452340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0436"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG: dra:DR2556
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35758"
FT                   /db_xref="GOA:A1VJD0"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD0"
FT                   /protein_id="ABM35758.1"
FT                   /translation="MALIVVIDDDAGTRLLVSQVLKKEGHKVMSAEDGAKGLDLIREHK
FT                   PDLVVSDVQMPLMDGFEVLDQVRSDAALAATAVILLTSLQDRSYMRLGMTTGADDYLTK
FT                   PFAPQELREAVSAQLNKRDRAHAMRTQVVDKAVQLALDEQRHKIGALYETRMVQALSEQ
FT                   WPDSSTAQGNERFASATVLYADMRDYGVWTQALSSTELSEIIQQLYSSVGDTVYLFGAH
FT                   YMQFVGDGMLCVFVDAADTKSVNHGLRAARAALGLVSATRRIDAHVQKNLAGRGLPNFS
FT                   LGVALHSGPVAFASLDGLISRTGQTTPVGDTVAAALKLFQGEPRLSWTVAASVQAVRLV
FT                   TGAVRTGQRALVQVPGRSQPMDVLEILGLA"
FT   gene            452337..455729
FT                   /locus_tag="Pnap_0437"
FT   CDS_pept        452337..455729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0437"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region, ATPase domain protein domain protein; histidine
FT                   kinase, HAMP region domain protein; histidine kinase A
FT                   domain protein domain protein; Hpt domain protein; KEGG:
FT                   mca:MCA1204 sensory box histidine kinase/response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35759"
FT                   /db_xref="GOA:A1VJD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD1"
FT                   /protein_id="ABM35759.1"
FT                   /translation="MSSGARPLAMTFSLRTVLITSLLLFSLLPAGVVGWFLYRSNLQSV
FT                   ELLSGKIIEDMTQRIKTDVQGHLAQAHVVLNGLIHEQPDVSAVRRARQLIESPALFEQT
FT                   AFAMTRMTPDVPRMYVGSARGEFLSVETFAQDASTRVRVSERKEGGDGRGLFMAESPGD
FT                   RRHGLPAEKGGYDPRSRPWYRAAMDNKGRAFTPISVLAADRQLRLTLAQPVYGADGGAL
FT                   GVFAVDLPLKSLNQMLQSMRISARGAVFLVDEQGFMVASSTGDELFSGGAGNLQRHKPL
FT                   QSRNPIIRQAYGEAAPSLGQTLESSVQRVSFLRRISMADDTLMVALQPFGESMGVRWSL
FT                   VVAAPESDFTAVAQAALKKTLAVTALILLLGALLAIALAWRLSRHFRRLGEAAALLALG
FT                   EVPPVQPASRIAEVRQLSQTLHDSAGELQRHRAAIQAQTLALHEANETLEDRVASRTAE
FT                   LNASRDEALGAARAKAAFLAAMSHEIRTPLNGVVGMTTLLADTPLDLEQRDYVHTMRIS
FT                   SDQLLGVINDILDFSKIESGKLELENEPLNLLATIEEACDIGAPRAREKGLELLVDLGD
FT                   ELPGWVRGDVTRLRQILLNLVNNAVKFTEKGQVVVSAHVLEDFSPGRGGLVEFRIKDSG
FT                   IGIEPDRQAALFQSFVQVDASTTRKYGGTGLGLAICQRLVRLMGGQIGLESAPGDGSTF
FT                   WFTARLGHADAPEVAMLSALHLVSLAGKRVAVLDDTQLNLRILDKQLRRWGMQPVLFER
FT                   AAEALAWLAGNPVDVVISDMHMPEMDGLSFARLLRERTPATPIVLLTSGTMPSGEQARV
FT                   FDARLLKPYRQSQLFESLARVTSAPVEVQKVARSEPAAARNQFILVADDNAINLKVALA
FT                   MLAKLGYEAATAVNGSEAVDRVAASLRTGLGETPRQYAAILMDANMPVMDGFVVSRLII
FT                   STHGTQAPPIIALTASVLEEDRQRCLQAGMVGFLPKPLRIDELSESLARYARQAEPENA
FT                   TKIIAADAVPDAQDAQSGIKPEQVLIDWNRLEQFREFDDDELSMTREVVLLFITEMPQR
FT                   IDDIRGALSACDSAALSRAAHALKGAASNVGAQALSGACAALEQSCLQGQWPADAALQV
FT                   AALVAFADQTCQALKGWTAAQAA"
FT   sig_peptide     452337..452441
FT                   /locus_tag="Pnap_0437"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.645) with cleavage site probability 0.334 at
FT                   residue 35"
FT   gene            455888..456715
FT                   /locus_tag="Pnap_0438"
FT   CDS_pept        455888..456715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0438"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pol:Bpro_4211 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35760"
FT                   /db_xref="GOA:A1VJD2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD2"
FT                   /protein_id="ABM35760.1"
FT                   /translation="MRNRHFSCFFWLFCRCRSFPRQSNLSRGNPYIWSMVHPGTLLKAS
FT                   FQASKAFFRPPVQDGASRPGAPSVMVPIRSIGPSHRGRIAAHLLALSPQDRYLRFGYSA
FT                   NDEQIRRYVDGLNFERDEIFGIYNRRLELIAMAHLAFTTDPELKSCAEFGVSVLAHARG
FT                   RGYGARLFDRAVMHSRNEGIEMMFIHALSENTAMLSIACKAGATVERDGSETEAYLKLQ
FT                   PANLDSRMSEMFDEQIAQTDYRLKVQARQFWRFLALLQEVRRGVRDSRDRMKK"
FT   gene            456915..457784
FT                   /locus_tag="Pnap_0439"
FT   CDS_pept        456915..457784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0439"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: pol:Bpro_4209 CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35761"
FT                   /db_xref="GOA:A1VJD3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD3"
FT                   /protein_id="ABM35761.1"
FT                   /translation="MSDVPPSRSSKPEDKRGFLQKLAEMLHPGPDSKDELIETLVEAQD
FT                   NEVIGQQSREMLEGVIRMADMTAGDVMVAAPRMDLVNINAPFDELLHLIIDTAHSRFPV
FT                   FEDEKENIIGILMAKDLLKLQRAPELNIRALLRPAVFVPESKGLNELLREFRVNHNHLA
FT                   VVIDEFGRVAGLITIEDVLEQIVGEIEDEFDIAEDAGDIFALTDHTYRVSGDTSVERVN
FT                   ESFEVLLPDTDFETIGGLVAHEMGHVPKRGEHYALAGLQFTVLHTKGGAVRWFKVSPAA
FT                   VIQTSDAL"
FT   gene            457921..459471
FT                   /locus_tag="Pnap_0440"
FT   CDS_pept        457921..459471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0440"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pol:Bpro_4208 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35762"
FT                   /db_xref="GOA:A1VJD4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD4"
FT                   /protein_id="ABM35762.1"
FT                   /translation="MVAGCTHAASMAWPFPLGSVLGLVQGQPVGWLQLLALALLAGQLD
FT                   GARSWRRGAWLGGLFAVAMQCATFWWLFISLHVYGGLAAPLAVLSIVLLAAFLGLYYAA
FT                   ACGLFVAFAPVQAAWRALFFAAAWLLAELARVKFFTGFPWGEGGYAHVDGWARPLAAWA
FT                   GVHGLTFIAALVAAWLAFCLLAPKTRWRAALAGVALSVTVAWLPVYNVGDVEPDPQLAK
FT                   PMSVTLLQGNIPQDEKFVGGTGVVTALRWYGEQLHGAKGALVVAPETALPLLPQQLPDG
FT                   YWQALQARFTTGDQAALIGLPLGDYDTGYSNSVIGLKPVPPGQPASLAQPEPYRYDKHH
FT                   LVPFGEVIPPGFHWFIKLMNIPLGDFNRGAVGQPSFGWQGQRLAPNICYEDLFGEELGA
FT                   RFVDAAQAPTMFVNISNIGWFGNTVAIDQHLQISRMRSLEFGRPMIRATNTGATVIINY
FT                   RGEVTHSLPRHTRGVLTGEVQGRSGITPYAWWAGRFGLWPLWGLSLAVTGLAFLGRRR"
FT   gene            complement(459474..460394)
FT                   /locus_tag="Pnap_0441"
FT   CDS_pept        complement(459474..460394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: pol:Bpro_4207 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35763"
FT                   /db_xref="GOA:A1VJD5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD5"
FT                   /protein_id="ABM35763.1"
FT                   /translation="MNLRQLEVFQAVMQTGNMSAAARLICITPSAVSKTIGHTELQLGY
FT                   KLFVRAKGTLAPTPEARVLFEESTLIHRKLDELKRMAINLRQVDGGQVRLAALPSISHE
FT                   FLPLVLEQHLTRYPRVNVEVRTLHQDQMVEALLTRRVDFALGFYTHPHPLLTNTVLVSG
FT                   LLHLVVKADIWERAVRARRQNPMSFLTSMPLVRLVGEDPMCQSIDALARHLGHTATTGL
FT                   QVHTSRLALELVRRGMGWTVVDFLTARNLDASLTAVPLHDFASISLQMYVATSTPPSQD
FT                   ALRMVGMLPGLLHQMMESSPPPRRE"
FT   gene            460542..461681
FT                   /locus_tag="Pnap_0442"
FT   CDS_pept        460542..461681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0442"
FT                   /product="L-asparaginases, type II"
FT                   /EC_number="3.5.1.38"
FT                   /note="KEGG: pol:Bpro_4206 L-asparaginases, type II;
FT                   TIGRFAM: L-asparaginases, type II; PFAM:
FT                   Asparaginase/glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35764"
FT                   /db_xref="GOA:A1VJD6"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD6"
FT                   /protein_id="ABM35764.1"
FT                   /translation="MGLASARLAILKSLSTFEKYLMQTQLQLKIAKLVTGLGLAAMASL
FT                   AMAQAAKPNVVILATGGTIAGAGASALNSATYAAAKVPVDKLLAGLPELGNVANVRGEQ
FT                   VAQIASESFNNETLMKLGKRVSALVKQADVDGIVVTHGTDTLEETAYFLNLVVRTSKPI
FT                   VVVGSMRPGTALSADGALNLFDAVSVAASKDAAGKGVLVTMNDEINSGRDVAKLINIKT
FT                   EAFKSQWGPLGMVVEGKNYWFRAPVKLHTAQSEFNIDDFETLAPVEIVYSYGNVSTTAV
FT                   DAVGKSGVKALIHAGTGNGSVAAALVPSLQAIRAQGVQVIRSSRVPAGFVLRNAEQPDD
FT                   KYDWVVAHDLNPQKARILAAVALTKTTDSKELQRIFWQY"
FT   sig_peptide     460542..460688
FT                   /locus_tag="Pnap_0442"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.881 at
FT                   residue 49"
FT   gene            461823..462749
FT                   /locus_tag="Pnap_0443"
FT   CDS_pept        461823..462749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0443"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="PFAM: glycyl-tRNA synthetase, alpha subunit; KEGG:
FT                   pol:Bpro_4203 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35765"
FT                   /db_xref="GOA:A1VJD7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJD7"
FT                   /protein_id="ABM35765.1"
FT                   /translation="MLTFQQIILKLQSYWADQGCALLQPYDMEVGAGTSHTATFLRALG
FT                   PEPWKAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDL
FT                   KKNDIRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPATGEITYGLE
FT                   RLAMYLQGVDNVYNLTWTDGLTYGDVYKQNEVEQSTYNFEHSDTDFLFTAFSAHEKQAK
FT                   HLVEQQLALPAYEQVLKAGHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRE
FT                   RLGFPLAPREWVEQMTKTSKTTTKKGA"
FT   gene            462753..464888
FT                   /locus_tag="Pnap_0444"
FT   CDS_pept        462753..464888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0444"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rfr:Rfer_3695 glycine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35766"
FT                   /db_xref="GOA:A1VJD8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJD8"
FT                   /protein_id="ABM35766.1"
FT                   /translation="MTTKNLLVELFVEELPPKALKKLGDAFAGVLAEQLKALGLATAES
FT                   VVTAYASPRRLAAHISHVWLKADDKAVQQKLMPVSVGLDSAGHATPALLKRLQALGADL
FT                   SDPVAAVAALKRAPDGKAEALFYNSLVTGATLDTGLQKALEEAIAKLPIPKVMSYQLET
FT                   DCELPGWTSVNFVRPAHGLVALHGSTVVPVKVLGLKAGNSTRGHRFEAAVDPVVLADAD
FT                   SYAVTLEIDGAVIASFAQRKAEIARQLAEAAAELGGGVQPIEDDALLDEVTALVERPNV
FT                   LVCEFEKEFLDVPQECLILTMKANQKYFPLLDAAGKLTNKFLVVSNISPEDASFVIGGN
FT                   ERVVRPRLADAKFFFDQDRKRTLASRVEGLGKVVYHNKLGTQGERTERVAEIAVKIAQL
FT                   LEGDALAGKAGKAAWLAKADLLTDMVGEFPELQGTMGRYYALHDGHSAEIAAAIEDHYK
FT                   PRFAGDELPRNPVGVVVALADKLETLVGMFGIGNLPTGDKDPFALRRHALGVIRMLVEK
FT                   DLPLDLGALVGGAAPVFGDKITDATPALLDFIYDRLSGSLREQGYSAQEVDSVVSQKPQ
FT                   RLGDVPKRLAAVRAFAALPEAPALAAANKRIGNILKKEALEVDPHVSELLLREAAEIAL
FT                   YAAMRDVVPTANAQFDTGDYTASLQTLAALRAPVDAFFDGVMVNAEELDLRLNRQGLLK
FT                   SLHNAMNRVADLSRLVA"
FT   gene            464914..465564
FT                   /locus_tag="Pnap_0445"
FT   CDS_pept        464914..465564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35767"
FT                   /db_xref="GOA:A1VJD9"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJD9"
FT                   /protein_id="ABM35767.1"
FT                   /translation="MTRPDTGLSPAAAAPSGWTSQRTAWLLFGPPAFMVAVRWLLQLAD
FT                   DRQNATPALSLAPVSTTTGILDLLWPVAVVLAVLVAVGLVIRRLGWRRVMPVIGGAWLL
FT                   LWLAGSGAMLERHLNRQGLFLQGMNASATAPVTPVSARVVTSQFKPPSLRSLGGTELVL
FT                   QVAGLEIPQRLLIDDARAAPLKPGDTLALQLAPGRFSGLFVTGWQASPATDSH"
FT   gene            465564..466148
FT                   /locus_tag="Pnap_0446"
FT   CDS_pept        465564..466148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0446"
FT                   /product="D-alpha,beta-D-heptose 1,7-bisphosphate
FT                   phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   pol:Bpro_4201 histidinol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35768"
FT                   /db_xref="GOA:A1VJE0"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE0"
FT                   /protein_id="ABM35768.1"
FT                   /translation="MGLTMKLVILDRDGTINSDSDDFVKTPEEWLPLPGALEAIARLNH
FT                   AGWHVVIASNQSGLGRGLFDVVSLNAMHAKMNKLLALQGGRIDAVFYCPHTADEHCHCR
FT                   KPKPGLLEQIGTRFGVPLKGVPMVGDSLRDVVAGAAAGCEPHLVLTGKSQKYRGMAPPE
FT                   GLPDGTLVHQDLAAFADFVLARAAQSEAASR"
FT   gene            466315..467082
FT                   /locus_tag="Pnap_0447"
FT   CDS_pept        466315..467082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0447"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   pol:Bpro_4200 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35769"
FT                   /db_xref="GOA:A1VJE1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE1"
FT                   /protein_id="ABM35769.1"
FT                   /translation="MPLIRSVLHMLWLILTVIPWALFVVIASLFVNSTTMYWMCARWLK
FT                   LAVDSGTLILGIKNRVTGLENLPSGEKSAAVLLVKHQSTWETLTMPAIMPHPLAYVFKK
FT                   ELLYIPFFGWAMARMDMIHIDRSQRAQAFNKVVAQGKRLMAQGTWVIMFPEGTRINRGQ
FT                   KGVYKSGGTRLAIETGAPVIPIAVTSARCWPRKAFIKKPGIVDISIGKPIPSAGRKPDE
FT                   LMREVEAWIEAEMRRLDPEAYAGRDATPARVRS"
FT   gene            467090..468049
FT                   /locus_tag="Pnap_0448"
FT   CDS_pept        467090..468049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0448"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   pol:Bpro_4199 protein of unknown function DUF45"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35770"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE2"
FT                   /protein_id="ABM35770.1"
FT                   /translation="MMRQARQPAAMARRLVQLTLDLFAPDRAAPAGNLASAAQASDSIQ
FT                   NMPSAQAEQAQTAIETVASPVLPPLPAFRHPRATREIVLDGRLVAYEVKRRKRRTIGFS
FT                   VGSEGLAVSAPKWVPLYEIDQAVQGKSRWILKKLHETRERHRQLESARIDWQEGATFPF
FT                   LGEPVRVVLDSRQLHTALEAGSASAEAARILRIKLPPDAAPGQIQLAVQAWLQQQARQL
FT                   FTARLDFFAAQLGVEWRKLSLSSAATRWGSASTSGAIRLNWRLVHFSPAVVDYVVVHEL
FT                   SHLRFMDHGPHFWATVHGVMPNHAALRRQLKDEVIPRW"
FT   gene            468166..468606
FT                   /locus_tag="Pnap_0449"
FT   CDS_pept        468166..468606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0449"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   pol:Bpro_4198 response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35771"
FT                   /db_xref="GOA:A1VJE3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE3"
FT                   /protein_id="ABM35771.1"
FT                   /translation="MSDKLILVVEDNPDHLELTVLTLEELGLNAEIAVARDGAAALDYL
FT                   FGQGQHAGRDVRRQPAFVLLDMKLPKLSGLDVLRSVRSNPLTALVPVIMLTSSSEHSDM
FT                   VACYQSGANSFVRKPVDFVDFTEKLNRLQAYWLGVNESLAAV"
FT   gene            468674..472207
FT                   /locus_tag="Pnap_0450"
FT   CDS_pept        468674..472207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0450"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: pol:Bpro_4197 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM: GAF
FT                   domain protein; ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, HAMP region domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35772"
FT                   /db_xref="GOA:A1VJE4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE4"
FT                   /protein_id="ABM35772.1"
FT                   /translation="MKLQTLRKRLVWLLMAAMTPLFGLAILNAQLNADAAVSRATDNLK
FT                   FAVSLAASNQQRMTETVHQLLTAISQVPEIQQGQPASCNRYLGEIKRRLPDYMNLGVVG
FT                   MDGYARCHALAEGSQGAARAFFGDRLYFREAVARRNFFAGEYIVGRITGKPSVTFALPV
FT                   LDVQGRVSFVAYAALDLSSMARSIAAIELPAGAKLGIHDRYGTLLAGTGGIPIAIGQKA
FT                   ASPVLQEAVRTLETGVREGLDARGQHQLWAFMPSSSQADTAFFVAVGMDRSTILEPSRR
FT                   QMWLELAALALVAFLGGWMAWVLGSRAIVKPSADILEATRQLQQGRLDVRIPTQSVHAS
FT                   QELMQIAVGFNRMAESVQAHQAALESELASSQAARERLKDAQSLARIGYWQIDLATQQI
FT                   SWSDEVYELFDIDRTQLDGTYQSFLNWIHPSDREAFTVVRDAAVRAGTALDCEFRVIAP
FT                   GGRICWIHQFGRVHFNPDGRASTQRTGVIQDITQRKLAEQALIDSEQRYAELLEMVPLP
FT                   MWVYDSATTRFLAVNQAAVQAYGYSAAEFLSMTIFDIRPEAEHAYLRQWLDNPLRKKAL
FT                   WHDLRKDASLFSVETVSQPIQYVGRAARLVIAMDKTAQDKAEKETQDYLFTLQRAADAA
FT                   QAITWHQTLEGTMQEIADQARGVIGTHQAVVSLSVDGNPLQMTHALSLSEKYEPYRSLI
FT                   KPADGSDIQAVVSESNRLMRMTQAELEAHPRWPGFGGHGGKHPPMRGWLAVPLIGKNGK
FT                   NIGLLQLSDKYEGEFTKQDEYVALELSHLASAGLENSRLLEEISQLNAGLEQKVAERTV
FT                   ALARQEALFRALAEQAPQLVWTASPDGEATYFNRAWFDLMGGKLEDWTGLQWLAVIHPD
FT                   DVSDIQASWKIARASQSSYAGVRRLLAEDGSCHTMAYRGSPVLDEQGKVAFWVGIDADI
FT                   TEIKAIEAALRLSNQELEAFSYSVSHDLRSPLNTIDGFSRLLAKQLAQQLEGEADAKVT
FT                   HYLARIQAGVAQMGQLIEDLLSLSQVTRASLHTERVDLSFMARSLLDEWQTRQPERQVT
FT                   VTVESGLQAQGDRPLVRIVMENLLANAWKFTSQTAQANISVGQTFDAAGLPVFFVRDNG
FT                   AGFDMAYSDKLFDPFQRLHAASEFSGTGIGLATVSRVIKRHGGRIWAESAPACGATFFF
FT                   TLPQGEAYDAS"
FT   sig_peptide     468674..468775
FT                   /locus_tag="Pnap_0450"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.633 at
FT                   residue 34"
FT   gene            472320..472961
FT                   /locus_tag="Pnap_0451"
FT   CDS_pept        472320..472961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0451"
FT                   /product="response regulator receiver protein"
FT                   /note="TIGRFAM: DNA binding domain, excisionase family;
FT                   PFAM: response regulator receiver; KEGG: pol:Bpro_4196
FT                   response regulator receiver domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35773"
FT                   /db_xref="GOA:A1VJE5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE5"
FT                   /protein_id="ABM35773.1"
FT                   /translation="MLREPKTFEAAITATDFSSEDYCGTSYAAKVLGLSVATVQSLVEK
FT                   GEIEAWKTLGGHRRISLHSLNAYLTKYSPQLSRADLHPKHRLRVLVVEDDEAARDLYRC
FT                   HFEEWDLPVDCTWMSSALDALMDIASMRPDLLIADLSMPGVDGIEMLRTIKRNQHLADM
FT                   QIVVISGMAVEAIAARGGLPPQARLVQKPVNFDWLQGYVTALVMANAKWR"
FT   gene            472986..474545
FT                   /locus_tag="Pnap_0452"
FT   CDS_pept        472986..474545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0452"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: pol:Bpro_4195 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region, ATPase domain protein domain
FT                   protein; histidine kinase A domain protein domain protein;
FT                   SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35774"
FT                   /db_xref="GOA:A1VJE6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE6"
FT                   /protein_id="ABM35774.1"
FT                   /translation="MSRFLDKFRLTPAGNLPDVSLQSANSSLPAAQPEWGPLDLTLDGI
FT                   VLLDDKAVILDANAPALEFLHTSLSAISGYSLWDVVPEEVAKQNEEATELALDSADRHS
FT                   FIAHESFENSWVEYTFRRCPAGYVVNLREAGPAQKYQRLLEDSKRYNQLIFEANPNVMW
FT                   VFDRTTLRIFAVNQAAVKFYGIARKIFMTLGMEALFPQGEGAELLRSLHTGKEEQSEMR
FT                   LCKQKKMDGKEVLVELAWSQVKWDGHQAVLVSLADISDRHLADGVLKKTNEELQKTLVA
FT                   QQVELKNVRHDLLTFTQAVSSDLQDSLHAAHGFAARLAEKYSLALDDQGRHYVRRIQAS
FT                   ISQLAKLVDDLRTLAQLPLRSGVPAMVNLAPVCLSLIADLRKRDPDRDVTIEMDSKLML
FT                   VGNKGLLTTAMTCLLENAWKFTSKKTEAWIKVGLLPGKAPGELVLLVADNGAGFDPVYS
FT                   GNLFTAFQRLHSSADFPGNGLGLAIIKRVAQVHGGTVWAESPGQGGASFFMSLPQGEAS
FT                   AS"
FT   gene            474767..475162
FT                   /locus_tag="Pnap_0453"
FT   CDS_pept        474767..475162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0453"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein, MerR; KEGG: pol:Bpro_4192
FT                   transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35775"
FT                   /db_xref="GOA:A1VJE7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE7"
FT                   /protein_id="ABM35775.1"
FT                   /translation="MATTYTISDLAKEFDLTTRAMRFYEDMGLLQPEREGPGGRNRVYS
FT                   ARDRTRLKLTLRAKRLGLSLTEAKEIIDSYDSPRDTAPQLKKFLAILADHRKKLEDQLV
FT                   DLQANLDEIRTHEKEARVLLLKAEKLK"
FT   gene            475243..475686
FT                   /locus_tag="Pnap_0454"
FT   CDS_pept        475243..475686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0454"
FT                   /product="uncharacterized domain 1"
FT                   /note="TIGRFAM: uncharacterized domain 1; PFAM:
FT                   thioesterase superfamily protein; KEGG: pol:Bpro_4191
FT                   phenylacetic acid degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35776"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE8"
FT                   /protein_id="ABM35776.1"
FT                   /translation="MNAATAPSELFQRIEASFLRQGLMRHLGARLVRVEPGLCEVALPY
FT                   SERVNQQQGGFHGGAMGALADIAGGYAALTQVAPDTEVTTVEYKINFLAGFKDGELRAV
FT                   GRVTRAGKRIIVTTAEVTHLDASGKESACALMQQTIAPVTKTY"
FT   gene            475729..476910
FT                   /locus_tag="Pnap_0455"
FT   CDS_pept        475729..476910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0455"
FT                   /product="isovaleryl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.4"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4190 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35777"
FT                   /db_xref="GOA:A1VJE9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJE9"
FT                   /protein_id="ABM35777.1"
FT                   /translation="MNNMPGLNFQLGEDIDALRDAVRDFAQAEIAPRATEIDKSDQFPM
FT                   DLWEKMGALGVLGITVGEEYGGAGMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   KRNGSEAQRQKYLPKLISGEHVGALAMSEPGAGSDVISMKLKAEDKGGYYLLNGSKMWI
FT                   TNGPDADTLVVYAKTEPELGARGVTAFLIEKGMPGFSVAQKLDKLGMRGSHTGELVFQN
FT                   VEVPEQNILGNLNGGAKVLMSGLDYERAVLTGGPLGIMQSVMDNVLPYIHDRKQFGQSI
FT                   GEFQLIQGKVADMYTVLQAGRSFAYTVAKNLDMLGTDHVRQVRKDCASVILWCAEKATW
FT                   MAGEGIQIYGGNGYINEYPLGRLWRDAKLYEIGAGTSEIRRMLIGRELFAETC"
