(data stored in ACNUC7421 zone)

EMBL: CP000530

ID   CP000530; SV 1; circular; genomic DNA; STD; PRO; 353291 BP.
XX
AC   CP000530; AANM01000000-AANM01000054;
XX
PR   Project:PRJNA13418;
XX
DT   05-JAN-2007 (Rel. 90, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Polaromonas naphthalenivorans CJ2 plasmid pPNAP01, complete sequence.
XX
KW   .
XX
OS   Polaromonas naphthalenivorans CJ2
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Polaromonas.
OG   Plasmid pPNAP01
XX
RN   [1]
RP   1-353291
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D.R., Brettin T., Bruce D., Han C., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Madsen E.L.,
RA   Richardson P.;
RT   "Complete sequence of plasmid pPNAP01 of Polaromonas naphthalenivorans
RT   CJ2";
RL   Unpublished.
XX
RN   [2]
RP   1-353291
RG   US DOE Joint Genome Institute
RA   Copeland A., Lucas S., Lapidus A., Barry K., Detter J.C.,
RA   Glavina del Rio T., Hammon N., Israni S., Dalin E., Tice H., Pitluck S.,
RA   Sims D.R., Brettin T., Bruce D., Han C., Tapia R., Brainard J., Schmutz J.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Kim E., Madsen E.L.,
RA   Richardson P.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c6026e9c36356fbbdbba7807ba9f48eb.
DR   BioSample; SAMN02598302.
DR   EnsemblGenomes-Gn; EBG00001019954.
DR   EnsemblGenomes-Gn; EBG00001019958.
DR   EnsemblGenomes-Gn; EBG00001019961.
DR   EnsemblGenomes-Tr; EBT00001622933.
DR   EnsemblGenomes-Tr; EBT00001622934.
DR   EnsemblGenomes-Tr; EBT00001622935.
DR   EuropePMC; PMC2789088; 19941653.
DR   EuropePMC; PMC6015842; 29967598.
DR   RFAM; RF02033; HEARO.
DR   StrainInfo; 376940; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4000361
CC   Source DNA and bacteria available from Eugene L. Madsen
CC   (elm3@cornell.edu)
CC   Contacts: Eugene L. Madsen (elm3@cornell.edu)
CC             Paul Richardson (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..353291
FT                   /organism="Polaromonas naphthalenivorans CJ2"
FT                   /plasmid="pPNAP01"
FT                   /strain="CJ2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:365044"
FT   gene            complement(<1..198)
FT                   /pseudo
FT                   /locus_tag="Pnap_4122"
FT   gene            complement(483..1040)
FT                   /locus_tag="Pnap_4123"
FT   CDS_pept        complement(483..1040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4123"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein; KEGG: rru:Rru_B0010
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4123"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39412"
FT                   /db_xref="GOA:A1VUT4"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT4"
FT                   /protein_id="ABM39412.1"
FT                   /translation="MLIGYARVSTLDQHLDLQMDALTQAGCHRLFDDKMSGSRAERPGL
FT                   AKALDMLREGDTLVVWKLDRLGRSVKRLVDLVGQLHRQGVHLKSLTDAIDTGTPSGRFF
FT                   FHVMTSLAEMERELTAERTRAGLEVARQLGRKGGRKRKMTDSKIASAKKLLASGVPPRD
FT                   VAKNLGVSVPTLYRWIPASSQA"
FT   gene            1218..1526
FT                   /locus_tag="Pnap_4124"
FT   CDS_pept        1218..1526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4124"
FT                   /product="transposase Tn3"
FT                   /note="KEGG: rme:Rmet_6179 transposase Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4124"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39413"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT5"
FT                   /protein_id="ABM39413.1"
FT                   /translation="MPRRSILSAAERDSLLALPATQDELIRHYTLSETDLSIIRLHRKP
FT                   ANRLGFAVQLCYMRHPGLAGANEWRCCINPRDGAPSPWPPIFRRSGRSSGVRAQSCG"
FT   gene            complement(1477..2436)
FT                   /locus_tag="Pnap_4125"
FT   CDS_pept        complement(1477..2436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4125"
FT                   /product="transposase, IS4 family protein"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bte:BTH_II0087 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4125"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39414"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT6"
FT                   /protein_id="ABM39414.1"
FT                   /translation="MPKDTLLPSQPKGVYRVKNWPEYNAGLIERGNVTVWMDERMFSPA
FT                   LQTPGQRGRPQAYCDAMIQMLLTLKSVYRLPLRALQGFTTSLQHLALPGLPVPNYSTLS
FT                   RRAKSLRVSLPVLRNAGEAVHLLVDSTGLKLFGEGEWKVRQHGYSKRRSWRKVHLALDA
FT                   KTAQVCAVLMTHRDVDDASVLPELLAQLPPQTQVEIVGGDGAYDTKVARAAIAGCAALA
FT                   LIPPVEGAVHWPASQAGAPERNAAIDHIAQSGKQDWKDKSGYHCRSLVENLMYRFKTLT
FT                   GDRLWARDVDVQDAEVAVRVGILNRMIVLARPNSVRIA"
FT   gene            complement(2737..3492)
FT                   /locus_tag="Pnap_4126"
FT   CDS_pept        complement(2737..3492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4126"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: serine/threonine
FT                   protein phosphatase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4126"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39415"
FT                   /db_xref="GOA:A1VUT7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT7"
FT                   /protein_id="ABM39415.1"
FT                   /translation="MNDKFKNIAIPRFSLNLVGRDFAVGDIHGCFRALQKGMDAIGFDP
FT                   AVDRLFSVGDLVDRGPESHQVLAWLDQPWFHAVCGNHDLMAWRRALGEPFQEVDHLFHG
FT                   GEWLDDLSSDELNRIGKRLAALPIALEVKTSAGIVGLMHADCPFDDWQHMHGIDLKGLA
FT                   KMGSTAGRCLWSADRHDYRYTGIVKNILAVVHGHRTISAMMKLGNVFFIDTGGWTRTGH
FT                   FTFLNLQTLKPLRGPGTEISAVIPSRRNR"
FT   gene            complement(3514..5871)
FT                   /locus_tag="Pnap_4127"
FT   CDS_pept        complement(3514..5871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4127"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39416"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT8"
FT                   /protein_id="ABM39416.1"
FT                   /translation="MTSLLYHSNGSDANSSPFDDAVLQVAQGSIIKIVSPYIGLRYLQR
FT                   IIEASIGWTLVSDIEAWLSFLSSSERARTLPFIHANLEKIHHCSAIHAKTVISPTLAYL
FT                   GSANLTITGILNRTEMGVLLEDPRLVTELNDWFDGVWTQTEPPDTAEITEFADWLDQQA
FT                   LTAAAGPPKKSLSSAGQRVAARLTNRPNLGVGPVAIITAKPVKQQQKVPAPVATFDIYD
FT                   PGVVISLVDTLVVKGFGFQAFVQAAHRQSVSVAQRDLYFALLLFCANHPRSIFAADTLN
FT                   RLLFINGVFVQSTPEQLKLQQKPYDEYLSSLILALAFDEARLLPSSAQLQKATGLREAR
FT                   QRLLISSLVESGLLQPRKDTGNSPVRYALKSDFIWSRRFQLFSKAYKNWTKCLSRSAAD
FT                   NTALRISAAKESDDAPAAVQPIESWPFVINKKIAVKPESPSHAMENDDAPVLAAARSVK
FT                   PDPANFAPPEPHSESLQSKAIRIIRPSDHTALIWAIEPIFSSEADRIDELYLHLAKILE
FT                   PSTGFFNFKSIKAFVMYVYAHYREDKEFIEQVLIGNINKTRLFYITIGLEKMNICCKVE
FT                   LNLDADMNEYPKTYKFMKKSAEVLKRNLLNKKNGLILLKYNRGFFARTVGYKALAQCDP
FT                   QRKSAAIKRENALRRTALAKEDEAKQKTLAERQAYLDDGTVKAIKEAYARLDRADQVFE
FT                   SLLFLVQLYGNQLPLETEIEVFKKISDRTNIRIKEVERIFKNETNPFTLSILKASGDDT
FT                   ETCCLIQLNHSYSGNLEVLPRTKKLLDMASLN"
FT   gene            complement(6104..7399)
FT                   /locus_tag="Pnap_4128"
FT   CDS_pept        complement(6104..7399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4128"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: pol:Bpro_1566
FT                   HipA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4128"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39417"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUT9"
FT                   /protein_id="ABM39417.1"
FT                   /translation="MKTPVWTWLPGSSEPTLAGTLAADAGRGQFQYHDAYMEMADARPL
FT                   DPMELRFTRRAAGIPILRNHGLPRVIIDAMPAGYGADRLNARHERNLSSLELLELGPPD
FT                   GVGAIEVCQDIERKLQWRPRLLSELIEHINDLEESAPSSRAIRRLLDDGMTSAGGERPK
FT                   VTLQHDGRLWLAKLQDRGDVPHLPAREFVVMQMAEELDIQVPRILLEQHEGREVFLVER
FT                   FDRCGDPVQPQRHLFASAHTVLGLEANTTPGDARRSYLVLAEQMRRWIADKAALQIDLQ
FT                   ELWRRMAYNALVGNGDDHPRNHGLIHEGRGWRLSKAFDITPLPTFIRVLALSVAPDGSQ
FT                   ECSVLNLLDACPHFGFDPREAATWLGDAAVHVASHWQQRLRDNGVPAGHIGQFALAFDL
FT                   ATELAEYPNQIDEAMDEIELQRRKGRRRQHPR"
FT   gene            7465..7740
FT                   /locus_tag="Pnap_4129"
FT   CDS_pept        7465..7740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4129"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39418"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU0"
FT                   /protein_id="ABM39418.1"
FT                   /translation="MVKLRQEIHGIEHARERSNGHPRATLFKRHDRVRAHARKEGQITL
FT                   IHRSGTACEGNALAKCDEFIAWKNGKWCSAHYPNRNLKFYFRLLFG"
FT   gene            8115..8825
FT                   /locus_tag="Pnap_4130"
FT   CDS_pept        8115..8825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4130"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39419"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU1"
FT                   /protein_id="ABM39419.1"
FT                   /translation="MHYQAQSRVRPDFNFLSFTVRTTEDATSGTQMKISFADTLCLKRE
FT                   AKKLGHKFPEKSYSHLRSLAAQQLFGVRSVHEFNRLRKQTVEQHLVLSDGMATCAFCGL
FT                   QFYPNVPEDSKTHQAKHDAFEEATTVLNYTPKFYAQREANKKHGYALLSDTDPETQVSG
FT                   ALEVLRSWFDRSLDAAIGESSYWKRHPKFEEYVGFMLGATPPFPAHVVASLEKQYGRID
FT                   GVIEKGHSYWYPPK"
FT   gene            complement(8942..9325)
FT                   /pseudo
FT                   /locus_tag="Pnap_4131"
FT   gene            9429..9764
FT                   /pseudo
FT                   /locus_tag="Pnap_4132"
FT   gene            complement(9783..10319)
FT                   /locus_tag="Pnap_4133"
FT   CDS_pept        complement(9783..10319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4133"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39420"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU2"
FT                   /protein_id="ABM39420.1"
FT                   /translation="MQLVTIEQLAKSVVASDGFNQQNTLAQIRHILEVALKSELAMSTL
FT                   ARLVALDLRNAHMITCSVQLASKANQPALSPWIAGVPPEDVDMAWLRLRSHDPDDEAEV
FT                   AVLGVLDLELGWMIAGDWKGESFTDQVLEAITHFIPYDVPSTRLPENAHIEKAAAFRMW
FT                   LKITSRDQPPAGTAR"
FT   gene            10764..11669
FT                   /locus_tag="Pnap_4134"
FT   CDS_pept        10764..11669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4134"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RS02232 hypothetical lipoprotein
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4134"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39421"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU3"
FT                   /protein_id="ABM39421.1"
FT                   /translation="MNYKFSSPLLIALIASACLAACGGGDLPPGSGSPAAIPAPASTVS
FT                   LTPSPELPPGQTAIDASSCFNPALYVEGASIAITTKATFGATDTVQIKTDTTMGGSVTY
FT                   LGIQVKQLTEVQTSMPDAPVSASGQITKTTVATRYLTADATAKNTRDYGFSSKSTPLDP
FT                   SVGATVVDTTYTPFMETRYALQFGRSFQQTFTDDSKITNPDGTKTSSAKSVVKTILYAG
FT                   IEDVKVAAGTFKACKFQESGTTSDLTTSTQSVIPMKTIWYGVKNGLILKSMMDTPVGKS
FT                   YRTDTVELQSASINGVVVKP"
FT   sig_peptide     10764..10835
FT                   /locus_tag="Pnap_4134"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.421 at
FT                   residue 24"
FT   gene            11757..12239
FT                   /locus_tag="Pnap_4135"
FT   CDS_pept        11757..12239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4135"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39422"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU4"
FT                   /protein_id="ABM39422.1"
FT                   /translation="MTIRKSDIRELNKLITHLITDYSILIAIENRDGCLIRIFDNPITL
FT                   TLILARSEALQFNSIHATVFRTREAFMAVRLAVNRLERRFRRVESEHMVEGDIKSVVNE
FT                   IDYALAVYADQLDKVNIRTDQKRWHSKAPRTSLVRTQLAHTGQKPIPVQWLNQCDR"
FT   gene            12451..12690
FT                   /locus_tag="Pnap_4136"
FT   CDS_pept        12451..12690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4136"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39423"
FT                   /db_xref="GOA:A1VUU5"
FT                   /db_xref="InterPro:IPR010718"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU5"
FT                   /protein_id="ABM39423.1"
FT                   /translation="MIAETKIVGVLSAYLFMGVNGYYFMKIDKKAAREDQLRISEAALI
FT                   AIGFMCGWLGFFISCCDQHRIWLIYAEARHSEFS"
FT   gene            12802..14004
FT                   /locus_tag="Pnap_4137"
FT   CDS_pept        12802..14004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4137"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bxe:Bxe_C1182 putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4137"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39424"
FT                   /db_xref="GOA:A1VUU6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU6"
FT                   /protein_id="ABM39424.1"
FT                   /translation="MAKIKLTKSAIDAAQPQAQPVELRDTLVPGFMCKVTPAGRKVFML
FT                   QYRTNAGERRKPAIGLYGELTVEQARSLAQTWLAEVRRGGDPGGDKAEARKAPTVKELC
FT                   GRFMSDYSKVRNKPSTQKGYQGNIDRNIIPILGRMKVQDVKRPDVATMMKKLESTPMEA
FT                   NHTLAVMRKMFNMAEIWGLRTDGTNPCRHIPQYPQGKTTRLITDEEMGKLFRHLDKVEA
FT                   ESSEPPIVTLAIRLQFEFAARRSEILLLEWTWVDLENRRVAWPDSKTGGMSKPMSEEAH
FT                   RLLSTVPRHEGSLYVLPSLRDPLKHMTNGEHYNGWSRILKAAGVQHVGTHGIRHRSATD
FT                   IANSGIPVKVGMVLTAHKTVAMFMRYIHTEDAPVRQAAELVANRRKTVVAGTIATPVDV
FT                   S"
FT   gene            14028..14369
FT                   /locus_tag="Pnap_4138"
FT   CDS_pept        14028..14369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4138"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   bxe:Bxe_C1183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4138"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39425"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU7"
FT                   /protein_id="ABM39425.1"
FT                   /translation="MAAYEIEHYLTLGEQKDFYIEWLKRLRDGQAKVAVARRVIRIEQG
FT                   NFGDHKFCRKGVWELRIDAGPGYRVYYALSGRRVVLLLCGGDKKTQDADIARAVDYWQD
FT                   WQRRTDDEK"
FT   gene            14356..14679
FT                   /locus_tag="Pnap_4139"
FT   CDS_pept        14356..14679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4139"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: bxe:Bxe_C1184 predicted transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4139"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39426"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU8"
FT                   /protein_id="ABM39426.1"
FT                   /translation="MMRSRPHDDAMAELYRNDPAFALEVVNGILEDGDQAELLIVLRQM
FT                   AEAFGGVQAVAEQAHLNPTQLYRTLSPKGNPALNSLRAILKAMGLRLAVQPLAAPAVPA
FT                   HAT"
FT   gene            complement(15183..15839)
FT                   /locus_tag="Pnap_4140"
FT   CDS_pept        complement(15183..15839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4140"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bxe:Bxe_C1185 outer
FT                   membrane protein (porin), OmpW family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4140"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39427"
FT                   /db_xref="GOA:A1VUU9"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUU9"
FT                   /protein_id="ABM39427.1"
FT                   /translation="MKIIASTLTCFAVATLSAGVHAQAFTNSPSPWSIGVGAVHLKFHP
FT                   SADVSFAGNPVPGGAVTVGSDTVLGVEIGYAVTPNWTARLDVGSPVETDFGGAGTLSPL
FT                   GKLGSVKGGPAILTMTYSPGMLGPIRPFFGGGLTYLRVFSTKDGAVQNLKVDDGLGTAL
FT                   TIGADWPLSDGYSIGFSVQKLFLKVKATGTAGGAPVRADVKLDPVVTFLSLRKQF"
FT   sig_peptide     complement(15771..15839)
FT                   /locus_tag="Pnap_4140"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 23"
FT   gene            complement(15986..16846)
FT                   /locus_tag="Pnap_4141"
FT   CDS_pept        complement(15986..16846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4141"
FT                   /product="alpha/beta hydrolase fold"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bxe:Bxe_C1186
FT                   2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BphD)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4141"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39428"
FT                   /db_xref="GOA:A1VUV0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR017727"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VUV0"
FT                   /protein_id="ABM39428.1"
FT                   /translation="MTALTESSTSKFVKINEKGFSDFQIHYNEAGNGETVIMLHGGGPG
FT                   AGGWSNYYRNIGAFVEAGYRVILKDSPGFNKSDAVVMDEQRGLVNARAVKGLMDALDID
FT                   RAHLVGNSMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFKLYAEP
FT                   SYETLKQMLQVFLYDQSLITEELLQGRWEAIQRNPEHLKNFLVSAQKAPLSTWDVSARL
FT                   GEIKAKTFITWGRDDRFVPLDHGLKLVWGINDARLHVFSKCGHWAQWEHADEFNRLVID
FT                   FLRHA"
FT   gene            complement(16917..17957)
FT                   /locus_tag="Pnap_4142"
FT   CDS_pept        complement(16917..17957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4142"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; DmpG
FT                   communication domain protein; KEGG: bxe:Bxe_C1187
FT                   4-hydroxy-2-oxovalerate aldolase (BphI)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4142"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39429"
FT                   /db_xref="GOA:A1VUV1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR012425"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017629"
FT                   /db_xref="InterPro:IPR035685"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VUV1"
FT                   /protein_id="ABM39429.1"
FT                   /translation="MNLQGKQVTVHDMTLRDGMHPKRHLMTLDQMKSIACGLDAAGVPL
FT                   IEVTHGDGLGGSSVNYGFPAHTDEEYLGAVIPLMKQAKVSALLIPGIGTVEHLLMAKDL
FT                   GVGTIRVATHCTEADVSEQHITKSRALGLDTVGFLMMAHMASPEKLVSQALLMQGYGAN
FT                   CIYVTDSAGYMLPDDVKARLGAVRAALKPETELGFHGHHNMAMGVANSIAAIEAGANRI
FT                   DAAAAGLGAGAGNTPMEVFIAVCARMGIETGVDVFKIQDVAEDLVVPIMDHIIRIDRDS
FT                   LTLGYAGVYSSFLLFAKRASVKYGVPARDILVELGRRGMVGGQEDMIEDTAMTMARERG
FT                   LTLAAA"
FT   gene            complement(17975..18889)
FT                   /locus_tag="Pnap_4143"
FT   CDS_pept        complement(17975..18889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4143"
FT                   /product="Semialdehyde dehydrogenase, NAD-binding"
FT                   /note="PFAM: Semialdehyde dehydrogenase, NAD - binding;
FT                   KEGG: bxe:Bxe_C1188 acetaldehyde dehydrogenase
FT                   (acetylating) (BphJ)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4143"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39430"
FT                   /db_xref="GOA:A1VUV2"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR003361"
FT                   /db_xref="InterPro:IPR015426"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VUV2"
FT                   /protein_id="ABM39430.1"
FT                   /translation="MTKKIKCALIGPGNIGTDLLAKLQRSAVLEPVWMVGIDPESDGLK
FT                   RAREMGIKTTADGVDGLIPHMQADGVQIVFDATSAYVHAENSRKVNAQGALMIDLTPAA
FT                   IGPFCVPPVNLIEHVGKGEMNVNMVTCGGQATIPMVAAVSRVQPVAYGEIIATVSSKSA
FT                   GPGTRKNIDEFTRTTASAVEKVGGAKKGKAIIILNPAEPPLIMRDTVHCLLESEPDQAK
FT                   ITESIHAMIQEVQKYVPGYKLVNGPVFDGKRVSVFLEVEGLGDYLPKYAGNLDIMTAAA
FT                   ARTAEMFAEEILAGRLTLKPVHA"
FT   gene            complement(18910..19692)
FT                   /locus_tag="Pnap_4144"
FT   CDS_pept        complement(18910..19692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4144"
FT                   /product="4-oxalocrotonate decarboxylase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: Hydratase/decarboxylase; KEGG: bxe:Bxe_C1189
FT                   2-hydroxypenta-2,4-dienoate hydratase (BphH)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4144"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39431"
FT                   /db_xref="GOA:A1VUV3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR017632"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV3"
FT                   /protein_id="ABM39431.1"
FT                   /translation="MTPELIETLGDELYHAMTTQTVVEPLTTRHPDITIEHAYHIQQRM
FT                   ISRRLQAGERIVGKKIGVTSAAVMNMLGVYQPDFGYMLDGMIVSDGGSIAMSSLIQPKA
FT                   EGEIAFVLKKDLMGPGVTNADVLAATDFVMPCFEIVDSRIRDWKIKIQDTIADNASCGM
FT                   FVLGSTAMDPRKLDLMTCGMVLEKNGEIIATGAGAAALGSPVNAVAWLANTLGRLGIGL
FT                   KAGEVILSGALAAMFPAKAGDHFRVTIGGIGGCSVRFH"
FT   gene            complement(19780..20391)
FT                   /locus_tag="Pnap_4145"
FT   CDS_pept        complement(19780..20391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4145"
FT                   /product="Glutathione S-transferase, C-terminal domain"
FT                   /note="PFAM: Glutathione S-transferase, N-terminal domain;
FT                   Glutathione S-transferase, C-terminal domain; KEGG:
FT                   bxe:Bxe_C1190 glutathione S-transferase (BphK)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4145"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39432"
FT                   /db_xref="GOA:A1VUV4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV4"
FT                   /protein_id="ABM39432.1"
FT                   /translation="MKLYYSPGACSLSPHIALREAGLNFELVQVDLASKKTASGQNYLE
FT                   INPAGYVPCLQLDDGRTLTEGPAILQYVADQVPGKLLAPANGSFERYHLQQWLNFISTE
FT                   LHKNFSPLFNPAASEDWRNAVRQAIAARLGVVATRFEDAPYLLGDSLSVADIYLFVVLS
FT                   WGAYVNLDLSPWPALQAFMGRVGGREAVQAALRAEGLVKD"
FT   gene            complement(20423..21301)
FT                   /locus_tag="Pnap_4146"
FT   CDS_pept        complement(20423..21301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4146"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_C1191
FT                   2,3-dihydroxybiphenyl-1,2-dioxygenase (BphC)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4146"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39433"
FT                   /db_xref="GOA:A1VUV5"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017626"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV5"
FT                   /protein_id="ABM39433.1"
FT                   /translation="MSVKSLGYMGFAVKDVSAWRSFLTQKLGLMDAGVTDDGALFRIDS
FT                   RAWRIAVQQGEADDLAYAGYEVADAAGLTQMTEKLRQAGIEVVTGDVELAKRRGVMGLI
FT                   SFADPFGLPLEIYYGASEVFEKPFMPGAAVSGFLTGEQGLGHFVRCVPDSEKALAFYTQ
FT                   VLGFQLSDVIDMKMGPDVTVPAYFLHCNERHHTLAIAAFPLPKRIHHFMLEVSSLNDVG
FT                   FAFDRLDADGLITSTLGCHTNDHMVSFYAATPSGVEVEYGWAARTIDRSWVVARHDSPS
FT                   MWGHKSVRNKA"
FT   gene            complement(21312..22142)
FT                   /locus_tag="Pnap_4147"
FT   CDS_pept        complement(21312..22142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4147"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase; KR; KEGG:
FT                   bxe:Bxe_C1192 cis-2,3-dihydrobiphenyl-2,3-diol
FT                   dehydrogenase (BphB)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4147"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39434"
FT                   /db_xref="GOA:A1VUV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR017711"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV6"
FT                   /protein_id="ABM39434.1"
FT                   /translation="MKLTGEVVLITGGASGLGRALVDRFVAEGARVAVLDKSAERLQQM
FT                   ESDHGDKVVGIVGDVRSLQDQKQAADRCVAKFGKIDTLIPNAGIWDYSTALVDLPEDRI
FT                   DAAFDEVFHINVKGYIHAVKACLPALVASRGSVIFTLSNAGFYSNGGGPLYTAAKHAVV
FT                   GLVRELAFELAPYVRVNGVAPGGMSTDLRGPSSLGMSGQAISTVPLADMLESVLPIGRM
FT                   PDTEEYTGAYVFFATRGDTVPATGALLNYDGGMGVRGFFSAAGGKDLLEKLNIK"
FT   gene            complement(22185..23411)
FT                   /locus_tag="Pnap_4148"
FT   CDS_pept        complement(22185..23411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4148"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bxe:Bxe_C1193 biphenyl
FT                   2,3-dioxygenase ferredoxin reductase subunit (BphA4)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4148"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39435"
FT                   /db_xref="GOA:A1VUV7"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV7"
FT                   /protein_id="ABM39435.1"
FT                   /translation="MIESIVIIGAGLTGAMAARALRAQGYAGRLHLIGDESQQAYDRTT
FT                   LSKQVLTGEQAEPPAIMDASWYASANVEVQLGRRVSGLDVASRQVRFESGAPLAYDRLL
FT                   LATGARARRVAIPGCDLAGIHILRDRADSLALRQALQPGQSLVIVGGGLIGCEVATTAR
FT                   KAGVTVTLLEAGDELLLRVLGRRTGAWCRAELERLGVQIERNAQASRFEGEGHVRAVIC
FT                   ADGRRVAADGVLVSIGADPADELARAAGIACARGVLVDATGASSCPDVFAAGDVAAWPL
FT                   RGGGQRSLETYLNSQAQADTAAAAMLGKPVPTLQVPTSWTEIAGHRIQMIGDAEGPGEI
FT                   VPRGDAQNGQPLVLFRLLDGRVEAATAINAAKEFSVATRLVGARVPVSAGQLQDAGLNL
FT                   RDLLKAKPQ"
FT   sig_peptide     complement(23340..23411)
FT                   /locus_tag="Pnap_4148"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.816 at
FT                   residue 24"
FT   gene            complement(23408..23737)
FT                   /locus_tag="Pnap_4149"
FT   CDS_pept        complement(23408..23737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4149"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bxe:Bxe_C1194 biphenyl 2,3-dioxygenase ferredoxin subunit
FT                   (BphA3)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4149"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39436"
FT                   /db_xref="GOA:A1VUV8"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV8"
FT                   /protein_id="ABM39436.1"
FT                   /translation="MEFTRVCSLSEVPQGEALKVESGDTAVAIFNVEGELFATQDRCTH
FT                   GEWSLAEGGYLDGDVVECSLHMGKFCVRTGKVKSPPPCVPLKIFPIRIEGNDVFVDFNA
FT                   GHLAP"
FT   gene            complement(23849..24256)
FT                   /locus_tag="Pnap_4150"
FT   CDS_pept        complement(23849..24256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4150"
FT                   /product="conserved hypothetical membrane protein, biphenyl
FT                   pathway"
FT                   /note="KEGG: bxe:Bxe_C1195 hypothetical membrane protein,
FT                   biphenyl pathway"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4150"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39437"
FT                   /db_xref="GOA:A1VUV9"
FT                   /db_xref="InterPro:IPR009310"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUV9"
FT                   /protein_id="ABM39437.1"
FT                   /translation="MRQARTFLLAVGVFYLLNLVGTLPFRALGLFDMMYPGVEMDVGLP
FT                   MFKLLQDAWFVVGLQLGAIGVVALWGARDPQRYLALVPLVIATEVVTALWDFYSMAWGR
FT                   MALGFWLALLVVHAAWIVWGLRVWRAARLER"
FT   gene            complement(24295..24861)
FT                   /locus_tag="Pnap_4151"
FT   CDS_pept        complement(24295..24861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4151"
FT                   /product="Benzene 1,2-dioxygenase"
FT                   /EC_number="1.14.12.3"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase, beta
FT                   subunit; KEGG: bxe:Bxe_C1196 biphenyl 2,3-dioxygenase small
FT                   subunit (BphA2)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4151"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39438"
FT                   /db_xref="GOA:A1VUW0"
FT                   /db_xref="InterPro:IPR000391"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW0"
FT                   /protein_id="ABM39438.1"
FT                   /translation="MTTPSTNLFKAFEWPSKAVGLELQNEIEQFYYREAQLLDHRAYEA
FT                   WFALLEKDIRYFMPLRTNRRLQESELEYSGDQDFAHFDETHETMYGRIRKVTSELGWAE
FT                   NPPSRTRHLVSNVMVREAAEPNTFEVSSAFILYRNRLERQVDIFAGERRDVLRRADNGL
FT                   GFKIAKRTILLDQSTLLANNLSMFF"
FT   gene            complement(24982..26352)
FT                   /locus_tag="Pnap_4152"
FT   CDS_pept        complement(24982..26352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4152"
FT                   /product="ring hydroxylating dioxygenase, alpha subunit"
FT                   /note="PFAM: ring hydroxylating dioxygenase, alpha subunit;
FT                   Rieske [2Fe-2S] domain protein; KEGG: bxe:Bxe_C1197
FT                   biphenyl 2,3-dioxygenase alpha subunit (BphA1)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4152"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39439"
FT                   /db_xref="GOA:A1VUW1"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR015881"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW1"
FT                   /protein_id="ABM39439.1"
FT                   /translation="MSSTIKEVQESTVKWTRNWTPEAIRALVDQEKGLLDPRIYADQSL
FT                   YELELERVFGRSWLLLGHESHIPKTGDFLTTYMGEDPVVMVRQKDRSIKVFLNQCRHRG
FT                   MRICRSDAGNAKAFTCSYHGWAYDIAGNLVNVPFEQEAFCDKKEGDCGFDKADWGPLQA
FT                   RVATYKGLVFANWDAEAPDLETYLGDARPYMDVMLDRTPAGTEAIGGMQKWVVPCNWKY
FT                   AAEQFCSDMYHAGTMSHLSGILAGMPPEMDLSNAQVPTKGNQFRAHWGGHGSGWFVDEP
FT                   GMLMAVMGPKVTQYWTEGPAAELAEKRLALPVRRMFGQHMNIFPTCSFLPAINTIRSWH
FT                   PRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRTFSAGGVFEQDDGENWVEIQKVLRGH
FT                   KAKSQPLNAQMGLGRSQTGHPDFPGKIGYVYAEEAARGMYHHWARMMSEPSWATLKP"
FT   gene            complement(26444..27178)
FT                   /locus_tag="Pnap_4153"
FT   CDS_pept        complement(26444..27178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4153"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR, HTH; GntR domain
FT                   protein; KEGG: bxe:Bxe_C1198 transcriptional regulator
FT                   BphR, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4153"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39440"
FT                   /db_xref="GOA:A1VUW2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW2"
FT                   /protein_id="ABM39440.1"
FT                   /translation="MSTRTSNRLTMGGDKSFADAPVPRANARSLIESACQRLRADIVEG
FT                   QLAAGARLGIEDLKSRYGVSGGTVREALSLLVAEGLVQTQAQRGFHVTPMSLGDMRDLA
FT                   TTRIALECEALRQSILNGDAEWETRVVSSFHRLSLIEERTMRDPVHLFNEWERDNRDFH
FT                   EALISACPSCWTRRFLSILYLQMERYRRLTSVHNPPARNVHEEHQALRDSALARDAERC
FT                   TALLRAHIESSISVVQQFGLLR"
FT   gene            complement(27260..27766)
FT                   /locus_tag="Pnap_4154"
FT   CDS_pept        complement(27260..27766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_2657 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4154"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39441"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW3"
FT                   /protein_id="ABM39441.1"
FT                   /translation="MDQEVSDLWPHVGADQERIRASLATNQLSYQTNGFITLAGSSPAA
FT                   KTLADYFKARDFASIEAEFGRAISQIDRDPHAAITASSAIIEALCKTYIEINRLEMPAK
FT                   QTIGPLWKVVQQHLGLNVDHTLQDDQKRILQGLASIVDGVGAYRTHIGSAPIAKMSIVD
FT                   YNIDI"
FT   gene            complement(27988..28539)
FT                   /locus_tag="Pnap_4155"
FT   CDS_pept        complement(27988..28539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4155"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39442"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW4"
FT                   /protein_id="ABM39442.1"
FT                   /translation="MPPSFLSSSPAKDRASEGLAVKEASAGLVRPTASGEDSALRALTA
FT                   RHRWLRSREKAMNLGKDEQRPMGQGCAETNAARQAPLRAKGTPSWMSVGRSGVACSAVF
FT                   EGRQTECGGDGLSSRSPGGKAQRAGRERRDGRRHQGSKPDGHDSTRGMGQRPRARRRNA
FT                   EMPGLRETGGISSQSRGSTP"
FT   gene            28650..29477
FT                   /locus_tag="Pnap_4156"
FT   CDS_pept        28650..29477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4156"
FT                   /product="protein of unknown function DUF932"
FT                   /note="PFAM: protein of unknown function DUF932; KEGG:
FT                   rme:Rmet_1477 protein of unknown function DUF932"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4156"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39443"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW5"
FT                   /protein_id="ABM39443.1"
FT                   /translation="MQLSSRFASRSPVLRADHPLSDDQIRTVAPSIFAEDKHASRSDRY
FT                   RYIATGAVLSELRKEGFQPFMVCQTRVRDEGKREHTKHMVRLRHADQINGAEANEIILL
FT                   NSHDGTSSYQMMAGLLRFVCKNGLVCGDVVADVRIPHKGDVIGHVIEGAYDVLDGFDLV
FT                   RERRDEMRAITLDRGEAEVFAHAALSLKYDDPTAPAPITESQLLMPRRRDDDRPDLWSA
FT                   YNRVQENLTQGGLHGRTATGRKHSTRPIQGIDQNVKINRALWMLAEGMKRLKA"
FT   gene            30595..31101
FT                   /locus_tag="Pnap_4157"
FT   CDS_pept        30595..31101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4157"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: rso:RSc2620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4157"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39444"
FT                   /db_xref="GOA:A1VUW6"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW6"
FT                   /protein_id="ABM39444.1"
FT                   /translation="MSQLSLSLDSSLLVRDVAGDYRPANADEVLQAAQRLLGAQLRGRE
FT                   VLTSPQAVRDFLRVKLGGLEHEVFAVLMLDAQNRLIEYVELFRGTVSQASVYPREVVKE
FT                   SLALNAAAVIFCHNHPSGVAEPSRADEVLTQTLKTALSLVDVRVLDHLIVAGNEIMSFA
FT                   ERGLL"
FT   gene            complement(31145..31528)
FT                   /pseudo
FT                   /locus_tag="Pnap_4158"
FT   gene            31719..33758
FT                   /locus_tag="Pnap_4159"
FT   CDS_pept        31719..33758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4159"
FT                   /product="ParB domain protein nuclease"
FT                   /note="PFAM: ParB domain protein nuclease; KEGG:
FT                   rme:Rmet_1478 ParB-like nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4159"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39445"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW7"
FT                   /protein_id="ABM39445.1"
FT                   /translation="MNTVTHQEVQALEAAAPSQNMLLVPLSQLRPSKRNVRKTLGASIT
FT                   ELATSVERVGLLQNLTVTLASDGEHYEVVAGGRRLAALKLLAKKRRIAKDYAVPCLLVA
FT                   DASARTASLTENVQREAMHPADQFEAFADLIAEGRPIEDIAADFGVTPLVVQRRLKLAN
FT                   VSPRLMADYRADTVNLDQLMALAITDDHAAQEAAFYDAPNWQRNPTALRERLTEREIDA
FT                   HRHPLVRFVGLEAYEAAGGGIRRDLFADADQGIYLTDAALIDRLAQDKLAGIADEVRRE
FT                   GWAWVEAVPAATYADLQAFQRAPKERRKPNAREAKRIAKLQAKVLEVGEALDAALEAED
FT                   EEKAEALQEEGERLGEQLEALEAELLAYGSTVRAAAGAIVTLDRQGEPVIHRGLLRDAE
FT                   AKALRTLARVQGGIDSEDTEDEDSPEPKKAGISEKLARRLSAHRTAALQIELARNPQAS
FT                   LAALVHGMVQRVLQDAHAVELPIGISIRPQDRLEGYAPDWPQSPAAVALRELQQACGEK
FT                   LPEDDAELFAVLLALSQDELVRLLAVCVASTVDVVSSREHDASGKVLAQAVGLDMAAWW
FT                   KPTAEGYFSHVSKAVILEAVQQFAPGNVSRLAKLKKADIASEAERLAEGTGWMPAMFKS
FT                   EDSTSAAQDDAQQESSQNATNDTPEEAAQEAVIEMEAVAEALAA"
FT   gene            complement(34188..34449)
FT                   /pseudo
FT                   /locus_tag="Pnap_4160"
FT   gene            34523..34831
FT                   /locus_tag="Pnap_4161"
FT   CDS_pept        34523..34831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4161"
FT                   /product="protein of unknown function DUF736"
FT                   /note="PFAM: protein of unknown function DUF736; KEGG:
FT                   rso:RSc2613 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4161"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39446"
FT                   /db_xref="InterPro:IPR007948"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW8"
FT                   /protein_id="ABM39446.1"
FT                   /translation="MANIGTFTADKDGFTGTLRTLTLNVKVKFIQNDKTSENAPDYRIQ
FT                   AANGLEVGAAWKKISQAERPYLSASLDDPSFPATVYARLIEGEDGTHNLIWSRSKGD"
FT   gene            complement(34878..35174)
FT                   /locus_tag="Pnap_4162"
FT   CDS_pept        complement(34878..35174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4162"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   xac:XAC2176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4162"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39447"
FT                   /db_xref="GOA:A1VUW9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUW9"
FT                   /protein_id="ABM39447.1"
FT                   /translation="MQKRSIQRGRPAGATTFEAEPAQAFGAAVRALRTEQGVAQETLAH
FT                   LAGIERSHMGKIERGEHMPTLAIILKIARALGCSSADLMTATESRLTASEPEH"
FT   gene            35617..35967
FT                   /locus_tag="Pnap_4163"
FT   CDS_pept        35617..35967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4163"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: rso:RSc2609 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4163"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39448"
FT                   /db_xref="InterPro:IPR021341"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX0"
FT                   /protein_id="ABM39448.1"
FT                   /translation="MTQSLITDEQRAQLLANSRASAEGQDIDPTPVVKLFTPDAHATWL
FT                   LTELDPEDGDTAFGLCDVGIGMPELGNVRISELASIVGPLKLPIERDLYFVAQRTLSDY
FT                   ARLARINGSIID"
FT   gene            36329..37126
FT                   /locus_tag="Pnap_4164"
FT   CDS_pept        36329..37126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: zmo:ZMO1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4164"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39449"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX1"
FT                   /protein_id="ABM39449.1"
FT                   /translation="MAELSSDHWRPSAAYLYVLHLDGPALAWEYLRRDLDYRRDWLRRQ
FT                   RHPEVAQRWGLRLLEDPGQDARDAHPAWFPDHDTVVQLYPDADPPPNAGLFEFWRIPGH
FT                   KQLIHDGRRLVLIVRQPGCCLRMALAPALEDGMAYVYAIRACQAPCVRYRALAGELNKL
FT                   QEASNTTPAGVVKPRPSPSSLLELHTLQALDGTLAGASLRTVADVLFGPDAVAEGWHAD
FT                   GDLRARVRRLVQRGKKLMRGGYRRLAQLPPLEQGRFASDAKRP"
FT   gene            37211..37513
FT                   /locus_tag="Pnap_4165"
FT   CDS_pept        37211..37513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: zmo:ZMO1937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4165"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39450"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX2"
FT                   /protein_id="ABM39450.1"
FT                   /translation="MRPVPLRPAAAPAATQQPAQPVRYLTNDEAAEFLRLSPRTLEKQR
FT                   VIGGGPRFRKFGRRVMYAVADLETWADARSFEATSDPEYAERHSGDSRDGQHGRR"
FT   gene            37549..38400
FT                   /locus_tag="Pnap_4166"
FT   CDS_pept        37549..38400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4166"
FT                   /product="conserved hypothetical replication initiator and
FT                   transcription repressor protein"
FT                   /note="KEGG: rso:RSc2606 hypothetical replication initiator
FT                   and transcription repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4166"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39451"
FT                   /db_xref="InterPro:IPR018777"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX3"
FT                   /protein_id="ABM39451.1"
FT                   /translation="MSSPSLLPAQTMQQHEQLDLFRALPGDMAPRDAQDLMAYPFFSLA
FT                   KSRRIAPIDFRSGGVTVRVEGTAEHGIATIWDADILIWAASQIVEARDAGIRSSRRMQA
FT                   TPYEILRFIGRGTSLHDYQRLKAALDRLQSTSVATSIRETTGRRLHRFSWINEWKERAD
FT                   SKGVPLGLELILPDWFYAGVLDEALVLTIDPAYFKLTGGIERWLYRLVRKHGGKQPGGW
FT                   QFDFPHLHRKSGSSARFSDFAYDLRALVARQSLPGYTLSIERLPGEPEILAFRPVPQTA
FT                   RG"
FT   gene            38651..39289
FT                   /locus_tag="Pnap_4167"
FT   CDS_pept        38651..39289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4167"
FT                   /product="Cobyrinic acid a,c-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid a,c-diamide synthase; KEGG:
FT                   rme:Rmet_1486 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4167"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39452"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX4"
FT                   /protein_id="ABM39452.1"
FT                   /translation="MIIALLNQKGGVGKTTLATHIAGELAMQGKQVILLDADPQGSSLD
FT                   WTQRRSQQGLPRLFSAVGLARETLHQEAPELARRCDHIVIDGPPRIAALARSALLAADC
FT                   VLIPVQPSPYDVWASAEMVALIREAQVFRPTLRAAFVINRRVSTTVIGREARNSLADQP
FT                   LPALRAEIRQRIVFADSVAAGRLARELVPDSAAAREITALVDELLRWSP"
FT   gene            39286..39528
FT                   /locus_tag="Pnap_4168"
FT   CDS_pept        39286..39528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4168"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_3022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4168"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39453"
FT                   /db_xref="GOA:A1VUX5"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX5"
FT                   /protein_id="ABM39453.1"
FT                   /translation="MTSKRIAIGARPPANPQAEAWIRQGEGADINKGDLYTARLTLDVT
FT                   PALRARIKVSAFTQGTTVAELLRALLEHEFPEKTP"
FT   gene            39525..40070
FT                   /locus_tag="Pnap_4169"
FT   CDS_pept        39525..40070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4169"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4169"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39454"
FT                   /db_xref="InterPro:IPR021263"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX6"
FT                   /protein_id="ABM39454.1"
FT                   /translation="MNTNTQVQPTTSAAAPPPSLPALTGQVGNVPLTRVALAYVDKRIN
FT                   LYLRFGNPARTIQLDRWRRSAVFLPAFIFCRIRWESNDYGTTRWQLMVMQACTPLDAVQ
FT                   RIPGIHPGARILLHAEGERQVQAVLPLIDAIEALGIAPIDVSPAYWRTLGNRLSAHLAL
FT                   PQYTAERHAAWLAGKELQ"
FT   gene            40067..40618
FT                   /locus_tag="Pnap_4170"
FT   CDS_pept        40067..40618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4170"
FT                   /product="putative conjugal transfer TRAF transmembrane
FT                   protein"
FT                   /note="KEGG: rme:Rmet_1488 putative conjugal transfer TRAF
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4170"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39455"
FT                   /db_xref="GOA:A1VUX7"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX7"
FT                   /protein_id="ABM39455.1"
FT                   /translation="MTAKPRSRLCAHLVLAVLSTCGLAAMAWASFAMPSAHVVYNPSNS
FT                   VPVGWYRIESVTSPADSLHVGSIVLARLPAEAAALAAQRGYLPPHIPLLKRIGAVAPQD
FT                   VCIVNGVVRIDGVPVAAVLRTDRMGRPLLSWQQCRALAEGELFLLSVTNPASFDSRYFG
FT                   PIAASAVIGTAQSVYLEKQP"
FT   sig_peptide     40067..40165
FT                   /locus_tag="Pnap_4170"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.684 at
FT                   residue 33"
FT   gene            41133..43094
FT                   /locus_tag="Pnap_4171"
FT   CDS_pept        41133..43094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4171"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39456"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX8"
FT                   /protein_id="ABM39456.1"
FT                   /translation="MSRRGNSDGEDRFSIRPGAPKQRGQAFVSQVLRQASKGANSTGRK
FT                   PGKTPGSRLGRGHVAARFTGQSLSATSRRATVKVRLVYLKQAGARSTITHLRYIEREGV
FT                   GREQDAGKAYGPMTDEADLPAFEERGREVRHQFRLIVSPEDAEQLDDLRTYTRHLMGRM
FT                   EADLGSRLDWVAVNHWNTDNPHTHIVLHGKDDTGKDLIISQAYITRGMRERAAELSTEW
FT                   LGPRIELEIQRTLVREVDQERWTSLDRTLQREAKDGLNHVDQPASDPNLRQQRVLLVGR
FT                   LQRLQRMGLASEQQPGVWVVHADAEPVLRAMGERGDIIRTMQRAMGGAQRDLAVFQPGQ
FT                   DSRSVIGRVAGKGLADELYDKGYLVVDGIDGKAHYVALPAKMELAQYPVGTIVEARGSV
FT                   EFRAADKNIVALAVDGLYRTDHHLAVAKAQATSGRDPHEVIDAHVRRLEALRRAGIVER
FT                   IAEGVWRVPVELPEQGRQYDMQRLGGVSVELRSHLPIERQAFVIGATWLDQQLIGGASG
FT                   IADNGFGGEVRNALRQRANFLIDQGLAERRGQRLILARNLLATLRGREVEAAGGRIAAE
FT                   TGLAHRPVADGERITGVYRRSVQLASGRFAMLDDGIGFSLVPWKPVIEQRLGQTLTAVV
FT                   RGGGVSWEFGRQRGPSIG"
FT   gene            43455..44072
FT                   /locus_tag="Pnap_4172"
FT   CDS_pept        43455..44072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4172"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: pol:Bpro_5551
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4172"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39457"
FT                   /db_xref="GOA:A1VUX9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUX9"
FT                   /protein_id="ABM39457.1"
FT                   /translation="MAEKAPKKKKMREEVLERSVPLFATVGFDGVSMRDIAAAVGVTPA
FT                   ALYHHFSDKEQLYLDAVGYAFEEKVGPLKTLLDGGGNPWERIEAFITRLANLLAAERDF
FT                   LRLMQWVLLDSDERRQRSLVDCVFRDLFNALRDFAAELAPGHDAHRLAVSIIGLVLYPF
FT                   ETQSVRRFLPGYTHQQEDPEAIARHIVGLLRNGLGGINEENP"
FT   gene            44142..44729
FT                   /locus_tag="Pnap_4173"
FT   CDS_pept        44142..44729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4173"
FT                   /product="Late embryogenesis abundant protein"
FT                   /note="PFAM: Late embryogenesis abundant protein; KEGG:
FT                   pol:Bpro_5552 late embryogenesis abundant protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4173"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39458"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY0"
FT                   /protein_id="ABM39458.1"
FT                   /translation="MKLQKWLVLSVLVIGASAQAAEDPAAKPVEPAKVSVLQKAEEGAK
FT                   KAAEEAKEATRKAAEAAKLAVDKAEQAVSEASQKTAEAARQAARDADEAAKLAVRKTAE
FT                   ATRKATAATKEAAQKAEEAAKKAAVATKEAAQKAEEAAKKAAKSGKEAAQKAAEATRDA
FT                   AQKTTEATREAADKALEATKETARNVKDAVTK"
FT   sig_peptide     44142..44204
FT                   /locus_tag="Pnap_4173"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 21"
FT   gene            44817..45263
FT                   /locus_tag="Pnap_4174"
FT   CDS_pept        44817..45263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4174"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39459"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY1"
FT                   /protein_id="ABM39459.1"
FT                   /translation="MSKSNTPSSTTKDKLIADIKQIVADADALLQATTDQASEKVADLR
FT                   IGLRKNLKTAQGRLAEFEATAVDKTTEAIREALQKISEAANQATVATMEAAQKAEEAAK
FT                   KVAGSGKDAAQHAAEAARDAAQKAVAATREAANKALDAMQDWMR"
FT   gene            45476..46177
FT                   /locus_tag="Pnap_4175"
FT   CDS_pept        45476..46177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4175"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4175"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39460"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY2"
FT                   /protein_id="ABM39460.1"
FT                   /translation="MQNETGNNIGGSNDAVMLEAEVRSAVEQGHDVQEMVRQLTLRKIS
FT                   ARSLDIESLRQIARAVLSGARAGAQKELQQSAAQTEIMRTRLKQAVAGLDAALAQFAEA
FT                   SKLAVEEAAVRAQTFSREDLARARTDLESLEAMFLETLQSSASGAKDAAGEILSDLARH
FT                   ARLYGSAVRAQLKETLAVITHQLGTAGRTQVVAGLHLAQATSDLLRQIAAGVLTGLADH
FT                   VKPGHSQGKGN"
FT   gene            46177..47925
FT                   /locus_tag="Pnap_4176"
FT   CDS_pept        46177..47925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4176"
FT                   /product="2-octaprenylphenol hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: pol:Bpro_5555
FT                   ABC-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4176"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39461"
FT                   /db_xref="GOA:A1VUY3"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY3"
FT                   /protein_id="ABM39461.1"
FT                   /translation="MLWQALTAVRDIGRLHDITSILIRYGFGDMVRRMGLANALERAGR
FT                   ALHWNEAQELAHLDPPARVRRALEELGPTFVKLGQVLATRIDLFEPEWIAEFGKLQDSA
FT                   PAASYAGIRQQLTEDLGAPPEEVFAAFDPEPLAAASVAQVHRARLEDGSEVVVKVRRPG
FT                   IRPIIEADLRWLARLAKLAEGESPELRAFRPQEVVRQFSQSLRRELDFAGECRNAEHIA
FT                   ENFAGYTDKDEPTGDASAEAAPEPPPALPIIIIPRVYWQWTGERVCVQEFIAGISGRKL
FT                   ATVDEAGLDRKVLARRGAHAVLKMIVEDGFFHADPHPGNVFYLPGNRIAFIDFGMVGRL
FT                   TEVRRDQLTGLLLGLVKHEPRRVADVMLDWTGDGAMDEDGLLVEIQTFVQQYHGVALKQ
FT                   LRLGAMLSDLVAILRQHQLALPPDLSLLIKAFISLEGMGRELDPDFDMAGEAMPLLEQA
FT                   LRARYAPTALLQRGWRGVSEALSLVAGLPQDISRLLRAARRGRLEIHIDITHLKRVGNQ
FT                   LDSAANRLVVGIVVAALIIGSSIVMTVPGGPTLLGLPFFGLLGFVGAVIGSLWLLLSIW
FT                   RSGGKE"
FT   gene            47922..50582
FT                   /locus_tag="Pnap_4177"
FT   CDS_pept        47922..50582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4177"
FT                   /product="Glycosyltransferase 28, C-terminal domain"
FT                   /note="PFAM: Glycosyltransferase 28, C-terminal domain;
FT                   KEGG: pol:Bpro_5556 UDP-N-acetylglucosamine:LPS
FT                   N-acetylglucosamine transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4177"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39462"
FT                   /db_xref="GOA:A1VUY4"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY4"
FT                   /protein_id="ABM39462.1"
FT                   /translation="MSGSQTAQGFGADPLIALALAAAFTLLVALAWLALVRQRSRARHP
FT                   ASDVPAASDVGAAPPRKIVIFYSSIGHGHISAAQAIQEEIGRLAPGARVILQDIREFMH
FT                   PLWRWVDERLYWFIAGNLPESFDALFHALQARGNRVPSLAWLSNDYPEDQVRAFLEAQA
FT                   PDAILATHYGSAQVLGTLRERGLLAQVNIGWLHTDFFEGYFPRISKRIDRTFLAHPELE
FT                   ARWLAAGVAPDKVTTSGMPVRVAAADGRTREMALTALGLAPDAPTVLITSGKEGVGDYA
FT                   LVVESLARHHQGPLQIIAVCGANARQQALLNVLRMALQKRLPEPVALKVCGLVPHADLL
FT                   AWMRAADLLITKAGGMTPAEAFAVGTPTILLDVVSGHERENAALFVRLGVAELADTLAQ
FT                   AGELAAAVLADPQRQAAMRHAQHAFHDSADLGRIARFALDPALPAPGMTPDFGAEHGSA
FT                   VTDIDAALARLQAEAPCDIELLLSYSTAQTPQRVVLENPFGHIAIRVDNTVYSANYVAV
FT                   PGHDPNLLQHVTLADYLYGVQPPSPSQVHTNTYGMAYGRETLGLRVAGVAAERKAAMVA
FT                   EAHRIEDEFGQGRLLWDRSEFNCADVVVRILRAGGYDRSPPLGRRWLPVMPLDIFEEAR
FT                   QTCEEDASLYMELVAYRQIPGANAAYRFSRFPLSLGQPLRSVARALREAPQEPLEAAAT
FT                   KQLTGYFGDHQLYFEDLRGHGAGALADDPAHFSRVQRSLADALATDLRRLLAAQARRPL
FT                   REIGRLGELDGAQDIRRLLERSLALARIATERADEVLQDRGARRMRALFTELVDGYGRI
FT                   GAWHLRRQEIEAYLKRFQVFEAAVGREFPARHGARLARATTLRRSLRYGIRRLCRRVGG
FT                   RHRPTGHGPDKGASQ"
FT   gene            50579..51550
FT                   /locus_tag="Pnap_4178"
FT   CDS_pept        50579..51550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4178"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pol:Bpro_5557 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4178"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39463"
FT                   /db_xref="GOA:A1VUY5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY5"
FT                   /protein_id="ABM39463.1"
FT                   /translation="MNEPQTSKAPAASLTPPKRPRIGLALGSGSARGLAHVGVLRALKE
FT                   ANIEIDLVAGTSMGAVIGAVFASGKIDGLSARLRNLDWPGIVALLDPVFPRSGLIDGQR
FT                   VAEFVRAHVPSAHIEGLLLPFAAVATDLMTGEEVVTTAGDLTEAVRASIAVPGIFTPVR
FT                   SNGRILVDGGLVNPVPVSVARAMGADLVIAVDLNHDIVAGRLSHPAAHANGNGHGPIMA
FT                   RLLESLRAINSPVLAQFEAWLHKPTLEPLPGIFEVLLASIYIMQARVTEADLRQTQPDL
FT                   LIQPPLGAVRFMEFDRAEEIIDIGYRSAAEQLARWTRTPTHD"
FT   gene            51543..52352
FT                   /locus_tag="Pnap_4179"
FT   CDS_pept        51543..52352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4179"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39464"
FT                   /db_xref="GOA:A1VUY6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY6"
FT                   /protein_id="ABM39464.1"
FT                   /translation="MTDTHPMNFPETVIAGVHAAVASTLTCEAVPVRGALRLLLLGQNT
FT                   PIRALVTCSLHAGQPGIDAGTALDLIHIGLQQLHAHVDATTGASALLGTGATVLAGDYL
FT                   TTGAFRLLVRCADLQVLALVSDAVNRASELEATQLGLDPDARDDPSRLLQTRQQLAAPL
FT                   GEAAGATGATLAGYPEPLAGTARRYGQYLVSSHVLQQEADAMDISEARTALQDAALDLC
FT                   RQARREARTIAAATGNGRPLELAELIAASLGAKASACKPKTITSTSS"
FT   gene            52349..53449
FT                   /locus_tag="Pnap_4180"
FT   CDS_pept        52349..53449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4180"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   pol:Bpro_5559 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4180"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39465"
FT                   /db_xref="GOA:A1VUY7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY7"
FT                   /protein_id="ABM39465.1"
FT                   /translation="MKDPLVKKRKNLLLYLAPLALAALLGACGKAPEAPAASNTTSRPL
FT                   PVMTASAGAPLEYTAVGSVVSDQRVEVASRLSGYIRDMLVQEGDRVRRGQLLTRLDASD
FT                   VEGGIRQGQAAGGAAEAALRDAQIDLERFQRLFERGSVSDNELRKVRLKFEAAREARNQ
FT                   ARAGLDTALAQRAYAEITSPVDGVVVARHKRTGDLALPGMPLLTLESGRGLLFETFVAE
FT                   GQVAAIAAGQPVQVNIDGVPAALKGTVSRVVRSGDPVSRSYQVKITLPETAGLMPGMFG
FT                   RAAFGLGASQAPLVPRQALVERGGLTGVFVVDAEGRARFRWLRIAREWPDQVEVSAGLA
FT                   ADERFVAAATPALREGDRVTAAKEAQ"
FT   sig_peptide     52349..52438
FT                   /locus_tag="Pnap_4180"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.558 at
FT                   residue 30"
FT   gene            53446..56727
FT                   /locus_tag="Pnap_4181"
FT   CDS_pept        53446..56727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4181"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   pol:Bpro_5560 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4181"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39466"
FT                   /db_xref="GOA:A1VUY8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY8"
FT                   /protein_id="ABM39466.1"
FT                   /translation="MSQHKLNSAGRLANLFVTSKLTILFMLACILLGLLAVTLTPREEN
FT                   PQIVVPGAQVWVTLPGASAEEVEELVIRPLEGIVKQIAGVDHTYATAMNSMGVLMVQFK
FT                   VGEDKEKSLVKLYDRVLGQRERLPAGAGEPLIRSVDVDDVPIVTVTLASEIYDDYALKR
FT                   LADRLMEGLRSLDKVSAISVKGGRDRELRIELDPQRLQAFGVTLDQVHATLRASNVAAP
FT                   LGTVVQQGQNRQVFLDGFLSSAQDLKRVIVGSHAGRPIYLGDVAQVVDGPPQERTHLSR
FT                   LAFGPADARFGKTQQAEMPAVTLAVAKKAGSNAVFVANDVLERIDRMKAQFVPAGVELV
FT                   VTRNDGEKADAAVSGLIEHLGIAVLAVFLVTAAFLGLKEALIVGVTVPLILALTLGAAY
FT                   LFGLSINRVSLFALILSLGLLVDGAIVVIENIHRNYSRLGKQDKRLVTVQATNEIGNPT
FT                   NLATLAVMLVFGSLLVVSGMPGQYFYPVAFNVPVAMAASLLVAYAVVPWAANRWLKPGE
FT                   GHDLEDHDTQDRLHRFYRHVMSPLVDRSRSRWLAFLLAGLAIAVSLLQPAWQFVRPSGL
FT                   GGPQSWFGVELAMMPKDDKNTFNITLDMPATAPVEATDRFAREVGALLRENAYVRNYQS
FT                   WIGEAGVIDFNGLLRGSGNKQGAHVAEIRVNLLNKADRSKTSIAIVRELRPTLQAMAAR
FT                   YPGSTVQLVEDPPGPPVRATVLAEIYGKDLQQLRTLSAQVKAAFQQTRDMVEVTDSEAQ
FT                   DVHQYRLTVDREKAALSGLSVAEVAVALRRLIDGEEMGRARIAGEKNPVPIRLQIPRRH
FT                   QIDPALLARVSVTNRQGQRVPLSEVVQVVPGSVDRAISHKDGERVTYVGGELESTAPVY
FT                   AVLDLDRRLDGLLLADGSRLTTGNLRLNPVAPDTLEGPRLLWDGELRMTLDTYRDMLGA
FT                   LGLALTFIFLVLVAYYRSFSLPLVAMAAIPLGLAGIFPGHWLMGPPFTATSMIGIIALA
FT                   GVVVRNSLLIIDFVLDYRRQGMDLREAILEAGAVRLRPILLTALAIVLGSAVMLSDPVF
FT                   GGLAISLIFGTLASTVLTLIVVPLLLYLLLRYKDQNEASLKKGTP"
FT   sig_peptide     53446..53556
FT                   /locus_tag="Pnap_4181"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.821 at
FT                   residue 37"
FT   gene            56724..58019
FT                   /locus_tag="Pnap_4182"
FT   CDS_pept        56724..58019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4182"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pol:Bpro_5561 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4182"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39467"
FT                   /db_xref="GOA:A1VUY9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUY9"
FT                   /protein_id="ABM39467.1"
FT                   /translation="MNRSIKIRGLLPLAALAAALLAGNAAAESLQQAWDIALTVDRGLK
FT                   ASRESTAAASSLLDAAKSARLPNLALEAGYTALDKAPAARVDFFGQSLQMPLAQKDSAA
FT                   YRAMATLPLYTGGRIERGIDAATAGMDAARLGETADAQNLKLRVADAYVNVLRASRMLK
FT                   VTESHVASLQAHARDVGNLHEQGMVAKSDLLSVQVALADARQRHLQVANGLDLARAAYN
FT                   RLLGRPLDQPVALDDLSPETAQEPLPALSERALARRSELAALARQIEAMRHQAAAVRGE
FT                   TAPQVALSGGYGYQENRYQVHQGQWMVTLGVKWSLFDGGVVSHRANAVERQAAALTEQR
FT                   DELASIIALQVRQTWLDVQETRKRLIVTQSAIAQAEENLRVARDRYANGLSTHTEVLDA
FT                   ETLRTGSEGNHANALSDAALAGLRLKRATGEL"
FT   sig_peptide     56724..56807
FT                   /locus_tag="Pnap_4182"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 28"
FT   gene            58169..58306
FT                   /pseudo
FT                   /locus_tag="Pnap_4183"
FT   gene            complement(58305..59330)
FT                   /locus_tag="Pnap_4184"
FT   CDS_pept        complement(58305..59330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4184"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein,
FT                   AraC type; KEGG: bur:Bcep18194_B1224 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4184"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39468"
FT                   /db_xref="GOA:A1VUZ0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ0"
FT                   /protein_id="ABM39468.1"
FT                   /translation="MHITNVRVTYLRQIADQAVELGVDLAAWLAISELKERDLVDATAL
FT                   IPIEKLGELVTAAIARSGESGFGVLAGCRLIPGSHGIVGMAAAASANIREAMQIVERLV
FT                   SLRTGVIDIRTRVANGAFEVFFEPVLGLGPASNPVTEIAMVAVKNIADDLIHHGSACSR
FT                   VGFSFPEPPHSALARDIFGCQVQYGQKWSGLSFALSAAEEDVPKHDALVLAEAVRICTD
FT                   EFKTLRSNKSASARLEGVILERSPSFPTLTFCARLLGMTPRTLHRRLIEEGTSYREVAE
FT                   SVRHRMALELLRKKVTVKEVAYLLGYTEIANFRRAFKRWEGVAPSDWFGQNTKRAEKLA
FT                   K"
FT   gene            59556..61814
FT                   /locus_tag="Pnap_4185"
FT   CDS_pept        59556..61814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4185"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; fatty acid desaturase; Oxidoreductase
FT                   FAD-binding domain protein; KEGG: bur:Bcep18194_B1222 fatty
FT                   acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4185"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39469"
FT                   /db_xref="GOA:A1VUZ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ1"
FT                   /protein_id="ABM39469.1"
FT                   /translation="MRSLLRRSSHEAEINGKTITVQPDETLLLAALRQDIHIPSICRVG
FT                   GCGTCKCKLKGGKVEELTETAYLLSEKEIADGFILACQSRLRSDVKIELDQEGAIDGPP
FT                   VKGVVVGKQMLTHDIARIDIRLDQPIRYRAGQFAEVALPALPDCSRSYSFSTAPGNDRQ
FT                   VSFTVRRVPGGRVSGHLVDKAQVGESLTVRGPGGQFWMRPGQAPVLMVAGGSGLAPILA
FT                   MLEDMKNRGDLRPVTLLFGARAQRDLYALDELAAYSASWPNFRFVPILSEADASQAWEG
FT                   RTGLVTEHIPELLGSATSAYLCGPPAMIDSAVAVLRKQGITDEHLHADRFVDQAPKLHT
FT                   GFYGTVGLPEVERAPANILDYLKFFLVHLVGVGGVLSILAGGVYTSLGLLGLLMFYIGG
FT                   DALLGRDTRTPEYRSPWILTVQLWLALPLLALVMFSYIWTLSPGDPLGFGAWISGLTGY
FT                   DVLAARAGTGFWHHLAGGVHAGLTIGLLGTVTGHELTHRTWDPVSLLVGRWLLAFSYDT
FT                   GFAIEHVYGHHRYVSTEHDPATAPRGRNVYFHVVASTIKGNISAWRLETERLMRKHHEV
FT                   LSPRNAYIRGVLMSVLLVAIAGWMAGWSGVLAFTGCALFAKALLEIVNYMEHYGMVRIP
FT                   DQAVQPRHSWNTNARMSSWAMFNLSRHSHHHAQGEVPYQDLMPLSDAPMMINGYLATIV
FT                   FTLVPPLWHRLMTPKLIEWDRLYATPEERALALRANQRSHLKALRDYDPRRWNTAAAH"