FT   gene            476964..477623
FT                   /locus_tag="Pnap_0456"
FT   CDS_pept        476964..477623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0456"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: pol:Bpro_4189
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35778"
FT                   /db_xref="GOA:A1VJF0"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF0"
FT                   /protein_id="ABM35778.1"
FT                   /translation="MIFMTTSLQHLLDNNCCWAARMEQQRPDFFSRLVDQQTPKYLWIG
FT                   CSDSRVPANEIIALDPGEVFVHRNIANVVVHSDLNALSVIQYAVDHLKVEHIMVVGHYG
FT                   CGGVLAALRGTRVGLADNWLRHVYDVKLRHRQRLDHLPVAEQEDALCEMNVIEQVGNVA
FT                   MSNVMQDAWSRGQKVEVHGWCYGLKDGLVKDMEVSMRGADEVVDVFRHALKRYPRG"
FT   gene            477701..479572
FT                   /locus_tag="Pnap_0457"
FT   CDS_pept        477701..479572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0457"
FT                   /product="Isocitrate dehydrogenase kinasephosphatase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: pol:Bpro_4188 (isocitrate dehydrogenase (NADP+))
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35779"
FT                   /db_xref="GOA:A1VJF1"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJF1"
FT                   /protein_id="ABM35779.1"
FT                   /translation="MFPQRLDSTVAYAIAKAMIDGFNRHYRLFRTESARAKHRFETADW
FT                   HGQQRAQRERIEFYDLRVREASIRLEREFKAGEQPMDVWHQVKLHYIGLLVNHHQPELA
FT                   ETFFNSVTTKILHRSYFQNDFIFVRPAVSTEYIENQEPTAQPTYRAYYPTQGNMHETLV
FT                   KLVEDFGLCREFEDLRRDAGYVAEAMAARLGDVKLRANFQIQVLSGLFFRNKGAYVVGK
FT                   IINGFGEIPFALPILHRQPAPGQVLPADGKGISSQSDAGKLVIDAALFGEDDLLILFSF
FT                   ARAYFMVDMGIPSAFVQFLRSMMPRMPRAEIYNALGLAKQGKTLFYRDFLHHLRHSTDK
FT                   FRIAPGIKGMVMLVFDLPSFPYVFKVIKDYYPPQKDTTREQIKGKYLLVKQHDRVGRMA
FT                   DTQEYSEVAFPRERFSDELIAEIEKFAPSQLEISDRDGDGQMEVIIKHVYIERRMIPLN
FT                   IYLQEAFDFGVAEPAARDQIERAVVEYGNAIKDMVAANIFPGDMLWKNFGITRHGKVVF
FT                   YDYDEIEYITDCKFRKVPTPRNEEDEMSGEVWYSVGPKDVFPETFGPFLLGNDAVREVF
FT                   MKHHADLLDAAFWQRHQARIQAGHVYDVFPYDQQKRFAVMHGPARAG"
FT   gene            479647..480828
FT                   /locus_tag="Pnap_0458"
FT   CDS_pept        479647..480828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0458"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: pol:Bpro_4187 acetyl-CoA C-acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferases; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35780"
FT                   /db_xref="GOA:A1VJF2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF2"
FT                   /protein_id="ABM35780.1"
FT                   /translation="MSESIVILGAARTPMGAFQGDFASLSANDLGGAAIRAAVERSGVS
FT                   PAQVDEVLFGNCLMAGQGQAPARQAGFKGGLPASTGAVTLSKMCGSGMEATMLAHDQLL
FT                   AGSRDVVVAGGMESMTNAPYLLPKARAGMRIGHDRVMDHMMLDGLEDAYEAGRSMGTFG
FT                   EDCAAKYGFTREAQDAFATASVQRAKAASESGAFKDEITPVTVKGRAGDTVISIDEGPG
FT                   KVKLEKIPALRPAFKKDGTITAASSSSINDGAAALVLARASTATELGLTPLARIVGHAT
FT                   FAQAPEWFSTAPVGAVNKLLKKIGWEVKDVDLWEINEAFAVVPMAAMADLGLSHDIVNV
FT                   NGGACALGHPIGCSGARIIVTLMHALKARGLKKGVATLCIGGGEGTALAIEVL"
FT   gene            480874..482004
FT                   /locus_tag="Pnap_0459"
FT   CDS_pept        480874..482004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0459"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pol:Bpro_4185 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35781"
FT                   /db_xref="GOA:A1VJF3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF3"
FT                   /protein_id="ABM35781.1"
FT                   /translation="MILNDDQEQVRDAVRAFAQAELWPHAARWDKEHYFPKEAHKGLAA
FT                   LGAYGICVPEEFGGANLDYVTLALVLEEIAAGDGGTSTAISVTNCPVNAILMRYGNPAQ
FT                   KKQWLMPLAQGDLLGAFCLTEPHTGSDASSLRTTAVKDGDGYVLSGVKQFITSGQNGQV
FT                   AIVIAVTDKGAGKKGMSAFIVPTDAPGYSASRLEDKLGQHSSDTAQVNFDNCRIPAENL
FT                   IGAEGEGYKIALGGLEGGRIGIAAQSVGMARSAFEVAVAYAKERQSFGSAIFNHQAVGF
FT                   RLADCATQLEAARQLIWHAASLRDAGRPCLKEAAMAKLFASEMAEKVCSAAIQTLGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDVQKIIIQRALA"
FT   gene            482039..482455
FT                   /locus_tag="Pnap_0460"
FT   CDS_pept        482039..482455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0460"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: pol:Bpro_4183
FT                   rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35782"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF4"
FT                   /protein_id="ABM35782.1"
FT                   /translation="MPITKGFQALVDEAMEEIKTYSVEDVKARMADPAVQIVDIRDPRE
FT                   LERGGTVVGAFHAPRGMLEFWVDPASPYFKPIFADESREFILFCGAGWRSALATKTLQD
FT                   MGMRNVAHIDGGYAEWVKQGAPTETLEARKARKA"
FT   gene            482671..483831
FT                   /locus_tag="Pnap_0461"
FT   CDS_pept        482671..483831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0461"
FT                   /product="aminotransferase, class V"
FT                   /note="KEGG: pol:Bpro_4174 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35783"
FT                   /db_xref="GOA:A1VJF5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF5"
FT                   /protein_id="ABM35783.1"
FT                   /translation="MPGLLPNIDPDGLLEFSVVYTDRALNHMSRSFQGVMNDISSILKE
FT                   VYKAHSVALVPGSGTYGMEAVARQFATARHVLVIRNGWFSYRWTQIFDMGNIPASSTVL
FT                   KARQLGAGAQAPWAPAPIADVQAAIAREKPAVVFAPHVETASGMILPDDYLRAVADAVH
FT                   EAGGLFVLDCIASGAMWVDMQATGVDVLISAPQKGWSSSPCCAMVMLSERARVAIDGTT
FT                   STSFACDLKKWLQIMETYEKGGHAYHATLPTDALTRLRAAMQETQAYGFAKVKAEQVAL
FT                   GEKVRALFESRGLPSVAAVGFKAPGVVVSYTTDPEIQSGRKFLDQGLQTAAGVPLQCDE
FT                   GADFMTFRVGLFGLEKWHQVERTVGQLAAALDRIGLVAPVGEAVAG"
FT   gene            complement(483853..484824)
FT                   /locus_tag="Pnap_0462"
FT   CDS_pept        complement(483853..484824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35784"
FT                   /db_xref="GOA:A1VJF6"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF6"
FT                   /protein_id="ABM35784.1"
FT                   /translation="MKDETVFAKEAEQEPPAPGQRPEHTMGTPAEATKPVSRPERLLRQ
FT                   LLLKRPKIVILAWAVVVLVFLLLLPLAYLAWFQLPGRLWAFANEQWWHWIPAFLGFIAI
FT                   VFIPLWAVMGAIALAGFLADISLSIEHAAIQDAQRVVRETEQDAISRLELTDVAGLLPL
FT                   LKYSRAQLDAYYAIGLNQTRKSFFNAVLAMWLGFILLLIGIALYVGPVEKLGLTRPQQD
FT                   FQILILSGAAIIEFVSALFLWVYRSTTAQLTYYYKRQMHSHTSILCFRMATTIQTLEKS
FT                   DEIKKAIIEKVLDWNEMPERPPLVGAKGLRSLLPASEAKATP"
FT   gene            485047..485313
FT                   /locus_tag="Pnap_0463"
FT   CDS_pept        485047..485313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0463"
FT                   /product="aminotransferase, class V"
FT                   /note="KEGG: pol:Bpro_4174 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35785"
FT                   /db_xref="GOA:A1VJF7"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF7"
FT                   /protein_id="ABM35785.1"
FT                   /translation="MAMFKAPGVVVSYTTDPEIQSSRKFLDQGLQTAAGVPLQCDEGAD
FT                   FMTFRVGLFGLEKWHQVERTVGQLAAALDRIGLVAPVGEAVAG"
FT   gene            complement(485332..485946)
FT                   /locus_tag="Pnap_0464"
FT   CDS_pept        complement(485332..485946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0464"
FT                   /product="protein of unknown function DUF1326"
FT                   /note="PFAM: protein of unknown function DUF1326; KEGG:
FT                   mlo:mll4476 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35786"
FT                   /db_xref="InterPro:IPR009758"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF8"
FT                   /protein_id="ABM35786.1"
FT                   /translation="MSSWQITGQYMETCNCAFLCPCITSNLTARPTEGDCKAAVTMHID
FT                   KGAKDGIALDGLSFVLILHSPGPMGEGNMTVGLIVDNTASDQQLEAISAIASGSAGGPM
FT                   AALAPLVSTNAGVERRPIRFEVDGLNYAMSAGELVDQACEGLPSVTDPEQAIGIDNTAH
FT                   PVNSRLSLAKAKRSRFHAFGIDWEDATGTRNGHFAPFAWAG"
FT   gene            486200..486994
FT                   /locus_tag="Pnap_0465"
FT   CDS_pept        486200..486994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_1844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35787"
FT                   /db_xref="GOA:A1VJF9"
FT                   /db_xref="InterPro:IPR018688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJF9"
FT                   /protein_id="ABM35787.1"
FT                   /translation="MRQQKPDSANKTPQGLLTLATRQPKLATGILAISVIGWLFLAWIA
FT                   VDMSQPFAQLTMPDSSQWGAASVLAIWTMWALMMAAMMLPSALPMILTFVDLGVRTAEP
FT                   ARGRSFVAAYLFVWFAFSAGATAAQWVLQAMGWVNPMIVSSSALLTALLLLIAGAYQFS
FT                   RLKQVCLSRCRTPMGFLLGEWRAGVYGAFVMGVRHGLFCVGCCWALMALLFVGGVMNLA
FT                   WVAALSITVAIEKLAPRGERLASALGLGLIAAGLAKLLVLVS"
FT   gene            487094..487504
FT                   /locus_tag="Pnap_0466"
FT   CDS_pept        487094..487504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35788"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJG0"
FT                   /protein_id="ABM35788.1"
FT                   /translation="MTTPCPCGRTSANSAKPAKTQPLPFFACCGPYLNESVPAPDAHAL
FT                   MRSRYSAFVLQRADYLLATWHASTRPAALDFAPGAKWLGLDVRSHRVLDADHAEVEFVA
FT                   RCREAGRATRLHERSRFVRESERWFYVDGDQF"
FT   gene            487567..488226
FT                   /locus_tag="Pnap_0467"
FT   CDS_pept        487567..488226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0467"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: bxe:Bxe_B1631 HAD-superfamily hydrolase,
FT                   subfamily IA, variant3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35789"
FT                   /db_xref="GOA:A1VJG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG1"
FT                   /protein_id="ABM35789.1"
FT                   /translation="MKFEAILFDCDGVLVDSEPITNGVLRDMLEEGGWSLTPAECMRVF
FT                   VGKAVRDERLLIEAKTGQPLTEDWMAEFYARRNRELQARLTAIAGAHEAVAAAHAHVAE
FT                   RIACASGADRFKVEMQLAQVGLMDYFAGRIFSGHEMPRSKPAPDVYLAAAAHLGAAGAR
FT                   CLVIEDTTTGVTAGIAAGATVWAYCPQPEQGAVLRQAGASQLFAHMAELPGLLAAV"
FT   gene            complement(488415..488861)
FT                   /locus_tag="Pnap_0468"
FT   CDS_pept        complement(488415..488861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0468"
FT                   /product="Ion transport 2 domain protein"
FT                   /note="PFAM: Ion transport 2 domain protein,; KEGG:
FT                   nha:Nham_1961 ion transport 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35790"
FT                   /db_xref="GOA:A1VJG2"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG2"
FT                   /protein_id="ABM35790.1"
FT                   /translation="MVLVIFSCLLLIALTTLMHYEVLSSLNLRLPALAMPSRAKLLVVI
FT                   FAAFMAHALEIALYGFALFGLVQYVGGVGGLTGAGDSSLQNCLYFSAETYSSLGFGDLI
FT                   PNGPIRLLAGVEALNGLLLIGWSASYAYIAMERFWGSGSGDGES"
FT   gene            complement(488880..489941)
FT                   /locus_tag="Pnap_0469"
FT   CDS_pept        complement(488880..489941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0469"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: rfr:Rfer_3834 transcriptional regulator,
FT                   AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35791"
FT                   /db_xref="GOA:A1VJG3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG3"
FT                   /protein_id="ABM35791.1"
FT                   /translation="MPELCATPASPRPALEPAITPMAFVQAIALAYERRGLSPAAALAQ
FT                   AQIAPSSLHDASTCITAWQMERLCGTAMQELDDEALGWFSRRLPWGSYGMLARASLSAP
FT                   SLGVALKRWCRHHGLIADDIALTLSVSGDTALLAITEQRDLGALREFCLVSVLRNILGV
FT                   ACWLIDSRIPLLGAQFPFAAPPHRDVYAVLFSGPTAFDTAPAGLRFDARYLALPLRRDE
FT                   RALQQMLERALPLTVLPYRRDRLLVQRVRQALAANPAQTHSAQALAALVHVSPRTLHRQ
FT                   LKEEGASLQALKDEVRRARALELLLRTRRPIKQVAEAAGFQNEKSFMRAFKTWTGQSPA
FT                   EFRRGGQGLDSSA"
FT   gene            490052..491791
FT                   /locus_tag="Pnap_0470"
FT   CDS_pept        490052..491791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0470"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pol:Bpro_4161 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35792"
FT                   /db_xref="GOA:A1VJG4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG4"
FT                   /protein_id="ABM35792.1"
FT                   /translation="MSEEHSVPRPETALLTRSFARGATDVPLIEQPIGAFFDAIAVHQP
FT                   NHEALVSVHQRRRYTYLELQRETNRLASALLSLGLQPGERVGIWSHNNAEWVLMQLATA
FT                   KAGLILVNINPAYRTAEVEYALNKVDCKALVTMARFKTSDYLGMLRELAPEWEHGQPGQ
FT                   LESAKLPHLRSVVWIDEAGQGDEQPGLTRFSSLLASGNPDDARLAALAFTLQATDPINI
FT                   QFTSGTTGFPKGATLTHRNILNNGFFIGEAMKLTPADRLCIPVPLYHCFGMVLGNLACL
FT                   THGATIVYPNDGFDALSVLQTVQDERCTGLHGVPTMFIAELDHPRFAEFDLSTLRTGIM
FT                   AGSPCPTEVMKRVVNSMNLGQITIAYGMTETSPVSCQSSIDTPLAKRVSTVGLVQPHLE
FT                   IKIIDPESGEIVLPGVSGEFCTRGYSVMHGYWDDPARTAESIDADGWMHTGDLATMDFE
FT                   GYVNIVGRIKDMVIRGGENIYPREIEEFLYRHPKVQDVQVVGLPDKRYGEELCAWIVTR
FT                   PGETLSEDEIRAFCKGQIAHYKVPRYIRFVPGFPMTVTGKIQKFRIRDEMKTQLGLEED
FT                   KTA"
FT   gene            491808..493415
FT                   /locus_tag="Pnap_0471"
FT   CDS_pept        491808..493415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0471"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: pol:Bpro_4160
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35793"
FT                   /db_xref="GOA:A1VJG5"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG5"
FT                   /protein_id="ABM35793.1"
FT                   /translation="MTTLDTQLNARSADFQANAAAMRALVDDLHVQLAKSAAGGGEVAR
FT                   ARHTARGKLLPRDRVQMLLDPGTPFLEVAPLAALGMYKGDAPCAGLIVGIGRVSGVDCM
FT                   IVCNDATVKGGTYYPLTVKKHLRAQEIAQQNHLTCIYLVDSGGANLPNQDEVFPDRDHF
FT                   GRIFFNQANMSALGISQIAVVMGSCTAGGAYVPAMSDESIIVKNQGTIFLGGPPLVKAA
FT                   TGEVVTAEDLGGGDVHTRLSGVADHLAQNDMHALALARASVKNLNKNKAFAHAGRAPIA
FT                   PKFVADELYGVIPVDVRKPFDVREIIARIVDGSDFDEFKARYGTTLVCGFAHIEGMAVG
FT                   IIANNGILFSESALKATHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIARNGAKMVT
FT                   AVATAAVPKFTVIIGGSFGAGNYGMCGRAFSPRFLWMWPNARISVMGGDQAAGVLATVK
FT                   RDGIEGKGGAWTAEEEEHFKAPIRSQYEHQGHPYYATARLWDDGVIDPADTRRVLALGL
FT                   SASQNAPIPETKFGLFRM"
FT   gene            493424..493945
FT                   /locus_tag="Pnap_0472"
FT   CDS_pept        493424..493945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0472"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: sme:SMc00593
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35794"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG6"
FT                   /protein_id="ABM35794.1"
FT                   /translation="MNLNVYFATLARYNVWATQRLLEAVADVPDDGYRCDAGLFFRSIH
FT                   GTLAHLLVGEHQLWFRRFAEGVSPVVALDADLVPERQALAAQLLAGARRWEPLVASLPP
FT                   ERFDGLLNYTTMRGQPASLPFAATLGHVFNHGTHHRGQITAALTALGRPCPELDMVYFL
FT                   QTQPHQESPA"
FT   gene            493942..494724
FT                   /locus_tag="Pnap_0473"
FT   CDS_pept        493942..494724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0473"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pol:Bpro_4159 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35795"
FT                   /db_xref="GOA:A1VJG7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG7"
FT                   /protein_id="ABM35795.1"
FT                   /translation="MSASLEISYDGAVARITLNRPDVRNAFNDEVIAELTAAFQEMAAR
FT                   AEVRAVVLAAIGPAFCAGADLNWMRRMADYTRDENLLDAAALAEMLRVMYECPKPTIAR
FT                   IQGDVYAGGMGLVAACDMAVSVDTANYCLSEVKLGLIPATISPYVIRAMGARAAHRYFL
FT                   TAERFDAKEAHRIGFVHEVVGADALDAKVAELTNALSSASPNAVRSCKTLVQEVAGQGI
FT                   EAPLIGRTVEGIADIRTSSEGREGVQAFLQKRKPSWLA"
FT   gene            494747..495418
FT                   /locus_tag="Pnap_0474"
FT   CDS_pept        494747..495418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0474"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: pol:Bpro_4158 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35796"
FT                   /db_xref="GOA:A1VJG8"
FT                   /db_xref="InterPro:IPR025196"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG8"
FT                   /protein_id="ABM35796.1"
FT                   /translation="MQALDTAQLIALAGALGWASGVRLYLVMLLTGLAGYMGWMELPQG
FT                   LHLLANPVVLGASGFMVFVEFFADKIPGLDSLWDVVHTVIRIPAGAALAAGVFGADSSA
FT                   MGLAAALVGGTLAATSHAAKATSRAAINTSPEPFTNIGTSLVEDSLVPAGLWLAIAHPL
FT                   VFIPLLALVLVLSIWLIRLCWRFLTQLFARVARIFSGKPDAGLPPAFTLKSPFSKNDPH
FT                   V"
FT   gene            495411..497423
FT                   /locus_tag="Pnap_0475"
FT   CDS_pept        495411..497423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0475"
FT                   /product="3-methylcrotonoyl-CoA carboxylase, alpha subunit"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain,
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   pol:Bpro_4157 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35797"
FT                   /db_xref="GOA:A1VJG9"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJG9"
FT                   /protein_id="ABM35797.1"
FT                   /translation="MFKKILIANRGEIACRVAATARRMAVKTVAVYSDADASAKHVGYC
FT                   DEAVHIGGSAPKDSYLRWERIIEAAKATGAEAIHPGYGFLSENEEFAKACAGAGLVFIG
FT                   PPASAIKAMGLKAESKQLMEKAGVPLVPGYHGADQDPVMLKHEADRIGYPVLIKASAGG
FT                   GGKGMRAVEKSEDFAAALASCKREAINSFGNDTVLVEKYAQRPRHIEIQVFGDMHGNYV
FT                   YLFERDCSVQRRHQKVLEEAPAPGLSPEMRQQMGLAAVAAARAVNYVGAGTVEFIVEQR
FT                   ADGSMNFFFMEMNTRLQVEHPVTEAITGLDLVEWQLRVASGEPLPLAQDQLKINGHAIE
FT                   ARICAENPDNNFLPTTGTLHVYDKPLCTAFERADLSNAGIAVRIDDGVRQGDTISPFYD
FT                   SMVAKLIVHGQTREEALARMDEALAQTRIVGLATNVQFLRYVVRSPSFAQANLDTALIP
FT                   REEAVLFKQEPVGLPLAAAAAIAQTLLSEKATEGADPFSRRDGWQTHGVTQRPFEFDFH
FT                   GEPAKAALTYRHDGALQLTVGDVSGPLVFAQSGQGIAIQFAGQRLSATVYTQGEVDHVF
FT                   TARGATQITAIDLLAHAGESHTEGGRLTAPMPGKILSFSVKAGDLVQKGQPLAVMEAMK
FT                   MEHTIAAPADGVVEELMYAPGDQVTEGSELLKITV"
FT   gene            497441..498370
FT                   /locus_tag="Pnap_0476"
FT   CDS_pept        497441..498370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0476"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase,
FT                   NAD-binding; KEGG: pol:Bpro_4156 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35798"
FT                   /db_xref="GOA:A1VJH0"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH0"
FT                   /protein_id="ABM35798.1"
FT                   /translation="MRISFCCTDTQAQPWLEGLRAAFPGADVEPWSAGAAAADYAVVWT
FT                   PPQQFIDEQTKLKGIFNIGAGVDALMKLRLPPGVPVVKLDDAGMSVQMAEYVCHAVIRH
FT                   FREFDGYEADAAEGKWSYRKPHQRQDFPVGVMGLGVLGERVARALAQFEFPVLGWSRSA
FT                   KVIDGVQCFSGEAGFNDFLAASRILVCLLPLTPNTDNIMRRDTLARLQPGGYVINVARG
FT                   SHLVDDDLIALIDSGHLSGATLDVFRTEPLPAAHPFWKHPKITVTPHTSARTLREESIA
FT                   QIAGKIRALESGAPIAGLAGVVDPNQGY"
FT   gene            498375..499301
FT                   /locus_tag="Pnap_0477"
FT   CDS_pept        498375..499301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0477"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   pol:Bpro_4155 pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35799"
FT                   /db_xref="GOA:A1VJH1"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH1"
FT                   /protein_id="ABM35799.1"
FT                   /translation="MTLHLPSRVKLVDVGPRDGLQNEKSPVPAAVKIELVHRLQDAGLT
FT                   EIEVTSYVSPKWVPQMADNAEVMAGIRRKPGVRYSVLTPNMQGLEAAMKPAPELWPDEI
FT                   VVFGAASEAFSQRNINCSIAESIERFRPVVAAARANNIYVRGAISCTVGCPYEGEIAPE
FT                   RVEMVARLMKDIGVQHIGVADTIGVGTPLKVQRALEAALKHYDLDGVSGHFHDTYGQAL
FT                   ANTLASLQMGVWQFDTSVAGLGGCPYAKGATGNVATEDVVYLLHGMGIETGIDLDKLID
FT                   AGKFISDFLGRQPNSRAATALLNKRMN"
FT   gene            499301..500053
FT                   /locus_tag="Pnap_0478"
FT   CDS_pept        499301..500053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0478"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   protein of unknown function DUF1289; KEGG: pol:Bpro_4154
FT                   YbaK/prolyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35800"
FT                   /db_xref="GOA:A1VJH2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH2"
FT                   /protein_id="ABM35800.1"
FT                   /translation="MCGAELKVLPEGVQRVAAFLQDKGHMHAPVMLDDAARTAQQAADA
FT                   LGVAVGQIAKSIIFRRKSDDAAVLVVTSGDRRVDEKKVEALVCLDGKRLGRADAAFVKS
FT                   RTGFSIGGVSPLAHATPSVTLIDQSLFRFEQIWAAAGHPHGVFQLSPWELQDLTGAPVA
FT                   DLAVDEDDKKRELQRAISLVRLRAPTPDTTLDVSSPCISICRMNASSGLCEGCFRTRDE
FT                   IAGWSGATDEGKRAVWKIIEQRMAALQT"
FT   gene            500050..500739
FT                   /locus_tag="Pnap_0479"
FT   CDS_pept        500050..500739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0479"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: pol:Bpro_4153 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35801"
FT                   /db_xref="GOA:A1VJH3"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH3"
FT                   /protein_id="ABM35801.1"
FT                   /translation="MTSMNPNLQAPAAELKDISCYLDFISPYAYLAFELLPEALQGISY
FT                   SLSYKPVLFGAMLKHHGQLGPAEIAPKRDWTYRQVAWLAHRHGIPLQMPASHPFNPLPL
FT                   LRLALACSPAAEPTAPNRYVCETIFRHVWRGGNEVTDPARLQALTSALAPPREVNGDEV
FT                   KMQLKRNTDEAIALGVFGVPAFVVDGKLFWGLDSLPMLRAYLQGDAWFDGPAWDAGASV
FT                   REGLRRQ"
FT   gene            500800..502626