FT   gene            61877..63517
FT                   /locus_tag="Pnap_4186"
FT   CDS_pept        61877..63517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4186"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; FAD
FT                   dependent oxidoreductase; GMC oxidoreductase; KEGG:
FT                   sil:SPO0190 oxidoreductase, GMC family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4186"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39470"
FT                   /db_xref="GOA:A1VUZ2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ2"
FT                   /protein_id="ABM39470.1"
FT                   /translation="MNFDYVIVGGGSAGATLAARLSEDPSTSVCLLEAGGRGDGILVRA
FT                   PAGMVAMMPGRGKINNWVLHTVPQPGLNGRRGYQPRGRALGGSSAINAMLYIRGQRQDY
FT                   DHWANLGCDGWDWESVLPYFKKSENNERGPGAFHGGSGPLHVSEQRSPRPITLAFIEAA
FT                   KHCGIAPRADFNDGDNEGVGLYQVTQFHDAARRGERCSTAAAYLHPLRRQRPNLTIKTN
FT                   TRATRIIFEGKRAVGVAYRSAGREQEIRAKQEVIVAAGAFGSPQLLQLSGVGRPEDITH
FT                   HGIRMVHELPGVGQNLQDHLDFIHAFKSKDTDNFGIGLRGTMNLLGHIAQWRKDGSGML
FT                   ATPFAEGATFFKSDPGIDRPDLQLHFVISVVDDHARKLHAGYGFSCHVCYLRPYSRGEV
FT                   FLQSPDPLDDPGIDPRFLSDERDLKALMHGAKVTREILLAPPLKKYRHRELFGMTDGMN
FT                   DAQWEQHIRSRADTIYHPIGTCKMGVDAMAVVDPELKVRGLQGLRVVDASVMPTLVSGN
FT                   TNAPTIMIAERAVDLIRGFATRYSTAIRN"
FT   gene            63521..65158
FT                   /locus_tag="Pnap_4187"
FT   CDS_pept        63521..65158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4187"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   sil:SPO2045 medium-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4187"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39471"
FT                   /db_xref="GOA:A1VUZ3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ3"
FT                   /protein_id="ABM39471.1"
FT                   /translation="MLGKMMREPLLVSSLIAHAASYHADTEIVSVQTTGGVEKTTWSQV
FT                   ECNARRLSSALAKLGVRQGDRCATIAWNNRRHLEIYFGVSGAGMVCHTINPRLSFEALT
FT                   YIVNHAEDRVLFVDRTFLPIVAKLRPALNTVKHVILMGPRETEAQGMVDDLLFYDEVVT
FT                   TGDQDSQWPNFDEDLPSSLCYTSGTTGHPKGVLYSHRSTMLHALAGNHPDGLAISARDT
FT                   VMPVVPMFHVNAWGVPYIAASQGAKLVLPGPNLDGASLAALIDAEEVSLALGVPTIWMG
FT                   LLAALRARGTKPKSLKRTVVGGSALPPSMFAAFRDEFGVELIHAWGMTETSPLGTLNQP
FT                   LARHAHLDPQSQSDLRLGQGRPPYGVQLRLVDNLGTVLPCDGKTQGSLQIKGHWIVDTY
FT                   FGATTSALTADGWFDTGDVATIDANGYMIIRDRAKDIIKSGGEWISSVEVENIAIGHPA
FT                   IANAAAIGVPHPKWDERPVLVAVKKEGATVSDADVLAFFKEKVPDWQIPDKVVFVDALP
FT                   LSGTGKVLKNKLRESYKDLLTVDRAESA"
FT   sig_peptide     63521..63595
FT                   /locus_tag="Pnap_4187"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.814) with cleavage site probability 0.784 at
FT                   residue 25"
FT   gene            65158..66897
FT                   /locus_tag="Pnap_4188"
FT   CDS_pept        65158..66897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4188"
FT                   /product="aldehyde dehydrogenase"
FT                   /note="KEGG: ade:Adeh_1143 aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4188"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39472"
FT                   /db_xref="GOA:A1VUZ4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ4"
FT                   /protein_id="ABM39472.1"
FT                   /translation="MENSHLPNTEVQAALDQDLQALEAAKHAWARTSVADRIAILGRIK
FT                   QTLMQVAQGWAETAARKKRIPHGSPLAGEEWISGPYSVMAACNGLMQTLSQLKRKEFLA
FT                   HLHMRRLKNGQLAVGVMPHSVWDSLLLSGVSAEVWMQKGVSEVNVDEHAAAAYDVPVDQ
FT                   RSGKVALVLGAGNIAAISPLDAFQKLFIENQVVLLKMNPVNDYLTDYLRAALRPLIECN
FT                   ALRIVRGDGAVGAYLCEHPRVEEIHITGARATHDAIVWGVGEEGLRNKAANTPKNHRKV
FT                   TSELGAVCPTIVVPGPWSRADIRFQAEQIATQKLHNSGFNCVACQTLILPQGWAHTEPL
FT                   LAEVGRVMSRNGQREAYYPGNEHRTADFAAHAGRSDAIERGPGAPPCVLADMDGGDEPW
FT                   LAEHEVFGTALAMKSLAYQDAESYLKAAIDYANNRLYGTLGANILIHPKTLRQIGQQRF
FT                   EELLRELRYGTIAVNAWTGLAFLLAPCPWGGFPGGMAIDPQSGVGTVHNSFMLEKTERT
FT                   VVFAPWRPFPRGLFSLQFTLLPRPPWFITNRRQHELGRLLTDFQFRPGWTKLPRIFINA
FT                   LAG"
FT   gene            66988..67698
FT                   /locus_tag="Pnap_4189"
FT   CDS_pept        66988..67698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4189"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: pol:Bpro_5480 OmpW"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4189"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39473"
FT                   /db_xref="GOA:A1VUZ5"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ5"
FT                   /protein_id="ABM39473.1"
FT                   /translation="MPKTKTTYAFAFAAGLTLAFGSIGAYAQSEDAANTLKIGYAGITF
FT                   NTKSGHLIGPPGTTPPGIQTDLRDARTFALIYERRISGPWSVVVQAATPPVVKVDGAGT
FT                   GAPLGSVETTKAWFPAVLATYTFAGLPGIRPYVGAGVNYAFFTDPQVSAAYTGAFGGTS
FT                   SSSTLKNSWGPVVKLGAEFPIAKNWVLDVGYSRYWIKTTATITTTTPGVGDIARTINVK
FT                   VDPGVFGLLVGYRF"
FT   sig_peptide     66988..67071
FT                   /locus_tag="Pnap_4189"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.945 at
FT                   residue 28"
FT   gene            67791..67981
FT                   /pseudo
FT                   /locus_tag="Pnap_4190"
FT   gene            68268..69179
FT                   /locus_tag="Pnap_4191"
FT   CDS_pept        68268..69179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4191"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein, LysR; LysR,
FT                   substrate-binding; KEGG: rme:Rmet_1336 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4191"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39474"
FT                   /db_xref="GOA:A1VUZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ6"
FT                   /protein_id="ABM39474.1"
FT                   /translation="MELRHLRCFIAVAEELHFARAAERLHIEQSPLSRAIKELESNLAV
FT                   QLFERTTRRTRLTWAGKVFLEEAHRVFAAIDQAKASVKAAATGYRGRLRIALSDGIAQP
FT                   RLSALLAQCREEEPEVEIRLSETPLSQQIKGLNSDLYDAGFAQSDEVGEGIIAEAIWSE
FT                   PLVIAVPARHPLLVHRRIPLDEVLRYPLVLCHPETCEGFWQQVKRVLRTVDAKPIVVDR
FT                   VPTLDLMMTLVAAGYGLGFAGESQIAACRNPDVIARPLAGRSPMLTTYLLRPEIEPSEQ
FT                   LSRFIDRVSPVDEQASNPATVQ"
FT   gene            69191..69433
FT                   /locus_tag="Pnap_4192"
FT   CDS_pept        69191..69433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4192"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39475"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ7"
FT                   /protein_id="ABM39475.1"
FT                   /translation="MKMIAALMLVLQLTACGQSAPTETVESLAANPERLKELRAQCKAD
FT                   RAKLGDALCNAVAEATHKRFIGNGTPYTPEPTPKN"
FT   sig_peptide     69191..69244
FT                   /locus_tag="Pnap_4192"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.473 at
FT                   residue 18"
FT   gene            69719..71710
FT                   /locus_tag="Pnap_4193"
FT   CDS_pept        69719..71710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4193"
FT                   /product="TRAG family protein"
FT                   /note="PFAM: TRAG family protein; KEGG: rso:RSc2586
FT                   probable plasmid conjugation traG transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4193"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39476"
FT                   /db_xref="GOA:A1VUZ8"
FT                   /db_xref="InterPro:IPR003688"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ8"
FT                   /protein_id="ABM39476.1"
FT                   /translation="MQGTSVLFGQVLTVFGIVLAGVWGATQWTAAALGYQLRLGTPWFD
FT                   FFGTPVYHPWRLFEWWFFFDAYAPHIFNTGGSIAGASGMVSVVVAIGMSIWRSRQSKLV
FT                   TTYGSARWADAKEIRKAGLTNPAGVFLGLHDDQYLRHEGPEHVLTFAPTRSGKGVGLVV
FT                   PTLLSWPASAVIHDIKGENWNITAGWRSRFSHCLLFNPTDPKSAAYNPLLEVRRGAHEV
FT                   RDVQNIADILVDPEGALERRNHWEKTSHALLVGAILHVLYAGEDKTLRGVANFLSDPAC
FT                   PFEVTLHRMMSTRHLGESTHPVVASAAREVLNKSDNERSGVLSTAMSFLGLYRDPTVAE
FT                   VTSRCDWRIADLISAEHPVSLYLVVPPSDISRTKPLIRLILNQIGRRLTESLDGSDGVE
FT                   RKHKLLLMLDEFPALGRLDFFESALAFMAGYGLRAFLISQSLNQIDKAYGQNHSILDNC
FT                   HVRVTFATNDERTAKRISETLGTATELRAQRNYAGHRLAPWLGHLMVSRQETARPLLTP
FT                   GEVMQLPPDESVVMVSGHAPIKAKKLRYYLDANFKRRVLPPPALTLGRYADVPAARADD
FT                   WSALAVPTVSAASATAGLGESLDDGGPRQQPELSEVATYSPEPDQSASDLSLLDDDDFP
FT                   LPLPNQLDPRLQRTARLAALDPDDGIQL"
FT   gene            71707..72159
FT                   /locus_tag="Pnap_4194"
FT   CDS_pept        71707..72159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4194"
FT                   /product="CopG domain protein DNA-binding domain protein"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: rme:Rmet_1549 CopG-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4194"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39477"
FT                   /db_xref="GOA:A1VUZ9"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1VUZ9"
FT                   /protein_id="ABM39477.1"
FT                   /translation="MTQARLNLFIQPDHAKRLDELAAKKGVSKSSIVAAALASWLSPDA
FT                   GDQREAATAKRLDRLSRQFERLERDQNILIETLALYVRYYLTVSTPVPEAHQEAAKAQG
FT                   KARFEQFIEQLGRHVLRGRSLVKEVYEEIQPDAARLAEAAMQEDGA"
FT   gene            72156..73187
FT                   /locus_tag="Pnap_4195"
FT   CDS_pept        72156..73187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4195"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rso:RSc2584 probable conjugal transfer protein TrbB"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4195"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39478"
FT                   /db_xref="GOA:A1VV00"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR014149"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV00"
FT                   /protein_id="ABM39478.1"
FT                   /translation="MSAVLKDQPPSSAATSLDRRIRMLRTAMGPLIAAALEDPDVVEIM
FT                   LNPDGSLWIDRLSSGRSPMGVKLSEADGERIIRLVAAHVGTEVHRGQPLLTAELPETGE
FT                   RFEGILPPAAPGPAFALRKRAVSIIGLERYVADSILSEEQAEFLRRAVRERLNILIAGG
FT                   TSTGKTTLANALLAEIAATGDRVLVLEDTVELQCAARDHVSLRTRAGVVSMAELVRATM
FT                   RLRPDRVIVGEVRGGEALDLIKVWGTGHPGGIATIHASSAHGALLRLEQLILEVALTPP
FT                   RALIAEAVNVIVFIAGRGRGRHVQTIARVVGFDVHGYQLDDALAPPLPTLSLPSSTTPG
FT                   ELP"
FT   gene            73184..73543
FT                   /locus_tag="Pnap_4196"
FT   CDS_pept        73184..73543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4196"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="PFAM: Conjugal transfer protein TrbC; KEGG:
FT                   rme:Rmet_1551 conjugal transfer protein TrbC"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4196"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39479"
FT                   /db_xref="GOA:A1VV01"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV01"
FT                   /protein_id="ABM39479.1"
FT                   /translation="MTHIAFSTSRFSANPHLRLTLHVVVLAALMLCLTLPAHAAGSSMP
FT                   WEGPLTSILESIQGPVARIVAVIIIISTGLALAFGDTSGGFRKLIQIVFGLSIAFAASS
FT                   FFLSFFSFSGGAVVA"
FT   sig_peptide     73184..73303
FT                   /locus_tag="Pnap_4196"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 40"
FT   gene            73540..73824
FT                   /locus_tag="Pnap_4197"
FT   CDS_pept        73540..73824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4197"
FT                   /product="putative conjugal transfer TrbD transmembrane
FT                   protein"
FT                   /note="KEGG: rme:Rmet_1343 putative conjugal transfer TrbD
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4197"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39480"
FT                   /db_xref="GOA:A1VV02"
FT                   /db_xref="InterPro:IPR007792"
FT                   /db_xref="InterPro:IPR016704"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV02"
FT                   /protein_id="ABM39480.1"
FT                   /translation="MSTETEFAQGFASGFEIPLHRSLTEPILLGGAPRTVAIANGTLAA
FT                   AVGLGLQLWIPGLVLWIVGHSLAVWGARLDPQFMAVFSRHIKHRPLLDV"
FT   gene            73846..76287
FT                   /locus_tag="Pnap_4198"
FT   CDS_pept        73846..76287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4198"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: rme:Rmet_1553 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4198"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39481"
FT                   /db_xref="GOA:A1VV03"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV03"
FT                   /protein_id="ABM39481.1"
FT                   /translation="MMNLAEYRKRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGP
FT                   DLDSATQGELIATSAQLNNALRRLGSGWALFVEAERRAAADYPYSDFPEPLSWLVDEER
FT                   RASFEEDHSHFESGYHLTLAYLPAEESRVRAAKLLYENTPQRGVDWRERLESFISETDR
FT                   FFDLLDGVMPEIVWLDDSQTLTYLHATVSARRYRVAVPEHPFYLDALLADSALVGGLAP
FT                   MLGDQHLRVASVRGFPTSTWPGLLDDLNRLGFAYRWSTRFLCMDKADAETELGRLRRQW
FT                   FAKRKNVVALLRETIFQQESPLVDTDASNKANDADAALQELGSDQVAFGYVTATVTVLD
FT                   PDSSVADEKLRRIERVIQGRGFVTIPETLNAVEAWLSSIPGNAYANVRQPIISTLNLAH
FT                   LMPVSAVWAGPERNNHLDGPPLIVTRTDGATPFRLVTHIGDVGHTLVVGPTGMGKSVLL
FT                   ATLAMQFRRYPGSRIFAFDMGRSMRATTLGLGGEHYDLGKGWEEGGEIAFQPLARIDQD
FT                   GYRTWAAEWLEGRLLHEGAAVGPEEKAMVWSALGSLAGAPVEQRTLTGLSVLLQSNALR
FT                   QALQPYVLGGAHGKLLDADSDRLGSGSVQCFEMEELMHSKAAVLAVLGYLFARFDERFD
FT                   GAPTLLILDEAWLFLDDPVFAARIRQWLKTLRKKNVSVIFATQSLADIQNSSIAPAIVE
FT                   SCASRIFLPNPQATEPQIRTIYEGFGLNRRQIDIVAEAVPKRDYYYQSRLGNRLFDLDL
FT                   GPVTLAFAGASTPQDQRDIDAVSRSESSSDFAAAWLRHRGLDWAADLVPSFPSIPQENA
FT                   P"
FT   gene            76284..77012
FT                   /locus_tag="Pnap_4199"
FT   CDS_pept        76284..77012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4199"
FT                   /product="putative conjugal transfer TrbJ signal peptide
FT                   protein"
FT                   /note="KEGG: rme:Rmet_1554 putative conjugal transfer TrbJ
FT                   signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4199"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39482"
FT                   /db_xref="InterPro:IPR014147"
FT                   /db_xref="InterPro:IPR025415"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV04"
FT                   /protein_id="ABM39482.1"
FT                   /translation="MKKTILAIAAAALVTLMPVAHAQWVVIDPSNLAQNIMTAARTLEQ
FT                   INNQIRQLQNQAQSLMNQAKNLTGLDFSALNELRASLSATNQLIQQAQGLAFNVSQMET
FT                   EFQRLYPDAYSASISGTQMTTDARSRWRNSLEALRTATKVQSQAVQNFASDEQTLTDLV
FT                   NRSQSAVGALQATQATNQLLALQARQSIQAQQLQITQDRATALEQARVIAAQERAREVR
FT                   RRFLGEGTPYTPQTIDFYRN"
FT   sig_peptide     76284..76352
FT                   /locus_tag="Pnap_4199"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            77023..78396
FT                   /locus_tag="Pnap_4200"
FT   CDS_pept        77023..78396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4200"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: rme:Rmet_1556 TrbL/VirB6 plasmid conjugal transfer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4200"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39483"
FT                   /db_xref="GOA:A1VV05"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="InterPro:IPR014150"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV05"
FT                   /protein_id="ABM39483.1"
FT                   /translation="MNDISVIDRFLNVFSRYIDSGFGLLGGEVAFLTATLVAIDMTLAG
FT                   LFWAMSHASGGGDDIIGKLIKKVLYVGAFAYIIGNFNLLAGILFRSFAGLGLVASGSTI
FT                   TQAEFLQPGRLAKVGIDAGAPILEQISAMAGFPEVFVNLDAITVMLLAWLVVVMSFFVL
FT                   AVQLFVTLIEFKLTTLAGFVLVPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIVGIGT
FT                   GLFAEFQVTPDEPSIDHALTIMLAALAMLGLGIFGPGIATGLVSGAPQLGAGAVAGTAL
FT                   GVAGAAVAVGAAATGVGGAVAAGARMAPGAAKMAASGARSMASTASSAKSAFQAGSAGA
FT                   GGGLKGAAAGLGNVAKTGAQSVGQKVAAGAKSMKDRTAAAIKPDASASGTGAGAGAGSA
FT                   AQGGNDAAPTDTQQPAWAKSLHRRQQISHAASTVAHTLRGGDGGGSGSSPSLRDPSDS"
FT   gene            78409..79113
FT                   /locus_tag="Pnap_4201"
FT   CDS_pept        78409..79113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4201"
FT                   /product="Conjugal transfer protein"
FT                   /note="PFAM: Conjugal transfer protein; KEGG: rme:Rmet_1348
FT                   conjugal transfer protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4201"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39484"
FT                   /db_xref="GOA:A1VV06"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV06"
FT                   /protein_id="ABM39484.1"
FT                   /translation="MRFKRSLVRYADTPQPATPYQSAEQVWDDRIGSSRVQAKNWRLMA
FT                   FGCLVLALLMAGGLVWRSAQSIVTPFVVEVDSGGQVRAVGEAATPYKPNDAQTAHHLGR
FT                   FVTLVRSLSIDPIVVRQNWLDAYDYTTDRGAAVLNDYARTNDPFARIGKESVTVQITSI
FT                   VRASEASFNVRWTERRYVNGAAAGLERWTAVVSIVLQTPRTEERLRRNPLGIYVNGLSW
FT                   SRELDSSEGAKP"
FT   gene            79110..80123
FT                   /locus_tag="Pnap_4202"
FT   CDS_pept        79110..80123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4202"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: rso:RSc2576 probable conjugal transfer lipoprotein
FT                   TrbG"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4202"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39485"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR014142"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV07"
FT                   /protein_id="ABM39485.1"
FT                   /translation="MKPSLRIYVFLSLLVATSMTLSGCATPGKPPPTITLDEPVAAQPL
FT                   PELPKPVEVVAVPQPLPLPEQLKLLPDELEAKTAPESADEKVRVTRANQEARIAPTREG
FT                   YVNAIQVWPFTDGALYQVYASPGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGAGAS
FT                   LRVSVLVKPTRSGLKTNLVVTTNRRTYLIELTSTEKAWMASVSWDYPKDRMLALQRQAQ
FT                   AAQIAAPVDAGLSLEKIRFRYAITGSNPPWKPLRAFDDGEKVYIQFPGGIAQGELPPLF
FT                   VIGAQGDGQLVNYRFRSPYYIVDRLFGAAELRLGADKGDVVRIERTDGTVSGTRRN"
FT   sig_peptide     79110..79187
FT                   /locus_tag="Pnap_4202"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.592 at
FT                   residue 26"
FT   gene            80126..81445
FT                   /locus_tag="Pnap_4203"
FT   CDS_pept        80126..81445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4203"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   rme:Rmet_1559 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4203"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39486"
FT                   /db_xref="GOA:A1VV08"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV08"
FT                   /protein_id="ABM39486.1"
FT                   /translation="MSQANNAPDTPDSAVPDVPPKVAPENVTLRSQPRPVTRLNRRMLA
FT                   VLAGGLATAVLGGTIWSLQSTQRRGAGDQKELYNVDRVSRSEGLDRLPADYSKLPPTLP
FT                   APVPQLGAPLPGDLGGPIHKAEQQAQGYGYQQPGHDPAEVERLARLKQAEEAAASSVFF
FT                   RSGGQKVAAAAQPQALPVATALAANAAFDPMAAGPASTAAQSADPTAVQNRQDQKEAFL
FT                   SKAGSTETRNSGSLQMSASPYQVMAGTVIAAALVTGIKSDLPGDVIATVTEPVYDTATG
FT                   KYVLIPQGSRLLGKYNSQVSYGQSRVQVVWNRVILPDTSSFQLDKLIGTDPAGYAGLED
FT                   GVDWHWDRVFAGAALTTLLGIGAELAAPENRNGGDRVIIAGRDSLKDSVNQAGQEMTRR
FT                   NMNMQPTLTERPGLPVRVIVNRDLVLRPYQPLFFVRGGLR"
FT   gene            81442..81711
FT                   /locus_tag="Pnap_4204"
FT   CDS_pept        81442..81711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4204"
FT                   /product="Uncharacterized conserved small protein-like
FT                   protein"
FT                   /note="KEGG: rso:RSc2574 hypothetical/unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4204"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39487"
FT                   /db_xref="InterPro:IPR018733"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV09"
FT                   /protein_id="ABM39487.1"
FT                   /translation="MSTPTKKLRLGPLPSITSTKLTFTCPASLKADLDHYAALHAQAYG
FT                   ETVDAVTLIPHMLEAFMAGDRGFKKRNTSKPTLQKSPQREATPP"
FT   gene            complement(82262..82612)
FT                   /locus_tag="Pnap_4205"
FT   CDS_pept        complement(82262..82612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4205"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   chu:CHU_1014 possible cytochrome"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4205"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39488"
FT                   /db_xref="GOA:A1VV10"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV10"
FT                   /protein_id="ABM39488.1"
FT                   /translation="MIWFLDAMIKYAVFQGRARRKAYWMFLLFVILISFFMGLILAIIQ
FT                   SVLHLGVDLAGIANIGFSLAILIPSVAIGVRRMHDIGRSGWRLIVPFLGWFMLCMDSQP
FT                   GENKYGPNPKTS"
FT   gene            complement(82654..83067)
FT                   /locus_tag="Pnap_4206"
FT   CDS_pept        complement(82654..83067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4206"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39489"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV11"
FT                   /protein_id="ABM39489.1"
FT                   /translation="MPADGQTSFIVKLPMNLDATHALLWVHLFKIGRIVMSKAMAIWLG
FT                   LKSQRLIDTIDAVQVYLCVTDAVNDAMDVLISSWKSPLHTFADAFGIELAYGMPPAIAH
FT                   VALSQNGLSPEEIKVVLTASEKALLSVIGPLPI"
FT   gene            complement(83134..83589)
FT                   /locus_tag="Pnap_4207"
FT   CDS_pept        complement(83134..83589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4207"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV12"
FT                   /protein_id="ABM39490.1"
FT                   /translation="MHVLSRQLDDQCSSLSPPITRQKTNFPIGIHDQKVTSEKEPQPVD
FT                   KSIKKYPMGLFYVSYVLVVGAMFLKFPIHSLIIGIVFLVLSVTMICRSQKPFVEPVFEV
FT                   DLDEDDSCSLVGRNAQQQEFDYDFFDFENARINSNLGQQKAILEINK"
FT   gene            complement(83904..84173)
FT                   /locus_tag="Pnap_4208"
FT   CDS_pept        complement(83904..84173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4208"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39491"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV13"
FT                   /protein_id="ABM39491.1"
FT                   /translation="METNYRMRPIAAEITHGWIARALSSKFRVTYSSGRFGDTHYVIKD
FT                   GVGGHVVLTQNTKNGRNVDASLFSPLQHAIMEKLQGWGLVVAAE"
FT   gene            85400..85678
FT                   /locus_tag="Pnap_4209"
FT   CDS_pept        85400..85678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4209"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39492"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV14"
FT                   /protein_id="ABM39492.1"
FT                   /translation="MGVSLLFQGNVMAHPKTAQSVSKKPVRVISPRVTIFRPGFTEVDE
FT                   WRSALPNEALHVFSNFTGSLDAPEVMPAGGMRKSAYGGKTLFAFRSL"
FT   gene            85689..85958
FT                   /locus_tag="Pnap_4210"
FT   CDS_pept        85689..85958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4210"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39493"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV15"
FT                   /protein_id="ABM39493.1"
FT                   /translation="MELHSNELRDYILRAPKRWTFNGCEMVNNSEACYRWLEQLCRGTL
FT                   DQRINRRAGLVEKWFPYWRTPTMKSIKRHHDREHIKKYGYFINR"
FT   gene            86109..86990
FT                   /locus_tag="Pnap_4211"
FT   CDS_pept        86109..86990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4211"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39494"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV16"
FT                   /protein_id="ABM39494.1"
FT                   /translation="MQETKTVLSEYTQMSPFIKSDTKVCWDCLRAKPLRELKPYNPVPG
FT                   LLVWQCGCGQSALPPFMTVAGGKVIICEDLTGDSLPDEWTGVCVSGNDAKSFWYIGHDL
FT                   GERSFNKLPLEIVTIKGAVAYVENNAACKNTLAMTDAAIAVWKAVECAQAVVCESLPEN
FT                   LPKDWLVMNAPRPILGDQIAQGAFMHGVYYAAINPSVEFAQDLVRRNLINDARVVFVAS
FT                   KVTQEAMALETISPEYQNAYRKMPDHNRANAISSFVLKLNRGKTYCEIKELARRAYVAM
FT                   QEEELLKVVPTA"
FT   gene            87439..87819
FT                   /locus_tag="Pnap_4212"
FT   CDS_pept        87439..87819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4212"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39495"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV17"
FT                   /protein_id="ABM39495.1"
FT                   /translation="MNIQNIKRNSMGTLDFDGKFDGMRKPQDFITYPIGANDDKTRVKI
FT                   QSDTRIGFINLTNGHVLMSPSIKGGAYNHHLSQINDVGKLNQEELFSLKAQLLDSASAK
FT                   AGTNGIVTTDNSGAAEVFAKQP"
FT   gene            87892..88443
FT                   /locus_tag="Pnap_4213"
FT   CDS_pept        87892..88443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4213"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39496"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV18"
FT                   /protein_id="ABM39496.1"
FT                   /translation="MKTMTEAEWDATHDDFKKLWTAERTDWTDWERVRNRYMGKRTVMS
FT                   DGVLLVEGMGLVITPNPPKSKDDKVYLRDIGRALEKNIYAQTDTSLHWLAVIGEDSIQP
FT                   VPTKEWYYNDALIQVGVVNGNSEGSLIYVQAQKNRYQPELLVPLFRIKLLCSPMAAFAE
FT                   AKIVYEFFESQEFMDMVSHT"
FT   gene            88638..89492
FT                   /locus_tag="Pnap_4214"
FT   CDS_pept        88638..89492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4214"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: pol:Bpro_5428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4214"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39497"
FT                   /db_xref="GOA:A1VV19"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV19"
FT                   /protein_id="ABM39497.1"
FT                   /translation="MISKPLEVTMQQKIFTTFSLFQDEEADDLKSELIRINELIARGAI
FT                   FVVNHSGGKDSQAMFHFITDLVPRSQIFVVHAELPEVEWEGVLEHIQSTVLGMTVHTCR
FT                   SRRMLLEMIRERGMFPSPSIRQCTSDLKRGPIERTIRRTGHKLIVNCIGLRSDESSNRA
FT                   KLATFKYSEKNSKNDREWYDWLPIHHWTVEAVFAKIKATGQVPHWAYSVGMSRLSCVFC
FT                   IMASTKDLTIAAQHNPKLYSTYVGLEHTTGQVMMMPSKSKGRQTLEQITGVIAEPEAEL
FT                   VPA"
FT   gene            90124..91254
FT                   /locus_tag="Pnap_4215"
FT   CDS_pept        90124..91254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4215"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4215"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39498"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV20"
FT                   /protein_id="ABM39498.1"
FT                   /translation="MSSEYIYDRAAVRLKGVRFEYIALYILSHSNNVDPYIPNWNLYGF
FT                   SKLEDALDIPLKYCYYCDDGITRGKKGQMISGEFDINKWRVAIERAPIIKDEFRLQLKF
FT                   CDEKHSESHPLLKLEKIKAFAVQLDLHLEIESILGHSEAAWLVLDLNNPEHVDLAWATT
FT                   RDMSDAESNDSYKRLMLPFNFLQRQVAERFFGHLGYCDEKRASATVLRKQSNFDLPETI
FT                   YKFEFPVDDQPVYKDVRFVVVNWLGRILSCSPDRWFCLKLIELEKKHLGTAESAYIKFK
FT                   KHMKALQVTSHEGMTIEVMASLSGAQRAEMTQWDMDKRDRLFARLHKPGMSAIFTEVVK
FT                   DHIQAMALAPYIECNLAISEMKTAKKPQVEQMTFDI"
FT   gene            91321..91683
FT                   /locus_tag="Pnap_4216"
FT   CDS_pept        91321..91683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4216"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4216"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39499"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV21"
FT                   /protein_id="ABM39499.1"
FT                   /translation="MRIIQGFPFRTDGGVNTQLEGGQCIIGADGSTCLGELVADEEFTS
FT                   KVITALNQHEKLEVPRFILLSILEMAESNYQDVSTGLDDGTYTAIENPNFIVHGQALDY
FT                   FKGLLNSHVKIAAIAA"
FT   gene            91757..92275
FT                   /locus_tag="Pnap_4217"
FT   CDS_pept        91757..92275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4217"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39500"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV22"
FT                   /protein_id="ABM39500.1"
FT                   /translation="MTSTRMFEVIIAGSNGQLPIAYPNSNGLDALKVMRALSTQGFRST
FT                   AETTALGITERLGLADMEAIYADQLDSALDDVQCLVERITQDIARLRDITIDPMNIVFG
FT                   DNPAFEIRPASDGNLFNVLNKERGNVSVHYIHEGVKCDVFAQDSLEPIDTVSVQTTELV
FT                   KLMESKIIT"
FT   gene            92352..92660
FT                   /locus_tag="Pnap_4218"
FT   CDS_pept        92352..92660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4218"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39501"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV23"
FT                   /protein_id="ABM39501.1"
FT                   /translation="MNTRKAHGIPSQINSFVSDKETEMTGYGRHNRLLVFHSNEKRALT
FT                   LREDLSKGLAMSTEEDRIKVLNGFQRMHPLGARPVSSGPSIPYQSAFGSSVEHVYAY"
FT   gene            92721..93107
FT                   /locus_tag="Pnap_4219"
FT   CDS_pept        92721..93107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4219"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39502"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV24"
FT                   /protein_id="ABM39502.1"
FT                   /translation="MAKIVNLQVLIDGDNDEEITEFLRVALMTARPDGSSTIEILDFHV
FT                   ASIDQPTDELTDSIVNETYLTGQAFDSWLIYSASEAKATGEPNDGYWSYQYGWTSRDLA
FT                   TRFEPVARDMPHSAGNDACMIIDI"
FT   gene            93235..93642
FT                   /locus_tag="Pnap_4220"
FT   CDS_pept        93235..93642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4220"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; KEGG: bpm:BURPS1710b_0084 H-NS histone family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4220"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39503"
FT                   /db_xref="GOA:A1VV25"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV25"
FT                   /protein_id="ABM39503.1"
FT                   /translation="MENPIDEVVKLNQQIAELQKKSEELKKKNRPVVVAELRERMAAYG
FT                   ITAQELTRPVPKARMLKEDFATPIKAVKGKIKSSPLPAKFRSPDGKNEWSGRGMAPKWM
FT                   NTLIEQGHSRDEFLISKDAPAQDKAAESAKA"
FT   gene            94256..94705
FT                   /locus_tag="Pnap_4221"
FT   CDS_pept        94256..94705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4221"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4221"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39504"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV26"
FT                   /protein_id="ABM39504.1"
FT                   /translation="MEAHEVLPGVHRVASLVKRWLLGTHQGSFSADHMQAYLDEFAFRF
FT                   NRRGSRARGKLFYRLLEQSVAMIPSPFGTSSPTQTPQKRGKSDLSHPALAGLRLRRSTW
FT                   KSTSAHGAAELPHLSGYPANLMALTCSSPLSSSNFSLRKVAHRVN"
FT   gene            complement(94730..95140)
FT                   /locus_tag="Pnap_4222"
FT   CDS_pept        complement(94730..95140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4222"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39505"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV27"
FT                   /protein_id="ABM39505.1"
FT                   /translation="MVLPYETMVSSFAAQDDIKEFLEFLGASDVLFGFDSNMDCSVQWS
FT                   RKDEVSNFPLNANGYIAMWMRARPWKRRPVVSERLNEQQEIELAVINFWYVLRDFVFSE
FT                   VPKRIFDQEKMLKVSEQQTQLLVKRMTLGTSA"
FT   gene            complement(95172..95870)
FT                   /locus_tag="Pnap_4223"
FT   CDS_pept        complement(95172..95870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4223"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39506"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV28"
FT                   /protein_id="ABM39506.1"
FT                   /translation="MISFQSIHRNQIMCINNSEAQAANYLTTAFKRTFDDVRVLTGVVL
FT                   PLPEGARLATAEYDCIVICNAGVYLFEVKGWNQCLVGREKVEAGHQWYLEQANGDRKHV
FT                   NDPVAQGSEKFQAMKGYLDARIAIKYYVVLPGTDVQISPTLPATILTAQDISYIPRLCN
FT                   SATKASKMYQKLDRETVALLADYIKEKSGVLTLNEHIANCNRFQLQKKAARHASGSGLM
FT                   AISVAPACCD"
FT   gene            96004..96990
FT                   /locus_tag="Pnap_4224"
FT   CDS_pept        96004..96990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4224"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   rme:Rmet_6302 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4224"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39507"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV29"
FT                   /protein_id="ABM39507.1"
FT                   /translation="MHNREHIEGQIALYLHPIKSILEDAEVSEIMVTADGCVWVEKRGN
FT                   IENSGVVLTEEKRKLTLINVAKAVGRDMLANTANAIVSTSVGGLRFAGALMPIDERGTT
FT                   LCIRKHLDPDKRPSLEQLVEWKMLTAEQAELLVRLIIVEKKNAVFLGPTSGGKTTLANA
FT                   VLGKIPSYERIGSIEDAHELAIRVANKDCYLTNPQIGITSRVLIQHAMRSRYDRLILGE
FT                   SRGEDTFDLIRALSSGHNGSITTIHGSSAREGLGTLEMLYQMSVPEGSNIPVETARGYI
FT                   AAAINLLIYTERRYEPADGGVFKSVRSVKEIALVKGIKNGEYEIDYL"
FT   gene            96962..97282
FT                   /locus_tag="Pnap_4225"
FT   CDS_pept        96962..97282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4225"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4225"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39508"
FT                   /db_xref="GOA:A1VV30"
FT                   /db_xref="InterPro:IPR007039"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV30"
FT                   /protein_id="ABM39508.1"
FT                   /translation="MVNMKSITSKRLKTAAVIALALVAGPVFAQSADTTGLCNLVSFIK
FT                   SIIGTVAVLAILLYVINSFFGKSALIGEIIEKVLIGCVVAVGATFLVTKTGLVVSCSSG
FT                   LI"
FT   sig_peptide     96962..97051
FT                   /locus_tag="Pnap_4225"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 30"
FT   gene            97293..97607
FT                   /locus_tag="Pnap_4226"
FT   CDS_pept        97293..97607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4226"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39509"
FT                   /db_xref="GOA:A1VV31"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV31"
FT                   /protein_id="ABM39509.1"
FT                   /translation="MASVDYPVLRRPRLRGGIGGNTAVLIWAITGMVGLVIGLPEGLFV
FT                   IIPALLIQGVMLWAFRTDHKVMEVYALYATLPDEFEAGIPAADSKKSSRPQFFGKGVSQ
FT                   "
FT   gene            97607..100072
FT                   /locus_tag="Pnap_4227"
FT   CDS_pept        97607..100072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4227"
FT                   /product="Type IV secretory pathway VirB4 components-like
FT                   protein"
FT                   /note="KEGG: pol:Bpro_5229 type IV secretory pathway VirB4
FT                   components-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4227"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39510"
FT                   /db_xref="GOA:A1VV32"
FT                   /db_xref="InterPro:IPR018145"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV32"
FT                   /protein_id="ABM39510.1"
FT                   /translation="MVIALKKEASESKSSHSELLPWLCHASPDWILCKDGSLLSGMEYR
FT                   CLDIDNISEHTLKKALLELQASLKTLDERFYVWWTIDKKRDSTRHKSNFPNDAAQKLDD
FT                   LIGKALDAGKMFNITYRMYILYTGETGMYAYMDNVRRLVNEENTSVITAMLKSLNPATF
FT                   TSASALSDARQLDQNLATAEGAVQQFMNSHSIMSLKRLSGWDLDNALLQSGNLSIALNS
FT                   TYKPPVGAMLDEYCALSDVKIGREVISVSGPNRTIFAANLTLKNYPTNLTPGLMERLVA
FT                   SPLEFRLTHVMRCLGQAAAVKTLKEVSNYYFMNQSTFMQRAIAKATSSEPGVDPGKADL
FT                   YMESLEALRRQTVEGLGWLYHAMTVTVFGTSLNHLEQEVNEVGRNLSDVPFIRERLGLK
FT                   ASFYSMIPGQWSMQQRLMLVNAEVAADCAPIYTIDQGSPKSQHFSETTGTYQPSLCLFQ
FT                   TVYGTPYHYNPHVGQLGHTMLVMPSGNGKTTFANLCLAQFQRYPDAQVFIFDRDFSCRI
FT                   ITGLVGGTHIDLKSGIKLNPMAAVNEGPMGRLWAREFLLQRLEESGTQVTPEDRNVIDD
FT                   TLLALSKTDQPISMGTVAGVLPRKLEAALAEWVNNGPYGMFDSTVDELSLESWTCIEMK
FT                   DIMAVDRLARAFLDHAFRMIMKRLDGRPTFIYLEEASFLLNSPQFLRAFDDWLKTFRKL
FT                   NAFVWLTIQSPESVSGIDDERVRATIADNIPNLILGYNQRLENHRELYKSMFGMHDEQV
FT                   NLLANLKPKRDYLLVADGICRVMGTNLSKDALAYLRSEMPYQDLFTKAQESGRTDWRDF
FT                   YIAEALKRS"
FT   gene            100075..100788
FT                   /locus_tag="Pnap_4228"
FT   CDS_pept        100075..100788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4228"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mll9607 conjugal transfer protein trbJ"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4228"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39511"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV33"
FT                   /protein_id="ABM39511.1"
FT                   /translation="MKLNIKKSLAIATIACAGFLPTFSQAMLVFDAANYSQTTITAIQQ
FT                   IKAQIDQVRQLQEQIKSNSANFAGKDIADLKREYDKVKRVYDSANALQNTLLGVQQNFD
FT                   NLKAMFGSGNYQDFGSMAVSIGDRAKAGDAVAKNLYDNSRRAQDQMKDAFDRHQKIVDQ
FT                   ASNVSGVTEATQATTAAVGVLIQQNNSMLAMMAADQTKKAVDASEINTEKQERAQAEMK
FT                   YQQNMSSELKKILKK"
FT   sig_peptide     100075..100155
FT                   /locus_tag="Pnap_4228"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.838 at
FT                   residue 27"
FT   gene            100795..102018
FT                   /locus_tag="Pnap_4229"
FT   CDS_pept        100795..102018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4229"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39512"
FT                   /db_xref="GOA:A1VV34"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV34"
FT                   /protein_id="ABM39512.1"
FT                   /translation="MRVLVHITIGFLLSLMACFSFAQDPVSIPAPVSAALAANTPAAVK
FT                   DSGNAQSLTVIQTVIENLFGKSNSGESLIKRFTGSGLTIAGSLTSTVALPLAGALALAS
FT                   MLWHIMLAMANRKSPTDAAIEGILFAVLTAFLISQYASIVRDVVKFGDMVITATGGTVG
FT                   ESVTNFMTGFLVKFIDVIVKGFSAFSITSWLTGSADMLFGVALMVLACFFAFTAMIELV
FT                   GVLLMGPVVVGLAIAIGPIFIACLASTFTRRWFNQWFNFLVGGAFLTAVTVIVLKLLTE
FT                   VVTAGVGAIGEGSVSGQALAMAMIAVGTAKIFAAIPNFADSILPGRTGAGQAVTSGDGL
FT                   GNSAVAVMGKAADPAKAALATAKAAANPGNALAQTSAAISNARTGGAVNNIRSGVATAA
FT                   SAVRKALP"
FT   sig_peptide     100795..100863
FT                   /locus_tag="Pnap_4229"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 23"
FT   gene            102231..102842
FT                   /locus_tag="Pnap_4230"
FT   CDS_pept        102231..102842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4230"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39513"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV35"
FT                   /protein_id="ABM39513.1"
FT                   /translation="MTWLKKWKLSSTQTLVLAALAFGSLSAQAQSKIHCLYNADAARYE
FT                   APLAWQNTLGAARANAMCSRVTGAVIPATPMMAASPVIAAAPVAPMAPAAAPPPERISA
FT                   PAQPVYSISSGEKVSEVLTKWAAAQGYSLVWDAPGQSDLSLLTGTVEAQSLTEAVGKLV
FT                   TALNSKLAGKRSANNQETQFAFPVEAIAYSNNVIAVTVKQ"
FT   sig_peptide     102231..102320
FT                   /locus_tag="Pnap_4230"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            102875..103348
FT                   /locus_tag="Pnap_4231"
FT   CDS_pept        102875..103348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4231"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bbr:BB3199 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4231"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39514"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV36"
FT                   /protein_id="ABM39514.1"
FT                   /translation="MKTTIVLVALIATSGLSFSQVRFIDAPYPSSVSRPALQMPVAQQV
FT                   AMPVYQATPVSAPAMQAGFEATPADANLRKALVRWTKMIGWTFEPEHWTLDRDIPIAGS
FT                   ASLGSDFKMATRLLLSSTEMTDLPAQPCFYSNNVLRVIPLNELCSRQQVNKTQ"
FT   sig_peptide     102875..102934
FT                   /locus_tag="Pnap_4231"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.990 at
FT                   residue 20"
FT   gene            103411..105033
FT                   /locus_tag="Pnap_4232"
FT   CDS_pept        103411..105033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4232"
FT                   /product="lipoprotein"
FT                   /note="KEGG: bbr:BB3198 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4232"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39515"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV37"
FT                   /protein_id="ABM39515.1"
FT                   /translation="MRQHLLSLFVTAALATIALPGCGTYNGKQEIKQSLGETRQHIDAM
FT                   ATASNSRARDMGINKFNGQDVGAPWIAGKSIPLSKEVSVPSQLRKNVRTTVLSSECANA
FT                   VTLRVVANCITDATGLPVRVKADANLPIASFVPRASAGAGPAPAPATRPGEAGNSGANT
FT                   TRVFTPEAADISLTRLLDTISAVYSVSYRLTNDSALEFYRLDTRTFRIKSLAQKLTAKT
FT                   TQSTGFDNNSITTFEIKEADAIDAIGKTITAMGTMAGSINVSHETKAVTVTDTPEVLDS
FT                   IARYLEEENKRLTRRVTLVVDQFYVSDKDNREFSLDWNLVYGALNVSSASRAPTTLAPD
FT                   TAGAFGAVANTGRFAGSGLLVKALSEQGLMVQQRSFPLSTQNGSPVSIGLPTIFDYVSE
FT                   VTLTQTNAGAVNSQTAPSVKQKEEKIGTYLTITPEAQDDGQVIISANFQDRTGVLTPYT
FT                   VQAGGNSSTIQQRNIDEVSNIVRTVVRVGVPTVIGGLSETVDNSKDRRLVDGAPILLGG
FT                   SDSLKKNRRSMILVVTAVAEDGV"
FT   sig_peptide     103411..103494
FT                   /locus_tag="Pnap_4232"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.909) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            105034..106392
FT                   /locus_tag="Pnap_4233"
FT   CDS_pept        105034..106392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpe:BP1830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4233"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39516"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV38"
FT                   /protein_id="ABM39516.1"
FT                   /translation="MSANNQLAEPVLLGDGSVAPPGVTIILGMTWKVLLGQKLGAMAVQ
FT                   AAVLAKASHYTHTPNIGSVGYTNLKPGVKTTYISAAGIVASQKTMGDFLIGLALNETDT
FT                   WLCGVSNGSVVSGYDIVVNDALTFEKIVNAFKVRFEEAHLIGDVELGFAAEYGWDAISE
FT                   GLASKEFRKNATIRPTSKGLSERFEAVPKKVLYIGGIALILLVGQRFIVPAISNVFHKP
FT                   KEIAVIDPSEAWKDALDEWVRAHPVSSQGSLNELLDALANQPLVVAGWQASAFDCVWGQ
FT                   KSWQCTTKYSASKRSHTNQAFEAAKPKDWITTFTPMRDVQVRYDIAASAVKLDVKSLKP
FT                   VADYELITMSQLQQITPLIADSAAPMGTFVKVPVPEPKTNEGQPIALPADMLIPKVSML
FT                   KIIAPLRDIAAFQTWINDVAWTNVSLRIERGKQPSAKDSAITMELKGNFYAKN"
FT   gene            106379..107233
FT                   /locus_tag="Pnap_4234"
FT   CDS_pept        106379..107233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:510377.134 mucin-associated surface
FT                   protein (MASP) Pfam: Prosystemin PROSITE: ALA_RICH"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4234"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39517"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV39"
FT                   /protein_id="ABM39517.1"
FT                   /translation="MPKTNFFSHFALSLLGALSLHASAQNVPAVAGTALAASAAAASAA
FT                   RPAGAASGVAVARVSADTKRAEVSKQEGKGPVGTLSSAKTIRELLEIDDQIALSKERKA
FT                   LADETKKTEKEPVANAPVNLTLAVTARKAAENKANAIKQANAVASSIKIDAIMGIQGER
FT                   VINANIAGTQTWIRETNPTPIAGWLMVAVKGSCATFERNEASAPKAKKVRAAKGKKLHQ
FT                   SNGVQTTEQTVCFKRPEAFLPPPAFGSSGGGAGAMPMPVPLPFPAPFSTPPRVAPVAPI
FT                   ATL"
FT   sig_peptide     106379..106453
FT                   /locus_tag="Pnap_4234"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 25"
FT   gene            107238..109205
FT                   /locus_tag="Pnap_4235"
FT   CDS_pept        107238..109205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4235"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bbr:BB3195 putative general secretion pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4235"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39518"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV40"
FT                   /protein_id="ABM39518.1"
FT                   /translation="MAMVNLFRKLFLRPALVENQVIASDIAAAVNFRPRKPLKVSVADA
FT                   MADSEDIPSNIEAFATSVASTNVQHGPFGKSISVETIKDFATLPLLFEGLVNDFQLGSH
FT                   LGYNVQPALFGGVQGSEAARIAILVNPLYANSDEVVELLSILANPKQHKHEFKLWEHAS
FT                   RVIIPHSLMLSLSRGEIDKNSLSNRRKINSDPKKHSFYVALENIIQWGVRQNASDVHFN
FT                   LNFNEEHSEVRFTINGRYVAPQMWRMPTQTMFQILSVAWMSGTGGNGPSYDTRVEQQCR
FT                   IALKIDDKPIMLRWASASTESPGPSVTTRIIKSDANILTLEQLSYLPDQIATYNRAMNA
FT                   EKGAIILAGVVNSGKSVTIASLMGSLPDYRKKLGIEDPVEILIPGMLQKSINRPLEGDT
FT                   GKEFDAIAKTAKRFAMNDILIGEIRDKATGMLMVDIVLMGTSVYCTTHTPSALGAFDKL
FT                   ASDMVGVSRDFLSVPGNVKLITYQALLPKLCTCALPLKCITQQGHAEYKASGNDYIKRL
FT                   QRLYDLDESMLRIGNREGCPKCRHEGLPELNGFKGRTLAAEMVEPDETLLSMVKQADSI
FT                   GMRRHVAELRGSTRFDDPLMVGKSAMECAVYKMSTGILDPREIEPRFHSFEREEMMRAS
FT                   SKHYAEHVEKQVYTALKKVR"
FT   gene            109205..110419
FT                   /locus_tag="Pnap_4236"
FT   CDS_pept        109205..110419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4236"
FT                   /product="putative general secretion pathway protein"
FT                   /note="KEGG: bpe:BP1833 putative general secretion pathway
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4236"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39519"
FT                   /db_xref="GOA:A1VV41"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV41"
FT                   /protein_id="ABM39519.1"
FT                   /translation="MSQTHDVETVGGKITFSGVLSDIGQFFKIFNDPVASAARKFKKSL
FT                   PEFYQSTADRIENAKELKYSTMFERDAVRYSKNEDGKPIKTPRGVLSAHWATKIMDSGG
FT                   DLALTFTGTLPREDIALIRMGQAAGAGALPSTLRDLARISLLISRAKSIFMTSTFMGVL
FT                   AIVIMLTVMIITPMYTVPMIKKTFVIPPEYIPAIAKKLFAFSDFIESYLLYIVGGVAML
FT                   LYGVIWSLPNYVGKYRKKLDQYFIWGLYRDLQGALFLAVLSTMVKKRGNVSDNLMVALQ
FT                   QMANHTTPWRRWHITKMIENMQNLDLSSLDNSTAITNALNTGIMDRESFFFLVDVQDGQ
FT                   GLAIGLQKAGERVEGPTLTSVQKQAKIIAMLLLGAAFGIVGIWVGAHLSTSKAMIDALK
FT                   SFMSS"
FT   gene            110651..111295
FT                   /locus_tag="Pnap_4237"
FT   CDS_pept        110651..111295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4237"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5457 type IV secretory pathway
FT                   component VirB8-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4237"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39520"
FT                   /db_xref="GOA:A1VV42"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV42"
FT                   /protein_id="ABM39520.1"
FT                   /translation="MAQAAMQVYFERGSLEAIQTHRWRLISISMIVVTVLQSAALALLI
FT                   PLKTVETIQINRDGQGRVAVANADAQRFTADDGVKQAWVIDWATDLTEINSATWQRSVE
FT                   RASSRSLGVAVDQIRDYLSRTENQPAQLLADKPSYIREFSRQTVNMIDTNVALIRYSLT
FT                   SRSAPGAPKVVKSYAMTVTLATVKQYSREDVLRNPTGLAVQSFNISEELPK"
FT   gene            111292..112134
FT                   /locus_tag="Pnap_4238"
FT   CDS_pept        111292..112134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4238"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: rbe:RBE_1012 VirB9"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4238"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39521"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV43"
FT                   /protein_id="ABM39521.1"
FT                   /translation="MIRFRFHSATTALVTGGLLAMCCQGNAAVSSPPNSAVNGLSVAVP
FT                   GGLDSRIRVFAYSPDVVYTLPVTVGMHTHIPLGPDEELIEKPKMGETIQWRVSGNQNNI
FT                   YIKALKADVSTSLTLVTDKRVYQFELVATTRATERIQKAYFVYPDDEEGILLNQQAKTS
FT                   KRADAAAAEEERKRDQELSPQPISPNNLVFFRVEGNKEYERMHAYDDGRMTFIRMPPGI
FT                   QDLPALFLVDTDNKLVPINYTVLDRKGHDDRDVLKVERTNPKWLLKIKKSVEVKLTKE"
FT   sig_peptide     111292..111375
FT                   /locus_tag="Pnap_4238"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.900 at
FT                   residue 28"
FT   gene            112141..113439
FT                   /locus_tag="Pnap_4239"
FT   CDS_pept        112141..113439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4239"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   pol:Bpro_5455 conjugation TrbI-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4239"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39522"
FT                   /db_xref="GOA:A1VV44"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV44"
FT                   /protein_id="ABM39522.1"
FT                   /translation="MASNVQPPPLMTDPLNMSAPEELIDPISREQQDEISRQQEAMERG
FT                   KPTRNLKKLGIVLVGAAVAGYMLYPSLFPPSKEKKTVVVEKSDAHQETPGSIIEQLKSQ
FT                   PKPPPPTVEVSVPPPQVHPTPPAGMSNNPDGASVLTPRQIEANRRETIMASAMEPSDIN
FT                   ITLRDQPRKKADSEADGPDSALARALAQQNGILEKSLAQPVEKPQPLAKGSNQDEFLLR
FT                   TRNASLEEATKLAPARAAAALYQGTIVQVILDRAINTDNPGTARGRVRSDVYDSVTQSI
FT                   LLIPRGSLVILPYLNSMLVGDSRILVAGERLIFPNGKSMSLSGTPAADMQGASGIPADV
FT                   DNHFYEMFKTSFMVGAASLLLPKSQQNVSISDTVSGGSRTGGSILGTTLYDTIKQISAR
FT                   NASIRPTGSIEVGEPFTLMLSKDIELEPYRGRK"
FT   gene            113436..113771
FT                   /locus_tag="Pnap_4240"
FT   CDS_pept        113436..113771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4240"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39523"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV45"
FT                   /protein_id="ABM39523.1"
FT                   /translation="MNMAKIKIASAVVLMAASALLGGCAFQSFRVDEASMRYAEALPQG
FT                   LSYAWRQGGKVWLVPAKNVFLGSARTLSGQTMMMASEGSYFTIADAPPSFYIEIDSRIE
FT                   PLSIPIQ"
FT   sig_peptide     113436..113519
FT                   /locus_tag="Pnap_4240"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.291 at
FT                   residue 28"
FT   gene            complement(113838..115505)
FT                   /locus_tag="Pnap_4241"
FT   CDS_pept        complement(113838..115505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4241"
FT                   /product="superfamily I DNA and RNA helicases-like protein"
FT                   /note="KEGG: rme:Rmet_6048 superfamily I DNA and RNA
FT                   helicases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4241"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39524"
FT                   /db_xref="GOA:A1VV46"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV46"
FT                   /protein_id="ABM39524.1"
FT                   /translation="MLITAQQTAISTANLFGVTKVVAYAGTGKTTTLESLAKVQAGQGL
FT                   SGLSLVFNKSAEQDAKKRFPKEWVTVKTINGLAHGVVSPRYKGKFRGYSLKSIEVIKFM
FT                   GLAWNWIFAKQVLDTLNFWCASDSHEFPKTAMSFNGPPVGPPDMLDYAAVVAKQLWERM
FT                   IDLHDEVPISHDGILKLYQLSQPRLSYPYLMLDEAQDTNPVTWDIMRRQSSPLVIVGDP
FT                   YQSIYQFRGACNAMTDAQAVQTFPLTQSFRFGQYVAEIANALLWGFYAETTPLEGLGPN
FT                   TRVGPINFLSPHAVISRTNAAIFSQAVIAMQAGQKIGFIGGVQGYNFNKIVDTWYLMDG
FT                   QTGEIRDPFLKDFHNFEQLAEYAENANDLEVKRTIEAVQTYGASVLQIVPAIHEACVQD
FT                   LSKAHLTLSTAHKCKGSTLRSVRLADDFPDLLNGQGEMLATEELSRQEVNLYYVVLTRA
FT                   THELQLNDTMLAFLSSMEMDTDRFRQNAGAAQYAVVPDRPAAPEAAAVPLRRIPKAWLP
FT                   EGGQMPGAFFDESTCQPTPVVAKPSDMPSRGNQIDLFS"
FT   gene            complement(115527..115958)
FT                   /locus_tag="Pnap_4242"
FT   CDS_pept        complement(115527..115958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4242"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39525"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV47"
FT                   /protein_id="ABM39525.1"
FT                   /translation="MNVPIHGTPKACEVFEMCHPLDGDKIYFDGMRNANIIRHGHRWPM
FT                   WLMPIAMNYQMMSYPEPARAGLARIKPIQSSWSGGYLALDDILQSQESMRFPPGPTTLL
FT                   SEDEVRLWMENCDLMRTCDFGSNEWRAIRPIKKLRQIYK"
FT   gene            116229..116765
FT                   /locus_tag="Pnap_4243"
FT   CDS_pept        116229..116765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4243"
FT                   /product="Lytic transglycosylase, catalytic"
FT                   /note="PFAM: Lytic transglycosylase, catalytic; KEGG:
FT                   bcn:Bcen_0007 lytic transglycosylase, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4243"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39526"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV48"
FT                   /protein_id="ABM39526.1"
FT                   /translation="MFKLLKKEPKQSEGTHLLHRVVRSPHTRFFALLGLFLVWQPSANA
FT                   FCFAEASARYTVNEYILRAIALHESRMNPSLQLVNSNGSVDIGLMGINTVHISPGERLY
FT                   RAGMTGSMLLDPCTNVMTGAYLLRLKMNRFGNTWTAVGAYHSITDQYNVAYQGRIRASL
FT                   DKVMRQAQAAVRVDN"
FT   sig_peptide     116229..116366
FT                   /locus_tag="Pnap_4243"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.660) with cleavage site probability 0.352 at
FT                   residue 46"
FT   gene            complement(117029..118330)
FT                   /locus_tag="Pnap_4244"
FT   CDS_pept        complement(117029..118330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4244"
FT                   /product="initiator RepB protein"
FT                   /note="PFAM: initiator RepB protein; KEGG: pol:Bpro_5513
FT                   initiator RepB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4244"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39527"
FT                   /db_xref="GOA:A1VV49"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV49"
FT                   /protein_id="ABM39527.1"
FT                   /translation="MHMASKSIDDQIGLFSTKDVPNAFRKAVQVVHSKPMAPLSLVQRK
FT                   LLNSWLKNAANTPHDSEGWWAIRIDAVCNEIGFNSNNRSYLKESSEALMRIIFTWDVLA
FT                   PEEKRARWKASVLFPEVEITRYLIKYQISSQLQAHILKPEMYALIDQAVLRKYRRAASA
FT                   GIYEHCIRFEKINQTPAIPWQEFRDIILGVSADKKSYKEYKSFKQKVLNPCIAEINAEG
FT                   AIQIELRETKVGKTVEGVFFKVQKPKLAATSTEDVSADEAKLIGNMVLLGIMHSEAKRM
FT                   LQQNPASTIEQALAYTNERRASTKAEKLENPAAYFRKALSQRWQASVDIEDAVDKVAPA
FT                   VRPQKQDIPAMYKASKIDEADEYFQELDGGDQSELISMYNNQQSMKTLLLKSKPTKPSQ
FT                   AAFNQWLMRHLWGDPTPEQYIEFAQNLLNTRSQT"
FT   gene            complement(118850..119311)
FT                   /locus_tag="Pnap_4245"
FT   CDS_pept        complement(118850..119311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4245"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39528"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV50"
FT                   /protein_id="ABM39528.1"
FT                   /translation="MNGWSCARWPRRALPAMLSWPRPADAVTMDEARFQSLARRAKVLT
FT                   GDYGAGYQTRRRRHHHGKEFCDQREHELPEVRQDEYCRGYRDGLTGQEPTPLVGRPLLP
FT                   AGASCRDKRPRTVRLDDEHWEKLRRLGTDWLERAMDRAREPDDSTRKSG"
FT   gene            120157..120969
FT                   /locus_tag="Pnap_4246"
FT   CDS_pept        120157..120969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4246"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0019 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4246"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39529"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV51"
FT                   /protein_id="ABM39529.1"
FT                   /translation="MSRPRLDEQLKMSHPLVRLTNLMNWDEIERSFGAHFASSLGRPAL
FT                   SPRLIAGLLYLQHANDASDEAVVATWLENPYWQYFCGQTYVLPIDPSSLSRWRKRVVQE
FT                   GVEVLLAVTIEAARAAGLIKKSSLDKIIVDTTVMPKAIAHPTDSRLLEKSRQHLVKLSD
FT                   EHHLALRHNYNRQAPRMAAQIGRYPNAKQYNRMRRTSPSSTKVGSNSGGSWSTSSIGTA
FT                   AFSLPFQRTTPARPAHAAGMSPGKTGKRKPNSSASIAATRTTPMSSAR"
FT   gene            complement(121145..122119)
FT                   /locus_tag="Pnap_4247"
FT   CDS_pept        complement(121145..122119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4247"
FT                   /product="ParB family protein"
FT                   /note="TIGRFAM: parB-like partition proteins; KEGG:
FT                   pol:Bpro_5044 ParB-like partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4247"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39530"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV52"
FT                   /protein_id="ABM39530.1"
FT                   /translation="MSGFKKRIVSSDRVAQVEAAAAGSTLIGDPRLSPSIPESDKVNPN
FT                   LGASQDVEILKSTYEVGRVYDVPLGEIKSNPFNPRYLYTNTAIDEMATSLTSGGQMMSA
FT                   TGFIDEFGAVVLIEGETRLRGCRAGGLLTLRIEIKTRPNSDAALYEEARTANVERRDQT
FT                   PLDDAIKWKELLAKKIYPSQSGLAKALKLGEDHVSRVMSLNELPSKVIHAAAENPGLLS
FT                   LKMLNAIREYFAVKGEESTLELIFEAGKLSLGYRDVVARRKAAEKGPVKRTRSTKEALD
FT                   FKGVNVELRTFEEDGRLELSLKGLSPEDTEEIRTKIRAVFKKM"
FT   gene            complement(122119..122787)
FT                   /locus_tag="Pnap_4248"
FT   CDS_pept        complement(122119..122787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4248"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: rfr:Rfer_4285 ATPase involved in chromosome
FT                   partitioning-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4248"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39531"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV53"
FT                   /protein_id="ABM39531.1"
FT                   /translation="MVITIGAEKGGVGKSRLATNIAALAACNGVDVVLLDTDKQGSATS
FT                   WSRIRNEEGIVPSIPVLALPPNPARELANLSGKYTLVVVDIGAQNYRTMLECSLLSDLV
FT                   LVPCGPDQQEIESTLNVFSHLKEMDSRHELGHIPAHIVLTRVSTTETAKATTELREYFK
FT                   EEGLSVFDTQIAQRASWLASGKTGRALHELNSRDRSVKATEEIQALYTEILKRINAGNK
FT                   "
FT   gene            complement(123239..123628)
FT                   /locus_tag="Pnap_4249"
FT   CDS_pept        complement(123239..123628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4249"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   ftl:FTL_1926 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4249"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39532"
FT                   /db_xref="GOA:A1VV54"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV54"
FT                   /protein_id="ABM39532.1"
FT                   /translation="MQQPDMEEVMVDSTCCRAHQAPAGARKTSGPQAIGITRGALNTKI
FT                   HAVCDALGNPLRFVLTPGQRHVSKPVPELLDGLQAKALLADKAYDRDKIVQAAEKRGMQ
FT                   VIIPCRVNRKKTSASWTDTATRRGT"
FT   gene            complement(123668..123868)
FT                   /locus_tag="Pnap_4250"
FT   CDS_pept        complement(123668..123868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4250"
FT                   /product="putative transposase"
FT                   /note="KEGG: sco:SCP1.214 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4250"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39533"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV55"
FT                   /protein_id="ABM39533.1"
FT                   /translation="MTHARHTFTDAQWQRIEPFMPPCKGRPGGAHRTFFFALLWMARTG
FT                   APWRDLPERLGKWSMVYQRYA"
FT   gene            complement(124072..125946)
FT                   /locus_tag="Pnap_4251"
FT   CDS_pept        complement(124072..125946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4251"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   rso:RS01673 putative integrase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4251"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39534"
FT                   /db_xref="GOA:A1VV56"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV56"
FT                   /protein_id="ABM39534.1"
FT                   /translation="METCPIRKSPMKSTPFFAPTKYVMKIGLHHFAHLRAIAEGVDARE
FT                   AGKLYLGVEHGHEAITASRQTIEAVRSIARRHGEKSAWRLIGLTVKPKTVAFLKSVEDG
FT                   FVNIDKARMPSLEQYIEEHDLDDWGAAEVLEMYRDAYPASEKGVASSTRRNRLRQRQLA
FT                   LLSKLEALSAEVPTESDPVAGWFDDVTASKLVTAGLINLGMLRQAIDSAGRWYRFMPGV