FT                   /locus_tag="Pnap_0480"
FT   CDS_pept        500800..502626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0480"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294,
FT                   nucleotidyltransferase putative; KEGG: cvi:CV2945 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35802"
FT                   /db_xref="GOA:A1VJH4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH4"
FT                   /protein_id="ABM35802.1"
FT                   /translation="MPSAFNFSASPFDCLTPDEQQLVQDSVDIAYFPQGATILAPGAQP
FT                   THLFVIIKGFVQQFDGNDVVTTYGPEDCFDGRGLMAGKVSSRFVAAEEVVAYQLARQAV
FT                   SDLIAGNVTFGALLFSDLSNKLSALSERQSRHELQSLTMARVDEAFVRTPHFVDADMSI
FT                   LDVTRQFHSLRTATLLVRDSQVSPPALGIFTLTGLQRAILDGTPLDRLAVRGLTNFSLI
FT                   KVRPSDQLGDALAVMIKHKVHRVVVAEGEHITGVLEALDLFSFLSNHSYLINVQILDAR
FT                   DVPALQEAAGQITRLISLLQRSGTHINMIARLVQELNAKLFERAWQLIAPPDLVANSCL
FT                   FVMGSEGRGEQLLKTDQDNGLVLRDGYEPACDVAAVCRRFSAALADFGYPPCPGNIMVS
FT                   NPQWCQSVTDFSQTARLWLMAATTDGLMALAIFLDAHAVCGDRTLLDKVRAAVYDMTAD
FT                   NDAMLARFASAINAFGNSSAWWNRLLFRGDQGKEALDIKKAGTFPLVHGVRSLALAHHV
FT                   SATSTVERVQALVAAGRLPEKLANDLIDSLHFFMGLKLKVGLQQLETGHAASDEIALDK
FT                   LSSLDRDLLKDTLGVVKQFKALLNQRFHLEAM"
FT   gene            502623..503285
FT                   /locus_tag="Pnap_0481"
FT   CDS_pept        502623..503285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0481"
FT                   /product="Exonuclease, RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease, RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: wsu:WS0596 DNA polymerase III,
FT                   epsilon subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35803"
FT                   /db_xref="GOA:A1VJH5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH5"
FT                   /protein_id="ABM35803.1"
FT                   /translation="MSVFAGLPPSRWFAALKREWLLYHLGDPRFRFMWDPAPENEWVAL
FT                   DCETTGLNTRTDDIIAIGAVRIRDNRIMTSERLELLVRPEKRRLSAESVRVHRLREQDV
FT                   AQGISADEAMMKLMYFIGSRPLVGYYLEFDLAMINRVLFPMLGMGLPQPKIEVSSMYYD
FT                   YKFHQLPHHARDSGSIDLRFESLMKDLNLPLWSAHDALNDAIMAALAFLKLRQLRAG"
FT   gene            503441..503794
FT                   /locus_tag="Pnap_0482"
FT   CDS_pept        503441..503794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0482"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35804"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH6"
FT                   /protein_id="ABM35804.1"
FT                   /translation="MKGFAMRYLNIKFSPLSAALVLSAACLLGCSVLQAGEQAASAPGD
FT                   PALAAAVTQAIHDALDYKAKDIQVAVNGGVVMLSGWANQPSDESRARAVASRVPGVMRA
FT                   YSRVHLWSSDDSY"
FT   sig_peptide     503441..503548
FT                   /locus_tag="Pnap_0482"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 36"
FT   gene            complement(503880..505884)
FT                   /pseudo
FT                   /locus_tag="Pnap_0483"
FT   gene            complement(505881..506234)
FT                   /locus_tag="Pnap_0484"
FT   CDS_pept        complement(505881..506234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0484"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   xoo:XOO4547 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35805"
FT                   /db_xref="GOA:A1VJH7"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH7"
FT                   /protein_id="ABM35805.1"
FT                   /translation="MTNYPSRRKFMSDPVRVDPMVAKVEANPKYHELRRKRNTFGWSMT
FT                   ALMMVVYYGYIALIAFNKPFLAQPIGAGVTSLGVPIGFGVIVFTIVITGIYVRRANGEY
FT                   DRLTAEILKEASK"
FT   gene            506556..508214
FT                   /locus_tag="Pnap_0485"
FT   CDS_pept        506556..508214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0485"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: pol:Bpro_4142 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35806"
FT                   /db_xref="GOA:A1VJH8"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH8"
FT                   /protein_id="ABM35806.1"
FT                   /translation="MATTVDKSVMTAEQRKVIFASSLGTVFEWYDFYLYGSLAAIIAKQ
FT                   FFSGLDAGSAFIFALLAFAAGFIVRPFGALVFGRLGDMIGRKYTFLVTIVIMGLSTFIV
FT                   GLLPSYASIGVAAPVILIALRMLQGLALGGEYGGAAVYVAEHAPEGRRGAYTSWIQTTA
FT                   TMGLFLSLLVILGVRTAVGEVAFADWGWRVPFVVSILLLAVSVYIRLSMNESPAFQKMK
FT                   AEGRTSKAPLSESFGQWKNLKIVILALVGLTAGQAVVWYSGQFYSLFFLTQALKVDGPT
FT                   ANILVAYSLLLATPFFVVFGTLSDKIGRKPIIMAGCLLAALTYFPVFTALTKAANPDLA
FT                   EAQARNQVVVTADPKECSFQFNPTGTAKFTSSCDIAKQVLAGASVSYENVAGPAGTVAS
FT                   IKIGQNAIPSYTAKGLSADEARKKDVEFKKLIGDDLKAAGYPSKADPAKMDKVMVTAIL
FT                   FYLVLLVTMVYGPIAAMLVEMFPTRIRYTSMSLPYHIGNGWFGGLLPTTAFAIVAQTGN
FT                   MYNGLWYPIIIAGVTFVVGTLFVKETKDYDIYAND"
FT   gene            508230..508733
FT                   /locus_tag="Pnap_0486"
FT   CDS_pept        508230..508733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4141 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35807"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJH9"
FT                   /protein_id="ABM35807.1"
FT                   /translation="MIYVKTESGQSALLSRSLALTPRQRSAFIMFDGKRSMKEVLKATE
FT                   GLGITQDDVAHMVTRGLLVPISTANKVAAMVSLPGAPVIAAAPAPLAPAPQPQADRQDA
FT                   QAHYSKAYPIATRLTAGLGLRGFLLNLAVEAAGDLGKLRELAPKIEQAVGPEKFRELEN
FT                   ALYE"
FT   gene            complement(508744..509847)
FT                   /locus_tag="Pnap_0487"
FT   CDS_pept        complement(508744..509847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0487"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_4140 extracellular ligand-binding receptor; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35808"
FT                   /db_xref="GOA:A1VJI0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI0"
FT                   /protein_id="ABM35808.1"
FT                   /translation="MFFWCAALLTASLGQVCQAQILIGQTAGFTGPVGAGVKETTDGAR
FT                   LYLDSINAKGGIGGQKIELISLDDKFDPKLAAENARKLIEEKNVVAMFLTRGTPHTEAV
FT                   IPLLDKYAVPLVGPSTGAMVLHQPVQKHVFNVRAPYQREAEKAITHLSSMGISRIAIIY
FT                   TDDSFGTDGLTGAQKGMATAKRTLVALEKINRAKPDFTALAPKIQQSNAQAVIIIASGQ
FT                   TVAEGLQALRAAGSAAQIVTLSNNASSGFIKSLGDSGRGMIVTQVFPSERSIAYSLVKE
FT                   ALELVKAKQQTELSPAMLEGFAAAKILVEGLRRASPQPSREKLQAALEGIGKLDIGGLE
FT                   VTYNANDHSGLDFSDLSIIGTDGKFKR"
FT   sig_peptide     complement(509788..509847)
FT                   /locus_tag="Pnap_0487"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            510042..515939
FT                   /locus_tag="Pnap_0488"
FT   CDS_pept        510042..515939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0488"
FT                   /product="UvrA family protein"
FT                   /note="KEGG: pol:Bpro_4139 excinuclease ABC, A subunit;
FT                   TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35809"
FT                   /db_xref="GOA:A1VJI1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI1"
FT                   /protein_id="ABM35809.1"
FT                   /translation="MSQGTIRIRGACQHNLKNIDLDIRTGELTVVTGPSGSGKSSLVFD
FT                   TLFAEGQRRYVETFSAYARQFLDRMDKPAVDKVEGVPPAIAIDQTNPVRSSRSTVGTMT
FT                   ELNDHLKLLYARAAQLFDRQTALAVRHDSPESIYAELMARTAGADPRVVMTFPVELPGN
FT                   TSAAEVEQWLSASGFTRVHAQRDVATPAGPHKLLDVVADRFRLHLTEKIRVIEAIETAL
FT                   KRGGRLNVYVQPGQPGEAEEMWRFSTGLHCPESDLRYTDPTPSLFSFNSAMGACETCKG
FT                   FGRVIGVDYGLVIPNDRLTLRAGAIKVMQTPAWKEAQDDLMRHAEAEGIPRDTPWYKLT
FT                   PEQQAWVINGSPDWKGKWEKHWFGIKRFFAYLESKAYKMHIRVLLSKYRSYTTCEACGG
FT                   ARLKLESLQWRLGSKEAADAVLPPAERFMPVGVQWTRAQLEAMPGLCLHDLMRLPIDRL
FT                   QKFSGSLSFAAAGDDAEQKALKSLFEEIRTRVKYLCDVGIGYLTLDRQSRTLSGGEVQR
FT                   INLTTALGTSLVNTLFVLDEPSIGLHPRDMHRITQAMRRLVDAGNTLVVVEHDPAVMLA
FT                   ADRMIDMGPGPGEKGGQIVFDGTPEEVRHADTLTGAYLGGRKLVGMGLKRAVTDNTPRL
FT                   VLEGARDHNLKNLTVEFPLQRLVCVTGVSGSGKSTLMQDILAPALLRQFGKATETPGLH
FT                   DRLLGAERLTDVVFVDQSPIGKTARSNPASYVGAWDAVRELFALSPLARQRSYTASKFS
FT                   FNNGDGRCPTCGGSGFEHVEMQFLSDVYLRCPDCDGKRYRPEILEVTIERQAIGQLKSR
FT                   LLNVADVLDLTVSEAVQLFAQDREVMRALQPILDVGLEYVKLGQPVPTLSGGEAQRLKL
FT                   AGFLAGASKAAGQRQSASGQALALKHPNRGTLFLFDEPTTGLHFDDIAKLMRALRRLLE
FT                   AGHSLIIIEHNLDVIRSADWLIDLGPEGGENGGLLVAEGPPEIVRHHPTSHTALALRDY
FT                   EQAMSKSYKVEEPRPKAWKTRPAFSNLIQIVNARENNLKSLSVDIPRGKFNVVTGVSGS
FT                   GKSTLAFDILFNEGQRRYLESLNAYARSIVQPAGRPEVDAVYGIPPTVAIEQRLSRGGR
FT                   KSTVGTTTEVWHFLRLLYVKLGIQHCTKDGAAVMPQSPESIAAQLLKTYRGQHIGLLAP
FT                   LVMNRKGVYTELADWARPRGYTHLRVDGEFLPTTGFPRIDRFKEHTVELPIADIHVTPD
FT                   NEAALRQALATALEHGKGVVHVLATLDGLWEAMLAGASTQAIGRIEAFSTRRACPVCST
FT                   SYPELDPRLFSYNSKHGWCPDCVGTGVKLTRDQRKVFDDSVLGSDDNKGREQTFGEPET
FT                   DDVLDAVCPACAGTRLNPQARAVLFADAGIADIAALSVTDVRGWVDQLALSGREAGIAR
FT                   DLVPEIRSRLEFLEDVGLGYLTLDRGAPTLSGGEAQRIRLAAQLGSNLQGVCYVLDEPT
FT                   IGLHPRDNQILLGALGKLSERGNTLVVVEHDEDTIRRADNIIDIGPGAGKRGGTLVAQG
FT                   TAAQLSAVPESLTGRYLANPLIHPLHARRQTLAGSAVAELDSDPGAAASPGAVPAKPLS
FT                   KARQAALKAQALKAAAAQASAQHNAAPAAASPFTSWLTVVNASLHNLKNVTVEVPLYRL
FT                   VAVTGVSGSGKSTLARDVLLTSVHAGVTQRSTKAGREADDAGKHPAWTGCERIEGYRVV
FT                   DRVLEVDQTPIGKTPRSCPATYIGFWDTVRKLFADTLEARARGYAAGRFSFNTGEGRCP
FT                   TCEGAGVRTIGMSFLPDVKVLCETCHGARFNPETLAVTWRGKSIGDVLKMEVDEAVDFF
FT                   AAMPAIGHPLQLLKDVGLGYLTLGQPSPTLSGGEAQRIKLVTELSKVRDDITRRGQKAP
FT                   HTLYVLDEPTVGLHMADVEKLIHVLHRLVNGGHSVIVIEHDLDVIAEADWVIDLGPDGG
FT                   NAGGLVVASAPPEAVVALGTATGKALAAVLAR"
FT   gene            516348..517784
FT                   /locus_tag="Pnap_0489"
FT   CDS_pept        516348..517784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0489"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="KEGG: pol:Bpro_4132 adenosylhomocysteinase; TIGRFAM:
FT                   adenosylhomocysteinase; PFAM: S-adenosyl-L-homocysteine
FT                   hydrolase; TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35810"
FT                   /db_xref="GOA:A1VJI2"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI2"
FT                   /protein_id="ABM35810.1"
FT                   /translation="MNIALKTMLNTDHIIADLTLAAWGRKELKIAETEMPGLMAIRQEF
FT                   AAAQPLKGARITGSLHMTIQTGVLIETLQALGAEVRWASCNIFSTQDHAAAAIAAEGTP
FT                   VFAVKGETLADYWDYTHRIFEFTGAKGTPEEGPNMILDDGGDATLLMHLGARAETDASL
FT                   LEYPASEEETCLFGAIKAKLAQDPTWYSRRLANIIGVTEETTTGVLRLNEMSAKGTLAF
FT                   RAINVNDSVTKSKFDNLYGCRESLVDAIKRATDVMIAGKVAVVAGYGDVGKGCAQALRA
FT                   LSAQVWVTEIDPINALQAAMEGYKVVTMDYAADKCDIFVSATGNKNVITYAHMAAMKDQ
FT                   AIVCNIGHFDNEIDVASLESCNWEEIKPQVDHVIFPDGKRIILLAKGRLVNLGCGTGHP
FT                   SFVMSSSFANQTIAQIELFTKQAEYEAGKVYVLPKHLDEKVARLHLKKVGAMLSELSDE
FT                   QAAYIGVSKAGPYKANTYRY"
FT   gene            517927..519003
FT                   /locus_tag="Pnap_0490"
FT   CDS_pept        517927..519003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0490"
FT                   /product="ribosomal RNA methyltransferase RrmJ/FtsJ"
FT                   /note="PFAM: ribosomal RNA methyltransferase RrmJ/FtsJ;
FT                   KEGG: pol:Bpro_4131 ribosomal RNA methyltransferase
FT                   RrmJ/FtsJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35811"
FT                   /db_xref="GOA:A1VJI3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI3"
FT                   /protein_id="ABM35811.1"
FT                   /translation="MRADLFLVEHGHATTRSQAQRLIASGVHWRVDEAVAWKKVAKNGD
FT                   EIPGNAELQVLDTTEAKYISRGGLKLEGALKSTGLDVTGLRCLDIGQSTGGFTDCLLQH
FT                   GATQVVGVDVGHGQLHDSLRADERVVCIEGVNARSLTADDLAVHYRRALHISSGSEEDF
FT                   EDFEDFDDAEESDDGDEADGVDGVDDGGFDPVFDFLTGDLSFISLTLVLPAVVRLLKAD
FT                   GHLLMLVKPQFELQPGQIGKGGIVRDAAHFEFVEKRLRDACAGLGLEVKAWLESPIAGG
FT                   DGNREFFIHAQKGHDVQGEDQPLAAAPQRKVAKRVPRSEMRASWAPHEDSELAQAGQHG
FT                   PARGKRRDKNSDDNSTSD"
FT   gene            519013..519843
FT                   /locus_tag="Pnap_0491"
FT   CDS_pept        519013..519843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0491"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="TIGRFAM: 5,10-methylenetetrahydrofolate reductase;
FT                   PFAM: methylenetetrahydrofolate reductase; KEGG:
FT                   pol:Bpro_4130 5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35812"
FT                   /db_xref="GOA:A1VJI4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI4"
FT                   /protein_id="ABM35812.1"
FT                   /translation="MNIPVSFEFFPPKTPEGADKLRLTRQALYAHLPEFCSVTFGAGGS
FT                   TQEGTFSTVKAIQEEGVAAASHFSCVGATKSTVREQLGALRAMGVKRLVALRGDLPSGY
FT                   GMGGEFHYASDLVAFIRAETGDAFHIEVAAYPEIHPQAKSADADLNAFATKVRAGANSA
FT                   ITQYFFNADAYFRFVDDVRRLGVEVPVVPGIMPITSSTQLMRFSDACGAEIPRWIRLRL
FT                   QGYGDDTASIKSFGLDVITDLCGQLCAAGVPGIHFYTMNQAAATTEIIRRLTPA"
FT   gene            519843..520559
FT                   /locus_tag="Pnap_0492"
FT   CDS_pept        519843..520559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0492"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; KEGG: pol:Bpro_4129 rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35813"
FT                   /db_xref="GOA:A1VJI5"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI5"
FT                   /protein_id="ABM35813.1"
FT                   /translation="MAGLVFASRGGALKCWLAASLLALMAGCTTLPAPTAAPQPAPALS
FT                   PAESSALASPSTSAAVASPPPPHPSRLADFIARRFRKQVEKPPPAVETEAPAAPDVPVD
FT                   EKYRLTGAAALELERGHASWYGGQFHGRRTASGENYDKYALTAAHKTLPFGTIVRVRSL
FT                   ALGREVDVRINDRGPFAPGRVIDVSQAAAEALGLMGAGVAEVSLNVADTLDNAASAAGQ
FT                   LKKNGKAPRRSARTRR"
FT   sig_peptide     519843..519953
FT                   /locus_tag="Pnap_0492"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.901 at
FT                   residue 37"
FT   gene            520730..521353
FT                   /locus_tag="Pnap_0493"
FT   CDS_pept        520730..521353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0493"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: pol:Bpro_4118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35814"
FT                   /db_xref="GOA:A1VJI6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI6"
FT                   /protein_id="ABM35814.1"
FT                   /translation="MNLAPLTQRFVLHFGEMGSRWGINRTVGQIYALLYVSPRALNADD
FT                   IGEALAFSRSNVSMGLKELQSWNLVRLQHLPNDRREYFQAPEDVWAIFRTLAEERRKRE
FT                   IDPTLSMLRDALMEKPSGEDDIHAQERMRQMHELIELMTGWLLDVQKMDSSTLISLMKM
FT                   GAKVQKLLQAKDKVASTVKAGFKGMALPGTGAAAPATLSAKDGS"
FT   gene            521356..522768
FT                   /locus_tag="Pnap_0494"
FT   CDS_pept        521356..522768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0494"
FT                   /product="cytochrome bd quinol oxidase subunit 1
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit I;
FT                   KEGG: pol:Bpro_4117 cytochrome bd ubiquinol oxidase,
FT                   subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35815"
FT                   /db_xref="GOA:A1VJI7"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI7"
FT                   /protein_id="ABM35815.1"
FT                   /translation="MDGLDAVLLARIQFAANMTFHILFPTISISLAWVLLFFKLRFVKT
FT                   GQQHWMDAYQFWVKIFALTFALGVVSGITMSFQFGTNWPGFMQKVGNIAGPLLAYEVLT
FT                   AFFLEATMLGVMLFGRARVSEKMHTIATLLVAGGTTLSAFWILALNSWMHTPTGFEMID
FT                   GKAHVTSWLEVIFNPSFPYRFTHMMLASGLTVAFLVAGVSSYRWLRGERGAEAMAGLKT
FT                   GIYLAAFLIPLQILAGDFHGLNTMEHQPAKLAAMEGIWQTQKGVPAVLFALPDEKAKEN
FT                   RYEIAIPKLASLYLTHHLDGEVRGLNEFEGQHPPVAPVFWAFRIMVGMGLLMLAVSWSS
FT                   VLQLAPWKKDPARSIRTWQARALVAMTFAGWIALIAGWYTTEIGRQPWLVSGVLTAADA
FT                   ASQVVAPKIAFTLSLYLLLYAALIVAYVSVVFYLARHKTQADKPSGSGMEDTPNPVTYP
FT                   EQPTSQPGAAHA"
FT   gene            522761..523792
FT                   /locus_tag="Pnap_0495"
FT   CDS_pept        522761..523792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0495"
FT                   /product="cytochrome bd quinol oxidase subunit 2
FT                   apoprotein"
FT                   /EC_number="1.10.3.-"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase, subunit II;
FT                   KEGG: pol:Bpro_4116 cytochrome bd ubiquinol oxidase,
FT                   subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35816"
FT                   /db_xref="GOA:A1VJI8"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI8"
FT                   /protein_id="ABM35816.1"
FT                   /translation="MLDMAPNLTQAAGWMPIVFLGVMGLAMLAYVILDGYDLGVGMLMR
FT                   RASEDDKDSMIASIGPFWDANETWLVLGVGILLTVFPMAHGVILGALYLPVAMMLIGLT
FT                   LRGVAFDFRVKAHAARKPLWNRAFYAGSLMASWSQGYMLGSLITGFATTGWVIAFNAVI
FT                   GLALLSAYCLLGAGWLIIKSGGALQLQAVRWARASLWLTMAGIAAISLATPWVSPAIFD
FT                   KWFSFPNIVLLLPIPVATAVLFWVIYRSLQRLPTRLAQGNEYGIWVPFGATIGVFLLAF
FT                   YGLAYSLFPWLVIDRINIWQAAISPESMGVILAGAVVVLPMIIGYTVFSYRVFWGKSGA
FT                   LKY"
FT   gene            complement(523803..524825)
FT                   /locus_tag="Pnap_0496"
FT   CDS_pept        complement(523803..524825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0496"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   pol:Bpro_4114 protein of unknown function DUF519"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35817"
FT                   /db_xref="GOA:A1VJI9"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJI9"
FT                   /protein_id="ABM35817.1"
FT                   /translation="MFSYRHAFHAGNHADVLKHTCLIALMKYLTQKDTALTVIDTHAGA
FT                   GLYRLDGDYTETSGEAQEGIFKLLLASKMASAQTGKAGAAIKKVAPAATAKAAPAAPEP
FT                   AAKPASDYAWAPALLDYLELLRSLNPHFAQTGDPAHLKIYPGSPFIEQKFLSGRDKLKL
FT                   FELHPTDFKSLSGNIEQLGVGRQVVVAREDGFEALKTFLPPPARRAMVLCDPSYEMKTD
FT                   YLRVSSCMADAVKRFATGTYVVWYPIIPRPEAHDLPRKLKTIAVKAGRSWLNATLTVKS
FT                   SKLTTDTEGEVVRPGLPASGMFVINPPHTLKAELQAALPQMVALLGQDRNAGFTLEHGG
FT                   "
FT   gene            complement(524874..526469)
FT                   /locus_tag="Pnap_0497"
FT   CDS_pept        complement(524874..526469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0497"
FT                   /product="regulator of RNA terminal phosphate cyclase"
FT                   /note="PFAM: magnesium chelatase, ChlI subunit; sigma-54
FT                   factor, interaction domain-containing protein; regulator of
FT                   RNA terminal phosphate cyclase; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1470 regulator of RNA terminal phosphate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35818"
FT                   /db_xref="GOA:A1VJJ0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ0"
FT                   /protein_id="ABM35818.1"
FT                   /translation="MKRKVVIGFLGSQLDSGLGAARWDKWRPTVSLAQHDDLQVDRLEL
FT                   LHDVRYLALARTVQADIAQLSPGTEVRLSEMNLANPWDFGEVYGALYDWLKTYPFELEQ
FT                   EDYWAHITTGTHVAQICLFLMVEARLIPGVLLQTAPPRRQGSQAAGSYELIDLDLSRYD
FT                   AINTRLRSARQDAVSFLKSGIATRNPRFNALIEEIERVAVRSTAPILLTGPTGAGKSML
FT                   ARRMYELKKSRHQVSGAFVDVNCATLRGDGAVSALFGHRKGAFTGAAMERAGLLKTAHQ
FT                   GVLFLDEIGELGCDEQAMLLKAVEERRFLPLGSDAEVQSDFQLIAGTNKDLRTEVACGR
FT                   FREDLLARINLWSYVLPGLAQRREDIEPNIDHQLAIASQELGRQVRFTREARADYLGFA
FT                   QSGEALWSGNFRDLSASATRLATLAENGRIGVELVQAEKARLRWLWDKHPARDAASDVS
FT                   LHDLMGAAAEQLDAFDRLQLQAVIGICRQQASLSEAGRALFNVSRNQRAVINDADRLRK
FT                   YLLKFGLTWEQIRT"
FT   gene            526614..527906
FT                   /locus_tag="Pnap_0498"
FT   CDS_pept        526614..527906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0498"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   pol:Bpro_1473 protein of unknown function UPF0027"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35819"
FT                   /db_xref="GOA:A1VJJ1"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ1"
FT                   /protein_id="ABM35819.1"
FT                   /translation="MQCLSRRAPTTAPGKPTRKQKMNYEMHQVEGGVPVKMWTQGVPVE
FT                   AVALRQLENTARLPIVFSHVAAMPDVHYGIGATVGSVVATFKAIIPASVGVDIGCGMIA
FT                   CKTTLRAEDLPDSLAQLRSEIEKAVPHGMTPKEQRRGGSRDRGSWENPPNEADAAWAQL
FT                   VDEFEAICLDYPRLKNTNNHRHMGTLGGGNHFIEVCLDEAGAVWIMLHSGSRGVGNAIG
FT                   THFIELARKDAELHQRNLPDKDLAYFEEGAQYFGDYVRGVGWAQKFAKLNREVMMQRTI
FT                   AALRKVVKKPFETHIEAVNCHHNYVARETHFGQDVFVTRKGAVSARAGELGIIPGSMGA
FT                   RSFIVRGKGNPESFMSCSHGAGRSMSRTRAKKLFTLADQIKATEGVECRKDEAVIDEIP
FT                   MAYKDIDAVMAAQTDLVEVVYILKQIVCVKG"
FT   gene            527926..529023
FT                   /locus_tag="Pnap_0499"
FT   CDS_pept        527926..529023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0499"
FT                   /product="RNA-3'-phosphate cyclase"
FT                   /EC_number="6.5.1.4"
FT                   /note="PFAM: RNA 3'-terminal phosphate cyclase; KEGG:
FT                   pol:Bpro_1474 RNA-3'-phosphate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35820"
FT                   /db_xref="GOA:A1VJJ2"
FT                   /db_xref="InterPro:IPR000228"
FT                   /db_xref="InterPro:IPR013791"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR017770"
FT                   /db_xref="InterPro:IPR023797"
FT                   /db_xref="InterPro:IPR036553"
FT                   /db_xref="InterPro:IPR037136"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ2"
FT                   /protein_id="ABM35820.1"