FT                   GKLKAERIAQFLGSIMPATAASTRPAFALAMMPSQYTPYREIQTIESPACGSTPILSGS
FT                   SVLKADNDMDAVNAWIAARSGSKLTATVYLREAVRLMLWLQQERHAIGFKDMTVEDCLA
FT                   YMAFLQNIPPSWISRRKAKPFEAGWAPFRGQLSHDSHRQSVIVVSALFLWLHSASYINQ
FT                   NPWVLVNRKTGDDKNRIVKESKSISEFGYSEIIRYIDAQPPTAASERIRFIFKFLEAVG
FT                   LRSMEFLHARLKDFDKQPEGWVLYVHGKGAKNRYVFIPNQAFEALQRYLQFRGLGGIET
FT                   ADPKAPLISSTLDSMEPVGYRPFYQHVKSWTLRAIQYSTLPAKERTQLERASPHWLRHT
FT                   FGARSVARDVAMDAIQAQMGHASIETTMSIYGRAPLKRRAEELSKAFT"
FT   gene            complement(126243..126839)
FT                   /locus_tag="Pnap_4252"
FT   CDS_pept        complement(126243..126839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4252"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4252"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39535"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV57"
FT                   /protein_id="ABM39535.1"
FT                   /translation="MPKSQYLELGVGSLDDSLRSALAEWVKAGGNYIAQSENEVIAAQY
FT                   SWLRPVLNLLLYLCADVEYTRRGKPGHPANPELTRTRRDGWRLFPAAGPTKWDVGVRLG
FT                   AKLRAAYQAEQTSGAGGEHSSPRGHFRRAHWHGFRLGPRKREDGTEISLDARKLYFRWL
FT                   PPTLINVGDIDGLPAVVRPVVHSHKTVLIAASTGR"
FT   gene            126975..128513
FT                   /locus_tag="Pnap_4253"
FT   CDS_pept        126975..128513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4253"
FT                   /product="sigma-54 factor, interaction domain-containing
FT                   protein"
FT                   /note="PFAM: sigma-54 factor, interaction domain-containing
FT                   protein; ATPase associated with various cellular
FT                   activities, AAA_5; SMART: AAA ATPase; KEGG: hch:HCH_05030
FT                   sigma 54-dependent transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4253"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39536"
FT                   /db_xref="GOA:A1VV58"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV58"
FT                   /protein_id="ABM39536.1"
FT                   /translation="MKKTTWLVAWIGKTDHEAAEGLSSANQGPIAGALLGAQRFDKVYL
FT                   LTNYPHARSVVFCTWLEATTGYLPDQVELYDIDLPSPIDYAAIYSAVCSNLLAARLPRD
FT                   EVQLTFHLSPGTPAMAAIWIILSKTRFPARLIQTSRERGIEPVDFEFDLASDFLPEFLE
FT                   RGSARIERLSASPVGAVAQEFVAIVHQSTVMREQIELARRVAVYDVPVLILGESGTGKE
FT                   LFAQALHAANPKRKNALFVPVNCGAIPTELANSELFGHAKGAFTGAVKSHDGYFTQADG
FT                   GTLFLDEIGDLPLDAQVRLLRVLQNKEVTPVGSGTARKVDVRIVAATHRDLAADVAVGR
FT                   FREDLFHRLAVGILRLPPLRERRGDLDVLIDLFLSAFNDDARDRPEAQHKVLSESARKL
FT                   LHTHEWPGNVRELQHTLLRAAIWSPGESIDTRDVESAIFQVRRISDAVLNQPISQGIEL
FT                   QQLLDRVARHYMERALEHTGHRKAAAAKLLGFSNHQTLLNWEKRLGVGKGESDD"
FT   gene            128725..129060
FT                   /locus_tag="Pnap_4254"
FT   CDS_pept        128725..129060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4254"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39537"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV59"
FT                   /protein_id="ABM39537.1"
FT                   /translation="MFNSITSLPPPLFPLSLTNHAAIRMQQRGISRAALQAVLDFGRRI
FT                   HAKGLTFYVVGRKEVALYADRGVNLANFEGLQVLVAADGAVVTTYRSRDLHAIKVQARG
FT                   RPSKQHH"
FT   gene            129168..129890
FT                   /locus_tag="Pnap_4255"
FT   CDS_pept        129168..129890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4255"
FT                   /product="von Willebrand factor, type A"
FT                   /note="PFAM: von Willebrand factor, type A; KEGG:
FT                   hpy:HP0428 phage/colicin/tellurite resistance cluster TerY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4255"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39538"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV60"
FT                   /protein_id="ABM39538.1"
FT                   /translation="MKSAPSDSAKTTPAATRLKAFAAPQARPLPVIVLADVSGSMSENG
FT                   KIDALNVALKEMILSFGKESGLRAEIQVGLITFGGREAHEHLPLVAAKVIGGVEAFKAN
FT                   GGTPMGSAFALARKLLEDKEQIPSRAYRPVLILVSDGAPTDAWEAPLADLKASERGQKA
FT                   TRFAMAIGADADLDMLAQFPNDREAPVFKTHEARDIGRFFRAVTMSVVSRSTSAAPDQP
FT                   VTLDMEDGLTDDLDLDTL"
FT   gene            130056..130607
FT                   /locus_tag="Pnap_4256"
FT   CDS_pept        130056..130607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4256"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39539"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV61"
FT                   /protein_id="ABM39539.1"
FT                   /translation="MQAAQQVARQLPLQAGAWRDVPAREVATRIYRRWLATVPWTEKSS
FT                   AATTLLLLACDAQGYARIWQIGDGLVLCRLRGEVQVITPERTGFGNQTRALGVQRAWSD
FT                   WNTASFRLEKPDDLVMLMTDGVADDLPAPTLDGFTAVVHRELAQRSRRQARRWLTHELT
FT                   HWATPQHADDKTVAVVFKDK"
FT   gene            130614..132041
FT                   /locus_tag="Pnap_4257"
FT   CDS_pept        130614..132041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4257"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; SMART: serine/threonine
FT                   protein kinase; KEGG: hpy:HP0432 protein kinase C-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4257"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39540"
FT                   /db_xref="GOA:A1VV62"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV62"
FT                   /protein_id="ABM39540.1"
FT                   /translation="MNTSNNKNQGSAVKKQRVQDDRGTVYELSEKLAEGGQGVVLRTRH
FT                   DSRLLVKVSKWPDSDPRTQAWQRQIQVVHRMPIVENELPIAMPMALIVKPRAGYVMELM
FT                   EGLVPLEDLLIQAQEAFNQGNGLQGFVASGGLDRRLRLLARLARVMAKVHGLAIAHGDL
FT                   SPKNVFVSSSHEHAQVWLIDCDNLSYAVRNSSLQLYTPDYGAPELLRGEAGISTYTDVW
FT                   SFAVMAFQLLAALHPLKGGEMVDQDSELETPALRGELPWVDHPDDERNRASMGVSRDLV
FT                   CTPALQQLFDRCFRVGLINAEERPVMSEWAEVLEAAAAQQVLCSTASEGCGSTFLWNAA
FT                   LVCPFCDTRHAAGTALRLSHFVVAPLSELGEDAKPPDRWIPTYFHQVIALQPVELRAAP
FT                   PGTANYSESELVATVWIDGDELVMRPASGANVLFQASGSSKLVPVPRRFSLPRNSVPHA
FT                   LHFGGSAHIHDAWRFKW"
FT   gene            132049..135375
FT                   /locus_tag="Pnap_4258"
FT   CDS_pept        132049..135375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4258"
FT                   /product="Superfamily I DNA and RNA helicases and helicase
FT                   subunits-like protein"
FT                   /note="KEGG: hpy:HP0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4258"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39541"
FT                   /db_xref="GOA:A1VV63"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV63"
FT                   /protein_id="ABM39541.1"
FT                   /translation="MKLQETPFMLKDLLGARVTARDFDPTQWQVGQEVVLRLRQDELLL
FT                   RQNDQVTALALTSESGSMDFHAQNLDALWLLVRVKPGMVWLQCLVPMQTCQCEPGLDFG
FT                   ADQRTADSLHQQQLIGQPDIAEAMRWLMEEFVCTTEDGSSSRVFMAIHARQDQRQMQLV
FT                   GRRYVVDLKRDAEQALWVERIAKRRRESDEPFALLNGHNRFVDASQGMQAQTGAQRAIL
FT                   DAAVNSFGTYLELWHLYGQKEWDKDVQRASELKALRYSACQPASEEGGGWRLSVQRDEL
FT                   KEFSQRWRTLAGDDDQLEIDEDAPDWSSEHYTDLSVRDKRRLFRGKPQWRAEHLILEGE
FT                   SGTRPPQAGYVYLSLAGNRTQQERRQHARRAIEAGLGVPALRNLLQDLPTPTQRPSRLP
FT                   GLTVYARQSFKSGRATDKQEEAIRVALNTPDVALIIGPPGTGKTQVIAALERRLAELNE
FT                   GQVIAQEVLISSFQHDAVENALDRTDVYGLPAVKVGRSSRQEGVDPVQAWCHKHEVILD
FT                   KRLDELSSQEPTQALLQQLGKLLNSLLILGTPSSRREESFLALEGLLARLATEARIRPS
FT                   SRWQTDWEAYREHAADQPTSGHDLMPGRRRQLTRLVRGLRTLASSFEDDGPQRARIALG
FT                   LLQEVPGLLTQQDKALLQRASSLNAVEPTLLAELAVLRDQLLDRLRPDSRSATVRSQFD
FT                   ASTLALLQRLHTELADKVAATRHHQYGVLERYRDAFRSHPGWVRKAIENYSSIVGATCQ
FT                   QSASRQMSELKNTAGDSMAGMQFTSVVIDEAARANPLDLFIPMALAKRRIVLVGDHRQL
FT                   PHLLDTDIEEDIRAERGDQVHSNTYKDSLFERLWRQFKQREAADGFSRVVMLDTQFRMH
FT                   PRLGDFVSQQFYENAGLGKVHSGRKAEDFIAEVPGFGGAVCAWRDVSAEAGREESHGTS
FT                   RRRRPEAKQVAREVQRLLTVLQQDMSVGVITFYAAQRDCIFEELAGLGISEKGEGGWRV
FT                   RPEHAANVQCAERLRIGTVDAFQGKEFDVVVLSVVRSNPLPLGLREEADSEEAYEKPAS
FT                   RKYGHLRTSNRLNVAMSRQRRLLVAVGDQAMFSGKAACQAVPEMNAFLELCQQEAQHVS
FT                   A"
FT   gene            135362..136801
FT                   /locus_tag="Pnap_4259"
FT   CDS_pept        135362..136801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4259"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4259"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39542"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV64"
FT                   /protein_id="ABM39542.1"
FT                   /translation="MSAPERYLRWNGRSPRGKKLPLLWPVLVWTVLAPQASLRLNVFQE
FT                   AILGLLHAGERDLNRLASLLELAPELVAYIIAKELQPMRFVDSRQHVTPEGVKLLKGET
FT                   GREPRLTLQYAFQDAVFGQWLPRLSTNLPEVMPREGGRAERPEFMFNRDSGWVDRPFLL
FT                   PRRDWAGPPEKKLVLQAWRQCQRAQAQSSQDDTGFVADFSSEDIDFVGDQPMQARVWCD
FT                   LYINPDDPQPWLVSDPWHLTGAAKWLREPLQKELPRFAQLAERIGKLLPEVGASDKETE
FT                   LQVELKLAAMPHLTKPEHALLREHLGRVMRQRGRLEQQERTHQEELNSLAQECASLLEA
FT                   IVKWLLERWPVDASDWPRTHWSRQHGSELLSQLPLRADLSRQVIAILCGQEAKVVRLAV
FT                   MLKDRPFKALLFGALLCTHEHADHPLRHLPANSLQWDRVLELVDKRNKGSHASGQSMER
FT                   HEMLEWADFTLAWHEQFKPYF"
FT   gene            136931..139267
FT                   /locus_tag="Pnap_4260"
FT   CDS_pept        136931..139267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bat:BAS0873 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4260"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39543"
FT                   /db_xref="GOA:A1VV65"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV65"
FT                   /protein_id="ABM39543.1"
FT                   /translation="MFATVKQAAPVLKMDAPHWDEDQVKDLWGKLPTPEQLRFQVFTDQ
FT                   FTQLGTQMKEAHERFVAAESDFNAQQQAGDAKLAQEISRLGAEHQAISDGHAALSAERE
FT                   HLRTTQAALENERAGLQQHRLAITRQEEHLTVREAELRGGLVAEREQSLAELRKQVSDL
FT                   ETLRNRLPADMDKERQTLLAQARLDAQALMASAEQHAATLHGREIRLNTLELELDKRNE
FT                   RQQMNEELLQVRCASLTKEIEEGFQRQLDDKEEQLQRRLKDLDKLHNRIDQQQSELDGL
FT                   ESLRDQVGDDPQRMLDELDALRQDKRALDREVQALRANRSEDDANELRSQRDRLQERLT
FT                   KDENELFDLRHRESVWRSSVTEQQDWQKARKVLEKNRELLHDVVDRLQSDVDGMLSKQK
FT                   ENTVFPELTRMDLELIKPVHTDPVPELKHLVGDLQARILYAEPGKELHFRKEELQLFVG
FT                   GLAMSQLHIFQGISGTGKTSLATAFAKAVGGECTIVPVQAGWRERADLLGHFNSFEKRY
FT                   YERNTLQALYRAQTEADQDRLHIVLLDEMNLSRPEQYFAEFLSAMELSERDRWINLMEA
FT                   RPAHGAPTKLRNGRDILLPPNLWFIGTANHDETTNAFADKTHDRAFVLELPKQDTVKEK
FT                   IAKPQSRASWSFESLNRQFNKARDKYKDQIAELQTLINQSSLTTLLSETFRLGWGNRLE
FT                   SQMQRFVPVVLEAGGSEALAVDHLLASRMFRDGKVIGRHDVDANKLHQVEDALRVMWED
FT                   CELTGEPTRCLAALESDIERLDSGR"
FT   gene            139264..141159
FT                   /locus_tag="Pnap_4261"
FT   CDS_pept        139264..141159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4261"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39544"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV66"
FT                   /protein_id="ABM39544.1"
FT                   /translation="MKVFDRYVGADVELPAEVDPGRYRLLAPVCLNGTLLLQAGEVLWS
FT                   DGGSRCLLTESLSDEQVRSFRTSPAEQDGQTPGSVIDAAVLAVAEQVESMNPGDSLPSP
FT                   VMPTKLGELAQMYPLERLLETTLSAGHLQTIAKRPRMDMRYDTEMLPVSRVQRMAVDAV
FT                   TRLASHSEDWIRREITGVVPGRLKAEISQDELVIYENIVFARLLDRLRKTLRKRLRDLD
FT                   ALLSKQAEAGKLENAQHFDHRLRHDLCELWGRSFADQPGAGKSVHVTRDQISALLGKVT
FT                   QLQRSTVVQAIPPMQQVPLSLRSTNILQHDPHYRHLRPLWLLAHSTLLQQARSPQDWLN
FT                   DQRQRAQRYSAYTGLLVRHALHASKMVDPQGEGASWRFGPSTLTLRSERGDWILQLRTG
FT                   TGSVEQLTVVPAWRGCRDWEGQKLDRCVLFCHPDETEADDSATGSDSVLNPLQFYGVER
FT                   VRQAIERWLLAQLLIRYPFHVKNVPAALANDCKNAAPNFIKVDGRSLSIIGAPDAQVRA
FT                   KLEEFMRAGKTSQETTHAITNALDQAKLLAKCRLCGQSVAPSDFKKSAHGFKASCGCGH
FT                   TWTFQRSGDGTLQAAYRLGAQQRPFSEIGSRELLIGPASFAQLPPQSTQKKQWVS"
FT   gene            complement(141166..143667)
FT                   /locus_tag="Pnap_4262"
FT   CDS_pept        complement(141166..143667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4262"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39545"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV67"
FT                   /protein_id="ABM39545.1"
FT                   /translation="MKLYEAFAARGYHTSVVTTFGIDFDTYENVALARLRGNGCTNNLL
FT                   LADHRMLALALENPVALPRLAGRFYSLTGVRPEGSGVYHPKILLQIGRTQGRLVIGSAN
FT                   MTAAGLSGNLEVTSEIICDESESPEQAALVAAWRFVLRHADRAQSGIERQISWTLDRAH
FT                   WLKTALNRPHADGPATPRFFSTGSGAGIATRFAEAIGPARVKQLIVVSPYWDSTLQALD
FT                   HLVGILQPESVITLIQKDMQLFPGPQAGRIPGLRVIDLASAGVKPAKDRFVHAKIIIAQ
FT                   TADADHVLAGSANCTVAAMGNSTFAGTNEEASLYQLLPAGSMIESLGLQAAMSAQAMSS
FT                   DELANCQCVMTNEIALDEGERLNPGRFELDQMTLFWWPTKDQDADVEPSLLQLFDIDGQ
FT                   PLAIALLALPGSTGTVPKRFRLGAFSHPPRFAAVHRLDGTISGLAVINWADQLQQAARE
FT                   VRRGPTERALQDLDGEEDEGLWLLDVIDTLEAAERAERNDARPVEESLDTATARSMARH
FT                   KPKEEDLPASTAAVAYDLFIAGRRAHADEFKVTRSSLGGSELSAARIFLNRLLKSHQEV
FT                   FFDKTEDNQALETSLTDKSQTDREGDEDQLASLPASTTPMIGSKSIPEPDAEREPEKKQ
FT                   IRKTDTPQDYARSVMKFTELCKKLADSQGLGSAQALKLRILLSVIAGAGTSRSERTLAK
FT                   DRKGLHKHQILPADGDEGWMRLIGILLFTFFGQSRPLARAFQLDASLEQVPDDFLEVWA
FT                   TCFWVAIARSLATVDGKTGGLDEQARKFADLVYRLTALRPDELRGEIVLSMLTRLNERY
FT                   AARLGVDGNELLRLHGLFIQA"
FT   gene            complement(143664..145226)
FT                   /locus_tag="Pnap_4263"
FT   CDS_pept        complement(143664..145226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4263"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39546"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV68"
FT                   /protein_id="ABM39546.1"
FT                   /translation="MNARSLPPEWTDSTVKNGVDPLGMQNASVSKYQDLVPGISNVTLR
FT                   MRYYGLYAWLSDRYARQVGVGNIETWKWHVRRAELLYALVAQKKTGERGVAGTNWAHVA
FT                   LNQPTGTVDFAAGADPMAPNPYLRQEWGAYGGAYYSQLVATGVLTKADGHPVPVPSEAS
FT                   GDRLARLFGDARAELGETFFDVLTRGSVTHEELTRLAPLAPSAIPPDSQERAAYEDLLF
FT                   CRMANTPAGDQNRKMTLILLLQLANQMGSCPTSTDVRWSLYTGQLADGQPLQLHDPALR
FT                   AHRDRWWLYQLDDLCHMCLESLLKYTLDILEGYPIGLSMRELIAEATQRIADERQAPVD
FT                   SWAQFTTGTASAVGWGSSSEPATEYHRLERLLRSARPNASVQAGDALNSLELLVVLSQR
FT                   AKADSAGFVTQTAKSDNDGARSIHTEMAFLDSVAQRPFKEVVASLIRDRVLHRHLWVAL
FT                   RKLRYQGEYTFLVETDEGRVRLRRKDGPVQTTPRLDTSIDFLKDIHLLDSKSITDLGRR
FT                   LIQ"
FT   gene            complement(145574..149353)
FT                   /locus_tag="Pnap_4264"
FT   CDS_pept        complement(145574..149353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4264"
FT                   /product="SNF2-related protein"
FT                   /note="PFAM: SNF2-related protein; helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: pcr:Pcryo_0956
FT                   SNF2-related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4264"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39547"
FT                   /db_xref="GOA:A1VV69"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV69"
FT                   /protein_id="ABM39547.1"
FT                   /translation="MNILSLFKKAPAPQAAQAPGWLRSLDASGIHVHRDKRAGDHSLSF
FT                   PTLTGLMTQLSDDGLTQEDEHGRYFLAWDSLYEAMDLPGYAELSQALDLPATTGLRPTL
FT                   SSRHALTDSDFSISLGAWRDASGKAVSPHHVGPVLQLNGKAELMSAPQWDLFKRVVAFA
FT                   ERFPEDHTDHRQRQAWGQIRRSALAASAHMSDFLVKTVVLTPERLKMAFRKSDATGKDT
FT                   VVEVIPGFEGAPPNWLEQFDRFDTTLDRYDLPMDDGGLVQIVLSPQVKTVLQQIKRFPA
FT                   RRVAGSRAQAFLLNPFATLGEAASEVIDEAQFEQAREDAGLEFERFTPVIERDGAGFAQ
FT                   KVGILIESASSSGPTGSNTQYLDDAELRAFIASVEQAISRGLQLAFWQGSELEILGDTP
FT                   DHLHALKQALAQRTEPRLLVTHAQVHDLSHYSSRVEGIGVEPPYYSPYIAKKKEEDSWF
FT                   PENVFPVIAFTPEGEHEAVTVPVNNHALEELRDQTQKAQAAGKSAVELPWLPKPMPLAE
FT                   AQRITQTFDEVLEDVKKGKFDPDRKGATKPSARKTLMLRANIETVDYEEKRRQAMIVAL
FT                   GEPTISNSLSKDHRLLGHQEEGVAKLQHLYSLRHTFQVRGMVLADDMGLGKTLQLLSLM
FT                   VSIVESDSNAAPMLVIAPVSLLENWLEEAHKFFPGALRILTAYGDALSPLRVPRESIEE
FT                   RLRNEDGLVRFLKPDWVGNAQLVLTTYETLRDLEFSFATQHWSLMVCDEAQRIKNPAAM
FT                   VTRAAKKQNAQFKIACTGTPVENTLADLWCLFDFVQPGLLGALNDFGRKYRRPIEIDAR
FT                   DKEGQTRIEELRSLIEPQILRRTKLEVAKNLPRKIVVDTCRRLPLSSTQRNLYAKAIGD
FT                   FKKRADPSFRTPFKNHLGLLHYLRLVCTDPRRHGLSIFKPEPISQYRASAPKLDWLLNQ
FT                   LGLIQSQGEKAIIFCEFRNIQRLLQHYIEEVFALQADIINGDTSASASHSASRQKRIKA
FT                   FQAKPGFGVIILSPVAVGFGVNIQAANHVVHYTRTWNPAKEDQASDRAWRIGQTRDVYV
FT                   YCPVVAAQDFTTFDVKLDQLLERKRSLAGDMLNGSPDISLAEFKIEDVIPDADVGSIDE
FT                   RVTLDLALRMDWRHFEGLAAALLCKRGFETVYCTPGSSDNGVDVVGIRGNLGELVQTKT
FT                   SAADDRSLNWDTVKEVVAGEAFYRRRHPGVTFKKVGLTNQHFNVQAHESAVLNGVDLME
FT                   RRHLGEMLEKYPVTMLDVERLLYTEWSDADLHAF"
FT   gene            complement(149350..151158)
FT                   /locus_tag="Pnap_4265"
FT   CDS_pept        complement(149350..151158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4265"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39548"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV70"
FT                   /protein_id="ABM39548.1"
FT                   /translation="MDLLNLFSSMLNQAALNSPVDVRASDDIDKVLLALEKQVKSGGRN
FT                   DEPKDLQIEAVRRFWKTGHVETLREARLVAFGLAVTPWDDRRSLMEDKRLFGSALDAVD
FT                   AWQGAPRQYRKCFQGLVRSYFDYDGMGRSTPDVGKVNWRQLRDYLNSNAASIRDASLNP
FT                   DWVSCTLSNTGLFTEEPCAAYGPDLLAGNSDLVGDIRKLLGISDGSWFTRELIIAQIRQ
FT                   ATQLGDQAFHAAVSGLLRLLGGNEVLRDRGLQILLDRYALIPQPPQHPSLRDYAVTCWG
FT                   NPWLPSNQDRWGGVQTAARQMVSNWLKLEFIELFFTKLAQDGLSDTRRVKFWAKYVPAI
FT                   EEIHFALGPHAMYSRERDFVELRDKLKGLIVPLQDNIAANNAFIMTMGDLVAVEFSGAS
FT                   NAFYGYNVKNRMPFDLTQPVRTPVNGQNSLKNSSRALYLRHQDNVLGFNGWEGRFQDEL
FT                   RTKFNIRPGVTSPQRVVVERQWNDAPAPPHPKSPQTPLFAARTLAPAASTRPMPRTFTT
FT                   PAPVPKSTAPAFATDQSAPFAPDLPFTMDNLREVCMRIGASVQDRSDRGGALWVMAPAH
FT                   IPHIRELLTNWGFKFTIGKGWWKKIE"
FT   gene            complement(151158..151865)
FT                   /locus_tag="Pnap_4266"
FT   CDS_pept        complement(151158..151865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_0954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4266"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39549"
FT                   /db_xref="GOA:A1VV71"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV71"
FT                   /protein_id="ABM39549.1"
FT                   /translation="MIGSRARTRRGSQGEAEKPFWISFADLMTALMVLFLVVMAVALLA
FT                   VTRTVSAREALEAQHKKDVDNCMAQAVTAAERHKGVKVDLDRRVIDFGDRARFAFGSSV
FT                   LAPEQEAVLRRFVPELLSMAQTPSCKRVLKRVVVEGYTDRAGTYLGNLNLSLMRSQRVL
FT                   CAMFTTSGADALTEAQKDAVRDVFLVGGFAFNSSKDTAEESRRVEMRLEFLGVEEKPIA
FT                   SPATSGNFGACAI"
FT   sig_peptide     complement(151728..151865)
FT                   /locus_tag="Pnap_4266"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.660) with cleavage site probability 0.431 at
FT                   residue 46"
FT   gene            complement(151862..154312)
FT                   /locus_tag="Pnap_4267"
FT   CDS_pept        complement(151862..154312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcb:XC_2788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4267"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39550"
FT                   /db_xref="GOA:A1VV72"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV72"
FT                   /protein_id="ABM39550.1"
FT                   /translation="MPSIAPHLLISGALVLLLALSFVIYFLVPAFKHGRRLSELLRTLR
FT                   SPALKDERNPDQLSQVFEKDAHLAHLWNEYRKTLYDAMPTSGGVVAPQWRSTVAAENFW
FT                   NGQLVVESRVHAEFFKHVPGIFTGLGIIGTFLGLIEGLRNFKVSALTQGGDAATQDSVA
FT                   QTAQKSLESLMHSVGDAFLISAAAISLAMLATFLEKLLLNSLYAKVDYIAQLLDDKFAA
FT                   ASAEKFLEQTASYTEESATQLKQLKGELIKDLTPILHELSDKQSKMLERLAGSFQERMS
FT                   EASHNQIEASRDNTTAMADTISGAITNGLSGPLEEIKAAVKQASGDQSATAIKMLQDVM
FT                   VSFSQKLNDLFGGQINGINELNHKTAETMQNAVTKLNELVANLQEAGRSSSASMGEQMA
FT                   RALSDMEARQAAITQSTQQLVAELKLAIEQSHTATSAGVQNSSDEMARRMAESIEKMEQ
FT                   RQDSINERTREFVEQIKAVVSSSQNETGTKVQSTLQAIGDQVGDMLNQFQAAQQAALAT
FT                   GQQREADNASKTESAVAALAARSQTFVDEVGQLLSRSQAATDAGVRSTMQALGGQVGSM
FT                   LQEFQGAQQSALESGRQREEQNAQKTQELVSAMVGSVESLVQQIAQASARMQESVAALT
FT                   TTTTSAISRLSDGADQVNSAARNFAAASDKAAGTIHQVSSVTGQLSDLTTHLTASSTAL
FT                   QQGIQDYRSHREAVAAMVAELNGLVNNAKSDVSITSNVLQRIEQASDKLASAHFETEKF
FT                   MMGVATVLAKAHEEFRVSVTTSLGKANHEFQQKLSAAVGMLGSSIKELDDVLVTATPKK
FT                   KAIA"
FT   sig_peptide     complement(154214..154312)
FT                   /locus_tag="Pnap_4267"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.677 at
FT                   residue 33"
FT   gene            complement(155091..156239)
FT                   /locus_tag="Pnap_4268"
FT   CDS_pept        complement(155091..156239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4268"
FT                   /product="UMUC domain protein DNA-repair protein"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   rfr:Rfer_4341 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4268"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39551"
FT                   /db_xref="GOA:A1VV73"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV73"
FT                   /protein_id="ABM39551.1"
FT                   /translation="MGAPWFEIEHLAESSGLVALSANFALYGDMSDRMMSLAAGLGPAQ
FT                   EIYSIDESFIDLAGVLGDLVQRGLKVRERILQWTGIPCGIGIGATKTLAKLANHIAKTA
FT                   ERKPGSYPATMAQVCDLSALAPEALQEVLAATAVNEVWGVGRRLTAQLSECGIHTAQDL
FT                   AGLDPAMVRRRWSVVLERTVRELQGMACIALELAPARKHEIACTRSFGQPVTRLADLNE
FT                   AVTEFASRAAHKLRQQGSLAGQVLVFIRTSPFRPEAQFSRSISMPLRRPSADTGVIVSA
FT                   ALRGLHAIYRPGYQLAKAGVMLFDLQPTTVLQAELDLQRDEAPDRRRLMTTLDDINQRY
FT                   GPSTVQMASAGLAGDRRAWTMKQERRTPGYITCWADMPVARA"
FT   gene            complement(156791..158065)
FT                   /locus_tag="Pnap_4269"
FT   CDS_pept        complement(156791..158065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4269"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4269"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39552"
FT                   /db_xref="GOA:A1VV74"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV74"
FT                   /protein_id="ABM39552.1"
FT                   /translation="MTAPEKNKTGFAGLSSLESNVDVTEKNPPSPSALSASPTQPDRTN
FT                   TSTKAASGASAPSSPSTLASIPATQSVRPQAQKTSSSPPPVTYVGSSKVFIVGALTVCV
FT                   IIVSIIASKSNDATRPAENDANSASTYVEVSVPPKATVPKITFAVASLSANVREKPTAR
FT                   SRQLRVLKQGEILEFIEVTGSFTRVKLLDSTLGFIASELLIPEDDFQRLKNLSARQYVD
FT                   QRSDEKRLDSVQAQIKPMDDAVSEAISAISSRSPSIKASLQTIDEGRHVGIASDEAAGI
FT                   WYSLAARAAANSAQFEDAVLNARAAVEAAPLNPDYYVAMGLSSYKIGYLNGLNMGATML
FT                   PILAPKSTNAWMIFGLSVATLDNEIKYDTFAIGAFVLAIKLSKNPDVTRKYFLEMSNKS
FT                   DNIHLKKLLNEALDEESKNPSVFGF"
FT   gene            158334..158705
FT                   /locus_tag="Pnap_4270"
FT   CDS_pept        158334..158705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4270"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0666 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4270"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39553"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV75"
FT                   /protein_id="ABM39553.1"
FT                   /translation="MEENAIMTANNLRQPFIDLVIESWRFSKLFSRVLGKIENTEATRY
FT                   ANQLRYFQKKLDDSLEAANLRLVSLEGQAFDPGMAATPLNIGDFGPEDNLIVEQMMEPI
FT                   LMGPDGIVKSGTILLKRAD"
FT   gene            158708..161203
FT                   /locus_tag="Pnap_4271"
FT   CDS_pept        158708..161203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4271"
FT                   /product="Heat shock protein 70"
FT                   /note="PFAM: Heat shock protein 70; KEGG: noc:Noc_0667 heat
FT                   shock protein HSP70"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4271"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39554"
FT                   /db_xref="GOA:A1VV76"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV76"
FT                   /protein_id="ABM39554.1"
FT                   /translation="MKNYVGIDLGTTNSAISTFDGADIRLYKSPEQNDVTPSAIFIDKR
FT                   GNKYVGQRAYNSAAQSPLNAATGFKRFMGTSTPIKLPAVNIVMTPEECSAEILRVLYSY
FT                   LPESIRNDPETGTVITVPAAFNQMQKDATMAAAESAGLGKVALMQEPVAAVMSVMRQRK
FT                   TDGMFLIYDLGGGTLDVAIAESTNGRVSLLAHGGIAMCGGRDFDRILMDNVIKPWLLEH
FT                   FDLPEDFSIGKDYTTLRQMAGWATERAKIELSAKEDSVISLDDTELRVKDRSGADVYLD
FT                   IPITRKQYDDLIAEKVLESIVSARETMEKVGLSPHDIGRVVFVGGPTQYKPLRDKVAFE
FT                   LGIAASTDVNPMTAVSEGAAVFAESIDWSMESRGRKSGRGTLAASGSLNVGFNYVARTP
FT                   DIKAKVVAKIDGKPVAGLSFQIDSIDTGWSSGKVTLNDGASMEVALTKPGENLFKIFVF
FT                   DAAGGPITIAENKIIITRTAAQIDAIPASHSIAVQARLKLDGPYILDYLVKEGDQLPKT
FT                   GKKSYRTEELLRAGSTNSIKFKLWEGSIEDIVTDNRFIGVFEISGADFSDGVIAKGAEL
FT                   LVDYKVLDSGNIDLEITIPSIGGKFNSGRNFYSRQIGQIDYSNAARRIEEESEMLSSRI
FT                   DAVASRVDDPKLDQARERLSRTTDSRKIESDNVAASQAMSDIQEAKKLLAQSRKDNLKV
FT                   IRQMDLDSCVDAFNEVVRKHARPIEATAFDKLAITAQSAIDNNKDDFESHLQGLRGKNW
FT                   EIIFKQDWFVIDRFNRIMNTPHLFLDTNEFNELVKQGKQSLAADDIDKLRQVVDHLENV
FT                   RIRMGGEEQMLSGSNILMG"
FT   gene            161207..162655
FT                   /locus_tag="Pnap_4272"
FT   CDS_pept        161207..162655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4272"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; SMART: AAA
FT                   ATPase; KEGG: noc:Noc_0668 AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4272"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39555"
FT                   /db_xref="GOA:A1VV77"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV77"
FT                   /protein_id="ABM39555.1"
FT                   /translation="MAIESWFPVGYSMPDGATCRRAVFGEAQWQIIKTDGAGTVLIVRS
FT                   ELMDRWKALGLIEVGVFNTFKFGPDTFHEISCGPSEIIAPVDQSNSPDSRNEAIAFAMA
FT                   LKATREIDPESPLQDAIYAEGLGRLLPIFSVSPRADDDVILGYWLTGGAQVSAKSFRRL
FT                   NQMMSWITPSGLKDVVSAAGMTQLTKDAPRDDHFQDEAELEKIDSSKIECSCDDEVSSL
FT                   ESGVPFVLAGRPLLEDFFNEHVIDIVRNKERYAALGIGFPSAIVLHGPPGCGKTFAVEQ
FT                   LIEYLGWPSFQVDASSVASPFIHETSKKVAEVFDKAMVNAPSILVIDEMEAFLADRESG
FT                   SGSSMHRVEEVAEFLRRIPEATKNEVLVVGMTNRVEMIDSAIMRRGRFDHVIQVDPATE
FT                   VEVKALLDKLLAKLPCDKDIETGPLSRRLSGRPLSDVTFVIREGARLCARSGSNKIAQR
FT                   FLVEALDSTPERTGSGTHRSIGFV"
FT   gene            162714..164369
FT                   /locus_tag="Pnap_4273"
FT   CDS_pept        162714..164369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_0670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4273"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39556"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV78"
FT                   /protein_id="ABM39556.1"
FT                   /translation="MNDQPTCSIYNNAFWLLGATTRDARLSIIEKSEERSLHEDPDKCQ
FT                   KAKSDLTNPRARIAAEVSWLPGVSPRMAGKLVSDLASNPLEIASQTGLPELARANLMSS
FT                   ALELAHSDSLTSKTMARFMRELGEVADDIDTDAVLRDINEDRSVAGFPEVRDLGVLEDE
FT                   LEQQKKKYKSALKNALNNMPSALLVETMFLLVNETTGNGEQAAPPLIDDLVDSYEVETQ
FT                   GFLTKEEEKIDKLVEGALTAAPSGARSVDPFLEKVELVVHSWSQVIKPIQVSMKSRGLE
FT                   HKNSLKIGYTIRNLGLELYNTHNLLPQSQRTTALLLKFFGDMPEFKEQVQTDANTLARF
FT                   KNEAAKSELEDAERRRLITFKAQVGLVFKDELSISPDGIRWKDKHYDLEAINGIRWGAI
FT                   KKSVNGIPTGTDYTIAFGDERGSSEVSISKEATYSQFVNCLWRGVGVRLLFEMAKGLKD
FT                   GRTFSFGDIEVEDVAVKIERHKFLGFAETVRLPISQIKIWSSDGKFIVGASNDSKVYSS
FT                   ASYMHHWNTHVLEHLMRTSLEKGSRGGLSSCFLS"
FT   gene            complement(164826..166365)
FT                   /pseudo
FT                   /locus_tag="Pnap_4274"
FT   gene            complement(166679..168343)
FT                   /locus_tag="Pnap_4275"
FT   CDS_pept        complement(166679..168343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4275"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: dar:Daro_2560
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4275"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39557"
FT                   /db_xref="GOA:A1VV79"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV79"
FT                   /protein_id="ABM39557.1"
FT                   /translation="MIKPQAWLPSDGLTLEPNALLAAQEVLRSLALTAGPGAGKTEMLA
FT                   QRADFLLRTGTSRYPQRILAISFKVDASRNLKDRVRKRCGAELAARLDSHTFHAFAKRI
FT                   IDRFRPILTGRDALNPDYTIGVGRVQGQQLDFGNLVPLAVQILKACPIACNAVRQTYSH
FT                   VFLDEFQDCTDEQYQLIKVAFLGSSARLTAVGDTKQRIMGWAGALEGVFLTFATDFQAV
FT                   PLNLYQNFRSKPRLRRMQNAMVRVMDPAAAVPDDMLMGPGGSVDVLHFSDSAEEAREIA
FT                   DLVQHWIGIESIPPSEIAVLLSRQPDLYAELLMNEFKRRGIAFRNEQLLQDLSVEPAAR
FT                   LIVDFLTVVAGERQSAAFGRLMDVLIATGIDEETAYEQRSRWLRFLEQSRRAMRGGQAQ
FT                   PLNAISLRANAMTFLKMLGREAVVALSSDYERGDRLTEVVAQTFDRLTELLGGEADPVR
FT                   ALSHFSEDSAVRIMTIHKCKGLEFDTVVILGVEQQTFWGDRDEQRSAFFVGISRAKSRL
FT                   YLTVADQRQRPTEAQNRWDIVRRPHDEYIGYATSSVG"
FT   gene            complement(168340..170277)
FT                   /locus_tag="Pnap_4276"
FT   CDS_pept        complement(168340..170277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4276"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: SMC domain protein; KEGG: dar:Daro_2559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4276"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39558"
FT                   /db_xref="GOA:A1VV80"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV80"
FT                   /protein_id="ABM39558.1"
FT                   /translation="MKLTRLRISNFQSFGPVPTPIDFEAMTFLLGPNGAGKTVVLQALA
FT                   RLFGFDPSLRRVRRSDFHISPATLAAGNAGTLNLWIEAQFEFPELLDANGQHATIPGHF
FT                   SHMQLDSADGVPRVRFRLTAILDEDGDIEEKMHYVIHVDANDEPVNPMVVPKHDRNSIQ
FT                   VHYLPARRDPTDHISYTASSLLGRTLRAANWHAERATVAGLTQGISAALASNAGVQGIG
FT                   EQMAGHWLKLHKGSYYASPSVSFEHNEIDNLLRHLTIGFTPGHEASMVDFSRLSDGQQS
FT                   LLYVSLVLSIQGIGRRVLAGQLDAFDIDRLRPAVFTLMAMEEPENSLSPHYLGRVIKAL
FT                   TDFAGHHDAQAVVATHAPSLLRRVPPESIRYLRLDAARCTTVKTIVMPAKTDEAHKFVR
FT                   EAVQAFPELYFSRLVILGEGDSEEIVLPRLFRAMGLADDDTSIVIAPLGGRHVNHFWRL
FT                   LSGLQIPYVTLLDLDVGRHQAGWGRIRYAAKQILALWQSTPNLTLEAIEALPAWNGPDQ
FT                   ILSSSQGAKLLSWLEKQGVFFSSPLDLDFSMIQAFPGAYGVSQAELVAADDPTVKSVLG
FT                   KSGLGPDQYSTDQQSYFSAYHARFKLGSKPAAHLEALAKLDDAALTAGMPPPIARLIAL
FT                   VEKKLADLPE"
FT   gene            complement(170793..172820)
FT                   /locus_tag="Pnap_4277"
FT   CDS_pept        complement(170793..172820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4277"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases-like;
FT                   KEGG: sco:SCO6640 putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4277"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39559"
FT                   /db_xref="GOA:A1VV81"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV81"
FT                   /protein_id="ABM39559.1"
FT                   /translation="MSEFDKLHPALQYHVVNSLGWSSLRPTQLQAIEPILSGVHCLLLA
FT                   PTAGGKTEAAIIPVLSRMLTHAWPGVSVIYVCPIKALLNNLEQRLSHYARLVGRRVAVW
FT                   HGDVSQSKKGHALKDAPDILLTTPESLEGMLVSTRIDRKVWFGNLRVVIADELHAFAAD
FT                   DRGWHMRAVLHRLQQYVPQEMQRLGLSATVSNPAELLDWFAPTGIKQVVGSASVSTDAD
FT                   VTVDFVGSLANAATVIARLHRGSKRLVFSDSRSSAEQLTSMLRAQEVRTFLSHASLSHS
FT                   ERKLAETAFAEEKDCVIVATSTLELGIDVGDLDHVIQIDAPATVSSFLQRMGRTGRREG
FT                   ARRSCLFLCTNDDSLMLAIGICRLWGEAWVEAAYPPPEPWALVAQQAMVATLERAQWPR
FT                   RELIALLCGAFPESSRPGITDVIDHMVASSYLMDTHGVLQIGPATEKQFGRAHYKDLLA
FT                   SFSGTQLLLGRCGSAEVGYIDPTMLAGDKPVRLILLAGKSWRITEIDWKRQTVWLEPAK
FT                   EGGTARWNGSGRTLSREIAQGILRALRQGAGEHTVISKRARLEIEQVTQDLPETGNDGA
FT                   LSVTRNEAGAARLWTFAGTRANRTLARQIQSLAESRRIDAMGIDLKTPVDLSDLSAELL
FT                   STALAFSPEEVKELAKPIKFSECLPATLLLQIIRKRQFGL"
FT   gene            complement(172817..174127)
FT                   /locus_tag="Pnap_4278"
FT   CDS_pept        complement(172817..174127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4278"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="KEGG: hch:HCH_03464 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4278"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39560"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV82"
FT                   /protein_id="ABM39560.1"
FT                   /translation="MISAARRDDIIGALRRGTVPSAGLDALAVGIESFAPTLEAELATV
FT                   ATGRGGFKAVRGEYGTGKTFFGRWLQERARAKGFATSEVQINETETPLHRLETIYRRLV
FT                   ERLGTADSSTGAFRSVIDGWFFALEQDVLADGSVDADDAQALLARTDTLMEAQLAGISK
FT                   TAPAFSAVLRTYRRALAGGDHQLAEGLISWLAGQPNVAASVKRAAGIKGELDHFGAANF
FT                   LIGLLTILRDSGFAGLLLVLDEVETLQRMRADTRERGLNALRQLIDEIDAGRFPGLYLV
FT                   ITGTPAFFDGAQGVQRLAPLAQRLHVDFGTERTFDNPRAVQIRLAPFDQGSLVAVGQRV
FT                   RDIYAQLQANEPRLRSVVDDAYIEVLARAVAGGLGGKVGVAPRLFLKKLVADVLDRVDL
FT                   HASFEPRLHYKLTLADNEMTVNERAAAGAASVDDIEL"
FT   gene            complement(174124..176850)
FT                   /locus_tag="Pnap_4279"
FT   CDS_pept        complement(174124..176850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4279"
FT                   /product="PglZ domain"
FT                   /note="PFAM: PglZ domain; KEGG: hch:HCH_03465 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4279"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39561"
FT                   /db_xref="GOA:A1VV83"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV83"
FT                   /protein_id="ABM39561.1"
FT                   /translation="MSVSVPQITAQLDAVLAREPGALAVAIRAASRQVWPDSVNQRGRR
FT                   FTLRWCDSMLAIREALCEVEQADAADAGLVVLTPLGSHEITEDIAARLALRQVLQPKGW
FT                   EMVRQLFGAKEIDARLGRFGWMPQALVDGAAQGAYAPVANGFLDLETAWKEVLQRFLQL
FT                   NVPRPDAAGLLQWTQQPLSDASLKLLPANARADALRWLAESAGTAGRMVLACIEAGRTG
FT                   DAMALGLVCGALYAAAGEGQAALGHAAIRLERFVGDTHVGVLEGRAWAQAAQQLVCEPG
FT                   GAEVYRPALERADALLAELRVAEFAHLSEVLPLGLEQRLRAFAMLLSQHVQAPTDATLI
FT                   AVEDAANRALAHELATTQPHRADRVEMARRLARWLVRPATGAATVADMVCWQADEGAFV
FT                   DWARFRLLGGDELVEVSHAFEALRAAVMARRNALGQQFALALQRWNAQAPSVEARIVPL
FT                   ESVLDRVVTPLAALHPVLLLVVDGLSTSIFQELFARPERLGWSEWVPAGLARPLAGVAA
FT                   FPTVTEVSRATLLCGKLTTGQSSLEKTGFSSHAALLAHSNANLPPKLFHKGDLSDATNL
FT                   SSSVRAAIADPKQKVVGLVYNAVDDHLSGPDQLLQRWSLEDLRLLLPILREARAARRVV
FT                   VITADHGHMLEEGSAHINGGESDRWRYGTEAAHSGEIVLSGGRVRTASGATSVACLWSE
FT                   SVRYAGRKNGYHGGVSLQEVTVPLSVLLPTGLTLSGWQPALPAQPEWWDLPNQPAMLQT
FT                   TVRSPSARKPTARQPAAPASAQTPLFDASVTPVAAPSAAPSLGLAPASDWIDTLLQSQV
FT                   YASQRSLAARVAPPDEQMRKLLSALSERGGKLSRAALAQRLSVPEVRLSGMLSAVRRIL
FT                   NVDQAVVLGVDEVAGTVELNRTLLLLQFRITSVGDGR"
FT   gene            complement(176847..180569)
FT                   /locus_tag="Pnap_4280"
FT   CDS_pept        complement(176847..180569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4280"
FT                   /product="putative phage resistance protein"
FT                   /note="KEGG: hch:HCH_03466 probable phage resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4280"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39562"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV84"
FT                   /protein_id="ABM39562.1"
FT                   /translation="MTLLKDLINIPERVHQGDFVLKLSEGVTHADATLRDYVVTPQLVD
FT                   AFENALGFIKQSVESSGSKAAYLHGSFGSGKSHFMAVLNLLLAGNTQARSIPELAGVVA
FT                   KHGWTNGKKFLLVPYHMIGARDMESAILGQYAEFVRKLHPSAPVPGFYLAEGLFGDAQR
FT                   MREQMGDAAFFAKLNEAGGGAGGNSGGDNAGWGDIDSGWDATRFEAATLEAPNGEERSR
FT                   LVGDLITQFFSAYRSLAGGGESFVSLDDGLSIMTRHAQALGYDAVILFLDELVLWLASH
FT                   AADVGFVSREGTKLVKLVEATNADRPIPLVSFVARQRDLRDLVGENLAGAVQSQFSDVL
FT                   RHWEARFHRITLEDRNLPAIAEKRVLRPLNEAARQILKAEFEKILAVRRDVLDTLLTTS
FT                   ADRDMFQKVYPFTPALVQTLIAVSAALQRERTALKLMMQLLVDRREDLQLGQLIPVGDL
FT                   YDAISEGDEPFSEGMRLHFDNAKRLYNQRLLPMLESQHQVTLEAMKLGQADSTAARNLR
FT                   NDARLLKTLLLAALVPEVESLKGLTGARLAALNHGTFKSPIPGREAQDVLRKCRDWSSQ
FT                   IGEIKVTDDQNPVVSIQVTGVDIEPILRAAEAIDNAGNRRKKIRESLFAELRIPDDGAL
FT                   FTTYGFTWRGTHREVELLYENVREMTDDRLRGRSGAWTVVLDFPFDEPNFTSNDDIARL
FT                   GDYCGGDTKTLVWLPSFFSHKALADLGRLVVLDHILSGERFESYATHLSFVDRVQAKAL
FT                   AKNQLDSLRSKLRSQLEVAFGISTEPRDAVTQVLSADQQFCSLDPTLSPRPPVGASFKE
FT                   AFEALLGQLFSHQYPGHPEFDTEIKPGVIRKIWPEMQRAIEAPDRRGLVPDSATRRLVR
FT                   SVVFPCQLGQMGETHLLVQDHWRARFAQSHARDGGGAMTVAQLRRWIDMPTPMGLPLEL
FT                   QNLIILSFAAMTNRRFILRGGPVEPTLDSLADELELREQALPDPAHWATAVKRAASLFG
FT                   LIVSQTLNAGNVGRLVDEVRREAGTKREAVGTLVASVRDRATRYGASMAGRVRTSESAQ
FT                   ALLATLQAASDAELVQALASASVETSEAAVGRSMGQAPQVAQALSNAKWSIFDSMRNLQ
FT                   DHRQAAAASILSRLTEVLGSDEHVIALKPRLEEIERDAVHLLTMAAPTPPVPPLPPQPP
FT                   IISPVPLPVIPDPAPFTRNGTPPSAAEFVDGDEKMGLGTDEAASLLKDLQERLQGDPGL
FT                   ELSLSWRLERRSAQP"
FT   gene            complement(180693..181241)
FT                   /locus_tag="Pnap_4281"
FT   CDS_pept        complement(180693..181241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4281"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39563"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV85"
FT                   /protein_id="ABM39563.1"
FT                   /translation="MATYLESGLRLDLPDGQHFRFADLPAYQALSSYRLKEMDFAWLDG
FT                   GKLFLLEVRSYAQVTETLTGAHFVPAKGQPAPFRYEALIDKVTDSLLMLLAAWAGSAGG
FT                   QALREGLPEGAKIRLPLKLVIAVDLPAKLAIHLQGLRDSLNARLRGRMALADVRNVVLI
FT                   DYARLVADPRFSAFIRLQV"
FT   gene            complement(181245..182312)
FT                   /locus_tag="Pnap_4282"
FT   CDS_pept        complement(181245..182312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: nma:NMA0935 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4282"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39564"
FT                   /db_xref="GOA:A1VV86"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV86"
FT                   /protein_id="ABM39564.1"
FT                   /translation="MTAFKSLVVENFVAFQQKLVWQHASLNVIIGENDTGKTHLLKLLY
FT                   AMGRAIEDYSKKKAGPEPKDLTELLAQKLRWTFLPPKLELGRLVSRGTGNRLSVELGWN
FT                   TDGHLKFGFGKDTVSKIVELQANGLPELEGHKATFLPPKEILSIFDAIVATRETVEIAS
FT                   FDDTYYDLVQDYRQPTTAGKLQDNIKKVFKHLEEVTGGGEVEMEKDGSIVFRRGKEVFN
FT                   MHQTAEGIKKIGILSRLMRNRRLTPAGGSMLFVDEPEVNLHPKAIVLFAEMLHEFAQSG
FT                   IQVYLTTHSYFLLKRLEQLARQKNTDYSLLDLRKQSGAGVVGTVTHLADGLPQNPIVEE
FT                   SLRLFDLDVQLDLAA"
FT   gene            complement(182344..186045)
FT                   /locus_tag="Pnap_4283"
FT   CDS_pept        complement(182344..186045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_I0114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4283"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39565"
FT                   /db_xref="GOA:A1VV87"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV87"
FT                   /protein_id="ABM39565.1"
FT                   /translation="MINAPQLLTDLKRRLALLESDLRERIHTLPDLKASLQAEWQVARD
FT                   ANRTAETLESWSDQVITQAGVHWLLSCVFLRFIEDNTLVERPWIGGTPGSGRLVLARDR
FT                   HETYFRASPLESDRDYLLACFTEAGTLPGLHTFFDAAHNPVFRLGISGDAAMSLRQFWQ
FT                   QQDPNTGALLHDFTDASWNTRFLGDLYQDLSEATRKRYALLQTPEFVEEFILDRTLTPA
FT                   IREFGYREVRMIDPTCGSGHFLLGGFQRMVGEWSRAAPAHNRRDVAQKALDAVAGVDLN
FT                   PFAVAISRFRLLLAALQASDVHRLSDAPDFTIHVAIGDSLLHGQRFGLSGQSGIQSDDL
FT                   FDVAESHADSGLAHAYASEDLKLVQRILGRQYHAVVGNPPYIVVRDAALNAAYRSQYAS
FT                   CHRQYSLGVPFTERFFELAVTGRPALLPLPQGEDRGEGGPGSAGFVGLITANSFMKREF
FT                   GSKLIEQVLPRLDLTHVVDTSGAYIPGHGTPTVILFGRHQTPKPDNPIRTVMGIKGEPS
FT                   APNDPAHGLVWSAILSQIDRAGSESEFVSVADMERKGLAKHPWSIGGGGVADVKEQIEA
FT                   NTVPLSSITTDLGFVCITKADDVFVLPLEAAIRKGCEPAVLKAFAVGEDVRDWTVNSEN
FT                   ICLFPYSDKAELRPASDLANALRFIWRCRTSLLDRKIFGGETYRETGKAWYSYGQIPAE
FT                   RFKIRTAITFAFVATYNHFVLDRGGKVFNRTAPVIKLPAGASEDSHLGLLGLLNSSTAG
FT                   FFLKQVCFNKGNGGIGGGISDEHWELRYEYNASQLVDFPVVENRPLDLATHLDHLANQL
FT                   AASQPAALLAAAHAGTEALPTRASLDAARVHATELRRQMIAGQEELDWRCYRLYGLLPA
FT                   SSQAADVEHAAPPEVALGERAFEIVLARRVAAGTETTTWFERHGSTPVTDIPGHWPEDY
FT                   RQVVQRRIDLIASDRNIALIERPEYKRRWNSPKWNDLEQAALRDWLLARLELPRYWPAS
FT                   ADQPPQLTSTSRLADAARMDADFMQMATLYAGHADFDIGQLVAQLVASEAAPFLPVQRY
FT                   TEAGLRKRAQWEATWALQRREDAGEDLTASVGAIPVPPKFKSTDFLKTDVWRLRGGLDV
FT                   PKERWVSYPGCERGADGSLIIAWAGWDHLQQATALAGFYLDMKDSEGWPPERLQPLLAG
FT                   LLELVPWLAQWHNEVDPVYGERMGDYYQGFVAEEARAQGFTLDDLRAWTPAATVKARGR
FT                   RKATAASE"
FT   gene            complement(186128..187297)
FT                   /locus_tag="Pnap_4284"
FT   CDS_pept        complement(186128..187297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4284"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4284"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39566"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV88"
FT                   /protein_id="ABM39566.1"
FT                   /translation="MKNFFHRQRLAADMADKILQTAPGSASSSGLFLAAPRRTGKSTFL
FT                   REDLRPQLEAQGALVLYADLWENRKADPGAVIIAAVRAALAQHEGVVARLARASGMDKV
FT                   SVGGLSFSLDRIGLASGVSLSSALAALSDETGQTLVLVIDEAQHAITTESGADALFALK
FT                   AARDELNSSRHHGLRVVATGSNQDKLAMLRNGKEQAFFGAPLVKFPALGKDYIAWFCQQ
FT                   VRLPAALSVEVVHALFVRASFRPEMLGAAADALRFDFELQPEDVPARFAQAVQEQIEAS
FT                   YAEQLRVIHSLTPLQSAVLRVLASKGAQYAPFETETILAYQRLLDTLAPHSTVKADVPN
FT                   VQQALAALQEKALVWRASRGVYALEEASLQELMAQEGLLPGAGGATGQN"
FT   gene            complement(187488..191771)
FT                   /locus_tag="Pnap_4285"
FT   CDS_pept        complement(187488..191771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4285"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein kinase; NERD domain protein; SMART:
FT                   serine/threonine protein kinase; KEGG: hch:HCH_03471
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4285"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39567"
FT                   /db_xref="GOA:A1VV89"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV89"
FT                   /protein_id="ABM39567.1"
FT                   /translation="MSMSANRWKVIAESSFPWERDALEWLRAQLPDREPWSVWTNFEFI
FT                   DDQGKVNEVDVLVLSPAGLFLIEIKSRPGTVDGDAHTWTWNTDGREYSYDNPLLLADRK
FT                   SKRLASLLRRQAAIVKAKIRLPFIQPAIFLSSTSLKSKLQGIAKTATFQRGQPGSLTDD
FT                   GIVHALVNGIHSNAAQAVDGQKARAIARGLAEAGIRPSNKHRQVGDYQLIKLIAEGEGF
FT                   QDWQSQHVSMASIQRRVRIYTVAHASSPEARATRVRQARREFEVLEGISHPNILKVNDY
FT                   KETEMGPALVFDHDPKAQRLDHLLRDRGTQLTVTQRLQLVRDIAETLKFAHSRRLYHRA
FT                   LGPQSIMVHTADGGALTPRLMNWQTASREAGNPDTVHRTTGTRHVEDYVEDPGLVYLAP
FT                   ETTRADATHGPSLDVFSLGAIAYHVFSGQAPAGSVLELAEKLRLGQGLRLSDVSDGCGM
FT                   RLQELIQYATCPDVMARYDVVQGFLDDLVKVEDELTAPDPEATVDPSIAGHGDRLEGGF
FT                   TVVKRMGRGSSSDVLLVREDDSPEELILKVACDLAHNDRLVAEGDVLAGLHHQNIVEYR
FT                   RTLSVAGRTALLMRSAGPKTLAQKIKEDGRLSLDLLQRFGEELIEVVNHLEDHGVAHRD
FT                   LKPENIGIATTSSGKLQLVLFDFSLCRTPTENISAGTHSYLDPFLSLRKPPRWDLYAER
FT                   FALAVTLYEMAIGKLPVWGDGQTSPAMLDVEATVASDVFDPVTREGFTAFFSKAMRRDF
FT                   KERFDNAEDMLRAWRAIFAARQTVHPPQAEGFSAIALTALSTTTMAELGYTLEAQDVLE
FT                   RMGVHNARELLAVDRIRFRYLKGVGDRIRKEIRLTAKELAHLRPDLAQGRATLHDSDDD
FT                   GTHDGAVSVNELAALLMPRRPAGDDRPEEAALAHYLGLDLGLDDAAQPESASSQAAWPT
FT                   LGESAQATGVERSTLTATLVKARERWLKNPAFTEVRLQLDKLVLTQGQVMTAHEAALAL
FT                   LALRGCAMQEDAQRLQLASAVLRAVLEAEAHLENPRIQLYDHPPSPLIATSSAWADYAR
FT                   QLGSVADTCALVDPLLPPSRVIEALVAVQPVGVLMGSGPAQEAGEAPMPGTRLLRLATS
FT                   ASRTAALSSRQEIYRRGMPALQALRQSLGALVGVPTLRIRELQDRVRGRYPEATLLPGR
FT                   PALDRLLEEAGAPLQWSPAAADGAGAYLCPALNNHPTVGTTTVFSRQSTFPGAHAAGTP
FT                   AGEASEAALADAQAAEIRLQRALKSGGLLVLTVEPRQARHAEAELLRRFGPDSQTQPAL
FT                   QRMSFDALLLKALRTEADRARVDWSMVLRADTAEPGSRDWANLQRLVQRTLASLKPLLL
FT                   DSPAPALLTNVGLLARYDLMALVTEMEASAGRPGHTPAVWLLLPSHKQGLPVIDGVPVP
FT                   LVNSTQAFALPPAWIENKHRASALA"
FT   gene            complement(191768..191989)
FT                   /locus_tag="Pnap_4286"
FT   CDS_pept        complement(191768..191989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4286"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: pol:Bpro_0373 transcriptional regulator,
FT                   Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4286"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39568"
FT                   /db_xref="GOA:A1VV90"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV90"
FT                   /protein_id="ABM39568.1"
FT                   /translation="MIRCHLSLFMGRDKLRISDVAKRTGLNRSTVTALYNETATRVDLP
FT                   AIESLCTLFQCQVGELFEIVPPKPEVSP"
FT   gene            192190..192414
FT                   /locus_tag="Pnap_4287"
FT   CDS_pept        192190..192414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mhu:Mhun_2961 protein of unknown function
FT                   DUF262"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4287"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39569"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV91"
FT                   /protein_id="ABM39569.1"
FT                   /translation="MYSPYFVRRHQGQLQLPDFQRSWVWDEDRIISLIASVSRGFPIGA
FT                   LMTLKTQTVGTNKFAHRLVQGASDRAVGN"
FT   gene            193002..193505
FT                   /locus_tag="Pnap_4288"
FT   CDS_pept        193002..193505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4288"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39570"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV92"
FT                   /protein_id="ABM39570.1"
FT                   /translation="MPRKLNSSPVALVERAVLAAVANARDKGWRQSQMEMFAQRLGDYR
FT                   IAGYGIDLERECIRIVRTLGCRYARKLLNWFRAVKVLPAFQPAAINFPIGIPKASRFGE
FT                   MKVQVASHVRISAIVDACFKLIVDDVSAPSWTRRDARKRGINVSQTSQCQRAMGRREAM
FT                   AFDS"
FT   gene            complement(193643..194374)
FT                   /locus_tag="Pnap_4289"
FT   CDS_pept        complement(193643..194374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4289"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1939 IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4289"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39571"
FT                   /db_xref="GOA:A1VV93"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV93"
FT                   /protein_id="ABM39571.1"
FT                   /translation="MNEQTLTQLRSLRLDGMVRAIEEQATSIAVSALGFDERFSLLVQR
FT                   EVAWRDERRVERLLKAAKLKVSSACVEDINWRASRALDRALVTALAGGDWLRNAQNLLI
FT                   TGATGCGKTWLACALAHQAARLGFSVLYVRAGRLFDELHVAHGDGSLNRRMSQLAKLDL
FT                   LVIDDFAISPMGAPERNDLLEVLDDRVGTRSTLITSQLPVKAWHTYLDDPTLADAILDR
FT                   VVHSSHRIDLKGATLRDPNTN"
FT   gene            complement(194416..195954)
FT                   /locus_tag="Pnap_4290"
FT   CDS_pept        complement(194416..195954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4290"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   pol:Bpro_1938 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4290"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39572"
FT                   /db_xref="GOA:A1VV94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV94"
FT                   /protein_id="ABM39572.1"
FT                   /translation="MPTNRITMRQIRESLRLHLQANLSYNEVGRNLKISKSVVGKYMSL
FT                   ARVAGVDWSVAQTLSDQELEAKLYKAALPRNSKQALPDFAQIHTELKRAGVTLQLLWEE
FT                   YAKGNDLAFKYTSFCVKYREWAMGLKRSMRQTHIAGEKLFVDYAGQTVPLIDAGTGEIT
FT                   KAQIFVATLGASNYTFACATARQTTADWIGAQVLALEYFGGVPRLIVPDQTRSLIKNPC
FT                   SYDPQNNRLYEEFAAHYGCALLAARPAHPRDKPKVENAVLVVERWILARLRNRKFFSLM
FT                   ELNHAIALLLNDLNQRAFKKLPGNRRSAFEQLDAPALRPLPAKRFELFRWKSAKVNVDY
FT                   HVEFDGHYYSVPHTLVRTTVELRASDTLLECYSSNQRVACHAVSPKRGAHTTTPEHMPA
FT                   SHRAHLEWTPQKLIDWGLRIGVSTAAVVTWQLEHRAHPEQGYRACLGLQRLAREFTPAR
FT                   LEAACTRALAIRSLTYRSVASILKTGLDRQQNLPTMTPGALPAHDNIRGADYFH"
FT   gene            196635..197126
FT                   /locus_tag="Pnap_4291"
FT   CDS_pept        196635..197126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_3916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4291"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39573"
FT                   /db_xref="InterPro:IPR019701"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV95"
FT                   /protein_id="ABM39573.1"
FT                   /translation="MPATNKAIDIRTCGKSDHQEIKEAPDQLNPGQTIKVKTSELIGAA
FT                   FNWAVAKCEGYEVELSPDWYAPTNCAIKASYANGICLRWVHSGEWSPATNWNQGGPIMG
FT                   REGITTRCIGRSIFGFLWDASTYGNDEEIVGYTQLTAGMRCYVASKLGDEIAIPYELMP
FT                   "
FT   gene            197439..197918
FT                   /locus_tag="Pnap_4292"
FT   CDS_pept        197439..197918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4292"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39574"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV96"
FT                   /protein_id="ABM39574.1"
FT                   /translation="MQTNNVSKPSWNITNGAIEPNRTLAALLVQQRFLNENLLPVKTGL
FT                   VGAILAREFVSNPELSLFKVEIYLKFGTTYRLTVEKSLNLMGQEAPFDFQLEMTDDDEI
FT                   EVLFKAFEKNHFGVVEIECRRDDIASLLGSGEWISGNEAFEKFFPGLAGASAQPH"
FT   gene            198155..199906
FT                   /locus_tag="Pnap_4293"
FT   CDS_pept        198155..199906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4293"
FT                   /product="ParB family protein"
FT                   /note="TIGRFAM: parB-like partition proteins; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_5053 ParB-like
FT                   partition proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4293"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39575"
FT                   /db_xref="GOA:A1VV97"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR022396"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV97"
FT                   /protein_id="ABM39575.1"
FT                   /translation="MEKAESVTSGTPARIAVNLIDRGNNPRTRFDETAMDEMVASFRAH
FT                   GILQPILLRPSGESRFQIIAGERRFRAFTTVYGMGVDISIPALVVEMDDAQADMSALIE
FT                   NVIREKMTPVEEAEAAARVLGYSQGDRDEAARKLGWERKFLDRRIALMYAIDEVRQALQ
FT                   DEKILLGHAELLAGLRKETQKQVLTALLSSAEKPTVAQLKDRLEKAALSLVKAIFEKSQ
FT                   CTDCQHNSGNQQALFAEAISDGNCTHKPCFERKTERELGIRARALEADYQVVRIVYPGD
FT                   NFTVVQLAADGVRGVGQEQAAACRSCKDYGAVVSALPDKLGASFKGMCMNTVCNNTKVA
FT                   DRIMGEKAAASALADQTIAKAQDDTKAKAKSPSQAATSASEVKAGTSKVQTGAVKAPVS
FT                   SEPSNALKEYREKVWRSVLSRVIARLDPETNQCVMLALAAFSPRVIDSTALLEAITKSS
FT                   ILLQNNATDIGVVLDSAMALDNDALKKALSLIPASISKDLEIRQVVSLLKGLDVKLEEH
FT                   WKVNDEMFGLLTKNEIDATCGEIGIKAAIGTGYPKLIGGKKDDLVNAILTITGFEYKGR
FT                   IPKQMRW"
FT   gene            200560..200769
FT                   /locus_tag="Pnap_4294"
FT   CDS_pept        200560..200769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc1661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4294"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39576"
FT                   /db_xref="InterPro:IPR022289"
FT                   /db_xref="InterPro:IPR032866"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV98"
FT                   /protein_id="ABM39576.1"
FT                   /translation="MALIAKTISRTFKFNGMTLADPSPEMDMETVKRFYANQYPELLNS
FT                   VVEGPVTKGTVSTYTFIRAVGAKG"
FT   gene            200886..202046
FT                   /locus_tag="Pnap_4295"
FT   CDS_pept        200886..202046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4295"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4295"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39577"
FT                   /db_xref="InterPro:IPR022283"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV99"
FT                   /protein_id="ABM39577.1"
FT                   /translation="MLDRYEHGREFECDPESASLVTTSVRNLGVVAQGNQGGMWVLPTF
FT                   SPEIPLEISRADAEASNLADFILLAHKKGIRIPDSIYTTTSELMTQQFANYARSQVKNV
FT                   RVELPLDVSIVAIDKKIEFAANATDRFQGIYQLKDSVERLNAASPGLGWFITDTIRKGH
FT                   GVGLTTYDPCRIANCVQLIWFDSETDQEAAAEVLDIDEKNVTEAHIEQARDERTFMPSD
FT                   FLASVGGHKHLLSWSQTKKEKAACRSMSASRVRACIHKLKLVEADRALVMAALEFHDSI
FT                   KVRKANAAIAPNGWFEHENLHEFECLDALGSLAFIVWDDSEFAREAITHYEEYAMNGEG
FT                   SHSQLVGLFVELDEPASWGPFIDAYKLYIKRYAAFSNFIGALPEEE"
FT   gene            202049..202846
FT                   /locus_tag="Pnap_4296"
FT   CDS_pept        202049..202846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4296"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39578"
FT                   /db_xref="InterPro:IPR022280"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA0"
FT                   /protein_id="ABM39578.1"
FT                   /translation="MLMVQASANSTTMALQKAILVYGVAKRNLYDPDQSLAITHATIND
FT                   VEMKSGAPVLKAGRLMTQSDLNELVTGLSQSQSLSVPSWIDTTMLALGAGRMIWYTPAC
FT                   QRAMFFKTSSFTKDTFEAQGQLPTPGLVWLVMQGALYVYAYKGSGRPDKETKLYQAPFF
FT                   NVWSQGKVCTGNAAMPVGDNAAIPHMWVDAFFGSNFTHPNFKEKDRLVKGVCPIDFWKA
FT                   MTEKPLPVFPEGRLVDLPLTVADLLAPDLNQKLGNIDRAAGEF"
FT   gene            202846..203490
FT                   /locus_tag="Pnap_4297"
FT   CDS_pept        202846..203490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4297"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39579"
FT                   /db_xref="InterPro:IPR018560"
FT                   /db_xref="InterPro:IPR022499"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA1"
FT                   /protein_id="ABM39579.1"
FT                   /translation="MNLDQITMGVFPLLAASQTGVLQDPEKHGVRYVAASDGMWRAIDT
FT                   AWLKALTPVALSSKKAVIPYGRLTQSVEFLCSMPPASLWREFAVLAKSTLPNEVAAAMV
FT                   WNAEQDTWRLAARQSIEANPGFVRYREVELQEGEHFVVDIHSHGNHSAFFSETDDCDDF
FT                   GSTKVSAVLGCVGQGATQVRIRLMLIDKHIDLKLTCSGGWEVQEEKQEIIL"
FT   gene            203487..204332
FT                   /locus_tag="Pnap_4298"
FT   CDS_pept        203487..204332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4298"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   pol:Bpro_5068 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4298"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39580"
FT                   /db_xref="GOA:A1VVA2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR022500"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA2"
FT                   /protein_id="ABM39580.1"
FT                   /translation="MKHKVHPELIRRAINVVVIGAGGTGSRVIEGLACLHRAIKAKGHP
FT                   FGLKVSVIDPDTVSEANVGRQAFYPCDVGHSKAHTLVNRVNMALNGEAVWTAYCEMVTL
FT                   QTDLSSADIVIGAVDNRKARLAILRSLENVSSGNRYWLDLGNRISDGQVILGEVTSRKR
FT                   KTDDPERLPHAGELYPELIDPAMEPSDDVPSCSLAEALEKQALFINPAVCVQAMNLLWL
FT                   LLTKGELEIHGAFINLEFGTVLPLRVDPQQWARFGVVRNGKRQKVVRPSAQKIKAAATA
FT                   "
FT   gene            204426..204968
FT                   /locus_tag="Pnap_4299"
FT   CDS_pept        204426..204968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4299"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39581"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA3"
FT                   /protein_id="ABM39581.1"
FT                   /translation="MPLGPLDLTASRAAIFLHSIMESERKFMSSTEQIEKPSWVVGSSG
FT                   KFKSNAALENVFENEKLVQRQLALANLSMVGAILAYQFVANPKLHVFRIEVEKVARSFC
FT                   EVTLVEAFDASGKPARAPSIEKLESDEALSLFTAFKVNANGVAEIQCGRESIADLLKIE
FT                   TAVNGAEAFHKFFPDYA"
FT   gene            complement(205475..205810)
FT                   /locus_tag="Pnap_4300"
FT   CDS_pept        complement(205475..205810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4300"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39582"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA4"
FT                   /protein_id="ABM39582.1"
FT                   /translation="MEIVDGFVRWSCEEDRQSFMELCAPHTDAPAELHQFVAWLEGVIQ
FT                   AHQEEGGERLLYATFLSAYISELPPTNLWPDGIAEGCITQRAVRDACSIAHEARRPRKI
FT                   GNAGILH"
FT   gene            206036..210985
FT                   /locus_tag="Pnap_4301"
FT   CDS_pept        206036..210985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4301"
FT                   /product="helicase, C-terminal"
FT                   /note="KEGG: dar:Daro_2546 helicase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4301"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39583"
FT                   /db_xref="GOA:A1VVA5"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA5"
FT                   /protein_id="ABM39583.1"
FT                   /translation="MKKPKVISVNQMSLFGDVIEIEEPPASVAVLKPVAKAVETLTKRR
FT                   EMFVLESKYFAQLTGPAAKVKANLAAVKMAMQGGKKSLEEKAVIVAYSGWGGISAMFAD
FT                   NGDFEAQRLEFLEMVGEKSYAQARDSVLTAYYTEPEVIQAMWGLVQKMGFKGGKVLEPS
FT                   AGTGNFIGAMPVALREASTITMVEPDSVSATICKALYADSDTLVHTCGMEIAPLRSESF
FT                   DVVIGNVPFGNYRVHDSKFDCMKLVIHDYAIAKSLDLVRAGGIVAVITSTGTMDKPKSN
FT                   FREYIAERADLVTAIRLPSGAFTRLGETDVATDILVLRKKPKVADSHVGHDFKVAEVIK
FT                   LHEFGNMNERSYDTINAFYSQNQRQLLGMPKASTNQFGACLKFVPELAWGEQLKTMCSD
FT                   ATLDGWYTHEERKEIRENFVADMSGLKTMVASGFFFDDQGQLYYMTNQNAESQAHLPEP
FT                   KRRRIEGMTHIRNCVVELLELDSVGANSTYERAKLNRLYDAFVVKYDYLMKPYNRRLFS
FT                   LDSHAPLLWSLERYDDENEKAVKTDIFSKSTVSAAVLSDTAESLSDAIALSYNRFARLD
FT                   LAFMAKALSLGEDEVVQKLLDANRVFFDPESREYVDSEVYLSGKVLEKLLVARAAAEGD
FT                   ERYMLNVAALEAVVPATVPLSKVSIQLGVPWIGQEDVQAFVDEIVTLDAEKVQDYNDIK
FT                   AVTVTQVIGMAVWSVTMGNRFQKETRYSGDWGTAHRPFDDLLSDLLNQRSTTVYMEIEV
FT                   EPGKTKRIVNKDETLAARDKAEKIQAAFTSWVYADPERVQRLEFTYNSKFNGTLNREFD
FT                   GAHLVVPGLSSAVKLRSDQLDGIWAGLIGGNKLYAYAVGGGKTLITICLAQMMKRLGFA
FT                   KKPTIVVPNHMLEEFAGQYARAFPRARILAASKEDLEGDKRRVLMMRLAMEDWDCIIIT
FT                   HGSFGKIALSKQVVQDFADEAGEKIDAMISGSDDRNVVREAVRQKKTVIAKVMALAEKG
FT                   KKDDGVLTFDQLGIDQLLVDEADLFKNLWFQTKKTRVPGLSSACSGRALDLFLKSRIIF
FT                   ERRKDGFGLVFATATPIANTIGEMFIMQTYLQPDRLKELGIDGFDAWAANFAREVTSIE
FT                   VTPDGGGYRMHTRFSQFVNVPELMLIFKEVALIRTKAMLALPEPKVAGGRHCIVAARAS
FT                   EAQKAYVQKLVDRAAAIREGKVKPHEDNMLCVTGDGRRAALDMRCVDGLEMDHAGSKLN
FT                   ACIENVYRHWAEGREKKLTQLVFCDLSTPKAHGFSVYTDMREKLVLMGVPVEEIAFAQD
FT                   YKTTAQKGELHRKVRSGRIRILQGSTELMGFGTNVQDRLVAEHHLDAPWRPRDVEQRDG
FT                   RIIRQGNLNEEVFIYRYVTESTFDAYMWQTLERKAGFIAQVMEGKTEMRSVEDVTSQAL
FT                   SFAEVKAIASGNPLVIEKAGVDAEVSKILSLKAAWRSDREIVLSRLANCVQSIDYSKKR
FT                   IQAFEGDLGSIGNASEVTLGGMVHSASDKTGKSVMAHLASIKASVTTKEHQWRSFDALL
FT                   AVGNMSIGLELHGKIGSASYKFFAKGSSGVSFEFTLPYGAKDIEIFLRSKHLETDLMDK
FT                   LSWFRTRLIADEAELINLKRGAEKPFEYAERLEAALNKQEEIDKSLDLRADDVSTLFME