FT                   /translation="MAARKKTKERRKMIELDGSAGEGGGQILRTALALSLASGQPFRID
FT                   NIRARRPKPGLLRQHLTCVQAAVAVGGGAAETIARNSEGNEVRLGDTCLQFTPGKARSG
FT                   DYEFAVGSAGSCTLVLQTVLWPLALAQGVSNLLLRGGTHNPMAPSLSFLKHAAPCFAGD
FT                   GDALLELELRRHGFYPAGGGEAQVRIHPPAQGIAAINLTERGKPLRAWAECLHAGIPRG
FT                   VAARELGVLKSAFGWADDQLRDRGLRANEGPGNALVVVLEYENITEVFASYGDKATSAE
FT                   QVAHRLVKEVRGYLAHAAPVGPHLADQLMIPLALAALQGRPGQYFATELTEHALTNARV
FT                   IEKFLPLRFVMKPVDAKGVVISVNA"
FT   gene            529265..529708
FT                   /locus_tag="Pnap_0500"
FT   CDS_pept        529265..529708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0500"
FT                   /product="LSU ribosomal protein L13P"
FT                   /note="PFAM: ribosomal protein L13; KEGG: pol:Bpro_4113
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35821"
FT                   /db_xref="GOA:A1VJJ3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJJ3"
FT                   /protein_id="ABM35821.1"
FT                   /translation="MKTFSAKPADVTHEWFVIDATDKVLGRVASEVALRLRGKHKAIYT
FT                   PHVDTGDFIVIINAAQLRVTGAKSTDKIYYRHSGYPGGITATNFRDMQTKFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYGGAEHPHTAQQPKVLEIAGAAK"
FT   gene            529705..530097
FT                   /locus_tag="Pnap_0501"
FT   CDS_pept        529705..530097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0501"
FT                   /product="SSU ribosomal protein S9P"
FT                   /note="PFAM: ribosomal protein S9; KEGG: pol:Bpro_4112
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35822"
FT                   /db_xref="GOA:A1VJJ4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJJ4"
FT                   /protein_id="ABM35822.1"
FT                   /translation="MIGEWNNGTGRRKSSVARVFIKKGTGKITVNDKDIQAFFGRQTSI
FT                   MICRQPLFLTNHVETFDIMINVHGGGESGQAGAVRHGITRALIDYDATLKPALSQAGFV
FT                   TRDAREVERKKVGFRSARRRKQFSKR"
FT   gene            530261..530626
FT                   /locus_tag="Pnap_0502"
FT   CDS_pept        530261..530626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0502"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   pol:Bpro_4109 HesB/YadR/YfhF"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35823"
FT                   /db_xref="GOA:A1VJJ5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJJ5"
FT                   /protein_id="ABM35823.1"
FT                   /translation="MSAVAENIQTEMPAPFVFTDSAASKVAELIAEEGNPDLKLRVFVQ
FT                   GGGCSGFQYGFTFDEITNEDDTTMTKNGVSLLIDAMSYQYLVGAEIDYKDDLEGAQFVI
FT                   KNPNASSSCGCGSSFSV"
FT   gene            530809..533061
FT                   /locus_tag="Pnap_0503"
FT   CDS_pept        530809..533061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0503"
FT                   /product="helicase c2"
FT                   /note="SMART: helicase c2; KEGG: rfr:Rfer_2033 helicase C2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35824"
FT                   /db_xref="GOA:A1VJJ6"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039000"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ6"
FT                   /protein_id="ABM35824.1"
FT                   /translation="MSLSTTPSALEGAPLPSPSIQLPAAVPAHASEQGIDPDQLEAARI
FT                   RLELLYGEVAADWPGFIARPGQYQMMQACLLTFLSAKAPEDEVRTGSHLAQLEAGTGTG
FT                   KTVAYCLAAIVASEVLKKTVIVSTATVALQEQLFQKDLPRLAEIIPDLRYDILKGRARY
FT                   VCESRLEGVINDVAQDGLLTGELFQDSFGDARRQAAGIVRDRTQAMRWFKSSAKKLNSG
FT                   TWDGDIDSLAQPPDPQDWRQVQANAHACNGGQCEHFRNCAFFKARRQAASATLQVANHA
FT                   LVLATLQTDSSLIDAGNTLFVFDEAHHLPGIAAEQFSYRARLGTSSKLLTSLRTVALRH
FT                   GKALPASTRPDPVAFAQLVTGCTDKLAMLERYWQDAQLVSADQPVHRFAQGRIPEALVL
FT                   ECQELATLIRAIASVVSSIAAALKEPDESKSPTQREEQTHAGVELGVYLSRLGTLDKLL
FT                   SAWATHDRVPWAKWIEWAEDGAGSAPDAWLCASPMTAAQVLSKNLWNKVSAAVCTSATL
FT                   TACGSFDFFDRLSGMNRFPERRSLVVDSPFDYATQGELRIAPMTHSPKSPGFSDELCDK
FT                   LPGLLREHPHGQLVLFTSRRQMQACHAALPQDLLDQVLVQGVRSRTELLREHGRRVKAG
FT                   ERSIIFGLQSFGEGIDLPGRLCEHVVIDKLPFTPPSSPVEEALAEWLSGQGRDPFAELS
FT                   VPRAGMKLAQWAGRGVRTVTDRAVITVCDTRLVTMRYGQAILAGLPAFPLVRSAPT"
FT   gene            complement(533105..534244)
FT                   /locus_tag="Pnap_0504"
FT   CDS_pept        complement(533105..534244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0504"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   pol:Bpro_4108 protein of unknown function UPF0075"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35825"
FT                   /db_xref="GOA:A1VJJ7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ7"
FT                   /protein_id="ABM35825.1"
FT                   /translation="MHDYTIGLMSGTSLDGADGVLVDFSSQTLRVVASASEPFGDSFRA
FT                   ELLALNSPSHNELHRAALAGSQLAAVYAQVVAKLVRQAGAQGISASQIQAIGAHGQTVR
FT                   HQPQRTSAEPAGAGYTLQLNNPALLAELTGIDVVADFRSRDVAAGGQGAPLVPAFHQGV
FT                   FGRADATVAVLNLGGISNLSVLPPAGSPLPVLGFDCGPGNALMDAWCLRHTGQPFDAGG
FT                   TWAKSGRLVPALLASLRGEPYFSQPIPKSTGRDLFSLAWLDEKLRPFSGERPEDIQNTL
FT                   TELTVFACTAGVSSYGKESTELIVCGGGAFNLYLLQRLQAGLPWLRVSTSDQHGLPPLQ
FT                   VEAAAFAWLARQMIQRQPGNLPGVTGAAGLRVLGALYPA"
FT   gene            complement(534281..535678)
FT                   /locus_tag="Pnap_0505"
FT   CDS_pept        complement(534281..535678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0505"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: pol:Bpro_4107 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35826"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ8"
FT                   /protein_id="ABM35826.1"
FT                   /translation="MRLPVASHTPLTLSRVLSAIADSLRRHPKRLTASLAMLLLGTGVT
FT                   AFGVAPLAPDAADLPVRQVLEAIQPLSPQSAQAQADALADFNFKLFRTESTRSSDRAST
FT                   LLQRLNIDDTAAEVFLRTDANAQLILTGPPGKNVTAEASESQQLLKLSMRWPTDDEQVF
FT                   QRLVVERSSDGRFTSRIETAPYTRSARLASATIETSLFAAIDDARIPDGVGVQLAEIFS
FT                   TDIDFRRALRKGDRFNVVYETLEADGETMRTGRVLSAEFVNEGKAYQAMWFQPPGQDAS
FT                   GAPLKGGYYTLDGKSLRRAFLSSPVEFSRISSGFSMRFHPILQTWRAHNGTDFAATTGT
FT                   PARTIGDGVVEFAGVQNGFGNVVFIKHRNNLETVYAHLSKINVQPGQTVSQGQTIGLVG
FT                   STGWATGPHLHFEVRVNGVQQDPMAIAKQSDVVPVPTAALPQFRQLANGFRNQLQAAAT
FT                   IEQTQAE"
FT   sig_peptide     complement(535508..535678)
FT                   /locus_tag="Pnap_0505"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.963) with cleavage site probability 0.410 at
FT                   residue 57"
FT   gene            535905..537137
FT                   /locus_tag="Pnap_0506"
FT   CDS_pept        535905..537137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0506"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="TIGRFAM: tyrosyl-tRNA synthetase; PFAM:
FT                   aminoacyl-tRNA synthetase, class Ib; RNA-binding S4 domain
FT                   protein; KEGG: pol:Bpro_4106 tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35827"
FT                   /db_xref="GOA:A1VJJ9"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJJ9"
FT                   /protein_id="ABM35827.1"
FT                   /translation="MNQELVTNSPLSDRVKTALAVSLRGCDELIPQDEWTRKLVRSEAT
FT                   GVPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHTVIFLIGDFTSLIGDPSGRNSTR
FT                   PPLTPEQIKVNAETYYRQASLVLDPAKTEIRYNSEWCDPLGARGMIQLASRYTVARMME
FT                   RNDFHDRFKAGQSISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLLMGRHLQQEYGQ
FT                   EPQCILTMPLLEGLDGIEKMSKSKNNYIGISEDANSMFAKVLSISDVLMWKWYTLLSFK
FT                   SEADIAALKAEIEAGRNPKDAKVALAKEITARFHSAAAADAAEQDFINRSKGGVPDEIP
FT                   DVSLSGAPLGIGALLKAAGLAPSGSEASRLIDGGGVRVDSSVVSDKALKLAAGTYVVQV
FT                   GKRKFARVTLA"
FT   gene            537151..537615
FT                   /locus_tag="Pnap_0507"
FT   CDS_pept        537151..537615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0507"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   pol:Bpro_4098 D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35828"
FT                   /db_xref="GOA:A1VJK0"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK0"
FT                   /protein_id="ABM35828.1"
FT                   /translation="MKAVLQRVAEARVVVAGETVGRIGQGLLVLVCAERGDSEAQADKL
FT                   LAKILKLRIFSDDAGKMNRSVQDLDGQGACGGLLVVSQFTLAADASGGNRPSFTGAAPP
FT                   DVGRRLYDYFVAQARKLHPQVETGQFAADMQVHLVNDGPVTIPLHIAPDA"
FT   gene            complement(537696..538151)
FT                   /locus_tag="Pnap_0508"
FT   CDS_pept        complement(537696..538151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0508"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rfr:Rfer_0737 protein of unknown function UPF0054"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35829"
FT                   /db_xref="GOA:A1VJK1"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK1"
FT                   /protein_id="ABM35829.1"
FT                   /translation="MALNSLSLSLQFGKFPDAALHRAALPRHSVARWIRHALQSDAEIT
FT                   VRIVGAEEGQALNRDYRAKDYATNVLTFDYTQAPYVTADLVLCAPVVAKEAQDNQKTLQ
FT                   AHYAHLLVHGTLHAQGYDHETGEEDAEEMEALEIEILAGLGFDNPYR"
FT   gene            complement(538141..539178)
FT                   /locus_tag="Pnap_0509"
FT   CDS_pept        complement(538141..539178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0509"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: pol:Bpro_4095
FT                   PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35830"
FT                   /db_xref="GOA:A1VJK2"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK2"
FT                   /protein_id="ABM35830.1"
FT                   /translation="MPHFRKTHALILRHTFTPPNNTRMANLCGPMDIHIRTIEAGLQVT
FT                   IAHRFEQFKIDGPKLRAQQALEVLQALYEIAQRPIEPETVQLMLAGDTALSTAEGPMAL
FT                   STRRADLRARTINQGTYLENIATHDITFGIGPAGTGKTYLAVACAVDALERSTVQKIVL
FT                   TRPAVEAGERLGFLPGDLSQKVDPYLRPLYDALHELMGFERVQKAFERQQIEIAPLAFM
FT                   RGRTLNHAFVILDEAQNTTPEQMKMFLTRIGFGSKAVVTGDVSQVDLPRTQLSGLIDAE
FT                   RVLKRVQGIAITRLTSADVVRHPLVARIVDAYDKTPSDRDDANPAIDLVAVSARKTSAR
FT                   SRNGS"
FT   gene            539239..539817
FT                   /locus_tag="Pnap_0510"
FT   CDS_pept        539239..539817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0510"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: pol:Bpro_4094 Holliday junction DNA helicase
FT                   RuvA; TIGRFAM: Holliday junction DNA helicase RuvA; PFAM:
FT                   RuvA domain protein; DNA recombination protein RuvA, domain
FT                   I; SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35831"
FT                   /db_xref="GOA:A1VJK3"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK3"
FT                   /protein_id="ABM35831.1"
FT                   /translation="MAMIGRLTGQLAEKNPPEILVDCHGVGYEVLVPMSTFYNLPGLGE
FT                   KISLFTHFIVREDAQLLYGFGSTAERGAFRQLIKITGVGPRMALSVLSGMSVAELAQAV
FT                   TLQEAGRIVKVPGIGKKTAERLLLELKGKLGADIGAHVSVSSEAQLDILQALVALGYSD
FT                   KDAALALKALPPDVGVSEGIKLALRALGK"
FT   gene            539830..540756
FT                   /locus_tag="Pnap_0511"
FT   CDS_pept        539830..540756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0511"
FT                   /product="protein of unknown function DUF511"
FT                   /note="PFAM: protein of unknown function DUF511; KEGG:
FT                   cte:CT1399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35832"
FT                   /db_xref="GOA:A1VJK4"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK4"
FT                   /protein_id="ABM35832.1"
FT                   /translation="MLAKFTFLDLAEEVLKNSSTPLDISTIWKNGLASKAVDKVGSKGK
FT                   TPWISLGARLYVDTKDNAKSCFLRTGDNPVLFGLKSIHTAQQAQEAIIKVESIPKLKER
FT                   NLHPLLAFFAKLYLGDAYVKTIYHEKSLKKSFNEWLHPDLVGVRFPDLHVDARSLAATA
FT                   GELPFKLLSFELKRSLNFSNLRESFFQAVSNSSWAHQGYLVAANIKESPDFLGELKRLS
FT                   GSFGIGVISLDIENPDDSSVLYPAGERKNLDWDSINKLASENPDFSQFLRDVRIDLDGK
FT                   KVHPAEYDKIEKDIDKLKLLVNPTAKP"
FT   gene            540753..541823
FT                   /locus_tag="Pnap_0512"
FT   CDS_pept        540753..541823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0512"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: pol:Bpro_4093 Holliday junction DNA helicase
FT                   RuvB; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35833"
FT                   /db_xref="GOA:A1VJK5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK5"
FT                   /protein_id="ABM35833.1"
FT                   /translation="MTIQTDDFDMSDLPPARRMLSAAPASPKEEAIERALRPKLFDDYV
FT                   GQTKAREQLEIFIGAANKRQEALDHVLLFGPPGLGKTTLSHIIAHELGVNMRSTSGPVL
FT                   EKPKDLAALLTNLEKNDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSIKL
FT                   DLQPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPEELARIVKRSAGLLNAPMDAEGG
FT                   FEIARRSRGTPRIANRLLRRVRDYADVKGNGTITLDIANRALAMLDVDPQGFDLMDRKF
FT                   LEAVILRFDGGPVGLDNIAASIGEESGTIEDVIEPYLIQQGFLQRTPRGRIATLAAYRH
FT                   LGVAPPRGNAENLFEE"
FT   gene            complement(542006..543196)
FT                   /locus_tag="Pnap_0513"
FT   CDS_pept        complement(542006..543196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0513"
FT                   /product="putative threonine aldolase"
FT                   /note="KEGG: pol:Bpro_4092 putative threonine aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35834"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK6"
FT                   /protein_id="ABM35834.1"
FT                   /translation="MSNLPARLSELIGKPVHDIDTPALVIDMDALKRNLVRMADFAKKH
FT                   HVRWRPHAKLHKSTVLAKMQIKAGAAGVCVQKTAEAEVMVAGGIYNVYISNQVIAPAKL
FT                   ARVAALTQAVASHRGGQIAIAVDSPEGVSRLAKAMTEARTSARSSVATVIDVFVEIDVG
FT                   QGRCGAQPGEAAVKLALEIRKHPALRFAGLQAYQGKAQHLRSAIERRMAAASATKAVEL
FT                   TCQLLKAHGIAPGLVTGAGTGSFALEAASGVYGELQAGSFMFMDVDYAQNERDPAQPQF
FT                   EHALFVKTQVISTHASHAVCDAGHKSHAIDSGMPKVHAFEKKSGLDYFNGGDEHGILRP
FT                   VDGSDRLPALGQLLWLIPGHCDPTVNLHDVMIGVSGGLRNGTVDRIIQVDARGAMT"
FT   gene            complement(543224..543898)
FT                   /locus_tag="Pnap_0514"
FT   CDS_pept        complement(543224..543898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0514"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: pol:Bpro_4091
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35835"
FT                   /db_xref="GOA:A1VJK7"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK7"
FT                   /protein_id="ABM35835.1"
FT                   /translation="MIEPTRIIAIRHGETTWNVDTRIQGHLDIPLNDTGRLQAARLALA
FT                   LKEEPITAVYASDLARAWETAEYLGRARGLPVTPETGLRERCFGDFEGKTFAEIEALLP
FT                   EQSQRWRKRDPEFAPAGGESLLALSQRVVEAAERIAARHPGELIALVGHGGVMDVLYRA
FT                   AARLHIQAPRTWMLGNAAINRLLWTQQGFTLVGWADTQHLNDESLDDGLLAAGPSPIVS
FT                   TT"
FT   gene            complement(543948..544574)
FT                   /locus_tag="Pnap_0515"
FT   CDS_pept        complement(543948..544574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35836"
FT                   /db_xref="InterPro:IPR025411"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJK8"
FT                   /protein_id="ABM35836.1"
FT                   /translation="MKRALTAIFSIAFMGLFMAGCSGLRVVETDVTAFYNWGTAPPAPG
FT                   TAYRFERLPSQQVVGARHDAIEGLARTALARVGMELNPAAPRYSVQVRIGTLVIERPTY
FT                   YGPGYDGFGFATPGVFLGGGNRGAAFGMSFPVYPMRFSDPYYRRELSLLVRDLTTSQVV
FT                   FETRAVNDGVQNETLAVLSAMLDAALQGFPQPPPGPRRITAQIPR"
FT   sig_peptide     complement(544494..544574)
FT                   /locus_tag="Pnap_0515"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.670 at
FT                   residue 27"
FT   gene            complement(544596..545540)
FT                   /locus_tag="Pnap_0516"
FT   CDS_pept        complement(544596..545540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0516"
FT                   /product="tRNA s(2)C-32 sulfurtransferase"
FT                   /EC_number="2.8.1.4"
FT                   /note="PFAM: PP-loop domain protein; KEGG: pol:Bpro_4089
FT                   PP-loop"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35837"
FT                   /db_xref="GOA:A1VJK9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJK9"
FT                   /protein_id="ABM35837.1"
FT                   /translation="MNAIWIDEQLETSARVQNSMKIEREDHKLEKRLCREVGRAIVDFN
FT                   MIEEGDKVMVCVSGGKDSYAMLDILLKLQKRAPINFELVAVNLDQKQPGFPEHVLPEYL
FT                   SKLGVPYHIENQDTYSIVTRVIPEGKTLCSLCSRLRRGILYRVAGELGCTKIALGHHRD
FT                   DMLQTFFLNMFFAAKLKGMPPKLVSDDGKNIVIRPMAYVTEKDLTRWAQVQDFPIIPCT
FT                   LCGSQENLQRKQVGNMLRDWQKQYPGRIENMFSALQNIVPSHLMDSKRHDFKGIRTTGV
FT                   ADPEGDKAFDAEEFMQAAPAGRAVIGINPLAPG"
FT   gene            complement(545546..545998)
FT                   /locus_tag="Pnap_0517"
FT   CDS_pept        complement(545546..545998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0517"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="KEGG: pol:Bpro_4088 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35838"
FT                   /db_xref="GOA:A1VJL0"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL0"
FT                   /protein_id="ABM35838.1"
FT                   /translation="MTLYVTLLAPLTYFPDIFNPDPLQTATMLTTRGTRILHLTGLRFD
FT                   ANLGILAHEKTAPQPIQVDAELNLGTQTLLPHDDDIHHVLDYRKVRQIIITECTAEHAN
FT                   LLESLIGKLAHRLMLLPGVLGVRVKIAKLEIFDDCEVAIRVETGQW"
FT   gene            complement(545995..546762)
FT                   /locus_tag="Pnap_0518"
FT   CDS_pept        complement(545995..546762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0518"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR;
FT                   KEGG: pol:Bpro_4087 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35839"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL1"
FT                   /protein_id="ABM35839.1"
FT                   /translation="MTPASSRPVVLVTGAALRLGREIALALAAGGWQVAVHYRSSEADA
FT                   IKTVADCARLTCASAAFDADLSDEAAVRGLVPRVIAHFGRVDAVVNSASTFEHDTAASF
FT                   GFAALDKHLRSNTGAAILLAQALHAHVAARNATGAVVNLLDQKLWNQNPDFFSYTLSKA
FT                   ALEAAGTMLAMALAPEVRVVGVAPGLTLTSHLLTGEAFEARHKLSPLGRSSTPADVAAT
FT                   VKFALENSSITGTTLLVDGGQHLMRFERDFSLM"
FT   gene            546835..547941
FT                   /locus_tag="Pnap_0519"
FT   CDS_pept        546835..547941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0519"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   pol:Bpro_4086 protein of unknown function DUF185"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35840"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL2"
FT                   /protein_id="ABM35840.1"
FT                   /translation="MTNPFILTSPLQADIAKAIESAGGWLGFDVFMALALYQPGLGYYA
FT                   RDSLKFGLMPGGVKGGSDFVTAPELSPRFGQTLARQVAQALQASGTTEVWEFGAGSGAL
FT                   AQQVLDTLGEQVTRYTIVDLSSSLRERQRERLAAHAGKVQWATELPARMRGVVLGNEVL
FT                   DAMPVKLLARLGGVWHERGVVLHEGRFTYADCPTDLRPPLEVAGRHDYVTEIHPQAEGF
FT                   VRTLADRLEAGAALLLDYGFPEHEYYHPQRDMGTVMCHRAHLLDADALADVGEKDITAH
FT                   VNFTGIALAGQEAGLQVLGYTSQGRFLLNCGLLGGLEDASLAERAMVQKLVNEHEMGEL
FT                   FKVIAFGAKNSPAWEPMGFSAGDRTHTL"
FT   gene            548057..548335
FT                   /locus_tag="Pnap_0520"
FT   CDS_pept        548057..548335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0616 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35841"
FT                   /db_xref="GOA:A1VJL3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL3"
FT                   /protein_id="ABM35841.1"
FT                   /translation="MLFTPATLSTLAHYLIVERKGQGLSRAQAAAVCNVSPSFIRDAES
FT                   DPARCSLGLLLQYMAGLGLLMDVAGWSHDVQAPIDFPGVVGDAEGNP"
FT   gene            548332..549600
FT                   /locus_tag="Pnap_0521"
FT   CDS_pept        548332..549600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0521"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: pol:Bpro_0617
FT                   HipA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35842"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL4"
FT                   /protein_id="ABM35842.1"
FT                   /translation="MIRLRVWANARPMGWFGHAAGEFFFEYDAQWLAQPGAYALAPQFV
FT                   LNAQTTRGALVRSFFENLLPEGEVLDDVLAALQLRGASSLDVLGRLGAELPGVLSLLPE
FT                   DSMPRIQQDYRDLPFAELSARLAHRTATPLLVSNTQAGMSLAGAQDKLGLRFEPRTRRL
FT                   YDSVGASPTTHILKPDTRQLRYQPSAINEYACMKLAQALKLPVPKVWLLRVPEAAYVVE
FT                   RYDRVLTAGNIVGLHQFDGCQLLGHGPGWKYERSGGLASLPKLVAALRALRVRGSDLLQ
FT                   FQRWVMFNYLIGNADAHAKNLSLLVDGKGYRLAPFYDLLCVRAYGDEGLALFIGDDETF
FT                   DAVGAHSWEAFCTDCGFGLAPTLVEFRRMALALLPAWGKVQTSVAKEKGVTEAERAMLA
FT                   RMSTIFERHAGHALSMTALPAPV"
FT   gene            549611..549805
FT                   /locus_tag="Pnap_0522"
FT   CDS_pept        549611..549805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35843"
FT                   /db_xref="GOA:A1VJL5"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL5"
FT                   /protein_id="ABM35843.1"
FT                   /translation="MIRWFIVIFLALVCISWLSPLLQKLGFGKLPGDLRFRLFGREWFI
FT                   PVTTTILLSFVASLVSQLI"
FT   sig_peptide     549611..549685
FT                   /locus_tag="Pnap_0522"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.319 at
FT                   residue 25"
FT   gene            549995..551251
FT                   /locus_tag="Pnap_0523"
FT   CDS_pept        549995..551251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0523"
FT                   /product="carbohydrate ABC transporter substrate-binding
FT                   protein, CUT1 family"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   1; KEGG: rfr:Rfer_1097 extracellular solute-binding