FT                   EEKQEEAEMAS"
FT   gene            211149..211691
FT                   /locus_tag="Pnap_4302"
FT   CDS_pept        211149..211691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4302"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: protein of unknown function DUF882; Peptidase
FT                   M15A; KEGG: xcv:XCVd0044 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4302"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39584"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA6"
FT                   /protein_id="ABM39584.1"
FT                   /translation="MQRRAFLQTVAAGLVAPILQPHVMGQTQDFWSMPRTLHLYRPATR
FT                   ETVHATYFANGEVILCEYEKLCILLRDVQAGQAVQMSLVTLDILAGIQGWLRANGINSP
FT                   LHTNSGYRSPLTNNHTEGAAKNSRHMYGMAWDGRVPQVSTESLARFAVYLKGGGVGFYQ
FT                   EKNFLHIDSGSLRTWRG"
FT   sig_peptide     211149..211226
FT                   /locus_tag="Pnap_4302"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.754 at
FT                   residue 26"
FT   gene            212201..212485
FT                   /locus_tag="Pnap_4303"
FT   CDS_pept        212201..212485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4303"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39585"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA7"
FT                   /protein_id="ABM39585.1"
FT                   /translation="MMRSEELVVGVSLSFKEIPDDENLVFCFNRLELAQIIASVGLPFI
FT                   ECSGALVKGFGGYLETIWICRDRRAFDLDATYELVKYKGQCIHASELKF"
FT   gene            212963..213877
FT                   /locus_tag="Pnap_4304"
FT   CDS_pept        212963..213877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4304"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39586"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA8"
FT                   /protein_id="ABM39586.1"
FT                   /translation="MAYAGQVPWHGLGQKVEADASIEEWMAQANMEWEIKNSPVMYQNG
FT                   EMHEAPEYRVLYRSDTNAHLSVVSDRYKVVQPKQMMEFFRSLVDAEGFTIETLGSLKGG
FT                   RRIWALAKTNIEDTIRGGDLIKGYLLLITSCDGSLATTAKFISTRVVCWNTQAIALGEA
FT                   GQEVRVRHNTTFDANAVKGQMGLIGRVAFNGFIDRMRNLASVNLSTHDAKSALGLILPA
FT                   PTGAKELEETKGFRKILDLFQGGAMGSNLPGVAGTAWGFLNAVTEYTDHHIRARTTENR
FT                   LDSAWFGAGANLKATAEEVLLTL"
FT   gene            213989..215089
FT                   /locus_tag="Pnap_4305"
FT   CDS_pept        213989..215089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4305"
FT                   /product="DNA polymerase III beta subunit family protein"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III, beta chain; KEGG: pha:PSHAa0002 DNA
FT                   polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4305"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39587"
FT                   /db_xref="GOA:A1VVA9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVA9"
FT                   /protein_id="ABM39587.1"
FT                   /translation="MNISTTIGALKHALQNVLKAIHTKQITAEFCNGQLHIHACANGAH
FT                   AKALVPSTGTLPNLVFQLTAKLVLNIINNCATETKCSISQDKEDLRLSFGGARIKLTRY
FT                   TEKEVDFFKWNSKDEHNEAIGHFESQNLRKAIMSVSRFYSDDDQRYQLRGVYFQSIQGR
FT                   LVLAATNGTRLAEKITNLVVRDFRPMIIGGEYVEALVSIIKNDEEDVEISIRGGNDATA
FT                   VIFSTRNFSIKCPLIGGAYPSYRSIIPASDHHVQVNAAALIAALDRMEAVSGNFVHLNF
FT                   SNEIVTVETPDNDSSEQIQAEGDDFTLSLAIQPKLLAISLAAVTTEKVLIAVCLANGNT
FT                   SFLTIKNTEIQDGWLALVSPIKRSKN"
FT   gene            215133..215753
FT                   /locus_tag="Pnap_4306"
FT   CDS_pept        215133..215753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4306"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39588"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB0"
FT                   /protein_id="ABM39588.1"
FT                   /translation="MPSQGIAKPEVFKRCVFSKTSKGNMASDIKKSSEYFLPSNLYLEW
FT                   QGCELEDFVPAARQRLVMQAHEAAVVAGHFYTNDVKGFAADFLAVSQDLRLLNKHKVHG
FT                   GDVGYDIYYAGKAVNAAKHWKAISEVNQALQPKVGMPLGTLRISFKRTTNGVITKINGH
FT                   ALVIIGKRGHEVCTFACDVLQLQNASVNAFDKGWRQSPLVKTA"
FT   gene            216027..217454
FT                   /locus_tag="Pnap_4307"
FT   CDS_pept        216027..217454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4307"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4307"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39589"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB1"
FT                   /protein_id="ABM39589.1"
FT                   /translation="MPSIISDKVKARSNSSRSLPVSGHIRSGTQALIKSAAEAVGAKEL
FT                   YKKAASGAMSFKDAEKAILEKNPALRKAFTPKNTQYFSLYAHETEGGQASVDNIMQRYC
FT                   EVVEGDPVPRLYQIPVVFPPTPAGVEGFFKSEYSMAVGAIKYRSEYGDDGIRRCVYLKP
FT                   IDLKEQAQRKKFLRREPTIRKDCDPSSCDEFGSGACKFRGRIHFYIPGVIGSGTFVFET
FT                   GSANACEDIFLRLEDLQRSVRGGLPSFDPNGNPVFFLTKERKKVSYVEAGVEKSGMQWV
FT                   PVLQTTLIKSSILLLEEKERLQLAPPAAVPKSPSAPAGWLGASFGQSVQEDVVDGSGSD
FT                   DKLAPKSKTDAEKALWELNALNEVHKLPIAEYGEAKYGENWHCGDDVLALHKDVTDMIQ
FT                   SFGGNLDVVRIFLPLMTLLLANMIPVKELAFPYFKIFFGEFKKRHVPEAMAHISELLKS
FT                   GSELAIAHMKARLQIAA"
FT   gene            217746..218144
FT                   /locus_tag="Pnap_4308"
FT   CDS_pept        217746..218144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4308"
FT                   /product="protein of unknown function DUF1044"
FT                   /note="PFAM: protein of unknown function DUF1044; KEGG:
FT                   pol:Bpro_0470 protein of unknown function DUF1044"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4308"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39590"
FT                   /db_xref="InterPro:IPR009387"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB2"
FT                   /protein_id="ABM39590.1"
FT                   /translation="MHSKKVFKTKSFARWARKLISDSELCVAALEIEKNLYEADLGGGV
FT                   CKKRIAVPGHGKSGSTRTLVAKRHENAIFFIVGRSKSDPGADFSPTEETVAKAYAGLLQ
FT                   KASLSKLNQMKVNGALVEICDDKENCKR"
FT   gene            218164..218451
FT                   /locus_tag="Pnap_4309"
FT   CDS_pept        218164..218451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4309"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: pol:Bpro_0471 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4309"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39591"
FT                   /db_xref="GOA:A1VVB3"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB3"
FT                   /protein_id="ABM39591.1"
FT                   /translation="MESTIELSAYGLVSKTDMARMKALCEVPPEYPPERVVSIRTEIAK
FT                   MSQAVFASLLNLSVSTVQKWESPVANQRPSGSSAKLLHVLEKKGIEGLLI"
FT   gene            218632..219051
FT                   /locus_tag="Pnap_4310"
FT   CDS_pept        218632..219051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4310"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39592"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB4"
FT                   /protein_id="ABM39592.1"
FT                   /translation="MLVFKPNQGAPTAMPMNEADHAALELAAQLLGQPSVAFHHPQSFF
FT                   DALDAELLRQKRRIMRLRNDAKKAATLIEKLDILKQVSPAENALHRMRLSIFDAQDAIC
FT                   ECLKSGSNVAFDSHAGLFPKVAALLKATFTNSSQQ"
FT   gene            complement(219542..220165)
FT                   /locus_tag="Pnap_4311"
FT   CDS_pept        complement(219542..220165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcr:510243.50 adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4311"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB5"
FT                   /protein_id="ABM39593.1"
FT                   /translation="MLILHPVTFLAGLHGSGKSTLGHHLRRKHGWTHLSMGDAGRLARA
FT                   GKRPNNMSLRLFVELAMYRTGELMSQRLIDAILFEIGKHRQITPVVIDGFPAKPEHVAM
FT                   LPPDSLVVHVNCPEEVREARLNHRAAEAKRLWTPGLTSMRDSDLPSVIDAVRKRIDSLR
FT                   LLELDNGANGIDALCATVQDIIEIVRETAAIRPELPTGQAAQAF"
FT   gene            complement(220172..220465)
FT                   /locus_tag="Pnap_4312"
FT   CDS_pept        complement(220172..220465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4312"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39594"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB6"
FT                   /protein_id="ABM39594.1"
FT                   /translation="MTLLSFPSENKSRNLPHKLSQTLAHEKFGDAVDCLRECVEVLETI
FT                   SNPENQEFLARFIRKIKQSQQELQIVKSQAHVTECGGFGNSNSIFNLSIHHA"
FT   gene            complement(220721..221350)
FT                   /locus_tag="Pnap_4313"
FT   CDS_pept        complement(220721..221350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4313"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39595"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB7"
FT                   /protein_id="ABM39595.1"
FT                   /translation="MAAKRINPIFPRFGIGRARVVKLKKIKPSMPAGTVEDVFWRDYDI
FT                   PPNGPMAYVEKPTYVQKTFWAFMFCSVVASSMYVGFRSSQIHWPALIAALDGQALEPTK
FT                   PSLQSARPNATLAPVASQEPASSQAMAARESVTYPTPLPLGYGPEINADVNALALKGPI
FT                   NDALNQGADEEPISVDLVARVNKKVSMKNIQDDTVTLDRFSTKQIE"
FT   gene            221663..222580
FT                   /locus_tag="Pnap_4314"
FT   CDS_pept        221663..222580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4314"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39596"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB8"
FT                   /protein_id="ABM39596.1"
FT                   /translation="MSELSNSHDLGTSSPSGAPLTETEVALLEIDEAARIAFKSVEDEQ
FT                   NEALGAAPAQAALADSYVARPRVDFSTLTDEQKKDRIKVFTKRAASQRDRGRAELERVY
FT                   AGAMSVKMNVSWNDLTVASSCERFLGMCDLSPYTIGRRGPSVLGSKATTTVLEQFSALV
FT                   EKYYEAGMLAKRGAQALFDAERDHVFGDDEWVTPEYTTAAFAMVIHAKNRSTARIVAGM
FT                   AAWDEAIRLASVLEWNGKIETSKISDLREQERKGMYSIFSFARRSLIGLYKGTLKVEAT
FT                   KPAKELGAPAEAVPAAADTELTTA"
FT   gene            222675..224534
FT                   /locus_tag="Pnap_4315"
FT   CDS_pept        222675..224534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4315"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: rme:Rmet_6314
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4315"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39597"
FT                   /db_xref="GOA:A1VVB9"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVB9"
FT                   /protein_id="ABM39597.1"
FT                   /translation="MPDYFSDLNEGQFQAASCETHCLTIAAPGSGKTKMLSAKASYLLS
FT                   QNKTVTAVTFTRDSALELRDRIVKQAGIDVMSRLLVGTFHSIDLLMAFPGKAKSAMGSK
FT                   ILRHSRSSLSQSWVIVKEGNRRSAVARAFDAAAVPGLELDDATALIEGIKSGQVAPKCY
FT                   EEELLVKTYTDVLERHGVIDFQDILLKTNEGIKDGRISTLRTDYLLLDEYQDTDLPQLT
FT                   WTMHHAKTGSIITAVGDDDQSIYGFRRALGFGGMLSFENDLRATRVVLGLNYRSHSEVL
FT                   EPSAKLIAVNLNRMDKALVSNKGPGGATAWERFASRKLEAIACAQTIKTSLEEKQSVGV
FT                   LARTNKRLDEIETQCIALEIPYSRSAGGSVLKTREMSVFMSALSCMTRSSAKDTDELLA
FT                   WCGVDEQDLTALYQTFGDGLFDVARKRTDIGKAPIKDATKLLVAKLAKSFSDWKAFIRT
FT                   GGSSMVVDGVVQLLGSYTEDKYSKKMLEIVAGVLTPPINENVPLNKAQEHFECRLNTIR
FT                   AAMERPKTKEDEAGKPVVLMTAHGSKGLEFDMVWIVGAEEDTFPDKASSVQEERRLFYV
FT                   AMTRARKHLWISASGKLDVSRFVFESGVPRVPDGTFQTYDGDH"
FT   gene            complement(224590..225126)
FT                   /locus_tag="Pnap_4316"
FT   CDS_pept        complement(224590..225126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4316"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4316"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39598"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC0"
FT                   /protein_id="ABM39598.1"
FT                   /translation="MKNADRIEEIACNMAVVKKEVLFLTHPVSRTIRRDWNIVSAKMYV
FT                   FGLKRDYRVLIQEDLAELHHQIDELYKVASMGLFSDVDTSWLNMLRVEVKIISANSSSW
FT                   LRAMKTWDACVARLLTAERLGIIDRKQRKHILYPVTKAYIGFKNTAMRGKAQNARELVE
FT                   EGSLMLSPSLPDLAA"
FT   gene            226289..227317
FT                   /locus_tag="Pnap_4317"
FT   CDS_pept        226289..227317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4317"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:p1B250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4317"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39599"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC1"
FT                   /protein_id="ABM39599.1"
FT                   /translation="MNDQSGNLSLLIIDDDAREVFEKKSNFQLDLLSGSVKKAMNGAKS
FT                   SDLWMCPIDDIVIMEGFNVRSETAQYREKVEKLANSIIENGFYKSKPLAIFVGVDAEGK
FT                   NVNYLYDGHRRYAAAKLAISRNFELPNLPCVTSPAGTSLEDLTIAMVTMNDGDPVDPFG
FT                   VAIVCNRMIKGGTPIEEIARRLMLSPTYVKDLLTMMAAPRALRNLVSEGHVSATLAIST
FT                   IKKHGTSAPAVLQEGVEKAKAQGKTRVTGKTLAPEKVKTIKPEKRDLLQVATDWLARNA
FT                   DLADKDKRVFELAALLCEVSPNEVEGRYAFKLKDGAQPDATNSPAKSSGKEQLALAPEI
FT                   LT"
FT   gene            227441..228844
FT                   /locus_tag="Pnap_4318"
FT   CDS_pept        227441..228844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4318"
FT                   /product="DNA repair exonuclease-like protein"
FT                   /note="KEGG: dar:Daro_2561 DNA repair exonuclease-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4318"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39600"
FT                   /db_xref="GOA:A1VVC2"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC2"
FT                   /protein_id="ABM39600.1"
FT                   /translation="MTQGKYAGNTVRVAQMTDLHYCATNLEESDRCFTAAVTDAIEKQV
FT                   DCALITGDSTDHAMDAHSPAFVALAKQVQRLANHCPVLMLQGTFSHEPVGLLKVLSMVG
FT                   AKFPIMIAEKISSFGLTKSKGFELIIPNNDYRLVCTAIPTLNKADIAAMTEDSVGAAAE
FT                   EAGRIISDLLASLAPMNRALRLQGIASMVISHGTVMNCLTEHGVPMAGFDHEFTAGSLF
FT                   SAGADAVALGHIHKHQSWESDTQGFRQTIAYGGSIGRFHYGEEDAKVWLEWHMTSGQAS
FT                   FVAYETPARRTIDIFFDGPPDMEKIRAAAAQCEGAFVRVRYEVDAEHKQSVDRNAIKAI
FT                   LGSALHIQIEGTTLAIERVRAKGISTEPSLVGKLEKWCEATGTKVGILPEMLTMIQNQD
FT                   AQALVDSTMKRIMQQVMPVAEKPIETAAAEPAKLATAPVPIPKVDVKKETMSRGFFEDD
FT                   LAIEDRTLF"
FT   gene            complement(229164..229517)
FT                   /locus_tag="Pnap_4319"
FT   CDS_pept        complement(229164..229517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4319"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39601"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC3"
FT                   /protein_id="ABM39601.1"
FT                   /translation="MAQHIKLLIDNTANLAAPSRSTGDREKLFQRLLSVPCSFSEDEFK
FT                   EALALLGKRIDFETFNALFIERLKSRPDANSLVNRSILAILEDSEECEVLLTKLERINA
FT                   IGLFQVPALQPAP"
FT   gene            229820..232252
FT                   /locus_tag="Pnap_4320"
FT   CDS_pept        229820..232252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4320"
FT                   /product="putative ATPase involved in DNA repair"
FT                   /note="KEGG: dar:Daro_2237 putative ATPase involved in DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4320"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC4"
FT                   /protein_id="ABM39602.1"
FT                   /translation="MQVNKLMLEHFEGIERGRGKDRIEVDFTKVNPNAKLVALFGPNGS
FT                   CKTTLMDNMHPYRVMPSRATSPTPTAFSYYLHVIPGKNALKDIFWSHKGREFRSVIRIR
FT                   TTGKTNKQECYLTERVGEDFLPYEDTTGLVSDGKTDTYDRAVEAILGKPEVFFATQFSA
FT                   QGKKPISTMTAGEVKALMAAMLIMGSFKTLSEKANEVVKGLKPHLSAFQSQLLPLETKI
FT                   LKEQSLIELRGNLQREMQVNAEKVLRQKSLIKEGSATLSALELKLSQQESVLAQRSSLQ
FT                   MQLGSVVSQNAAELAAFEAKQVAERKSVEAADQNSRNAVRVAQSAYDDASLRVTETMAV
FT                   IATEKEIEQARVFHQTNVPVLNRLRGQQTDLYVDINKFNELTQLVAKMRESFAADRQTG
FT                   IAMSEAVETARQIAALIGEVPCAGHRFSGSCKLLAEANGAAVGLAGRQAKVVELRTRLQ
FT                   GDQVRIKNNNAELQRLIQVNAEREVLLGKIAALELALSNAKAVLKGAPALEKAKQQLDS
FT                   YRQSALQAKSDLANAKTIHTAALGAVNNILAKQQGDKSIFMSVLYKEKDRIQSAISELP
FT                   VLIQDYEVNEARKAWQYAELMLENEEKLRDGLVSRFNNVVLSISDIAASNAKISQVTSV
FT                   CDAISNEISQWSLLSRAMGNDGIIAMSIDDAGPEISALCNSLLKDCAGGRFNISLSTQA
FT                   ATAGGTLKEAFLINVEDVVRGGEPTELNFMSGGEKVWINECLVRAMALYMSQTTASSFK
FT                   TLFSDEADGPLDPERKRQYMAMKRTVLERGGYDREFIITQTPELLLMCDQVIDVTKL"
FT   gene            232375..232953
FT                   /locus_tag="Pnap_4321"
FT   CDS_pept        232375..232953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4321"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4321"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39603"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC5"
FT                   /protein_id="ABM39603.1"
FT                   /translation="METAAVQVSDFFAGTLAYVPTHKQNELKKCAPFGIEEVELMLPSF
FT                   PEVMVADMELCFQRYRRVKVNKDEVDEDGEFMDKAKYYAENGEMPKSQRKSAASANLFG
FT                   ASKGKATALQKQFYECIAWLFDIYESECRIPFEQACLNLAMEPELIRNTVSAAFSDDIR
FT                   EFILMYSYANPMDAKRVQRCMRGYINFYN"
FT   gene            233190..234113
FT                   /locus_tag="Pnap_4322"
FT   CDS_pept        233190..234113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4322"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39604"
FT                   /db_xref="GOA:A1VVC6"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC6"
FT                   /protein_id="ABM39604.1"
FT                   /translation="MSSQPKQPAIEKIFQIIAQMTGFVIATLVNFVKTVFKEIVTSEEK
FT                   LIDEAALKASPMQTAQAVSEGGHSSTVPEAIAIEVAVSHLQMHSGVIRDASTKVIKLSL
FT                   FAGSNPRIERLLSVPCEKLHFQRINWRFDRIRLSHFTPEKAAKSDLPFNYEGAKKYSLA
FT                   DFDAKAPHGHLSKQVQNFAEIPFLSKGGSPEKVSSQEEQTDNSVTSPTGCVTEAEGTVL
FT                   SASSVVVAPEGKAEYRSFAVVLSTATGDVTFQGVDLEVQFKKYHYSIGDLVSIKKSSSK
FT                   FEFTKPNKKSETRTKNVFIITVLKKA"
FT   gene            234180..234824
FT                   /locus_tag="Pnap_4323"
FT   CDS_pept        234180..234824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4323"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: pol:Bpro_4565 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4323"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39605"
FT                   /db_xref="GOA:A1VVC7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC7"
FT                   /protein_id="ABM39605.1"
FT                   /translation="MASVNKVIIVGNLGKNPEMRSFPSGDQIATVTIATTDKWKDKQSG
FT                   QMKEATEWHRVVFNGRLAEVVGQYLRKGSQVYVEGSLRTRKWTDQSGVEKYTTEIRADQ
FT                   MQMLGSRQGNDNAGHGQDDGGGYGQDDGGGYGQHHGGGYEEPRQARAPAQRPASAPAPR
FT                   PQAPAPRQSAPVPSHASSGFDDMDDDIPFVCGSMFYDMTTSKSRKMARYDY"
FT   gene            235004..236029
FT                   /locus_tag="Pnap_4324"
FT   CDS_pept        235004..236029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4324"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4324"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39606"
FT                   /db_xref="GOA:A1VVC8"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC8"
FT                   /protein_id="ABM39606.1"
FT                   /translation="MARLDLSKVDWYATLPRLGIDPSTIENPRRLGPCPIENDGRTRFR
FT                   FVNKDGRGNWFCNFCGAGDAVKLVALVNSKTDAEAILMIRDLDNGPGIKGPPQRLKPIV
FT                   EQPRDVTWIRKLLQQVWDETKPIQGSAVALYIERRVPGFDLNWLSSSLAYHPDLYHVDE
FT                   VTKKKNVFPALVGRVTGLDGTPVTLHRTYLSKDGFKAAVSPGQVKKQMTGVATLKGESI
FT                   RLNVPRIKTRVAIVCEGIETGLALVAATKNRHAVFSALNAGNLAKFMLSRAEFDLCIIC
FT                   ADKDVMNIKHGWRPGEHFAEILSEKLISEGYAVKFRIPQVEQTDFADLWMDRCKWLKLV
FT                   A"
FT   gene            complement(236173..236547)
FT                   /locus_tag="Pnap_4325"
FT   CDS_pept        complement(236173..236547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4325"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVC9"
FT                   /protein_id="ABM39607.1"
FT                   /translation="MPQLEAMMKLDPLKVFEQPTLTPFVEECLTDADKNIRAGLFCAFM
FT                   SYAVNRSDVPTALQSSFRQQQSLFGKNAFSVVQARELAMAQHGGKVEAKKCQTCQTVFL
FT                   TETSSKSKAHCFDHRSPQAA"
FT   gene            complement(236732..237274)
FT                   /locus_tag="Pnap_4326"
FT   CDS_pept        complement(236732..237274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4326"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39608"
FT                   /db_xref="GOA:A1VVD0"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD0"
FT                   /protein_id="ABM39608.1"
FT                   /translation="MSRLKKSEAVYPWAVYMARMLARNPIIVHALGLTKREGETIWKKT
FT                   NNRSSPSGQFPSNHDWYLETTDRRFQGALFILMYQKALTAMPRELALPHTYYHFSNITA
FT                   GEWKGPKGQDVDGAFRNIESDYALPYSRAFNLIAGYHNEQNPQSRHTHLVVKCCKGCLG
FT                   KYLARFDEGGSKCPLCL"
FT   gene            complement(237271..237645)
FT                   /locus_tag="Pnap_4327"
FT   CDS_pept        complement(237271..237645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4327"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39609"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD1"
FT                   /protein_id="ABM39609.1"
FT                   /translation="MPDNHGNDAELLPSHVTSPAFHAQINKVNKVVMELIEVALRLRKQ
FT                   EPLIAMLLGTTDEVLDAYEKAEKEDLLDLCRLGLPLVILRVNTVEEVTLLASSGFSSAQ
FT                   MLRNLSKHITLEPYKPRSKT"
FT   gene            complement(237678..238712)
FT                   /locus_tag="Pnap_4328"
FT   CDS_pept        complement(237678..238712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4328"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39610"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD2"
FT                   /protein_id="ABM39610.1"
FT                   /translation="MTHGLSNPMQALELINSHSPAVGYIGQIAPTISLEGDHFDEASAS
FT                   SVIHHALQVHQFELAIRTSARLLCVAMYHCHEAYIAASTGTNCNGWQDFCARNFARLRM
FT                   SDGNIRAAVRTGSALVNHEKQYPEGIEFFDQMSRAALFAIGGNEQTLIAVQEVLQADPA
FT                   GKITAEDVRRIAAELSSETIARLEAEKKLSAVEQTNVELCERLEERKTQAMRWKGIAEQ
FT                   AQIDAKTPVEAIKYALPKGVASEVELKETLTKENSELKDENERISSRLKQEGEKLQSLQ
FT                   RTLSLTEQSKVALDDLQADVSMMLAKYPKALAERMASVAPAIKEQFKAIAADLRSLAVA
FT                   LDVE"
FT   gene            238888..240114
FT                   /locus_tag="Pnap_4329"
FT   CDS_pept        238888..240114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4329"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39611"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD3"
FT                   /protein_id="ABM39611.1"
FT                   /translation="MKFSAKHPKYLFSEMGHDYFAQLLTACVGGEPAFRSQYLPVAERL
FT                   ACTVQDLPLENSSFAYAGGALQFGLLAGLTALRLCDGVIFEPSASAQKRMLVEPQYRYA
FT                   AWCATLAGVPLIVDHYALLTVNDKPWSFAFSPSSLWEACGTTGSYGIEWKPASKNPPTP
FT                   SLGLILLSSFFYAGQFTDFDSSVLASMCQSVNPGLTQSSGESSLSKLVRVAQEKVKATE
FT                   KLRISRVFVPGEAQVNTVASVMQALQTVPASTTTESAIVNTPKAKSISSNCENQKILQV
FT                   VTLNVASEQRTNQININSLTDSKLKLENDQKLENKSVPGIPPKVTFWLRALISDEAMRL
FT                   AFKFLPDQEMVDITGAQLRFGVVAKEMFELLHSSGFVHSKVGNLTVRLNKELTAVVQNE
FT                   FKNLGVTHA"
FT   gene            240107..242020
FT                   /locus_tag="Pnap_4330"
FT   CDS_pept        240107..242020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4330"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39612"
FT                   /db_xref="GOA:A1VVD4"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD4"
FT                   /protein_id="ABM39612.1"
FT                   /translation="MRKYEDMFRPAHEGYAVAGWAAGALLLVLFRPPFWWAAFPVILVM
FT                   LMFRGGQLETLWKFRLSLAVMLAPTIPILTLLAKSRQMRKQKKSLYLGRGFQWGQRHAE
FT                   IAQQVMNRNITEIPDLPDFLKKHIEKILETPPHDRTAIQKAASVFVNRLMPKHTKVMNE
FT                   AALGLPWIHGIGAVEDEDISLPLSVLTGHTLILGTTRAGKTRLFELLTTQVIDMGSALI
FT                   VIDPKKDRDWVNRLRMECKRKGRKFLYFDAAKPSESIRINPLANWNNISEPATRIGQLV
FT                   DADGSFAAFAWKTLVRVQRGLVAAGERPSIKNTKHYVQMGVDSLAERVLTVHFMKKYGP
FT                   EWDRDIKNSGVKDGPAGQKGPPSRLDLMIAKFIKDNEPDDAIAGLISMITHSKEHFSKM
FT                   IQVLEPILEMLGSDEIGDLLSPDPTNLEDKRPIYDMRKVIDEKAVLYVGLDSLSNKTIA
FT                   QAIGSILLADIASTLGSIYNFSSNPADCYLFVDETAEVANDQLTQILNKGGGAGMKVFL
FT                   AMQSIADLSVCFQSKKDKAEQMLGNLNNLISLRVQSVETAQYVSDKFSEVGTRAMDVAF
FT                   SSGSGSSEAFTEFRSNVSRSLKTTNTALVSPALLTKLPPLHYFAFIAGRSYIKGCLPFI
FT                   GE"
FT   gene            242315..243709
FT                   /locus_tag="Pnap_4331"
FT   CDS_pept        242315..243709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4331"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   pol:Bpro_5481 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4331"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39613"
FT                   /db_xref="GOA:A1VVD5"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD5"
FT                   /protein_id="ABM39613.1"
FT                   /translation="MAVFVLDRSARPLMPCTEKRARLLLERGRARVHKVMPFTIRVVDL
FT                   EAEDCEFQALRVKLDPGSKTTGIALVRETAEKNGVAVINLFELMHRGKQISEALTARRG
FT                   HRRMRRSHLRYRAPRFLNRGNKKSGWLAPSLQHRVDTTLAWVNRLERLAPVSAISTELV
FT                   RFDMQALENPDIEGAQYQQGTLAGYEVREYLLEKWGRTCAYCGARNVPLQIEHIHPKSK
FT                   SGSDRIGNLTLACQCCNQKKAALPVEVYLARKPELFKRILGQAKRPLKDAAAVNSTRWA
FT                   LVNALKTTGLVVETASGGRTKFNRIQLGIPKTHALDAACVGYVNSITGWRKPTLCLKAM
FT                   GRGSYQRTRLDKYGCARGYLTRSKSIQGFQTGDMVKAEVTQGKKTGIYTGRVAVRASGS
FT                   FNIQTRHGLVQGVSHRYCTVVQRGDGYGYSLVAKTDATGTSPKQGDALHPALYLPGLKA
FT                   GVSRAN"
FT   gene            243709..244344
FT                   /locus_tag="Pnap_4332"
FT   CDS_pept        243709..244344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4332"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4332"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39614"
FT                   /db_xref="GOA:A1VVD6"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD6"
FT                   /protein_id="ABM39614.1"
FT                   /translation="MIEIKNQFANHLIFWSFALPLVGVLGLPALLPSGDFVISDAEVTF
FT                   FKNVLAKDTGAITASCDALFNSLFVKTHIAPAFKEFFAPALSAGENPLGSMANKFSSDY
FT                   NNALWLMVYRGIWRLTGLWTIVLSVLMSLGIPFLIDGLAVRARKSYNFQFHNPVVFWTA
FT                   SHSMILVVGLGIFLPFLPYALNPGLLLGFCVMFCASLWITAANFQTGN"
FT   gene            244510..245103
FT                   /locus_tag="Pnap_4333"
FT   CDS_pept        244510..245103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4333"
FT                   /product="putative fimbrial protein"
FT                   /note="KEGG: bbr:BB3193 putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4333"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39615"
FT                   /db_xref="GOA:A1VVD7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD7"
FT                   /protein_id="ABM39615.1"
FT                   /translation="MKISPRVSHARPALKQQTGFTLVELLVVAAIIAILTIAALPQIQA
FT                   YIVSGKVGPANNEMQRGLTRMKINAEGNGTTPYSGVTTAVFANTMRDGSVFTVAGVAGA
FT                   ATIKHGLTASGAGVVAVAPAKIVATGDAFSITMNGVNRGACPDIAATMQKSAAQIDING
FT                   TTVKPIGGKFDGAAATNACIDTNTDTNVFVFTVQ"
FT   gene            245524..246882
FT                   /locus_tag="Pnap_4334"
FT   CDS_pept        245524..246882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4334"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   pol:Bpro_5402 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4334"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39616"
FT                   /db_xref="GOA:A1VVD8"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD8"
FT                   /protein_id="ABM39616.1"
FT                   /translation="MAVFVLDRSGQPVMPCSEKRARLLLQSKRARVHRVMPFTIRLIDR
FT                   SQADCLLQPLRLKLDPGSRATGLALVRDIETIEPAMGEVTRGAAVVSLLELEHRGRQIS
FT                   EALTARRQMRRRRRNQLRYRAPRFLNRGNKQKGWLAPSLQHRVDTTAAWVARIQRWAPV
FT                   TALSSELVRFDMQQLQNTEIEGAEYSQGTLAGYEVREYLLEKWKRTCAYCDAQNTPLQI
FT                   EHIEPRARGGSHRISNLCLACQPCNQKKAARTLQDFLKKDPKRLARILAQAQRPLRDAA
FT                   AVNVTRWALANALKTTGFPLELASGGRTKFNRCTLDVPKTHALDAACVGQVEAITGWQQ
FT                   PAFYTLTIKAMGRGSYQRTRLDAYGFPRGYLMRAKSVHGFQTGDRVKAVVPQGKKVGTH
FT                   VGRVAIRKTGSFNITTPAGVVQGISHKHCRIVQRNDGYGYFFHRADLTQDANR"
FT   gene            247082..248665
FT                   /locus_tag="Pnap_4335"
FT   CDS_pept        247082..248665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4492 methylation"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4335"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39617"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVD9"
FT                   /protein_id="ABM39617.1"
FT                   /translation="MEGTGVYMAMVKTGLERYNLTNHDSLVAGTAQAVVTPAVADAYAP
FT                   TIAELVRDKYITGNSLTAITPQRQSILTRITTPNCPGATCAVVGLAYTTTALVYSGTTD
FT                   PRFDLLGTYLASPGVAGGGLITKPEGDGSILSGNSGMVFPNPMGAVPGVLAIYTYIDQS
FT                   FYANFVRIQDTRDADLRGGLTLSGMSKDGVNTLRVNGDAITTGNSAINGSQTVAGPATF
FT                   LNDVSVKDPGAGTVCVKFYVAGQIDVNCNGVLNAKAGTFTGPLGTVRVGNTGSAYTIDS
FT                   SGKVRGQNGFYTAVNSMFGDNPNGVMFGGTFFTVTQDGINALLSVQSDGQVQARKSVAT
FT                   QFIALTSAVTLGQACGTPATISVQGPATMPGNTALASDGNGGVATCIGGVWTGITKLGA
FT                   FNAACPTEGAMAADAAGIALICQGGRYASLADRFGSLVFSESTVVSNVGINPLATDQPA
FT                   YPAVSKPLCASTSSPPRAYIIPNNETQRPQKVNRYLQDNGSSWLVYMLDGNRNVVTDAS
FT                   ATVQTYCAYN"
FT   gene            complement(248837..249895)
FT                   /locus_tag="Pnap_4336"
FT   CDS_pept        complement(248837..249895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4336"
FT                   /product="Allergen V5/Tpx-1 family protein"
FT                   /note="PFAM: Allergen V5/Tpx-1 family protein; KEGG:
FT                   rfr:Rfer_4490 allergen V5/TPX-1 related"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4336"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39618"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE0"
FT                   /protein_id="ABM39618.1"
FT                   /translation="MKAKNFNLVGFALALSALTACGGGEGSGATTAASAPSAQPAPVVT