FT                   protein, family 1; TC 3.A.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35844"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL6"
FT                   /protein_id="ABM35844.1"
FT                   /translation="MLKFSKLAAAAAFVAVAAAAMAGEVEVLHYWTSGGEAKSVDELKT
FT                   MMAGRGYTWKDFAVTGGGGENAMGMLKKRVLAGNPPAAALIKGPTIQEWANLNVLTNLD
FT                   TMAQFGKWDESLPKVIAEQMKYQGHYVAVPVNVHRVNWLWANSAVLKKAGVTALPKTYE
FT                   EFFAAADKLRAAGFIPLAHGGQDWQDFTVFESVALGVGGTAFYNKALVRLDEAALAGSE
FT                   MRKTLEVFRRLKPYTDDKSAGRDWNQATALVTAGKAGFQLMGDWAKGEFLAANQEPGKD
FT                   FTCTPAPGTAHAYSFNVDSFAMFQLKNGDARKAQGYLAFLLMGQNFQERFNLRKGSIPA
FT                   RLNMNLDKFDECARLSGQDFAAMSKTGALVPSVAHGMAVPPAVQSALRAAVSDFWNNDK
FT                   TTVNETLARLALAAGAPVK"
FT   sig_peptide     549995..550063
FT                   /locus_tag="Pnap_0523"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(551295..552680)
FT                   /locus_tag="Pnap_0524"
FT   CDS_pept        complement(551295..552680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0524"
FT                   /product="trehalose 6-phosphate synthase"
FT                   /EC_number="2.4.1.15"
FT                   /note="KEGG: pol:Bpro_3918 alpha,alpha-trehalose-phosphate
FT                   synthase; TIGRFAM: alpha,alpha-trehalose-phosphate synthase
FT                   [UDP-forming]; PFAM: glycosyl transferase, family 20"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35845"
FT                   /db_xref="GOA:A1VJL7"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="InterPro:IPR012766"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL7"
FT                   /protein_id="ABM35845.1"
FT                   /translation="MSRLVVVSNRVSDPRKSAGAGGLAVALGEALSANGGLWFGWSGTV
FT                   VEGGTPGEGEMHTHHSGNVTLTTVDLCREDHDSYYLGYSNGVLWPVFHYRLDLADFDAG
FT                   YIGGYRRVNQLMARKLMPLLKPDDIIWVHDYHLIPMAAELRAMGCKNRIGFFLHIPLPP
FT                   PLILAAVPQHEWLIRSLFAYDLLGFQAQSDVEHFSSYVGKEVGAEALDKHQFRAFGRKV
FT                   QAQAFPIGIDVDEFAALTHAKEGRDMYERMKKEFSRRRLLLGVERLDYSKGLPQRVRSF
FT                   RELLKNYPENIRSATLIQIASPSREALDTYAGLRQELESLCGAINGDYGELDWMPVRYI
FT                   HRNVSRKRLPGLYRVADVALVTPLRDGMNLVAKEFIAAQDPADPGVLVLSRFAGAAEQL
FT                   KEALLVNPYDVHGTAESIQLALQMPLIERQRRHQQLLERIRSQDVHWWRKAFLTALAEC
FT                   GQD"
FT   gene            complement(552677..554497)
FT                   /locus_tag="Pnap_0525"
FT   CDS_pept        complement(552677..554497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0525"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   pol:Bpro_3916 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35846"
FT                   /db_xref="GOA:A1VJL8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL8"
FT                   /protein_id="ABM35846.1"
FT                   /translation="MSAAVLAPNFAPPAPPSLSLGVIGNCAFSALVDARGRIVWCCLPR
FT                   FDGDPVFNALLDESDKGSAFAIEIENFSHSKQWYDPNTAVLRTQLFDKSGQAIEITDFA
FT                   PRFYNRSRFFKPMTLVRRVRPIKGAPRIRVQLDVRFDWGRSEPVITQGSNHLRYVGDAL
FT                   TLRLNTDAPLSHLLAKRPFVLTREYNFLLGSDESLADGIADTARLFEQETLSYWRKWSQ
FT                   RLHIPLEWQEAVIRAAITLKLSLFEDTGAIVAAMTTSIPEAPNSGRTWDYRFCWLRDAF
FT                   FVVRALNSLSEVGTMEDYLRWLGNVVVQADGGHIQPLFGIGLELELPEAVYDHLGGYRG
FT                   MGPVRVGNQAQEHFQHDVYGNVILGAAQAFHDHRLLHRAGAAEFLRLEAVGEQAVRSYD
FT                   KPDAGMWELRTRARVHTSSALMCWAACDRLGKIAVTLKQPERASYWSHHAQIMRERILR
FT                   ESWSEERQAFAESFGGRDLDASVLLMIEVGFIEPKDPRFVATVDALEKYLCDGPYMRRY
FT                   EAPDDFGKPETAFNICTFWRIDALARIGRKDEARAIFETMLAARNHVGLLSEDTHPVTG
FT                   EMWGNFPQTYSMVGIINAAVRLSAPWDSLV"
FT   gene            complement(554494..555273)
FT                   /locus_tag="Pnap_0526"
FT   CDS_pept        complement(554494..555273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0526"
FT                   /product="trehalose 6-phosphatase"
FT                   /EC_number="3.1.3.12"
FT                   /note="KEGG: pol:Bpro_3915 HAD-superfamily hydrolase
FT                   subfamily IIB; TIGRFAM: HAD-superfamily hydrolase,
FT                   subfamily IIB; PFAM: trehalose-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35847"
FT                   /db_xref="GOA:A1VJL9"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJL9"
FT                   /protein_id="ABM35847.1"
FT                   /translation="MPMQSETLPRLTPDTALFLDFDGTLVALAAQPELVEVPLGLTSTL
FT                   AALHRQLRGALALVSGRRLLDLDGFLAPLLLPSAGEHGAQRRTADGLLISAPPADMRQI
FT                   LQAAEGLVARHPDLKLERKNLALSLHYRHAPELESLCLQVMREAAQGNDSVELMQGKCV
FT                   IDLKPAGFSKGTAIASFMTEAPFAGRIPLFAGDDVTDEAGFEEVRRMGGHTIKVGPGPT
FT                   AAQYRCASVDQLAAWLQSASGVSPDAGGLSSRPGHSA"
FT   gene            complement(555398..557479)
FT                   /locus_tag="Pnap_0527"
FT   CDS_pept        complement(555398..557479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0527"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   pol:Bpro_0652 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35848"
FT                   /db_xref="GOA:A1VJM0"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM0"
FT                   /protein_id="ABM35848.1"
FT                   /translation="MLYKFLCSAAVLAALVAPALAQSPSTALPPGANAAGDSLIVEMNK
FT                   AFKRGDKGRLTQLLPQARGHALEPWAAYWELKARLGEASPQEVQDFLARYAGSYQEDRL
FT                   RNDWLLLLGQRRDWASFSAEYPKYRMNDDRELRCYALLVEHLKNPTQDARLSGEVRKNW
FT                   YAQRDADDGCTAAAERLVGSNNLTPLDVWQKARLALEANRPKAASNAVAIVAPEALGMV
FT                   AELNSSPIKFLAGKYLALRTVRKEIITLALVKLAISDSEGAASQLDGKWALQLTAEERN
FT                   WLWGLIGKQTASRMGTQPAGDALQYYARVTKDADLTDDMLAWKARAALRAGTQPSWQLV
FT                   LAAINAMSEDGRKEPVWTYWKARALLAMSPPDIATAVVTPQGPATTTVMAPQRIEGLRL
FT                   LQSIASASGFYEQLALEDLGLKISVPPKPAPLTAQEKDAARLNPGLSRATYAIMIGLRS
FT                   EGVREWNYATNLHQKSGMGERELLAAAQVACDRQIWDRCINTSERTTSVADFEQRFPMP
FT                   FQAAVVKRSQSINLDPAYVYGLIRQESRFIMDARSGVGASGLMQVMPATARWTANKIGL
FT                   DGFTPEQINDRDTNITIGTAYLKLALDDLGGSMPMAAAAYNAGPGRPRTWRNGHVLDAA
FT                   IWAENVPFAETRDYVKKVLSNTTNYAAILTGQPQSLKSRLGMIGPRDASMPEPYMDLP"
FT   sig_peptide     complement(557414..557479)
FT                   /locus_tag="Pnap_0527"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 22"
FT   gene            557489..558127
FT                   /locus_tag="Pnap_0528"
FT   CDS_pept        557489..558127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0528"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   pol:Bpro_0653 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35849"
FT                   /db_xref="GOA:A1VJM1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM1"
FT                   /protein_id="ABM35849.1"
FT                   /translation="MDKLSTRKALVQSRLDMPDRLARADLLQRVMRIWLVGSPHEVIGA
FT                   YWPIKGEFDPLPALYRWQEDAVLSPEFQENTHLPHAEREQFATESIAGRSPRKIGLPVV
FT                   NKLHKTLTFHAWYPGCPMEEDAYGIPKPKDTEIIVPTLLFVPCVGYGPGGFRLGYGGGF
FT                   YDRTLATLSPRPFTVGLGYSQGWLPDMEPEPHDVPLDVVLNDHGVVWPV"
FT   gene            complement(558214..559257)
FT                   /locus_tag="Pnap_0529"
FT   CDS_pept        complement(558214..559257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0529"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rfr:Rfer_1086 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35850"
FT                   /db_xref="GOA:A1VJM2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM2"
FT                   /protein_id="ABM35850.1"
FT                   /translation="MKSRYAIHAFSALISRPLPSIPMQHPHPHLRSRPIAAGQLRAFEA
FT                   VARHLNFRAASEELSLTQSAVSRQIQSLEEDVGVSLFLRHTRAVELTSAGAQLLRAVLP
FT                   SLERIDGVVRMIRQSAGRKSVAISTWASFASMWLIPRLEAFQREHPDIDIRIDATDTPV
FT                   DLETTDVDLALRYSMPASVPAQARRLFGEQLTPVISPWLLKSGPRLQNAQDLARFALVE
FT                   ASDAHRTQHMEWLSWQRWFDMQGLRRFEPKRWLYFNYAHQIAQAALTGQGVALARMPLI
FT                   AESLASGDLVEVLPDRRMDSPMAYWLIVGPRNAARPEVQAFCSWIEAQAAQTREAIGDV
FT                   PPAAPAR"
FT   gene            559331..559792
FT                   /locus_tag="Pnap_0530"
FT   CDS_pept        559331..559792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0530"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35851"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM3"
FT                   /protein_id="ABM35851.1"
FT                   /translation="MTSFSASHALVGAVQTARFSSQARSCGGSRPAISYTLPAGQAMTV
FT                   QARESGVLRVGQGRLWVTFSHADRDHRVPAGDHFLGFGESLWLSAGQTVVMESWPEAAP
FT                   GAEGAGTSACVSWEADAPARLLGGLMAAGWRAATLRPLAGLRHALGLAA"
FT   gene            complement(559817..560221)
FT                   /locus_tag="Pnap_0531"
FT   CDS_pept        complement(559817..560221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0531"
FT                   /product="BLUF domain protein"
FT                   /note="PFAM: BLUF domain protein; KEGG: pol:Bpro_0667
FT                   sensors of blue-light using FAD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35852"
FT                   /db_xref="GOA:A1VJM4"
FT                   /db_xref="InterPro:IPR007024"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM4"
FT                   /protein_id="ABM35852.1"
FT                   /translation="MHTTTGLQEIIYVSTLAADAPIRVVADIAVKARSHNQQRHITGLL
FT                   VFDGMHFCQQLEGCAQEVADLMARIREDPRHHGVAVLHHGPLDQRRFRRFSLGYTSVDD
FT                   IELLERLQRLQGQAAVEAFVALLSDLDVDG"
FT   gene            560234..561064
FT                   /locus_tag="Pnap_0532"
FT   CDS_pept        560234..561064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0532"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: mfa:Mfla_1734
FT                   transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35853"
FT                   /db_xref="GOA:A1VJM5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM5"
FT                   /protein_id="ABM35853.1"
FT                   /translation="MYRPALPWTMSKDTVAQNFSSKAYMDTLQPGPAPSPPPCKACRLR
FT                   KTGAFTPVSADEMAFIESFRTSTLNRPAGSTLMHEQKPGGKLFTLYAGWAFRYKTLSDG
FT                   RRQILNFLLPGDLIGLQQEFSDGAMHGIEAVTDVSLCVFPRDGLWELFRRYPNLGYDIT
FT                   WLAAREEGMVDDNLLSAGRRNAAERVAMLLMHLYRRLERLGLVQDGSVEFPINQQHIAD
FT                   ILGLSLVHTNKTMRRLQQLGLHEIRNGRLWLRNPKALQRLADYYDAPLRRAPLL"
FT   gene            561187..562608
FT                   /locus_tag="Pnap_0533"
FT   CDS_pept        561187..562608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0533"
FT                   /product="glucosamine-1-phosphate N-acetyltransferase /
FT                   UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /EC_number="2.7.7.23"
FT                   /note="KEGG: pol:Bpro_0671 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase;
FT                   transferase hexapeptide repeat containing protein;
FT                   Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35854"
FT                   /db_xref="GOA:A1VJM6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJM6"
FT                   /protein_id="ABM35854.1"
FT                   /translation="MAIHPLDVVIMAAGKGTRMKSSLPKVLHRLGGRALLAHVLDCAAQ
FT                   LSARQAVVITGHGAMEVEAACARRTGASADLSLKFVRQEPQLGTGHAVQQALPVLPDDG
FT                   ITLVLSGDVPLTQAATLQALLAQCDGQRLALLTLSMADPAGYGRIVRAGTQASAQVRAI
FT                   VEHKDASEAERAIHEIYSGIMAVPTRLLRRWLARLDNDNVQNEYYLTDIVKFAVADGVA
FT                   VVAHQITDAAQVAGVNSPVQLAELERVYQQRLATTLMEQGVRLADPARLDVRGQLTCGQ
FT                   DVEIDVNCVFDGRVSLGQGVRIGANCVIANAAIAAGAVIHPFTHIDGEKLGVQVGEGAM
FT                   VGPFARLRPGANLGAEVHIGNFVEVKNSTLARGAKANHLAYLGDATVGERVNYGAGSIT
FT                   ANYDGANKHRTVIEADVHIGSNCVLVAPVTIGAGATVGGGSTITRDVPAGALSVGRGRQ
FT                   VSIANWARPVKKPGV"
FT   gene            complement(562991..563239)
FT                   /pseudo
FT                   /locus_tag="Pnap_0534"
FT   gene            complement(563289..563771)
FT                   /locus_tag="Pnap_0535"
FT   CDS_pept        complement(563289..563771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0535"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein, AsnC/Lrp family; KEGG:
FT                   pol:Bpro_0674 transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35855"
FT                   /db_xref="GOA:A1VJM7"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM7"
FT                   /protein_id="ABM35855.1"
FT                   /translation="MEQNYADATDIRLLELLQTDASLSNQALAERVHISPPTCLRRVKR
FT                   LRDAGLIEREIAVLSPDKLAGVLGYGLSAVVEISLDQQGAEWLEAFEARVVADDAVQQC
FT                   YRVSPGPDFILLVHVADMPGYQALAQRLFTSNANVRNVKAFFSIKRAKFQPKVMLA"
FT   gene            563910..565766
FT                   /locus_tag="Pnap_0536"
FT   CDS_pept        563910..565766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0536"
FT                   /product="glutamine--fructose-6-phosphate transaminase"
FT                   /EC_number="2.6.1.16"
FT                   /note="TIGRFAM: glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase, class-II; sugar isomerase (SIS); KEGG:
FT                   pol:Bpro_0675 glucosamine--fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35856"
FT                   /db_xref="GOA:A1VJM8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM8"
FT                   /protein_id="ABM35856.1"
FT                   /translation="MCGIVAAVSSRNIVPILVQGLQRLEYRGYDSCGVAVYADGLKRAR
FT                   STSRVSELQEQVSAEHIQGGTGIAHTRWATHGAPAVHNAHPHFSHGTGAGSAARPGKVA
FT                   LVHNGIIENHDDLRAMLQAKGYVFESQTDTEVIVHLMDSLYDGDLFEALKATVAQLHGA
FT                   YAIAAFCKDEPHRVVGARAGSPLILGVGVLADNVETFLASDAMALAGVTDQIVYLEEGD
FT                   MVDLQLGKYWIFDRHQQRAEREVKTVHAHSGAAELGPYRHYMQKEIFEQPRAIADTLEG
FT                   VNGIVPELFGDEAWRTFKDIDSVLILACGTSYYSGCAAKYWLESIAGIPTQVEVASEYR
FT                   YRTSVPNPRTLVVTITQSGETADTLAALRHAQSLGMTKTLTICNVATSAMVRECKLAYI
FT                   TRAGVEIGVASTKAFTTQLVGLFLLTLALAQSKGRLPEDEETAHLKALRHLPAALQAVL
FT                   ALEPQVISWSEDFAKKENALFLGRGMHYPIALEGALKLKEISYIHAEAYPAGELKHGPL
FT                   ALVTSAMPVVTVAPHDALLEKLKSNMQEVRARGGVLYVVADADSRIDSSDGVHVIRMPE
FT                   HYGALSPLLHVVPLQLLAYHTACARGTDVDKPRNLAKSVTVE"
FT   gene            complement(565874..566455)
FT                   /locus_tag="Pnap_0537"
FT   CDS_pept        complement(565874..566455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0537"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   sal:Sala_0677 transposase, IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35857"
FT                   /db_xref="GOA:A1VJM9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJM9"
FT                   /protein_id="ABM35857.1"
FT                   /translation="MECGLPVLRLLVQQRALRAPFPGRAAATRHGRGDGRFDLLPGASS
FT                   FGRRPQNQRPAGHRHHARGPELPKIHAVCDALGNPLRFVLTPGQRHDSKPVPELLDGLQ
FT                   AKAPLADKAYDSDKIVQAAEKRGMQVIIPSRVNREKQRVLDKHRYKTRHLIENLFQRMK
FT                   AFRRVATRFDKLDIRSLGFVHIAGIMKWLH"
FT   gene            566895..567371
FT                   /locus_tag="Pnap_0538"
FT   CDS_pept        566895..567371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0538"
FT                   /product="thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: bxe:Bxe_B1556
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35858"
FT                   /db_xref="GOA:A1VJN0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN0"
FT                   /protein_id="ABM35858.1"
FT                   /translation="MAMASETTELVLPLALDVAREDAREAGLSYAGGVPPAVAWQLFST
FT                   GHALLVDVRSGEERKFVGHVPQSLHVPWASGTSLTRNPRFVRELEAKTGGKDAVLLLLC
FT                   RSGKRSALAAEAAAKAGFTQVYNVLEGFEGEIDEQQHRGAADGWRFHGLPWVQD"
FT   gene            567423..568349
FT                   /locus_tag="Pnap_0539"
FT   CDS_pept        567423..568349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0539"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: bxe:Bxe_B1555 serine O-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35859"
FT                   /db_xref="GOA:A1VJN1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN1"
FT                   /protein_id="ABM35859.1"
FT                   /translation="MAVFDIEHIVGALHAVRQDWRESQKRSREPGGRELPSRDALAQVV
FT                   EALKGALFPMRLGPLDLRQESEDIYVAHTLDSALHQLLAQIRLELTYSARHQMRNGSDL
FT                   EAEALTTTRSFGAALPEIRKLLDSDVLAAYHGDPAARSVDEVLLCYPGILAMIHHRLAH
FT                   QLYRLGLPLLARIVAELAHAVTGIDIHPGAQIGASFFIDHGTGVVIGETAVIGQRVRLY
FT                   QAVTLGAKRFPTDEEGNLQKGLPRHPVVEDDVVIYAGATVLGRVTLGRGATIGGNVWLT
FT                   HDVPPGGNVTQAVSREAGQGSAARQRP"
FT   gene            568346..568618
FT                   /locus_tag="Pnap_0540"
FT   CDS_pept        568346..568618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0540"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bpm:BURPS1710b_A0364 possible transcriptional regulator,
FT                   XRE family, cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35860"
FT                   /db_xref="GOA:A1VJN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN2"
FT                   /protein_id="ABM35860.1"
FT                   /translation="MRPTLVECFGIALRQSREARNWSQEQLAEHSNLNRSYVGEIERGS
FT                   AIASLATVEKLALALGISPSALVGRGEAVSQANVVRGIRLMAIAC"
FT   gene            complement(568766..570121)
FT                   /locus_tag="Pnap_0541"
FT   CDS_pept        complement(568766..570121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0541"
FT                   /product="putative transposase"
FT                   /note="KEGG: bja:blr1916 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35861"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN3"
FT                   /protein_id="ABM35861.1"
FT                   /translation="MDTVIPVRTNWPEDFQEWLQPFLAVFTRSEQRCWAPLYLQGLLGP
FT                   GARKSVAPMAERVCPGQTQQLHHFVSSSTWSTAPLEQVLRKKADALVGGKDAVLIVDDT
FT                   ALPKQGKHSVGVKRQHCGVLGKQANCQVLVSLTLARKEVPVPIALRLYLPEDWAQDEAR
FT                   RAAAKVPESITFETKGDIALAQIDAALADGVRFGMVLADAGYGSSAGFRAGLTQRGLRW
FT                   AVGVQPTQKVYPADVRLDVPADPPVGRPAKHPRPSTPSVSVVQMIETLGSKALRRCSWR
FT                   SGTKGMLSARFAAVWVCVADGALVSHWQHLPGQAAWLVCEVRSSGERKYYFTNHPADTP
FT                   RRTLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLTMMAFGYLQHRRLDS
FT                   VLQAGKKTGIQCTGTATATIIASGTPGHSRRALSGNLRSVSSLRRHDKPASA"
FT   gene            570177..571058
FT                   /locus_tag="Pnap_0542"
FT   CDS_pept        570177..571058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35862"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN4"
FT                   /protein_id="ABM35862.1"
FT                   /translation="MLANATKTTAQLETISPRWLTHLLQWVPVEAGIYRLNKVKNPESI
FT                   KVKCTAREQEGQLPRTFVDYEENPREFFLNAVSTVLDVHTRISDLYSSPHDQIKEQLRL
FT                   TIETIKENQESELINNPDYGLLSQVSEEQRIFPLTGAPTPDDLDELLTKVWKEPAFFLT
FT                   HPLAIAAFGREATRRGTPPPTVSLFGSQFITWRGIPLIPSDKVPVADGKSKILLLRVGD
FT                   KRQGVVGLFQPGLTGEQGPGLSVRFMGINNHAIASYLISLYCSLAVLTTDALAVLDDVE
FT                   IGKYHDYADTYK"
FT   gene            571073..573112
FT                   /locus_tag="Pnap_0543"
FT   CDS_pept        571073..573112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0543"
FT                   /product="cysteine desulfurase"
FT                   /EC_number="2.8.1.7"
FT                   /note="TIGRFAM: cysteine desulfurases, SufS subfamily;
FT                   PFAM: aminotransferase, class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bxe:Bxe_C0124 cysteine desulphurases, SufS"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35863"
FT                   /db_xref="GOA:A1VJN5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN5"
FT                   /protein_id="ABM35863.1"
FT                   /translation="MLATNPSAAPAAFESPLDTALLSRMATALFAALPGEVAAPAGLHS
FT                   AAGLPSTPPASLPGLPATPLGVQAPLQLAPAGSPLASPAGFGPGVPGTPIPQGQIPGAN
FT                   LIPASPAQVPSLGNRAPALLPHAVAGNGVPDKLVSAVPAYEPRLAGATIGVPEASAATV
FT                   SQAGRNPAANAVPFYFLGDQHGHPSPGGRDARVVPSQGGSLDSLATLPFEQPAVPALAA
FT                   PAAPVHAPEAASGQPKFYFVDSVVLPSGYVTPAKPAPHAVEPLAGRSAHPAFDVQAVRR
FT                   DFPILQERVNGRQLVWFDNAATTHKPQSVIDRVSYFYEHENSNIHRAAHELAARATDAY
FT                   EGARERVRKFINAPDVNEVIFVRGTTEAINLVAKSWGGQHVGEGDEIIVSHLEHHANIV
FT                   PWQQLAAAKGAKLRVIPVDDSGQVLLDEYGKLLNDRTKIVAVTQVSNALGTVVPVKEIV
FT                   AMAHRAGAKALVDGAQAISHMRIDVQDIGADFFVFSGHKVFGPTGIGVVWGKREVLEDM
FT                   PPWQGGGNMIADVTFEKTVFQPIPNKFEAGTGNIADAVGLGAAIDYVSRVGIENIARYE
FT                   HELLCYGMQHLGEIKGVRLIGTASDKASVMSFVLAGYTTEEVGKALNDEGIAVRTGHHC
FT                   AQPILRRFGVETTVRPSLAFYNTFGEIDRLVAVVKRLADQRRTF"
FT   gene            573413..574417
FT                   /locus_tag="Pnap_0544"
FT   CDS_pept        573413..574417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0544"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplasmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein, family 3; KEGG:
FT                   pae:PA3449 putative sulfonate transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35864"
FT                   /db_xref="GOA:A1VJN6"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN6"
FT                   /protein_id="ABM35864.1"
FT                   /translation="MEIFPMTLNRRTLLSLTGGLAGAVIAPATLRAADLPQEVRIDYAT
FT                   YSPTSLVLKRFGWLEEDLKRDGVAVKWVFSAGSNRALEYLNAKSLDIGSAAGLAALLAR
FT                   ANGNPIRAPYIFSRPEWTALLVPKDSPIRTLADLKGKKVAATKGTDPYLFLLRALQTVK
FT                   LKRSDIEHVSLQHADGRAALEQGRVDAWAGLDPHMAASELTAGSRLLYRNVAFNTYGFL
FT                   NVREDFQQRHPELLRRVIGAYERARLWTLANTGEAARILADEAKVSLQVALLQLKLRTD
FT                   LSNPQPSAEHVKALQAATPILLDEQLVKPGTDLLRTVEALVDTRFAQGLIRQA"
FT   sig_peptide     573413..573511
FT                   /locus_tag="Pnap_0544"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 33"
FT   gene            574425..575354
FT                   /locus_tag="Pnap_0545"
FT   CDS_pept        574425..575354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0545"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcn:Bcen_6520
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35865"
FT                   /db_xref="GOA:A1VJN7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN7"
FT                   /protein_id="ABM35865.1"
FT                   /translation="MPTIFSKTAMSAKPLTIAPHDVRETPASVFPGRRAYPARPVAEAD
FT                   QADALREIRPARHWPGIGLVIPLLALVLGEAAPRLGWISPHLLPPPSTVLQTLRDWGPL
FT                   TLATHIGASAARVAAGFALGAALAVAIGALVGLSRLGERLLAPSFQALRAIPSLAWVPL
FT                   LLLWLGIDEAPKIVLIAIGAFFPVYMGVASGFRDVDRKLVEVARMARLSPLALVRRVLL
FT                   PAALPAVLTGLRNGLSLAWMFMVAAELIAASRGLGYLLTDGRETSRADIVLAAILLLAL
FT                   LGKLTDSAMQWLEHRLLSWRDTFDGGQS"
FT   gene            575351..576088
FT                   /locus_tag="Pnap_0546"
FT   CDS_pept        575351..576088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0546"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bcn:Bcen_6521 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35866"
FT                   /db_xref="GOA:A1VJN8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN8"
FT                   /protein_id="ABM35866.1"
FT                   /translation="MSTALLDIEVRRKTFGDATVLQGIRLQISAGEIVSLVGASGCGKS
FT                   TLLRIVAGLETAYQGRITLGGQPLAGLSRDVGFIFQEPRLFPWLSVAQNVAFSAGAQGA
FT                   RDPRVAQLLAEVGLAGLTDALPKQLSGGQAQRVAIARGLFGQPRLLLLDEPFSAVDAFT
FT                   RMHLQDMLLDIARRHGTTLLLVTHDIDEAVYLADRVWVLDSKPGRLSADMAIDLPQPRQ
FT                   RDTEALAQRRIGVLHALQAVHAI"
FT   gene            576594..577703
FT                   /locus_tag="Pnap_0547"
FT   CDS_pept        576594..577703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0547"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: bacterial
FT                   luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35867"
FT                   /db_xref="GOA:A1VJN9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024014"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJN9"
FT                   /protein_id="ABM35867.1"
FT                   /translation="MSQEQIKFAYWVPNVSGGLVVSKIEQRTSWNIDYNRKLAQTAEKA
FT                   GFEYALSQIRFTAGYGAEFQHESVAISHALLAATDKLRVIAAILPGPWNPVVLAKQIAT
FT                   IDHLTNGRVAVNIVSGWFRGEFQAIGEPWLEHDERYRRSEEFIEVLKGIWTTDNFSYQG
FT                   DFYRIHNYSLKPKPLQQAPHPEIFQGGSSRAARDMASRVSDWYFTNGNTVEGIQAQVDD
FT                   IRAKAAANGHSVKVGVNAFIIARDTEQEARAVLAEIIEKADPEAVNAFGHEVKQAGKAS
FT                   PEGEGNWAKSTFEDLVQYNDGFKTNLIGTPQQIAERIVALKAVGVDLILSGFLHFQEEV
FT                   AYFGDKVLPLVRELERELQAEPVPLKLAA"
FT   gene            577720..578931
FT                   /locus_tag="Pnap_0548"
FT   CDS_pept        577720..578931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0548"
FT                   /product="long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /note="KEGG: long-chain-fatty-acid--CoA ligase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35868"
FT                   /db_xref="GOA:A1VJP0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP0"
FT                   /protein_id="ABM35868.1"
FT                   /translation="MTQTVNAASAAPATLPHWLLCQSHQQAGRIALRHKRLGVWQQRSW
FT                   RQAADEVHRLATALRASGFAEGSTLAILSRPRPEALLAALAAQWLGGVAALLDPLEAAA
FT                   GQIALLRALQPQAVFAEGLQEIERLQTSALTSGLVLYADGRGVTSPNPAGLALADYAQL
FT                   ALRETDCPWPVQAHAERTAFAFYRHAASGQIEQQRITHAELLQQGRRLVLAEKLGADEE
FT                   ALAARAFAASGQARYLLAPWLIAGFCLNFPENLATRDNDRRELGPTLVAGTLETYTRLH
FT                   ELVQSRLPQPGSVQRRLVDWALTAQPGAARRVLGEWLVRRPLRDVIGFTRTRAPLLVGE
FT                   PLSNNAQAFFAALGIEVRAWPDPAQWHSPAVAPAVPVPPTAPATPSLTTRQPGGWNPHG
FT                   AQAA"
FT   gene            578946..579743
FT                   /locus_tag="Pnap_0549"
FT   CDS_pept        578946..579743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0549"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 1, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: branched-chain amino acid ABC transporter,
FT                   ATP-binding protein, putative; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35869"
FT                   /db_xref="GOA:A1VJP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP1"
FT                   /protein_id="ABM35869.1"
FT                   /translation="MSEVISPPASALPLLTLNNISLSFKGVKAVTDISFAVARGEICAL
FT                   IGPNGAGKSSLLNVINGVYQAQEGRISFEGETCQRMRPHDAAVRGIARTFQNLALFKGM
FT                   SVLDNVLTGRNLKRRSNWLEQALRLGRAAPEDDRQREAAERVIEFLHIQPWRNALVGKL
FT                   PYGLQKRVELARALASEPKLLLLDEPMAGMNAEEKREMSRFILDINREFGTTVVLIEHD
FT                   IGVVMGLSHHVVVLDYGRKIGDGTPQEVRSNPEVIAAYLGTRH"
FT   gene            579765..580646
FT                   /locus_tag="Pnap_0550"
FT   CDS_pept        579765..580646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0550"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   1, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   psp:PSPPH_2369 branched-chain amino acid ABC transporter,
FT                   permease protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35870"
FT                   /db_xref="GOA:A1VJP2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP2"
FT                   /protein_id="ABM35870.1"
FT                   /translation="MEFFFEVLIGGLLAGVMYSLVAIGFVLIYKASGVFNFAQGSMVLF
FT                   AALTFVSLHERGMPFWLAFAVTLAAMVAIALLVERLVLRPLVNRSPITLFMATLGLSYM
FT                   IEGAAQALWGAQVHGLELGISDEPLALGGVLLSQFDLFAAGTAAVLVTALSLLFSKTRI
FT                   GLSLRAVADDPLAALAVGIRLQRIWAVVWAVAGFVGLVAGLLWGARLGVQFSLSLVVLK
FT                   ALPVLIIGGFSSIGGAIVGGLIIGASEKLAEIYLGPVIGGGLENWFPYVLALLFLLVRP
FT                   AGLFGERAIERV"
FT   gene            580659..581726
FT                   /locus_tag="Pnap_0551"
FT   CDS_pept        580659..581726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0551"
FT                   /product="amino acid/amide ABC transporter membrane protein
FT                   2, HAAT family"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   branched-chain amino acid ABC transporter, permease
FT                   protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35871"
FT                   /db_xref="GOA:A1VJP3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP3"
FT                   /protein_id="ABM35871.1"
FT                   /translation="MLYNEAGQFSISYAGERRLFRLRQDRRALALLLAFAFVIVPFVGN
FT                   DYWFSAILIPFLVLSLAGLGLNLLTGYAGQLSLGSAAFMAVGAFAAYNFGLRLPGLPLL
FT                   ACLFLGGVTAALVAVVFGLPSLRIKGFYLIVSTLAAQFFVSWALTKFGWFSNDNASGVI
FT                   SAPPLTIFGVDFSAPVGRYLLTLSVVAALFWLGKNLVRSELGRNWMAVRDMDTAAAVIG
FT                   IPLLKTKLLAFALSGFFLGIAGSLWAFTYLGTVEPHGFDLNRSFQVLFIIILSGLGSIL
FT                   GNFLGAAFMVLFPLLLSNLAGALPVGLIDPGQLENLQKFIFGALIIAFLIKEPEGLARL
FT                   WQRFRERVRLWPLRY"
FT   gene            581780..583105
FT                   /locus_tag="Pnap_0552"
FT   CDS_pept        581780..583105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0552"
FT                   /product="amino acid/amide ABC transporter
FT                   substrate-binding protein, HAAT family"
FT                   /note="KEGG: ppu:PP_2770 hypothetical protein; TC
FT                   3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35872"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP4"
FT                   /protein_id="ABM35872.1"
FT                   /translation="MFKPTFARSLVLALSLAAAAVTAQAEPEQYFPLQSYRVGPYAAGG
FT                   TGFFGGFIDYMQYVNANGGVNGVKLTWSECETEYVVEKGVECYERLKKGLNGAPAAATN
FT                   PLSVGIAYATLDRSTADKLPLITINHGRTDSTDGSVFPYAFPLQLNPYSEVSAIVNYIG
FT                   KQAGGLDKLKGQKIVTLYHGSPYGKETIPVLDLLAKKYGFTVEHVEVPHPGNEQQSQWL
FT                   NIRRAKPDWVILRGWGVMNPVALKTAQKVGFPANRIIGNIWSNSEDDAAPAGAAAKGFI
FT                   SITTHPSGTEFPVLKGIKKQVVDAGKGNLADPKRFGSVYYNLGVVNGILNIEALRIAQD
FT                   KFGKKPLSGEQVRWGFENLKLDDARLKSLGALGLVQPLKLSCADHEGGGAVRFQQWDGQ
FT                   KWSVISDWVQADRALLRPIIEESARKYAKEKGITPRDCGKEG"
FT   sig_peptide     581780..581857
FT                   /locus_tag="Pnap_0552"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 26"
FT   gene            583193..584434
FT                   /locus_tag="Pnap_0553"
FT   CDS_pept        583193..584434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0553"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: Acyl-CoA dehydrogenase, type 2, C-terminal
FT                   domain; KEGG: psp:PSPPH_2366 acyl-CoA dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35873"
FT                   /db_xref="GOA:A1VJP5"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP5"
FT                   /protein_id="ABM35873.1"
FT                   /translation="MSHNSLLFTLSIGTDYERLASRFRPIFARIAEGAVERECSRSLPY
FT                   EPIKWLKEAGFGAVRVPVAHGGAGASVPQLFRLLIELAEADSNVPQSLRGHFAFVEDRL
FT                   NAPPSAERDIWFQRFVAGELVGNAWTEIGSVKMGDAITQVSPVEEGGWLLNGTKFYSTG
FT                   SIFADWIDVYAKRTDTGGDVIAVVSTRQDGVTLSDDWDGFGQRTTGSGTSVFVNAQVES
FT                   VNVIDFATRFKYQTAFYQLVLNAVLAGTARAVERDAAREVRERTRIFSHGNATSVARDV
FT                   QVQQVVGRISAQAYAAEAVAIRAAEPAQRAYETRFGGNDEAEHQANIDAEIESAKAQVV
FT                   LADLVLRAASDLFNALGASAAREAKALDRHWRNARTVATHNPLIYKEKIIGDWVINGTE
FT                   PPYVWQIGAGTPGK"
FT   gene            584498..585751
FT                   /locus_tag="Pnap_0554"
FT   CDS_pept        584498..585751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0554"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   atc:AGR_pAT_773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35874"
FT                   /db_xref="GOA:A1VJP6"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR023922"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP6"
FT                   /protein_id="ABM35874.1"
FT                   /translation="MTATATLERPRVNSPAPFAPRPRPVKAAHLIRSDAEAIEIAHRLA
FT                   ARFAPESALRDREGFLPIDEIDAYSQSGLWGINVPKAYGGPGVSYATLAEVVAIISAAD
FT                   SSIAQISQNHFVLVAHVGLDASEAQKQELFGLVLQGHRFGNAFSELNSRNVAAFETKVV
FT                   VHGDEVEVNGQKFYTTGALLSHIVPIVAVNEAGKGYIVFADRDTPGLTVINDWSGFGQR
FT                   TTASGSVKIERVRVPQSRVVPIDAFDHPSAAGPISQIIQAAIDAGIARGALADSIDFIR
FT                   SKSRPWIDSGKETAGEDPFTIAAIGDLQIRLHAAEALLERAGRLVDAALANATEATVAA
FT                   ATVGTAEAKVLTTQVAIEVTNRLFELAGTRSALTVHNLDRHWRNARIHTLHDPVRWKFF
FT                   HIGNYYLNGVNPPRHPWN"
FT   gene            586010..586771
FT                   /locus_tag="Pnap_0555"
FT   CDS_pept        586010..586771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0555"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: branched-chain amino acid ABC transporter,
FT                   ATP-binding protein; TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35875"
FT                   /db_xref="GOA:A1VJP7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP7"
FT                   /protein_id="ABM35875.1"
FT                   /translation="MPSHPILQIDDIEVVYEQVILALRGVSLSVRAGQIVALLGANGAG
FT                   KSTTLKAVSHLIRAERGDLTRGRILYRGEDIGQHDPDALVAGGLVQVLEGRHCFAHLTV
FT                   EDNLLIGAFVRKVSRRAMQADLERIYGYFPRLRLRRKSLAGYTSGGEQQMVAIGRALMA
FT                   KPRLVLLDEPSMGLAPQIVEEIFDIIARLNRDEGVSFLLAEQNISIALRYAQYAYVLES
FT                   GRVVSQGQAQELAQREDMRDFYLGGQVAIAA"
FT   gene            complement(586812..587915)
FT                   /locus_tag="Pnap_0556"
FT   CDS_pept        complement(586812..587915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0556"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: pfo:Pfl_3918
FT                   sigma-54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35876"
FT                   /db_xref="GOA:A1VJP8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029995"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP8"
FT                   /protein_id="ABM35876.1"
FT                   /translation="MHLLTLPPSPALATSIRATAQVFEDPKSQALLAHLQQVAPSDASV
FT                   LIIGETGTGKELVARHLHELSARRGGPFMAVNCGAFSENLVEAELFGHEKGAFTGALSS
FT                   KAGWFEEANGGTLFLDEIGDLPMPIQVKLLRVLQEREVVRLGSRRSIPINVRVLAATNV
FT                   QLEKAINAGNFREDLYYRLSVVTLELSPLRERPGDILPLTRHFIAEYSRRLGYTDITLH
FT                   PEAQQKLIGYSWPGNIRELENVIHHTLLICRANLIRAEDLHLSKLRLERQDDSSRPQDE
FT                   SADALLQRAFQKLFEEESGALHEKVQEVLLGTAYRFCHYNQVHTAQLLGLSRNIIRAQL
FT                   IKAGELVVNKRRPAPGIPQARLANLSL"
FT   sig_peptide     complement(587853..587915)
FT                   /locus_tag="Pnap_0556"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.840) with cleavage site probability 0.768 at
FT                   residue 21"
FT   gene            complement(587932..589119)
FT                   /locus_tag="Pnap_0557"
FT   CDS_pept        complement(587932..589119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0557"
FT                   /product="Acyl-CoA dehydrogenase, type 2, C-terminal domain
FT                   protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase, type 2, C-terminal domain; KEGG:
FT                   pfo:Pfl_3917 acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35877"
FT                   /db_xref="GOA:A1VJP9"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJP9"
FT                   /protein_id="ABM35877.1"
FT                   /translation="MTATHQLKAIAPLQIARQLAARFAETAAERDLRGGTPKAERDALR
FT                   HSGLLALSIPRQYGGLGASWSETLQIVREFARVDSSIAHVYGFQHLMLATVRLFARPDQ
FT                   WEPWFEQTARNDWFWGNALNPLDTRTVSKKLNGWREFSGRKSFCSGSADSEMLIASALD
FT                   ESSSGKLLIAAIPSGRSGITLHGDWDNMGQRQTDSGSATFERVRVEENELLLDPGPLST
FT                   PFACLRPLIAQLTFANLFLGIAEGAFDEARHYTLKESRVWFKSKATHVSEDPYTLRHYG
FT                   EFWVGLEGVRLLTERANNLLDEAWRKENRLGAEERGHLAVAIATAKVAATRCGLDVTSR
FT                   LFEVTGARATHAALRLDRHWRNLRTQTLHDPVDYKLQELGDWALNASLPAPSFYS"
FT   gene            complement(589201..589761)
FT                   /locus_tag="Pnap_0558"
FT   CDS_pept        complement(589201..589761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0558"
FT                   /product="FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   pfo:Pfl_3915 FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35878"
FT                   /db_xref="GOA:A1VJQ0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR019912"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ0"
FT                   /protein_id="ABM35878.1"
FT                   /translation="MSTPLKIVAVSGGTFRPSRTLVLTQAIVAELGKHLAIDSHIIELG
FT                   DIARPLGSALSRKELTPAVERELRAIESADLLIAATPVYRASYPGQFKHLFDLIGQDAL
FT                   IGKPVLFAATGGSERHALVIDHQLRPLFSFFQALTLPTGVYASEADFSDYQISSELLQA
FT                   RIRLAVKHALPLLGQKTEELQAA"
FT   gene            589793..590053
FT                   /locus_tag="Pnap_0559"
FT   CDS_pept        589793..590053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35879"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ1"
FT                   /protein_id="ABM35879.1"
FT                   /translation="MAALAVWAGNWNSHRNSYAKVKMPSGPVRRTLPFIGRSPAQCFNR
FT                   RLCIRSRGCVALLPGLQFIRHVFLEVIGTMRTLHKHKKLFF"
FT   gene            590500..591714
FT                   /locus_tag="Pnap_0560"
FT   CDS_pept        590500..591714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0560"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: luciferase family protein; KEGG: bxe:Bxe_B1542
FT                   alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35880"
FT                   /db_xref="GOA:A1VJQ2"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ2"
FT                   /protein_id="ABM35880.1"
FT                   /translation="MSFEVFWFLPTSGDTRYLGKSNTGRPATNAYMRQIAVTAESLGYD
FT                   GLLIPTGSSCLDPWVTASSLIAVTQRIKLLVALRTSVTGPTASARQAATLDQALNGRLL
FT                   LNVVPGGDAAELAAEGVYLDHDQRYEAADEFITVWRDLMAGKTVDFTGKHVNVKQARNF
FT                   FPPVQQPAPPLYFGGSSPAAHELAAKHVDAYLTWGEPPAAVAEKIADVRRRAEKYGRTV
FT                   RFGVRLHVIVRETNEEAWAAAERLISRLDDDTIAKAQSNYASMDSEGQRRMAALHGGRR
FT                   DQLEVSPNLWAGVGLVRGGAGTALVGDAQTVAARLQEYADLGVDTFVLSGYPHLEESIR
FT                   FAELVFPLLPGKEPVTLIDQVLTGGAFDVRATAPAVAPQSAEKAAEKPASAAGQAIAAE
FT                   RAVAV"
FT   gene            591711..592562
FT                   /locus_tag="Pnap_0561"
FT   CDS_pept        591711..592562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0561"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bbr:BB1077
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35881"
FT                   /db_xref="GOA:A1VJQ3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ3"
FT                   /protein_id="ABM35881.1"
FT                   /translation="MKVIDLRCRPAYLHDFFGANPGSPGYETARWLNRRVGTRGSDEHF
FT                   ARSLTPEGFLAEVRDAGLSKAVVVGRNTPAQHLPNDLIHQITHAHEELLGIAGIDPALQ
FT                   GVDGALAEIDRAIDQLGLAGIGLEPGFGAPARHPDDALYFPVYEHLNRRGLPLFLMSGP
FT                   TTPDPAFNDPGRLAKVAQAFPQLRIVCYHGYYPNTQQLVGVAFRYENISVVPDMYQFLP
FT                   GSEVFVQAANGFMGDQLLFGSSYPFRPIRQSIDDFLALGFRGKVLDKLLYGNAARLFGL
FT                   AA"
FT   gene            592589..593578
FT                   /locus_tag="Pnap_0562"
FT   CDS_pept        592589..593578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0562"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="TIGRFAM: cysteine synthases; cysteine synthase A;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent enzyme, beta
FT                   subunit; KEGG: eba:ebA4678 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35882"
FT                   /db_xref="GOA:A1VJQ4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ4"
FT                   /protein_id="ABM35882.1"
FT                   /translation="MSTIYADNSQSIGRTPLIQLRRITDGAHATVLAKIEGRNPAASVK
FT                   CRIGAALIWDAEQRGLLGAGKEIVEPTSGNTGIALAFVAAARGIPITLTMPETMSIERR
FT                   KLLLAYGAKLVLTEGAKGMKGAIAKAEEIAASDPKYVLLQQFKNPANPAIHEATTGPEI
FT                   WQDTDGGIDIFISGVGTGGTITGVSRYLKKTQGKAIISVAVEPSASPILTQHRAGEELK
FT                   AGPHKIQGIGAGFVPEVLDLSLVDAIEQVSNEEAIDHARRLAREEGILAGISGGAAVAA
FT                   AVRWAKKPESAGKTLVVIIPDSGERYLSSVLFEGIFDASGAAVNQELA"
FT   gene            593702..594727
FT                   /locus_tag="Pnap_0563"
FT   CDS_pept        593702..594727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0563"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="TIGRFAM: sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein; PFAM: extracellular solute-binding
FT                   protein, family 1; KEGG: pol:Bpro_2345 thiosulphate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35883"
FT                   /db_xref="GOA:A1VJQ5"
FT                   /db_xref="InterPro:IPR000957"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ5"
FT                   /protein_id="ABM35883.1"
FT                   /translation="MAERRTFRRPFLKIALATTLAAASWGAIAQQAVNLLNVSYDPTRE
FT                   LYVEYNAAFIKYWKAKTGQDVTIKQSHGGSGKQARSVIDGLDADVVTLGLAGDIDALVN
FT                   NGGWIPKDWQKRLPHNSSPYTSTIVLVVRQGNPKGIKDWDDLIKPGVSVITPNPKTSGG
FT                   ARWNYLAAWEFAKRKFGGDAKAKDFVAKLYANVPVLDTGARGSSITFAQRNQGDVFISW
FT                   ENEAYLLEKEFGSKVDVVYPSLSILAEPPVSVVDKNVDRKGTRAVAEEYLKYLYTEEGQ
FT                   DIAGKNFYRPAVSEKAKAKYAKQFPNLKLFTIEQGFGGWTKADKEHFADGGSFDQIYLK
FT                   K"
FT   sig_peptide     593702..593791
FT                   /locus_tag="Pnap_0563"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.851 at
FT                   residue 30"
FT   gene            594770..595945
FT                   /locus_tag="Pnap_0564"
FT   CDS_pept        594770..595945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0564"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; helix-turn-helix, Fis-type; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase;
FT                   KEGG: pfo:Pfl_3918 sigma-54 specific transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35884"
FT                   /db_xref="GOA:A1VJQ6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ6"
FT                   /protein_id="ABM35884.1"
FT                   /translation="MNQLLTFPDAGKHALSIRAKALVFEDPQSQALLARLDQVAPTEAT
FT                   VVIIGETGTGKELLARRIHQGSARRGPFVAVNCGAFSESLIDAELFGHESGAFTGASQA
FT                   RAGWFEAANGGSLFLDEIGDLPLALQVKLLRVLQERQIVRIGSRKPIELDVRLIAATNV
FT                   DLRDAVNAGHFRADLYYRLSVATLELRPLWERPGDILPLARHFLASYAKRLGIEGSTLT
FT                   PGAEQALLAHDWPGNIRELENVVHYALIVAPAAAIHASDLQSIQRSARSRARQPVALPP
FT                   AVADSSASTPEVAAVPTLRQMLRELLLKSMKLNQPLLFEQVQATLVCTAFEFCHNNQVQ
FT                   TARLLGLSRNVLRTLLKQHGLLAAHEDSSPDTGDFAADLLVGQPVAASSMA"
FT   gene            596039..598219
FT                   /locus_tag="Pnap_0565"
FT   CDS_pept        596039..598219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0565"
FT                   /product="thiol:disulfide interchange protein, putative"
FT                   /note="KEGG: ccr:CC0217 ThiO:disulfide interchange protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35885"
FT                   /db_xref="GOA:A1VJQ7"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ7"
FT                   /protein_id="ABM35885.1"
FT                   /translation="MSRHWNTEARLALLGIGLGLAAACAQAAPDEAATQQVRARLVASA
FT                   GAVHAGDRLVLGVHQHIAPEWHTYWINPGDTGLATRIDWTLPPGSAAGQIQWPTPQRFQ
FT                   LGAITNFGYAGDVTLLTEIDVPKELQAGQQFAVRAQVNWLVCRESCIPQKVELRLSLPV
FT                   LEPGQPAGAGSPLIDAARARLPVASPWPVNVQYAADHVTLRLVNPGLSRDALDTLAFFP
FT                   AQRHQLSNELPQTIKVVDNEVLLQLPHGDEPPSAQAALTGVLVVRDPAQPASAARGYAI
FT                   NSAASPLARAPATAAQAPAPASSSVTTLASVLLLALFGGIVLNLMPCVFPVLSIKALSL
FT                   LQHAERPARETRRHGLAYTLGVLGSFALLGGLLIVLKQGGAQIGWGFQYQSPGFVLLAA
FT                   YLMFAVGLSLSGVFSVGASVAGWGSSLASRRGYSGSFFTGVLAAVVASPCTAPFMGAAI
FT                   GYALTQPAAILLAVFLTLGMGLALPYLLLTHWPALQHRLPRPGRWMERVKQGLAFPMYA
FT                   AAVWLAWVLAQQAGPHAVAAALGGMVAIAFAAWIFDATRGHARSGVQRSGAGLALLAVT
FT                   AALLGGQTGLRAQPAPPVQQPAMGKPSHGAEPYSAERLQSLRRQGQPVFLNLTAAWCIT
FT                   CLVNERVALSDASVQQAFERAGIHYLKGDWTNEDAQITRKLGEFGRSGVPLYVYYPANA
FT                   GADPVVLPQILTPKMVLDVLQSPAAVSVARTP"
FT   sig_peptide     596039..596122
FT                   /locus_tag="Pnap_0565"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 28"
FT   gene            complement(598299..599864)
FT                   /locus_tag="Pnap_0566"
FT   CDS_pept        complement(598299..599864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0566"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RS02156 putative outer membrane drug
FT                   efflux lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35886"
FT                   /db_xref="GOA:A1VJQ8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ8"
FT                   /protein_id="ABM35886.1"
FT                   /translation="MRHQQMEVGGEVGEVGRGQRGRQHCQGRWRLRLSWAGCTGLMALA
FT                   LAACGSVAPPPVALSEAPPAWQTPADLAAAQGAAPWRPAQPGDSLDKGAWWRLFNDPGL
FT                   DALQQQARQASPSLQVAAARLRQAHTLVDIAGASSLPRVDAGLRGTRTGTSANRPAATA
FT                   GAQASASVQNDFVLSSTVSYELDLFGRQRHEQQAALAFEQQAQADQLNAQLVLSADLAA
FT                   FYFTLRSLDAEIAVVEQGLQVQGRAADLLAARHEGGAASGLDRAQQQAQFDATRTQLTL
FT                   LRKQRGQLEHALATLVGTPASQFTLPVAALPAGVPGLPVALPSEVLQRRPDIAAAERAV
FT                   AVANAQLGLAKAAWFPSLTLSASGGWEAKNIASLIDAPSLLWALGGSLTQAVFDGGRLR
FT                   AREEQARAGQELAAASYRQVVLRALQEVEDGLLALNALASAQSQSQAASASAQRVLDIA
FT                   QDRYAGGLSTYLDVVTAQQNVLTNQRLSSQLRGQQLQATAYLVKALGGGWQPGELEQAL
FT                   LGQR"
FT   gene            complement(599861..601135)
FT                   /locus_tag="Pnap_0567"
FT   CDS_pept        complement(599861..601135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0567"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS02155 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35887"
FT                   /db_xref="GOA:A1VJQ9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJQ9"
FT                   /protein_id="ABM35887.1"
FT                   /translation="MRSFPSLNHEPIHPEAGRPLRRARWIGLGVLALLLGGAGARAYVN
FT                   AAHAKSVEERTGRSAIRSVLTTQARAAQGLRTVALPATLRGRNEAALYARTNGYVRSWS
FT                   KDIGDKVKKGDLLALIDTPEVDQDLAQAQATQEQIKARLALAQSSLARWEGLRQRDAVS
FT                   QQELDERRAAQQQALADLAASQANVRRLRQMHDFGRITAPFDGVVIKRNVEVGALVAAG
FT                   SATTTRELFYLAQSDALRLTVAIPQVYAADVAVGKEVSIKLLERPNAPGKGQITRVSGG
FT                   VDVATRSVQVEVSMDNQRGDFLPGAYVEVALPLSGAAMTLLLSPSTLQFRQDGAQVAVV
FT                   GEDGKVSLRQVKLGRDLGRSVEVIAGISPKDAIILNPPDTIEEGERVLVRKAPEDKPVP
FT                   KPAGGASRPAEAKADGDKDAKGGKA"
FT   sig_peptide     complement(601007..601135)
FT                   /locus_tag="Pnap_0567"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.688) with cleavage site probability 0.455 at
FT                   residue 43"
FT   gene            complement(601160..604357)
FT                   /locus_tag="Pnap_0568"
FT   CDS_pept        complement(601160..604357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0568"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   rso:RS02154 probable transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35888"
FT                   /db_xref="GOA:A1VJR0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR0"
FT                   /protein_id="ABM35888.1"
FT                   /translation="MWIVQVALRRPYTFIVAALLILLATPFVLRKTPVDVFPEINIPVV
FT                   AILVSYNGLSAEEMTNRIVTPIERNLANSVSDMEHTESQTLGGVGVIKVFFQPQVDQAA
FT                   AIAQVVASTQASLRSLPAGAQPPTIIKYSATDLPILQLGFSSPARSVQELNEQAFNVLR
FT                   TKLITIPGTAVTAPYGGRFRQISIDINGPALAARGLSAIDVVNALQVQNLMLPSGTAKI
FT                   GGQEIAIALNGSPASIAELGDIPITTVNGATVYVRDVAQVRDGAQAQTNIVRSGGERGL
FT                   LMTVLKNGGASTLDIIDTIKAKLPKALLALPEDITVTPLADQSVFVAAAIKSVVHEALI
FT                   AGALTAALLLLFLGNWRSTAIIAISIPLSILCSLITLHLIGQSINIMTLGGLALAVGIL
FT                   VDDATVEIENVERHLHLGKTPHQAILDGAAEIATPALVATGCICIAFVPLFFLPGVAGK
FT                   LFMPLAQAVVFAMAASYILSRTLVPTLVMYLMRHQSRHAGEGHHQPGRFRRIHLAFDAW
FT                   FERFRHGYSVVLAALLQRKALFGSGFMAFALLSSGLYTALGRDFFPTVDAGQIRLHVRA
FT                   PAGISLDEMPPFVDKVERRIREVVGAAEVASIVDIVGGPYTPYNMVYNNNGTIDSSDVE
FT                   IMVALTPDHQPTQGHIRALRETLARDFPGNEFYFQSADMVSQTLNFGLSAPIDIQIQGA
FT                   KTAENLAVAATLLNQIRQVPGAVDTLLYQRFNRRALQLDMDRSRLAQTGLVARDVAQNV
FT                   MVSLSSSFQTSPTYWMNPANGSVYNVAVQVPQYDIDSLGAMLGIPVNAPGSNGQPREPQ
FT                   LLGNVVSVKSASQQANVSHYNIAPVIDLYASVDGRDLASTYADIEKLIVKAREKLPRGS
FT                   EITVRGQIETLRTAFSSLIWGLALAIVLVYLLLVVNFQSWLDALIIVSGLPAALAGIAW
FT                   MLYLTGTPLSVPALTGAIMTVGVATANSILVVSFARQRLAEGVPALTAALEAGSTRLRP
FT                   VLMTALAMVIGMVPMAIGLGEGGEQNAPLGRAVIGGLLFATLSTLVLVPLVFAGVHRRL
FT                   SARVRLPGAAPVEPVPA"
FT   gene            complement(604587..605063)
FT                   /locus_tag="Pnap_0569"
FT   CDS_pept        complement(604587..605063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0569"
FT                   /product="cytochrome c, class II"
FT                   /note="PFAM: cytochrome c, class II; KEGG: mag:amb0751
FT                   cytochrome c' precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35889"
FT                   /db_xref="GOA:A1VJR1"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR1"
FT                   /protein_id="ABM35889.1"
FT                   /translation="MNKPLKLIASAVLSIGALAATATAMAQQAPKPEQLIKWRQSAYQV
FT                   LAWNAGRIKANVDGQYNKEDVIKAANTIAAIANSGLGALYAPGTETGKGWRETNVKPEL
FT                   FTDPKAGEIAGHFSKEASELARVALLGDLTVVKAQLAKVQGTCKSCHDDFRKKD"
FT   sig_peptide     complement(604983..605063)
FT                   /locus_tag="Pnap_0569"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            complement(605150..606154)
FT                   /locus_tag="Pnap_0570"
FT   CDS_pept        complement(605150..606154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0570"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rba:RB1022 gluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35890"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR2"
FT                   /protein_id="ABM35890.1"
FT                   /translation="MTTKNILGRALLAASVAGVFASAAAQAQSPAPSGAVTPAIAGVVA
FT                   AGTPIELIKEGFHGTEGPVALPDGSLIFTETTANRVTRIAPDGATSTFVEGSNGANGLG
FT                   FTANGDLYAVQVLKARVGIIFPTTKARTLADNFEGAPFGRPNDLVVDSRGNVYFTDSGA
FT                   NPPVAGQPAPPVQATAPAKPAVYRISAKGELKRLAADIERPNGIQLSPDEKVLYVANTL
FT                   GEHLLAYDIAPDGALGPRRNFAKLEGWQKTDTGNSSGADGLAVDEAGRVYVASNKGIEV
FT                   FSSQGEALGSIALPKKPQNLAFAGERKKTLYAVGRGAAYRLPVLTAGYAGRAK"
FT   sig_peptide     complement(606071..606154)
FT                   /locus_tag="Pnap_0570"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 28"
FT   gene            complement(606183..606791)
FT                   /locus_tag="Pnap_0571"
FT   CDS_pept        complement(606183..606791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0571"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   bte:BTH_II0300 bcp"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35891"
FT                   /db_xref="GOA:A1VJR3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR3"
FT                   /protein_id="ABM35891.1"
FT                   /translation="MKHRIFKAALPALMSTLLALPAAAALKEGDAAPDFKLKASLAGKE
FT                   FNYSLKDALKKGPVVVYFYPSAYTGGCNIQARSFAVNTEKFAAAGTSIIGVSLDNIGRL
FT                   NTFSADPEYCAGKVAVASDAGGKVSKAFDLSVSDTPAGRKDTRGADIDHARVERTTFIV
FT                   TPDGKIAATVGGLTPVANVEKALEVVQGLAKAGTAGSRL"
FT   sig_peptide     complement(606717..606791)
FT                   /locus_tag="Pnap_0571"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 25"
FT   gene            complement(606823..607506)
FT                   /locus_tag="Pnap_0572"
FT   CDS_pept        complement(606823..607506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0572"
FT                   /product="cytochrome c, class I"
FT                   /note="PFAM: cytochrome c, class I; KEGG: sdn:Sden_3622
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35892"
FT                   /db_xref="GOA:A1VJR4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR4"
FT                   /protein_id="ABM35892.1"
FT                   /translation="MKILFYSLLVSACLLPSVMAATPAGKARAADAAPARSLPVKGDPV
FT                   LGREKAESERCMECHGVDGHGAGHSNGPEGKFAKLAGQHPDYILKQIRDFRSGARKHDQ
FT                   MQIMARSVSDEDMRDIAAYFGSQPAMNAQDGERHALGKSLYENGDPARGVVACSSCHGV
FT                   KGKGLAASPLAPVVGGQEWRYLDQQLRDWRSGERRNSDGGVMSQATKALTDADIESLAN
FT                   YLSGI"
FT   sig_peptide     complement(607417..607506)
FT                   /locus_tag="Pnap_0572"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.719 at
FT                   residue 30"
FT   gene            complement(607522..607935)
FT                   /locus_tag="Pnap_0573"
FT   CDS_pept        complement(607522..607935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35893"
FT                   /db_xref="GOA:A1VJR5"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR5"
FT                   /protein_id="ABM35893.1"
FT                   /translation="MPRPAGRNFCFMRKMLIVMGLVMLLAGVGRAADIELDTDLMQTIE
FT                   DTNLSLASNIALKDGKSSKAEAAELHRMFTQVEAHFVAKGDAADAVDLSKKSKDWAGEI
FT                   VQSVDSKQFDHAAELAGNISRACKTCHNFYKKS"
FT   sig_peptide     complement(607840..607935)
FT                   /locus_tag="Pnap_0573"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.958 at
FT                   residue 32"
FT   gene            complement(607966..609417)
FT                   /locus_tag="Pnap_0574"
FT   CDS_pept        complement(607966..609417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0574"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   sus:Acid_1146 protein of unknown function DUF1501"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35894"
FT                   /db_xref="GOA:A1VJR6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR6"
FT                   /protein_id="ABM35894.1"
FT                   /translation="MNNDSRRDFLRKSGVYLGGAAAMSGVIPGLGSFSAAHAADLVDPL
FT                   ALKGPHFPGKIKSVIWLHQDGAPSTLDLYDYKPELIKLAGKEVPASFLKGIKTSTQGGV
FT                   GKLYASKREWKQHGQSGAWFSDLLPNLAKQADHMTFIKSSVTVGATHDISILKLNTGDL
FT                   NPGRPSLGAWITYALGSANKDLPPYVVLYNGDREPQAGSVNWSSGFLPAVYQGTAFRPG
FT                   DSPILYLDRPELRTAQQQRKSLDLLKRLNSAGAERYPSDSELRARIQSYELADRMQAAA
FT                   PAAVDISKESAATKEMYGLNDKTSQSYGEVLLRARRLVENGVRFVQVVSAVPQSLDSER
FT                   RNWDAHDELEQNHGLLSKMVDKPIAGLLADLKSRGLLDSTLVVWASEFGRTSWGESGSG
FT                   RDHNPWGYTQWMAGGGLKAGFTYGETDEIGLQTADKDKAMDTYDLHATILHLMGLDHLK
FT                   TTFLNNGRSERPTVVYGKVVKDLLA"
FT   sig_peptide     complement(609301..609417)
FT                   /locus_tag="Pnap_0574"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 39"
FT   gene            complement(609455..611803)
FT                   /locus_tag="Pnap_0575"
FT   CDS_pept        complement(609455..611803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0575"
FT                   /product="protein of unknown function DUF1549"
FT                   /note="PFAM: protein of unknown function DUF1549; KEGG:
FT                   rba:RB2845 hypothetical protein-transmembrane prediction"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35895"
FT                   /db_xref="InterPro:IPR011444"
FT                   /db_xref="InterPro:IPR022655"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR7"
FT                   /protein_id="ABM35895.1"
FT                   /translation="MKNKAIYLSVMLGVLAGPAVLAQTQAVVDAARSAQGAAPKAWSAY
FT                   QPVQAPQAPEVRQKAWVRTPIDAFVLSQLEAKGLKPSKEADRATFIRRATLDAWGLLPT
FT                   PEEVKTFVADKSPTAYEKLADRLLASPHYGERQARRWLDLARYADSTGFQNDNTRPNNW
FT                   RYRDYVIKAFNQDRPFSRFIQEQVAGDELWPESQDARIATGFLAGYPDNRNSRDLVQRK
FT                   YQIETDMTDLVGETFLAATVGCARCHNHKSDKVSQKEYFQLQAFLANTAFNEQTPLAKG
FT                   TETEWDKAYEQQQAAYQEATKDIRAKQKAILDTVREAGRKYYNERYLTDSREAIFKPEA
FT                   QWTPLDRWVNWRKQAVATDNEIASYLEDSGTKPSVVYYNPDNAEKWKTYKALREELKQF
FT                   DKIKPAKGSSQFTAALELTKEVPPTHVRFGGIHERPLEAVQPAIPALWGGKGEVAITPT
FT                   ASSSGRRTALANWLSSDSNPLTARVYANRVWAQYFDKGIISTVQDFGRAGTKPTNPELL
FT                   DYLATNFVKNGWSVKKLHREILLSSVYRQSSDERLDVVKADPENKLLAFYPRKRLEAEV
FT                   IRDSLLYASGLLSDKVGGPSVFPPVVKTGDVVGKAEDFQGNRVWAVSTDKEDWNRRSLY
FT                   IFTRRSFSYPITQNFDPANPNQPHHKRDVTTTALQALTLFNSEVVFDWSQALAGRVINE
FT                   AGGDETAQINRLYQILYSREPNQTERLALKSFLAEQKIVVQHKAANGKFEVAVPSGLKD
FT                   TTKFDPVKSAAFVDLVHTVANSNEFAYRF"
FT   sig_peptide     complement(611735..611803)
FT                   /locus_tag="Pnap_0575"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 23"
FT   gene            612254..613768
FT                   /locus_tag="Pnap_0576"
FT   CDS_pept        612254..613768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35896"
FT                   /db_xref="InterPro:IPR021485"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR8"
FT                   /protein_id="ABM35896.1"
FT                   /translation="MPSFKTTALATAVLLALSSGAVQAQAQPANEIQSLKGTVEDLRKQ
FT                   LEELRGLIQQRGAVAPAPGGATAASAGESQESVDARTAATKADIQGMRTDLENYKYDQS
FT                   RLQERNIPSVTRNTKIGGSVTVRYDIQNPEAPPSSASSGFGPTDPRHRGFNASAFGLNF
FT                   AGNLYRDYAEGRNLTYRLALTSQNTASSSSTSVNLTDAYLRYSFQPASGNAEDPLGTIT
FT                   LGQQTVPFGQDAQAQDPEVKAVIGNAGFVSGLGLNTRQTGLVLSGDYDPYVDFTNNYRA
FT                   PLLAYSLGFFNGNGANKADNNNYIDTVGRLVYTLPVDYSSWLRQLQIGGSYYRGYTSLG
FT                   TASTTATTAATSKGHNNRYGMDVNWTHLPYSVAYERAYGKQELLAATAANPDRYQRGMG
FT                   QYINFGYTWGEQFLASSRQQGKFDDYWPKSFQTFIRFDEWDPNRSGSVVNDKQFVTTLG
FT                   LNVFFAETTKFQINYLHIRNQLGGAAPTAARPASVNAIQALLNATF"
FT   sig_peptide     612254..612328
FT                   /locus_tag="Pnap_0576"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.748 at
FT                   residue 25"
FT   gene            613798..614886
FT                   /locus_tag="Pnap_0577"
FT   CDS_pept        613798..614886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0577"
FT                   /product="ABC nitrate/sulfonate/bicarbonate family
FT                   transporter, periplasmic ligand binding protein"
FT                   /note="KEGG: bcn:Bcen_4344 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35897"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJR9"
FT                   /protein_id="ABM35897.1"
FT                   /translation="MKRRLFNSTLLAGLGAPALIGLGGQARAAGKPTTIRIGFPGAGTG
FT                   GRPLPTSGFPANSVFRGEIEQEFAAEGIKIEWKYFVGAGPALNESYANGLLDFCFGHGD
FT                   LPLIVGRSTGLKHKILLSSGRGGDVYVVTPASSPAKSVADLKGKTLSVQKGTAGQLTLY
FT                   RVLAKYGFNDPEKEFRIISQIRDDRVASLATGDIAGAIESPFGLEARGVAKRVAEIFDD
FT                   PAINAPGSVWVGEAFEQQYPDIVQRIVTRLVKVAHWSTQEANRETQYQLWTRSGTSTYI
FT                   DNKNSWDRVKDLRTRINPLLDDYYLAAINKSIEETKKYKLTRRPVSLDGWLEPKYLNNA
FT                   LRELKLENYWPTQDAAGKFIAA"
FT   sig_peptide     613798..613884
FT                   /locus_tag="Pnap_0577"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 29"
FT   gene            614962..615825
FT                   /locus_tag="Pnap_0578"
FT   CDS_pept        614962..615825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0578"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bur:Bcep18194_B2062 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35898"
FT                   /db_xref="GOA:A1VJS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS0"
FT                   /protein_id="ABM35898.1"
FT                   /translation="MSASTADINVFPVSFARAESARWHRHALGAAKAGLKAAHTLLLGL
FT                   ILPALLFALWWIATEHHWVAEQILPPPAFVWDSLKDVLASGELLGHVGFSAARVAWSLL
FT                   IGGSVGLLLGFGMGLSRTFKAYVFPTFDVLAQLPVLGWIPLLIIFVGIEEALKVTAVSI
FT                   AVVVPVALSTLSGIANIPQALLEVGRVYQFSALQTIRRIVLPAAAPSLFTGLRQGVMQA
FT                   WISVIFVELLSSSEGLGFFMAYSRSLSQIDMVIVAMLAIGVVGIVIELGLRLIESRLQG
FT                   WRRSAF"
FT   gene            615843..616661
FT                   /locus_tag="Pnap_0579"
FT   CDS_pept        615843..616661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0579"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_C0132 ABC
FT                   nitrate/sulfonate/bicarbonate family transporter, inner
FT                   membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35899"
FT                   /db_xref="GOA:A1VJS1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS1"
FT                   /protein_id="ABM35899.1"
FT                   /translation="MSDTAPLVSAGISSATSDSKTAFDWRGLVLPIAFVIVWYAVTALE
FT                   LVNTKLIVPPAGVAAQGLKELANGSFYLGIGLSLWRDLSGFTLGALAGIAVGALIGVSH
FT                   LADKVIGPTFHTARQISLFAWLPLLSALVGTGELSKIIFISFSAFYPVVLGTLEGVRGV
FT                   SRAHAEVARVYGFTPAQVFFRLILPAASPEILAGLRLGLIYAWLATIGAEYLLVNDGQG
FT                   IGNIVFKGRMAFNVELILFGLLAIGLVGNVFNRIAAVAERRLLRWRAPAR"
FT   gene            616721..617518
FT                   /locus_tag="Pnap_0580"
FT   CDS_pept        616721..617518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0580"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_A2157 putative ABC sulfate ester transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35900"
FT                   /db_xref="GOA:A1VJS2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS2"
FT                   /protein_id="ABM35900.1"
FT                   /translation="MPQAGTIEIKNLNKYYEVKGQPLKVLENISLSIRPGEFISIVGSS
FT                   GCGKSTLLRLLIGLESGYEGQILLDGKPITGTSLERGIVFQEHRLFPWLTAEQNVSLGL
FT                   LNAPGTQAAKNKSVQEHINLVGLKGFEKAYPYQLSGGMSQRVAIARALVNRPEVLLLDE
FT                   PFGALDALTRSHLQQELQRIWQAEGITAILVTHDVEEAVFLGDRIVVMQPRPGRIKRIV
FT                   DVPLARTRERGSYDFAAIKDDVLGEFSHEPRAPDPATALALAA"
FT   gene            617587..618333
FT                   /locus_tag="Pnap_0581"
FT   CDS_pept        617587..618333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bja:bll5801 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35901"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS3"
FT                   /protein_id="ABM35901.1"
FT                   /translation="MTPSFKTSPFKASKARTAAWVFAAVAAVPLFALAQSASPPPPAPV
FT                   SAAEAAKLFSFFITSQGAGKGADLGGLAGADAHCQKLASAVGAGNKTWHAYLSTQASGG
FT                   QAAVNARDRIGHGPWYNTRGAVVAKDLVHLHGDTLETARLGNNLSWATAFSEKNEPVKR
FT                   AGDKPNEHDILTGSQPDGRAYTDDADHTCKNYTSSAADGSAQLGHFDRTGGGNTSWNST
FT                   HRSRGCGQDNLVSTGGAGLLYCFAVN"
FT   sig_peptide     617587..617691
FT                   /locus_tag="Pnap_0581"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 35"
FT   gene            complement(618504..619172)
FT                   /locus_tag="Pnap_0582"
FT   CDS_pept        complement(618504..619172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0582"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: eba:ebA3526
FT                   putative cyctochrome C biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35902"
FT                   /db_xref="GOA:A1VJS4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS4"
FT                   /protein_id="ABM35902.1"
FT                   /translation="MTTFAFLAAFLLLLALGFVLPALLRAQPVLPGVDPVHAAPPGNPQ
FT                   RGLAVGLAVALVAGAALVYAAVGAPASLLAARTPETIAELVQHLKTSPADAAAWRRLAR
FT                   ACEAAQRFNEAVQAYRQLVKLTPDDADTLLDYAVTLAMSADQRLGGEPEQLIEQALTLA
FT                   PQNVQALALAGSVRFERQDYAGAVALWRQVLLHAPADSPVAAAIADSIAKAESLAGRAR
FT                   "
FT   sig_peptide     complement(619092..619172)
FT                   /locus_tag="Pnap_0582"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.877 at
FT                   residue 27"
FT   gene            complement(619169..619570)
FT                   /locus_tag="Pnap_0583"
FT   CDS_pept        complement(619169..619570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0583"
FT                   /product="cytochrome C biogenesis protein"
FT                   /note="PFAM: cytochrome C biogenesis protein; KEGG:
FT                   reu:Reut_B4772 cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35903"
FT                   /db_xref="GOA:A1VJS5"
FT                   /db_xref="InterPro:IPR005616"
FT                   /db_xref="InterPro:IPR038297"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS5"
FT                   /protein_id="ABM35903.1"
FT                   /translation="MRRLLLCLMLAATPALAEPTLEQHVTRLSEQLRCLVCQNQTIADS
FT                   HAQLAIDLKNQVREQLAAGASDQEVLDYMVQRYGDFVLYRPPVKPSTWLLWFGPLAMLL
FT                   AGLGLLFVKVRQRQPQGDALDSAGETHAA"
FT   sig_peptide     complement(619517..619570)
FT                   /locus_tag="Pnap_0583"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 18"
FT   gene            complement(619563..620090)
FT                   /locus_tag="Pnap_0584"
FT   CDS_pept        complement(619563..620090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0584"
FT                   /product="periplasmic protein thiol--disulfide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol--disulphide
FT                   oxidoreductase DsbE; PFAM: Redoxin domain protein; KEGG:
FT                   dar:Daro_3997 periplasmic protein thiol:disulfide
FT                   oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35904"
FT                   /db_xref="GOA:A1VJS6"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS6"
FT                   /protein_id="ABM35904.1"
FT                   /translation="MRRFLFPLGLFFSLVCLLGAGLRLNPQEIPSPLIGKPAPAFALAQ
FT                   LALPDKTFGPQDMQGQVWLLNVWASWCTACRQEHPLLLELAGRNQVSIVGMDYMDARAD
FT                   GAKWLEKHGNPYRLSILDTDGKVGIDYGVYGVPETFVIDKRGVIRLKLAGPVTAEIIEK
FT                   KLLPLIKELNRA"
FT   sig_peptide     complement(620016..620090)
FT                   /locus_tag="Pnap_0584"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.317 at
FT                   residue 25"
FT   gene            complement(620099..622096)
FT                   /locus_tag="Pnap_0585"
FT   CDS_pept        complement(620099..622096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0585"
FT                   /product="cytochrome c-type biogenesis protein CcmF"
FT                   /note="TIGRFAM: cytochrome c-type biogenesis protein CcmF;
FT                   PFAM: cytochrome c assembly protein; KEGG: neu:NE0768
FT                   cytochrome c-type biogenesis protein (CcmF)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35905"
FT                   /db_xref="GOA:A1VJS7"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003567"
FT                   /db_xref="InterPro:IPR003568"
FT                   /db_xref="InterPro:IPR032523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS7"
FT                   /protein_id="ABM35905.1"
FT                   /translation="MIAELGNFSLVLALCLACVQGSLPLLGAYRGEPRWMALGRSAAFG
FT                   QCLFVTLGFAALVYVFAVNDFSVSYVAANSNSRLPLHFRVAAVWGGHEGSVLLWIQMLA
FT                   LWTAAVAVFSRSLPAGTVARVLGVMGLISIGFLCFLLFTSNPFDRTLPAAADGRDLNPM
FT                   LQDLGMIAHPPILYMGYVGFSVAFAFAIAALLEGRLDAAWARWSRPWTLLAWAFLTLGI
FT                   ALGSAWAYYVLGWGGWWFWDAVENASFMPWLVGTALIHSLAVTEKRDTFKNWTVLLAIL
FT                   AFSLSLLGTFLVRSGVLSSVHAFASDPRRGIYILVFLAVVVGGALALYAWRAPGVGLGG
FT                   RFALFSRESLLLVNNVLLVVTAGTVLLGTLYPLLLDALGLGKISVGAPYFEAVFVPLML
FT                   PFLLLIAVGPLASWKQASFKGVLRRLRWIAVGAVLFALGVALALNTSVMVAVGLALAAW
FT                   VLLGTAAELAGRLRHAALGAPLRQRLASLPRSYWGMLLAHAGIGVFVIGVTMVRGLDAS
FT                   SDHSMRVGDSATLGDYRFTFARLERVEGKNYIAARARFEVTRGAGPVAILYPEKRFYTV
FT                   QQMPLTDAAIDRGWLRDLYVSLGEATQDGAWVVRLQHKPFMNWVWGGTLFMALGGALAA
FT                   SDRRYGWGRKRSAKRPLADAAVTPSVQPAT"
FT   gene            complement(622093..622542)
FT                   /locus_tag="Pnap_0586"
FT   CDS_pept        complement(622093..622542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0586"
FT                   /product="CcmE/CycJ protein"
FT                   /note="PFAM: CcmE/CycJ protein; KEGG: net:Neut_0060
FT                   CcmE/CycJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35906"
FT                   /db_xref="GOA:A1VJS8"
FT                   /db_xref="InterPro:IPR004329"
FT                   /db_xref="InterPro:IPR036127"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VJS8"
FT                   /protein_id="ABM35906.1"
FT                   /translation="MKARHKRLGLIVAGLAALGLGAALVLSAFQKNLVFFFTPSQVAAG
FT                   EAPRNRSFRVGGMVEVGSIERQADGVTVSFLVTDTAQRLRVNYRGSLPDLFKEGKGVVA
FT                   QGKLTADQLFVADEVLAKHDENYMPPEAAYALKQAGAPALAGALK"
FT   sig_peptide     complement(622456..622542)
FT                   /locus_tag="Pnap_0586"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.487 at
FT                   residue 29"
FT   gene            complement(622718..623506)
FT                   /locus_tag="Pnap_0587"
FT   CDS_pept        complement(622718..623506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0587"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: nmu:Nmul_A1212 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35907"
FT                   /db_xref="GOA:A1VJS9"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJS9"
FT                   /protein_id="ABM35907.1"
FT                   /translation="MRPVLHAPFAARFFASPRPGWWKYAGAPAFYPLAGRLIPGLQAVA
FT                   VALLALGLAVGFLLAPTDHQQGDAYRIIFVHVPAAWLSMVLYVAMAFWAAMGLALNSRL
FT                   SFMMARAIAPTGAMFTFVALWTGALWGRPTWGAWWVWDARLTSELLLLFLYAGFMALQS
FT                   AIDDPRRGDRAGALLALVGVVNVPVIYFSVKWWNTLHQGASISLSSAPLMASSMLTGLL
FT                   LAALGAWVYALATVLKRLRCIVLERERHARWVAQLPEVSA"
FT   gene            complement(623530..624198)
FT                   /locus_tag="Pnap_0588"
FT   CDS_pept        complement(623530..624198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0588"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   nmu:Nmul_A1216 heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35908"
FT                   /db_xref="GOA:A1VJT0"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT0"
FT                   /protein_id="ABM35908.1"
FT                   /translation="MLKVLACVIQRDLLLAFRRRADLLATVFFFVIVVTLFPLGVGPEP
FT                   ALLRSMAPGIVWVAALLASLLSLGRLFALDFADGTLEQMALSAEPLVLIVLGKVLAHWL
FT                   VAGVPLVMLSPVLALQFGLPGAAIQVLCLGLLIGTPILSLLGAIGSALTLGVRGGGVLL
FT                   ALLVLPLYVPVLIFGAGAVQAQASGLDAAAHLLLLGGVLAGALALAPWATSAALRIALE
FT                   "
FT   gene            complement(624192..624836)
FT                   /locus_tag="Pnap_0589"
FT   CDS_pept        complement(624192..624836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0589"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: neu:NE0764 ABC superfamily (atp_bind), heme
FT                   exporter protein, cytochrome c-type biogenesis protein;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35909"
FT                   /db_xref="GOA:A1VJT1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT1"
FT                   /protein_id="ABM35909.1"
FT                   /translation="MVATGLRTHALACERGGRGLFRAVDIDVSAGEALWVQGRNGSGKT
FT                   SLLRLLCGLALPSAGTVHWLGRDVRGLREDFYRDLLYIGHAGGIKDDLTAAENLLLGAR
FT                   IAGQAVEEQQAQQALAQVGLGAVSRLPAARLSQGQRKRVALARLHLAHRPPLLVLDEPF
FT                   NTLDQAAADALHAALNQHLAQGGVVVYTTHQPLALQAARLHVLELGPAQPC"
FT   gene            complement(624830..625630)
FT                   /locus_tag="Pnap_0590"
FT   CDS_pept        complement(624830..625630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0590"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: dar:Daro_3282
FT                   cytochrome b561, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35910"
FT                   /db_xref="GOA:A1VJT2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT2"
FT                   /protein_id="ABM35910.1"
FT                   /translation="MKAQTILDNTPRHARAAPSASLPARVRIRLWDLPLRLFHWLLVLA
FT                   VTLALITGELGGPWMELHGKAGLGIVGLVVFRLVWGVIGSAHARFLSFLPTPSKLKAYL
FT                   GGRWRGVGHNPLGALSVIALLGLLAAQAGTGLFSNDDIAFSGPLFALVDEALAGRLTSL
FT                   HKQLATVLFGLLALHLAAIAFYAWFKHDNLVKPMVTGWKEVEPNQAPPAAHQNASGRKG
FT                   GAIAFALALAVAVAVVYGVSGAALPGSPAAAAEPATATQGQPGW"
FT   gene            complement(625646..626110)
FT                   /locus_tag="Pnap_0591"
FT   CDS_pept        complement(625646..626110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ttj:TTHA0836 rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35911"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT3"
FT                   /protein_id="ABM35911.1"
FT                   /translation="MAATLLSLSVCAAFAQQASPAASASGNTAAADVWKYKTKRLDRAG
FT                   VDALLAKPQKLVVIDVRRPDELTAKGSFPVYLNIQVNDVEKSLAYIPKDRAILTVSNRA
FT                   HRAGAVGDLLTSKGFKVAGAAGSQDYEDQGGTITRVTAPPPKPTTASAAP"
FT   sig_peptide     complement(626036..626110)
FT                   /locus_tag="Pnap_0591"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.616 at
FT                   residue 25"
FT   gene            626506..626691
FT                   /pseudo
FT                   /locus_tag="Pnap_0592"
FT   gene            complement(626748..627113)
FT                   /locus_tag="Pnap_0593"
FT   CDS_pept        complement(626748..627113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0593"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ccr:CC2592 ISCc1, transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35912"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT4"
FT                   /protein_id="ABM35912.1"
FT                   /translation="MQPQLGNPLRFVLTPGQRHDSKPVPELLDGLQAKAPLADKAYDSD
FT                   KIVQAAEKRGMQVIIPSRVNREKQRVLDKHRYKTRHLIENLFQRMKAFRRVATRFDKLD
FT                   IRSLGFVHIAGIMKWLH"
FT   gene            complement(627285..628640)
FT                   /locus_tag="Pnap_0594"
FT   CDS_pept        complement(627285..628640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0594"
FT                   /product="putative transposase"
FT                   /note="KEGG: bja:blr1916 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35913"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT5"
FT                   /protein_id="ABM35913.1"
FT                   /translation="MDTVIPVRTNWPEDFQEWLQPFLAVFTRSEQRCWAPLYLQGLLGP
FT                   GARKSVAPMAERVCPGQTQQLHHFVSSSTWSTAPLEQVLRKKADALVGGKDAVLIVDDT
FT                   ALPKQGKHSVGVKRQHCGVLGKQANCQVLVSLTLARKEVPVPIALRLYLPEDWAQDEAR
FT                   RAAAKVPESITFETKGDIALAQIDAALADGVRFGMVLADAGYGSSAGFRAGLTQRGLRW
FT                   AVGVQPTQKVYPADVRLDVPADPPVGRPAKHPRPSTPSVSVVQMIETLGSKALRRCSWR
FT                   SGTKGMLSARFAAVWVCVADGALVSHWQHLSGQAAWLVCEVRSSGERKYYFTNHPADTP
FT                   RRTLVRAIKARWACEQAHQQLKDELGLDHYEGRSWLGLHHHALLTMMAFGYLQHRRLDS
FT                   VLQAGKKTGIQCTGTATATIIASGTPGHSRRALSGNLRSVSSLRRHDKPASA"
FT   gene            628997..629239
FT                   /locus_tag="Pnap_0595"
FT   CDS_pept        628997..629239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0595"
FT                   /product="phage Tail Collar domain protein"
FT                   /note="PFAM: phage Tail Collar domain protein; KEGG:
FT                   mlo:mll4441 microcystin dependent protein MdpB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35914"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT6"
FT                   /protein_id="ABM35914.1"
FT                   /translation="MEPFLGQIQLLPYNFAPNGWAFCEGQLMAISQNTALFSLLGTTYG
FT                   GDGTTNFALPNLKGKEPDPNTHFCIALVGIYPSRS"
FT   gene            complement(629270..629572)
FT                   /locus_tag="Pnap_0596"
FT   CDS_pept        complement(629270..629572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0596"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35915"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT7"
FT                   /protein_id="ABM35915.1"
FT                   /translation="MISDDSFLCPLNSKSMCRRISPPTIPSNGVVRPSPASVARKFLRP
FT                   CFLQFSEEKSGFFLRAQGVSGSNRGSKKEAFCYVTNETEVLIDAMRSFPKAEVAQ"
FT   gene            629705..630034
FT                   /locus_tag="Pnap_0597"
FT   CDS_pept        629705..630034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0597"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu4334 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35916"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT8"
FT                   /protein_id="ABM35916.1"
FT                   /translation="MAMTTVGKFSLHNGGGFVARQMFTYLDDNGEKVASKSSGDVLLGQ
FT                   TQEFDPGDFGVPDGAMTWSYVFVVWGYDNEAKQAFMYKKGAPKTAAYTITGTTLSNTLG
FT                   LISSS"
FT   gene            630162..631676
FT                   /locus_tag="Pnap_0598"
FT   CDS_pept        630162..631676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0598"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   sco:SCO5857 FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35917"
FT                   /db_xref="GOA:A1VJT9"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJT9"
FT                   /protein_id="ABM35917.1"
FT                   /translation="MDMYNENENQWTNWAGSITTLPDTFCQPKSVRELQDIVIQNEGSI
FT                   IRCFGSGHSWTPLVVTNGGILIDPTGITENGQKAFRWQKNGLNLVTCFPSARWADVREA
FT                   LTTDGPLPKMYLPTAGVLPSINATGFVAAGCHGTGWEQPTVSDLIQAIEFVAADGKVHV
FT                   FSEDTTPNEMNTVRVSVGMLGVITKVTLKVDPMYRLWDQERLVPTAEVMGANPESRGGA
FT                   IDSSKLHALVTGNEYVELFWFPGSGFDGSIWVKQYNRTQDDPRDIPLRTDDDWVDSMAG
FT                   PVMQWSAQQPMVIPAVQALTWKTINDRVKVIESNKGFVADAPRVLHYQLKAFPILDLEV
FT                   AMPIPATGPNAWDFSNVVKAWWQAVNYTRVKWAAGKYPLTTCLHARFTKNSQALLSPAF
FT                   EPAHSETHYCWIEILSAYPKNDPNPNNRSAAMSEFDEMANRVVGEYWIKELKGRPHWSK
FT                   YWHKISPPVNIKSLLPQANLDTFNSLRRSLDPQDIFLNPFLRKQML"
FT   gene            complement(631708..632685)
FT                   /locus_tag="Pnap_0599"
FT   CDS_pept        complement(631708..632685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0599"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   bbr:BB0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35918"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU0"
FT                   /protein_id="ABM35918.1"
FT                   /translation="MRNLLNAPAIIAAALAFTFATAHAADAYPSKPIRMVVAFAAGGSA
FT                   DINARIVGQQLGKELGGTIVVDNKGGAGGNLGAVEVKRAAPDGYTFFYATSAVVLAPSL
FT                   YSKPGFDPYSDFTPVSLTATIPLVLVVNPNVPAKTVAELVAYGKANPNRLNYGSSGAGA
FT                   LLHLGGALFTKETGIQATHVAYKGSAPAVVDLLGGVTQFMFLPINEVMTHIKGGTLRAL
FT                   AVTNDKRSALLPDVPTLREATGKTTMDMGAWQGLMLPKGTPADVLGKVKAALENSLKDK
FT                   AMRDRLTAQGSIVLGGTQKEYADYMKQEGDRWARVIRDTGAKAD"
FT   sig_peptide     complement(632611..632685)
FT                   /locus_tag="Pnap_0599"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 25"
FT   gene            complement(632717..633355)
FT                   /locus_tag="Pnap_0600"
FT   CDS_pept        complement(632717..633355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0600"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   rso:RS03175 putative transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35919"
FT                   /db_xref="GOA:A1VJU1"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU1"
FT                   /protein_id="ABM35919.1"
FT                   /translation="MTTSEQITQLRDLGAATVYEAQGAKGALDSGMKPIDPTTRLAGPA
FT                   LTVDARPGDNLILHYAVQKARRGDVLVVDAKGFMEAGPWGDVLTLQAMKLGIAGLVING
FT                   CVRDANLIIGLGFPVFCRGLSIKGTGKNQPGKVNVPVMVGDVLINPGDIIVGDRDGLVV
FT                   VAQGEVATTISNSLAREEKEEKQRKAIDEGATTAELLNLTDTLTRFGLV"
FT   gene            complement(633394..634260)
FT                   /locus_tag="Pnap_0601"
FT   CDS_pept        complement(633394..634260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0601"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: nar:Saro_2815 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35920"
FT                   /db_xref="GOA:A1VJU2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU2"
FT                   /protein_id="ABM35920.1"
FT                   /translation="MHIAIIGLGEVGRCYAAPLQAAGFELSLCEARPSPAATALASSLG
FT                   LPIHDKPGPWLAGAQWVLSCVTGAVALEVVKGLAPLLARGAAIADLTTASPQAKRDAAL
FT                   AASGHDVGYVDTAIMGAISLNLVRTPLLASGKGAEEFKELIERAGGRVQVIAGGAAGDA
FT                   ISLKILRSVFTKGMEALCVELLMSAEKQGVREQLYEQLSDIDQTPLRSFIDMLVRTHVI
FT                   HAGRRAHEVHDAQSELASQGLASVVLPGVEQRFRITASALEKHPLALAEPSIDQALQWL
FT                   ASTADQA"
FT   gene            634463..635125
FT                   /locus_tag="Pnap_0602"
FT   CDS_pept        634463..635125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0602"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: nar:Saro_0179 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35921"
FT                   /db_xref="GOA:A1VJU3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU3"
FT                   /protein_id="ABM35921.1"
FT                   /translation="MQHARNTAYEVLRQRLVGGHYSPGSQLKEEPLARELGVSRTPVRT
FT                   ALKRLVEEGLATDAIGQGIHVAKWSEWDIEETFQLRMLLEPYASYLAATRGGDELVGRL
FT                   ESSNEEMAAAIKAGGDDAIARVQEANRSFHRALLDAAGSPRLRSMLDTIIDMPILVRSF
FT                   YLYTPAELEQSLHHHRDLTLAVAARDGELARQVMQLHLRMSYHRFMQHRSEYARSRR"
FT   gene            complement(635157..635624)
FT                   /locus_tag="Pnap_0603"
FT   CDS_pept        complement(635157..635624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0603"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein, MarR; KEGG: pol:Bpro_3119
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35922"
FT                   /db_xref="GOA:A1VJU4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU4"
FT                   /protein_id="ABM35922.1"
FT                   /translation="MPSSRKSAPPNPAVETVDTAFLESLIGYNARRASLAIVEVFMVRM
FT                   APYDLRIVDFSMLSLIAHNPGITSRQLCATLGILPPNLVGLIASLEKRELIERRPHPHD
FT                   RRAAGLHLSAQGVELARQAEQTAAMLETEAAARLTPSERKTLMRLLQKIYR"
FT   gene            complement(635771..636760)
FT                   /locus_tag="Pnap_0604"
FT   CDS_pept        complement(635771..636760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0604"
FT                   /product="Uncharacterized protein UPF0065"
FT                   /note="PFAM: Uncharacterized protein UPF0065; KEGG:
FT                   pol:Bpro_3116 twin-arginine translocation pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35923"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU5"
FT                   /protein_id="ABM35923.1"
FT                   /translation="MNHRRHFIQTLGSAAALAALSPLVARAQGLEQVKILYGFPPGSAG
FT                   DSVARRVGEKLAGSAYTKNAAVVENKPGAGGRIALETLKSAPADGSVLALAPVSGLSVY
FT                   PHIYSRLSYAPTDFAQVSIGAIMHHGLAVGPMVPAQVKTLKDFLAWAKANPAQASYGSP
FT                   GAGSMPHLLGALLGLRSGVDLKHVPYRGTVPGITDLVGGQIASTMNPSGDYLSYAKAGK
FT                   LRVLATSGPQRSPYSPNVPTFAEQGFGDLTVEEWFGFYAPAKTPAAVIASASAAINQAL
FT                   KEKVVLDSLAMVGLIAHGSTPEEMARSQKAEFERWGPLVKQTGFTAES"
FT   sig_peptide     complement(636677..636760)
FT                   /locus_tag="Pnap_0604"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 28"
FT   gene            complement(637033..637815)
FT                   /locus_tag="Pnap_0605"
FT   CDS_pept        complement(637033..637815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0605"
FT                   /product="vanillin synthase / trans-feruloyl-CoA hydratase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rfr:Rfer_0274 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35924"
FT                   /db_xref="GOA:A1VJU6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU6"
FT                   /protein_id="ABM35924.1"
FT                   /translation="MTHPDIQLDICGDEQEVAVVRLTRGAKRNALSDGLVLALRNIFEQ
FT                   LPATVRAAVIDGEGPHFCAGLDLSELKERDAGAGLHHSRMWHAALERVQYGPVPVVAAL
FT                   HGAVVGGGLELASACHIRVADETTFYALPEGSRGIFVGGGGAVRIPRLIGAARMTDMML
FT                   TGRVYNAQDGERIGLAQYLVPAGTAFDKALELAKRIAQNAPLTNYALVHALPRIAEQPA
FT                   DQGYMTEALMAAIAQSAPEAKQRVRAFLDGKAEKVSKD"
FT   gene            637966..638841
FT                   /locus_tag="Pnap_0606"
FT   CDS_pept        637966..638841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0606"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: rfr:Rfer_0275
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35925"
FT                   /db_xref="GOA:A1VJU7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU7"
FT                   /protein_id="ABM35925.1"
FT                   /translation="MDFDKLIAIDMHTHAEVSCWNPFDNYGEEYDRAADKYFHNSRRPT
FT                   IEETIAYYRERNIGLVMFTVDAETQMGRRRIPNEEIAEAAQKNSDMMMAFASIDPHKGK
FT                   MGAREAERLIKENGVRGFKFHPTVQGYHPYDKMAWPIYEVINAYKLPAIFHTGHSGIGS
FT                   GMRCGGGLRLEYSNPMHLDDVAIDFPDMQIVMAHPSFPWQDEALSVATHKPNVWIDLSG
FT                   WSPKYFPKQLVQYANTLLKDRILFGSDYPLITPDRWMKDFENAGFKPEVMPGILKGNAM
FT                   RLLGIGQTPA"
FT   gene            complement(638908..639954)
FT                   /locus_tag="Pnap_0607"
FT   CDS_pept        complement(638908..639954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0607"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bja:bll6212 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35926"
FT                   /db_xref="GOA:A1VJU8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU8"
FT                   /protein_id="ABM35926.1"
FT                   /translation="MMSRSMASLDGCISASSALMWEDAVHTGIGRMPAELRHQEVIHLL
FT                   PVGAQAFSGRIDYGDLAGTGLCRMTASPHRFQRALREGASLAASPLILVIQVKNSSYFE
FT                   QRERSGMLSPGDWCVLDTYRPFGWNSASGCEQIIMTIQRPADSGLGDLIARGAAQRCDG
FT                   KTGAARILQAMVSEVMGQIHHLAPYSAGSLASALTATAWNALQEQLEAPAPILLRDTQC
FT                   SRLKAWIETRLAEPDLSVDTIAQGCRMSARSVHRAFSSDPTGSVSSYLWQRRVVQCAAA
FT                   LKNPQEMHRSITDIALSWGFSSSSHFSRVFRSTLGVSPRSYRAGGQHADWLAAWSGVVP
FT                   EPDRPKAS"
FT   gene            640253..641245
FT                   /locus_tag="Pnap_0608"
FT   CDS_pept        640253..641245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0608"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC0352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35927"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJU9"
FT                   /protein_id="ABM35927.1"
FT                   /translation="MKSHLAPRSLARLAGTAFVTLLAGHAMGQSPAVSQPGGLNLGNTS
FT                   FYDGFSGPPGWTWLSTVLHSSANKIVDSNGNASPVFTDPKINSTVFVNQITYAMPASIG
FT                   GWRPALMAILPVVALDTSFGPGPSLKDGGTGAGDITLEASLQAEPVMNAGGAPVFVQRL
FT                   AAAAILPTGRYDQNVDINQGSGYASFNPYWAASFFPAPRWETSWRLHYLYNFKNNKPAS
FT                   SAPRPFNGQPVSTTQAGDAAWVNFATSYSVTPDVSVGINGYFFQQLSDSRANGTRLADS
FT                   RERVLGIGPGMMWRISPKKALWINAYTESMVRNRAASPLSLQARMVINF"
FT   sig_peptide     640253..640339
FT                   /locus_tag="Pnap_0608"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.841 at
FT                   residue 29"
FT   gene            641306..642568
FT                   /locus_tag="Pnap_0609"
FT   CDS_pept        641306..642568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0609"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfl:PFL_5958 major facilitator family transporter,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35928"
FT                   /db_xref="GOA:A1VJV0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJV0"
FT                   /protein_id="ABM35928.1"
FT                   /translation="MTNSSSLHTPPPDPAQSPPHELQTLGLMAFGFALVNLDRFIMYPL
FT                   FPVMARELGLDYQDIGLISAAVALTWGLSSMVFGRLSDRLGRRGILITSVLVFSILCGA
FT                   TGLAMGLGSLLLIRAVMGVFEGAFVPASIAAVVDSSPAGRVGRNTGLQQLMAPLVGSAL
FT                   APVLAIGLLQVLPSWRWVFVVTALPGLLCAWLIFRKLAEPGRSQPSPGQAPAIQAPLRT
FT                   VLACPNVALCSVGFCFWLAPIVIFGSLMPSYLSDHLHLELGQMGLVMSSLGVGGAAGML
FT                   VFPALSDRWGRKKMMVSCLVMAMLPTWLLMQTGAEPLRLSLLMFLAAAFISGVIAMVHS
FT                   VTADNVPAQHVSTATGFIIGAGEIVGGAIAPAVAGGLAKAMGIAAILPFSLGCMATGLL
FT                   LAIMLRSPRHSSIPQGAAMQN"
FT   gene            642669..644111
FT                   /locus_tag="Pnap_0610"
FT   CDS_pept        642669..644111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_0610"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="PFAM: aldehyde dehydrogenase; KEGG: bte:BTH_I0706
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABM35929"
FT                   /db_xref="GOA:A1VJV1"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJV1"
FT                   /protein_id="ABM35929.1"
FT                   /translation="MTTLHLHINSENIAAQDGRTFERRNPVTGQLVSTAAAASPQDALQ
FT