FT                   PVSTASTLVTAVSPSTYAVGSEEAAAFDKLNAERNACGFGLLAQNANLDVAAKGHANWN
FT                   VLNGYFGHFQIAGTPGFTGVTPQERFAKAGYTVGQGSTVGDESTSVIYSGNKVGFGKVG
FT                   MVRLLNAPYHLAGLMSGFREVGFSVLSSDDIAGSALRQVTLQANLAYKDVDQPQLIDGS
FT                   SVATYPCEGSTGINRQLADETPNPVPGRDLSRLPLGSSVYIAVRDGNKLTITNASLTNL
FT                   ATGVPVTVRPVLNSDSDPNKVNGQSYFAGHQAFITADAPMAANTRYQVVINGTNNGAAF
FT                   NRTFIFTTGTGG"
FT   sig_peptide     complement(249797..249895)
FT                   /locus_tag="Pnap_4336"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.661 at
FT                   residue 33"
FT   gene            250087..250824
FT                   /locus_tag="Pnap_4337"
FT   CDS_pept        250087..250824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4337"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39619"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE1"
FT                   /protein_id="ABM39619.1"
FT                   /translation="MTMDTPKRSNMNKKFNKCIAVALLASAGLAALPAVADNLYTSQTR
FT                   PRRVDDSSGYLTLTGNVVIPSTALPPGSTGGGLGNRIISFSTGPGSSGFIRAKTCVLSQ
FT                   TSSNDNRNTSYLRIATGPYYDGTFVYNLGSSGGVEDSTSANCYYDGVAGFTSSPVFNNY
FT                   ENQASSSNREYSGYYARTRYDTTQLNFLTGATKSLGSSYSSYEYVPCEVAPQSTACYET
FT                   IVCPAGYVSYQGTCYPVDTGGSG"
FT   sig_peptide     250087..250197
FT                   /locus_tag="Pnap_4337"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 37"
FT   gene            complement(250999..252381)
FT                   /locus_tag="Pnap_4338"
FT   CDS_pept        complement(250999..252381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4338"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein; KEGG: bpa:BPP0645
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4338"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39620"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE2"
FT                   /protein_id="ABM39620.1"
FT                   /translation="MARQVRELYVFASIAKKAGPRFVPAGLLTLTEDLGAGARSRELAS
FT                   RFSYGTRYLQRLEAIEIDPVSLSIPDRKAAIGQEFFPANGLEEFGGIRDAAPDAWGRRV
FT                   IEARRRVPANSLAEADYLLQAGGDRVGALDIRADSTSPDSPSASDMRSLGYVLQAADRV
FT                   DQGLPVPASLEDYLGAGPSAGGARPKASVRDDDGALWLAKFPARGDTLDVARAESCTLE
FT                   LARRCGLTVPEVKYQDIGGRPVMLIRRFDRYWAAAGQAPAAGTALHDTRPDGGLMEGRL
FT                   AFVSGLTLVGCSEFESRTKGYHDLAHAIRQFAHPQSIRKDCEELFTRMVFNIFVSNDDD
FT                   HLRNHGFVHSPHLAGWVLSPLYDVVPRPSLAYERMLHLQVGTEGKLASLDNAMTHFAAF
FT                   TPERSRALALIRQVWGEVRQWRTCFEEFAANGKLIDQIGSAFRDLEDIASPALVAQIRK
FT                   PD"
FT   gene            complement(252381..252665)
FT                   /locus_tag="Pnap_4339"
FT   CDS_pept        complement(252381..252665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4339"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: rfr:Rfer_3066 transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4339"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39621"
FT                   /db_xref="GOA:A1VVE3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE3"
FT                   /protein_id="ABM39621.1"
FT                   /translation="MGEKLARLRMARRLRQADAAARAGIARSTAALIEKGDLSRTQAQI
FT                   LRYLEAIAPGVSLLSLLQEDDPSLQALAAREATRRVRPLGVAELKKLDF"
FT   gene            253051..254166
FT                   /locus_tag="Pnap_4340"
FT   CDS_pept        253051..254166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_C6002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4340"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE4"
FT                   /protein_id="ABM39622.1"
FT                   /translation="MIAPASSQWHFPRPALAQAYLASLNLGLSSARGLFARRRMGKTEF
FT                   LVEDFMPAARAGGYSCAYVNLWELKSDPATALVLALHQAIEPKSFAKVWERLNTPISKI
FT                   KASGKFAGMAEAGVEAELGNRHQVAGTLLMQAMAEFDKYKKSLVLIIDEAQVLAAAENS
FT                   VFAHALRAALDIRKDRLKVLFAGSSETTLRRMFGRASEPFYNWAALEPFPLLGVEFVAF
FT                   MVDKVAQISRFPLPLPDALQAFDALKQTPLFFRDYVERYLTHPFEGTQGALDFTRAKAF
FT                   NDGEFEKQWKDLLPADQILLALIARDTSDLQGLEVRTTVGARLGIEKPVPAGAVQNSLR
FT                   RLVDKSVITRMDRGAYRIEDEAFADWVRHQD"
FT   gene            complement(254244..255059)
FT                   /locus_tag="Pnap_4341"
FT   CDS_pept        complement(254244..255059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4341"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cne:CNE03390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4341"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39623"
FT                   /db_xref="GOA:A1VVE5"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE5"
FT                   /protein_id="ABM39623.1"
FT                   /translation="MQAGDQPSSGADRQSDPRAMARERAMAESQAIAKRQSQERLKREL
FT                   QTIAVIRKERIANSKAGLRRRLMAVAAATGLVCVAVGYAVGTKSPAPVQRHIIERIEPA
FT                   PASEPPAGAAVAAHLAQPSPPTAPAPSQEAAPVQAAQPAALAVPLPLPARMLAPAPPAP
FT                   PAQRAPPPRLSNAPLPERTADKPAAKPPEEGEFVLSSSRAKAAPEARATDPAQALPAAL
FT                   DFKVVNVIEGTVIVRQGRSVRQIKVGEKMPDGQTLKSVSVDKGQFETSP"
FT   gene            complement(255063..255548)
FT                   /locus_tag="Pnap_4342"
FT   CDS_pept        complement(255063..255548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4342"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39624"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE6"
FT                   /protein_id="ABM39624.1"
FT                   /translation="MNRHVLFPSTTFDQPLTLVSEHTQLVAGTLKTSLTALIDGRLTDV
FT                   HIECTDDTPIKISALATLVNCTIDCNDLLIEGAFSGEIKARGHVELGDSAQFQGNVTVG
FT                   GQLLVSHLADAVDMRILRASAKASAAPESPNVGAGKFESKPEGYAARTASAAKAESL"
FT   gene            complement(255658..256005)
FT                   /locus_tag="Pnap_4343"
FT   CDS_pept        complement(255658..256005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4343"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39625"
FT                   /db_xref="GOA:A1VVE7"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE7"
FT                   /protein_id="ABM39625.1"
FT                   /translation="MDKDQLALRFMEFFVFVLKIERARSHLVAFLVNRGMDEGEVEPFL
FT                   EARGAAIRLTVLKVAVAMVVGGFLLSKLLTASSTGRVGAWVMYAGMVLGALQFKRASDS
FT                   SPATLRDMLKK"
FT   gene            complement(256010..256258)
FT                   /locus_tag="Pnap_4344"
FT   CDS_pept        complement(256010..256258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4344"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39626"
FT                   /db_xref="GOA:A1VVE8"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE8"
FT                   /protein_id="ABM39626.1"
FT                   /translation="MTNDPNNGRARPSKIDQIIDEAYEEPRRNGVTAQEIFVCGLGTAL
FT                   LGLALLNIGALPGSLHAMGSVMVFVGVVAMVLIRRKL"
FT   gene            complement(256402..257448)
FT                   /locus_tag="Pnap_4345"
FT   CDS_pept        complement(256402..257448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_2217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4345"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39627"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVE9"
FT                   /protein_id="ABM39627.1"
FT                   /translation="MKPSILAIDIGFGNTKATWSHRTLAGKAEAWSEIIFKSVCPLALD
FT                   DDIAPGQATSNLDRVAVSVAGQAYYVGPKADREGGLRALHPDYINTPTHEALLLGAWHY
FT                   MFKETGIVSPSVDMLVLGLPVSGFSANKKVLKEIGSRVRRVPVPMPMRSRLGKAYVDVS
FT                   AKQVVVLPQPLGGLRLAAQSALELADDGVISMVIDPGYLTFDWLLSDGMAPHYELCGSF
FT                   QGGVSQLINAVAKRLSQDHGIESADFAMIESALAKGELLLDLKRIDMTPYRKLAGQQAQ
FT                   DMVAQWLMRFNPYKAGVSRIFVCGGGAGFYIDALKARLPHIRMDVMPEGVMSNCRGYFL
FT                   TGQDMFAD"
FT   gene            complement(257516..258163)
FT                   /locus_tag="Pnap_4346"
FT   CDS_pept        complement(257516..258163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4346"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39628"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF0"
FT                   /protein_id="ABM39628.1"
FT                   /translation="MSASSKDMSLIGGAAAEAGLAAPAPKPAGKTAASLKIQLLIKASD
FT                   IGLEALYLELAAAGSTSHRTRHVKRVLHQIVCGQHAPGASDLGNNASLAACSGRMPSFK
FT                   IEFRISERDVGLEKLFLEICRIEGASQRSHYVKRRLFNAYCLSAQPSGDAAPCRALPVP
FT                   AAREPALQTAPDANPAVPIASLPDPSSMSEPHPAAKQTLAQRMRKTVTESEK"
FT   sig_peptide     complement(258098..258163)
FT                   /locus_tag="Pnap_4346"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.656 at
FT                   residue 22"
FT   gene            258301..258582
FT                   /locus_tag="Pnap_4347"
FT   CDS_pept        258301..258582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4347"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39629"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF1"
FT                   /protein_id="ABM39629.1"
FT                   /translation="MWALVGDLAADGILSAKIAISPPKNTQKIAAFTFLKRAKIQYSST
FT                   HSPSRASLFQLLLHAERKKPEFKVPGPARSRLFLNPYRAPSPSFFDRA"
FT   gene            258965..259210
FT                   /locus_tag="Pnap_4348"
FT   CDS_pept        258965..259210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4348"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39630"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF2"
FT                   /protein_id="ABM39630.1"
FT                   /translation="MIALDCWQWPQGHALQRAAENEASAFADEFNLERLSRMDCFATTC
FT                   PLGNLPGRRLENKAAWQRQGITSMNSTYLLSLEPAT"
FT   gene            259676..260965
FT                   /locus_tag="Pnap_4349"
FT   CDS_pept        259676..260965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4349"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   dar:Daro_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4349"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39631"
FT                   /db_xref="GOA:A1VVF3"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF3"
FT                   /protein_id="ABM39631.1"
FT                   /translation="MTVVQSGAIGSLIKSADAIVERHGAVRVNGKVASIRTIEISRQVM
FT                   RESCHRLHGLGFYLSDISSLKEKHIHALVRDWHATGSRSGKPLANKTMQNQLSRLRIFA
FT                   GWLGKPEIVKPGGLAVYLPEVEASSLKVRTYTERSKSWTGNGVDLVEIIGRARLEDERV
FT                   WAMLLMGVAFGLRKKEMLRIQPWRADALCELRIDGSVAKNGRARSIPFIGAGHPYGLFQ
FT                   RWCLDQARRVTKRGQTLGWPDLSFKQSENRFYHCMKKLGVTQVDSGISPHGLRAEFAEN
FT                   MALIRGLVPPSLGGDIDQMGKAQRLEITDAITSMLGHDEDRTIKAYFSSFYRPLAHVGG
FT                   IGGKVGPTLALDRMQDIFVTVHVNPVPVRAKDGSYRIQSVAERAATAVTCVLENPPQED
FT                   RHFDVVSFIAEYPQFAERIRKSLVAVGLGD"
FT   gene            261131..262006
FT                   /locus_tag="Pnap_4350"
FT   CDS_pept        261131..262006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4350"
FT                   /product="AntA/AntB antirepressor domain protein"
FT                   /note="PFAM: AntA/AntB antirepressor domain protein; KEGG:
FT                   sbo:SBO_3650 putative anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4350"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39632"
FT                   /db_xref="InterPro:IPR013557"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF4"
FT                   /protein_id="ABM39632.1"
FT                   /translation="MPNGKTQPDPVATGHGSAQALPKNSGASKPKPGDAVRKATKKAIA
FT                   SLGETAHQPAAMAASPVGGDSPAGLELVQVAQGVIGGLECLVVDGRALHEVLGAKRDFA
FT                   TWLKSKLDEYGFIEKVDFEIFPQTGENSKVGRPTQDYSLSLDMAKELAMVERTPQGRAA
FT                   RRYFIACEQRLMQAGIPAPALAQPTHGPVGHEGGDMLDYFGPEDVHETAMIHNAMYTRT
FT                   WLLAMREANNVLLLGRDAGIAEGFACVYQQRMLSQLVKSLESINFAERFKDNYIADTTA
FT                   YINSWMPAPN"
FT   gene            complement(262111..262665)
FT                   /locus_tag="Pnap_4351"
FT   CDS_pept        complement(262111..262665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_1191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4351"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39633"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF5"
FT                   /protein_id="ABM39633.1"
FT                   /translation="MPLTRRQPGSGPELSRRIAMSTQQVFNFLALAGLPVCWVDGASGF
FT                   VPGVRILNGVLAIDPRKALASDVLHEAGHLCVVPGRFRHLMGEDVDAGVQAMLAQCRHL
FT                   DPDDPLMVQVMQSGECEATAWSWAAGMHLGLDPQIIIENASFEGTGAQLRLALKMGHHF
FT                   GVHGPTSGPVFPHLRRWLQTH"
FT   gene            complement(262656..263072)
FT                   /locus_tag="Pnap_4352"
FT   CDS_pept        complement(262656..263072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCVd0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4352"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39634"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF6"
FT                   /protein_id="ABM39634.1"
FT                   /translation="MRKPAKIINVRPAGPDHQVVTVAGEVAGYRRKPCGGCPWLVQNAG
FT                   AFPAEAFRHSASTAYDMARNVFSCHESGIKPAHTCAGFLLRGAGHNMAVRIGYITGRYK
FT                   DDVAGADAALHDSYRAMAVANGVAHDDPVLAPCR"
FT   gene            complement(263173..263418)
FT                   /pseudo
FT                   /locus_tag="Pnap_4353"
FT   gene            complement(263442..264428)
FT                   /locus_tag="Pnap_4354"
FT   CDS_pept        complement(263442..264428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4354"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: pol:Bpro_5019 response regulator receiver
FT                   domain protein (CheY-like)"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4354"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39635"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF7"
FT                   /protein_id="ABM39635.1"
FT                   /translation="MSFPLYRRLGGIIFLDDDQAYLQVLGDALPEGLQVRLFHRPAVCA
FT                   KTLIQEQNVWNADFRCQQEIVKRWHGGTQLIPQILKYWRDDGTKRFSLTKICMVDYSMP
FT                   AMNGVEFLHSIKGWKGSRILLTGLADEQIAVSAFNSGLIQKYIPKQTSKLTSHLINTIG
FT                   EFLQASIDNHQQIWSPTLSERQLALISDPLISKRLEYLSLTQGWVEHVVIGAPFGVLSQ
FT                   NSKGTIQWLQLEAAENLQELAELAEHQGWDDKTVRNIKSGETLIDVELRQVLDDGRRPE
FT                   PRESFPIDGEHSTVYAAQFGVYESLGAGCVHSYGRLLVGLSQRAIQD"
FT   gene            complement(264672..266045)
FT                   /pseudo
FT                   /locus_tag="Pnap_4355"
FT   gene            266362..266949
FT                   /locus_tag="Pnap_4356"
FT   CDS_pept        266362..266949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4356"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: regulatory protein, LuxR; Sigma-70, region 4
FT                   type 2; KEGG: pol:Bpro_4045 transcriptional regulator, LuxR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4356"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39636"
FT                   /db_xref="GOA:A1VVF8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF8"
FT                   /protein_id="ABM39636.1"
FT                   /translation="MEALIILGPDPFSTEESRLVRAVQPANLLLAAQTLAKSGDFGVAW
FT                   DDFMAPLVGWEDIADAIPEATQGWRMLCVGHGLQSVLRIAFPMTGGRAFECYLFSSLKW
FT                   HDQNDAAQLAWSAFIKWPALKQALIQAHSPLSPREIECLKLAFKGLTARESSEKMGCTE
FT                   RTVTFHIANASTKLRADNKLAAIQRACWFGLF"
FT   gene            complement(267222..267914)
FT                   /locus_tag="Pnap_4357"
FT   CDS_pept        complement(267222..267914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC3949 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4357"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39637"
FT                   /db_xref="GOA:A1VVF9"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVF9"
FT                   /protein_id="ABM39637.1"
FT                   /translation="MKDYNKTLKGRNLAWLVATLVLDVLVLLVIAFNTAVDDLTLTKVA
FT                   VIRASLTTLLPIPALILSSLISSDHKAILVFWRFQHPLPGARAFSVHAPADPRIDIAKL
FT                   KKNVGEFPSTERDQNSKWYGLYRQVDSDPSVVDSHKNYLLFRDISVMSLLLVPTLPLVM
FT                   HFSGIDSTRMLASAAWFLGQYLVTAFAARTTGIRFVQNVLAVHASRKVAGSKPAARKAV
FT                   SIPDSLNM"
FT   gene            complement(267920..268783)
FT                   /locus_tag="Pnap_4358"
FT   CDS_pept        complement(267920..268783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4358"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C0677 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4358"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG0"
FT                   /protein_id="ABM39638.1"
FT                   /translation="MPGQMILQIWDVQHGACAMLTHQADNGEQGRLAMIDSGDNGLTGW
FT                   KPSTYIKNHLRRSVLDYLFITNADLDHMSDLNNLWTEGITVSSFQRNRSVSPEVLRIIK
FT                   EASGELTDDIERYLALHTDYIHAVDAPFDQHMGGITVTAFSNPYPRFYDTNNLSLAVFF
FT                   KFGPFKILFPGDLEEDGWLAMLEQPAFRAELVGTTVLVASHHGRTNGYCQRIFDYFEPQ
FT                   VVVISDKSIVHSTQKPHYQYAASNQGVLVSNTNRRRRCLTTRKDGWILFKVSDDGRYTV
FT                   TTEYNG"
FT   gene            complement(268848..271103)
FT                   /locus_tag="Pnap_4359"
FT   CDS_pept        complement(268848..271103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4359"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   xac:XAC3952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4359"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39639"
FT                   /db_xref="GOA:A1VVG1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR032865"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG1"
FT                   /protein_id="ABM39639.1"
FT                   /translation="MAEEYHELTNVSALADEVGLTIPRAKTLFDVVSRQRDYAVVQLLQ
FT                   HCDDGTPKLECIVVEVECDGVPPKNGVGINYRERLALCVSDDPKQLIEVLAMRKDFPVL
FT                   MHQNQGILDAPASLCLYFESVAAVMRTWTPQSFLRRIQWWLEKSARGELHPTDQPVEHL
FT                   FFATRYELVLPWNLSTLRKSAEHRFVIARGPERPDAGFTCFLEAVPKDAAVKTGTAAPI
FT                   ELVLQPILHGFVERDPATLGQLADILSRRGIDLLPYLRAALQARVGAKGVVASADDKCT
FT                   VILLHIPICRTEGAEPVGVTHRAFLLLAGGLELGVAVGALFVLDKKYFSATGLIGAQPA
FT                   TEWRSQPVLPMAVLSQNDAAAARKQSGITEEGPAGALVGAGSLGSAILNFWGRAGWGSW
FT                   TVIDKDHIKPHNLSRHVAYAQHIGYPKATVVADLHAAAMHGASEITPLNADASDFKPGA
FT                   VTDALSSVKLVVDASTTLEYPRAASMVDGFARHFSVFVTPTGNAGILLAEDAQRLLRLR
FT                   TLEAQYYRALIQENWGRNHLTDNTGSFWSGASCRDISVVIPYSRIMGQASTLAEQIPLA
FT                   AAQDGAMIRVWQRDPVRGTVEVHDVPVATERRMQLGEFDLFVDASVELQLRDLRTKGFP
FT                   NETGGVLIGYYDFNVSAVIVVAALPAPPDSKSSPGSFERGIAGLAETVTEASRRTAGVV
FT                   GYIGEWHSHPPGHSASPSRDDLVQLVHLALGMADDGLPAVQLIVGEHDLQVLQGTVK"
FT   gene            complement(271103..272257)
FT                   /locus_tag="Pnap_4360"
FT   CDS_pept        complement(271103..272257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gox:GOX2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4360"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39640"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG2"
FT                   /protein_id="ABM39640.1"
FT                   /translation="MADKHQVIFYPVGNGDTTQIVLTGGRRVLFDFCHREKAEDTSTPE
FT                   IDLKARLKADLKKADRDYFDVVAFTHADLDHIQGSTDFFELQHARKYHGEGRIKIHELW
FT                   VPAAMLLEQADNDHQMEEFVLLRQEARHRLLEGKDILVFSKPQALADWLEPLLKERGES
FT                   ASARDHLLIDAGTIVPGFSLDADKVEFFCHSPFIKHCDEGDIIRNEASLVFNVRFRADG
FT                   AHYDYLEVGDATWDSMEDIVKTTRYHKNEDRLAWDLYNIPHHCSYLALSDEKGDKETEP
FT                   KPLIKDLLRLGKKDAYIVSCSKPITDVKDSYTQKQPPHIQARKAYERYLKEVNGRKFLV
FT                   TMEEPNANKPEPITFEITNGGVTWIRSTSIGAPAVILSTPPRAG"
FT   gene            complement(272353..272895)
FT                   /locus_tag="Pnap_4361"
FT   CDS_pept        complement(272353..272895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0131 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4361"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39641"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG3"
FT                   /protein_id="ABM39641.1"
FT                   /translation="MTYQCRLRWGVHSIAFIQRHRHAWPVSVQCRVLRVSAAGYHEHLA
FT                   RRASNAQRRHLSDEALLVHIKALHAETRSAYGWPRIWRELVARGVPVGKERVQKLMQLH
FT                   GIRAKGKRRFKVTTDSNHKLPISPNLLNREFTVAEPDRVWVGDITYIDPQKSAASASVE
FT                   ELLLNTVKYQKALPVVY"
FT   gene            272942..273985
FT                   /locus_tag="Pnap_4362"
FT   CDS_pept        272942..273985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4362"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: rfr:Rfer_2266
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4362"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39642"
FT                   /db_xref="GOA:A1VVG4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG4"
FT                   /protein_id="ABM39642.1"
FT                   /translation="MKVTTVGIDLAKNVFQIHGVSEFGKPLIKKQLRRNQMAEFFVNLP
FT                   PCLVGMEACGSAHHWARKLQAMGHTVKLMAAQFVKPYVKTNKNDAADAEAICEAVTRPN
FT                   MRFVPIKNVEQQSVLLLHRARQGFVKARTAQANQIRGMLSEFGLIIPLGIRHIANHVPE
FT                   LIEDASNVLPGSFRLLIERLLNHLKELDRQVDELESQIVAWHRQSEASSKLARIPGIGP
FT                   ITASALVASLGDAKSFDSGRQVAAWLGLVPKQHSSGGRQNLLGISKRGDSYLRTLLIHG
FT                   ARSVVLRASLKSDPNRTCSWINDVVNRRNKNVAAVALANKNARIAWALLTHDRRYEAGY
FT                   IASKASA"
FT   gene            complement(274270..274563)
FT                   /locus_tag="Pnap_4363"
FT   CDS_pept        complement(274270..274563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4363"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   psb:Psyr_3811 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4363"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39643"
FT                   /db_xref="GOA:A1VVG5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG5"
FT                   /protein_id="ABM39643.1"
FT                   /translation="MTKTSRARYTLEFKQEAVRLVEGGQTIAGAARTLGIVEQTLFNWV
FT                   KAHRQGKLKGVDSKPVSAEQMEISRLRAELARVKMERDILGKATAYFARGSI"
FT   gene            274796..275470
FT                   /locus_tag="Pnap_4364"
FT   CDS_pept        274796..275470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_D6443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4364"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39644"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG6"
FT                   /protein_id="ABM39644.1"
FT                   /translation="MENANAGPVTMEDVLGALNGTDPLNTSASKIRAILGRGSFATLQK
FT                   HLDALRAAAKAAQEPVSLSAVPSAPPEVIAALWSAAYNAAGHQLAGKLASCMTERDALR
FT                   AAAIAAADDVATLAAQVDALEQETAAAHASSEAALADCAAARKELQAHQARDSADRMRL
FT                   ATAAEADVMAARHALEMEKRDRTIERQTLQSTVNSLTDQIGELKALLSLQARQPIAQAV
FT                   QP"
FT   gene            275467..275709
FT                   /locus_tag="Pnap_4365"
FT   CDS_pept        275467..275709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4365"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39645"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG7"
FT                   /protein_id="ABM39645.1"
FT                   /translation="MRSKPCAGCPFREGSKTVYDRDAIEALDEGQEPSCHCVVGHHSIF
FT                   DAVLPERSIACLGYLSWQECEPGFCRPKLDSNERP"
FT   gene            complement(275723..276046)
FT                   /locus_tag="Pnap_4366"
FT   CDS_pept        complement(275723..276046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4366"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4366"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39646"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG8"
FT                   /protein_id="ABM39646.1"
FT                   /translation="MCLLASQGGAALGYRFQLIHAKPVRFHAEPGFSGHVDGSTISGSL
FT                   GQFGIGANNLTIYLGLLTAFTVPLHLRPQSPLATLKGGGSVQQVYLPLISSGELGRHRG
FT                   SDR"
FT   gene            276121..277023
FT                   /pseudo
FT                   /locus_tag="Pnap_4367"
FT   gene            complement(277324..277776)
FT                   /locus_tag="Pnap_4369"
FT   CDS_pept        complement(277324..277776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4369"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: rfr:Rfer_4341 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4369"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39647"
FT                   /db_xref="GOA:A1VVG9"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVG9"
FT                   /protein_id="ABM39647.1"
FT                   /translation="MCGKVRQYWLSRVSWAVHTNPFRQHDTQYSRSLTVPLRWPTSDSR
FT                   LIVQAALHGLQQIYRPGLNYAKAGVMLLGLQHGPAAQHELALGDDAPRLEALMAAMDRI
FT                   NERHGPGTVALASAGHFAENRIWSMRQALKTPDYMARWSDIPTALA"
FT   gene            complement(277790..278713)
FT                   /locus_tag="Pnap_4370"
FT   CDS_pept        complement(277790..278713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4370"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39648"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVH0"
FT                   /protein_id="ABM39648.1"
FT                   /translation="MNPTYASTVQLLLAIAPAIFETPLFALKGGTALNLFVQDLPRLSV
FT                   DIDVVFVRHDMARDVALKAIKDELAAAKTRIERMGFVAEVRQNKAGDEAKMFVTDDKSE
FT                   VKVEVNFVFRGTVLPPVRTSLVAAAQALFAANIEVPVLAIPELYGSKLVAAMDRQHPRD
FT                   LFDVQHMFDRFGLPPEFVDCFVAYLAGHNRPVHEVLFAQSQPLAEVFASEFVGMTATPV
FT                   TLEQLEATRARLFESLPKALTPAHHTFLLSLVQAEPDWSQMPFAHLQELPAIRWKLMNL
FT                   SKLKKTNTQRFIQQYDELAARLAAVV"
FT   gene            complement(278710..279378)
FT                   /locus_tag="Pnap_4371"
FT   CDS_pept        complement(278710..279378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4371"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4371"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39649"
FT                   /db_xref="InterPro:IPR021561"
FT                   /db_xref="InterPro:IPR033455"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVH1"
FT                   /protein_id="ABM39649.1"
FT                   /translation="MSDHGLTTKHAARLAKEGWLERLGHGAYTLPAETLDRDASIAWLV
FT                   PAVSGLHVAGKTALSWRGVRHNLAFRETLTLWGDKPAKLPAWFTTRFPSHYQATHLFDA
FT                   RMPPELGIAPLPGGRPDVPVSTPERALLELLSDVGNRQTLEEAKHLVEGARSLRLPLLD
FT                   ELFSYLTRIKVVRLAYAVADELNLPWKSIARQHSERLGGGKRWVSVGKTGERLDLKRNP
FT                   "
FT   gene            complement(279764..280444)
FT                   /locus_tag="Pnap_4372"
FT   CDS_pept        complement(279764..280444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4372"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39650"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVH2"
FT                   /protein_id="ABM39650.1"
FT                   /translation="MPFHPFSRFEDHVKQFHYTFGATVLEPQTGWRHLAGAFDEQCGDY
FT                   NALLDARLDPQLDAMKHQHDCLVAEHAALTQEVAVCLEAKARLRALRLKIKERSTRILT
FT                   AADEALLFFCDTQREKVKAIEKRCKTQLYNLPIRIRIAHQKLERTRQLRLTQLPKPFAP
FT                   GRHACAVPAHPDRAGRDGGRPGGPAICHRQAHRQPARNRRHYLLAELDEEKMADADVDW
FT                   SPAP"
FT   gene            280602..280955
FT                   /locus_tag="Pnap_4373"
FT   CDS_pept        280602..280955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4373"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="KEGG: pol:Bpro_5415 DNA/RNA non-specific
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4373"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39651"
FT                   /db_xref="GOA:A1VVH3"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVH3"
FT                   /protein_id="ABM39651.1"
FT                   /translation="MAACLALPAWAAPTECPEHFAGGVPPALTNARLQSRTQALCFQSY
FT                   AALHSGISRTPVYSAEHLTRANIEAAKKLSRRDSFHAESQLAQEDRAELSDYARSGYDR
FT                   GHMQYPVKNILIS"
FT   gene            280963..281829
FT                   /locus_tag="Pnap_4374"
FT   CDS_pept        280963..281829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4374"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease I; KEGG: cvi:CV1988
FT                   deoxyribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4374"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39652"
FT                   /db_xref="GOA:A1VVH4"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVH4"
FT                   /protein_id="ABM39652.1"
FT                   /translation="MKLFKYIYSINILKRKTAPTTMNSQVFRRLLGIVFTLLFLVSCRP
FT                   SALQPPPTNQTKQVEKAEVEKPELVNSKKEIGHRDFANAKKILPEVFAGLEEDFYCGCT
FT                   YSGKKVDLNSCGYVPRKNQTRAERIEWEHVVPAWVLGHQRQCWQQGGRDNCTASDTEFS
FT                   KAEGDLNNLVPAVGEVNGDRSNYSYGAWSNNPTPIYGSCKTVIDFKLKRAQPREEVRGR
FT                   AARITLYMHEKYKLNMSRQDRQLMCAWAKLYPVDTWEQTRDKKIIRWQGEGNPLVSDPQ
FT                   QLSSLCP"
FT   sig_peptide     280963..281109
FT                   /locus_tag="Pnap_4374"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.681 at
FT                   residue 49"
FT   gene            complement(281934..282941)
FT                   /locus_tag="Pnap_4375"
FT   CDS_pept        complement(281934..282941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4375"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39653"
FT                   /db_xref="GOA:A1VJW6"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJW6"
FT                   /protein_id="ABM39653.1"
FT                   /translation="MNLDEWLTKNKSNFGSDYEILFAETVLPLIPELSFDAVSVQYPFQ
FT                   DGDRRQRYCDFVIHENEDVRIAIEIDGYDKRGMGTGMSHADFVDWQRRQAALTSQGWYV
FT                   LRFANRDVRDEPNRCAEHISLLLKRSQSKSQRKTLSAKEKERLDALTKGQNDKIEYLNK
FT                   ETSVMKYTVASFTALILMLVMVIVWQSRGGSSGQSQATVQSATTPLQPVMLSALPATEV
FT                   PVQVPEGATCDNPISWQQAGQHIGQTAAVVGPLMKVTHRENSRGNPTWVDVGAVYPNVQ
FT                   RLVLVIWGKQKPDFPMVRPGQLEGRSVCIIGQIESYKGIPQIELKTASQLKILR"
FT   gene            complement(282997..283458)
FT                   /locus_tag="Pnap_4376"
FT   CDS_pept        complement(282997..283458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4376"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39654"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJW7"
FT                   /protein_id="ABM39654.1"
FT                   /translation="MLKSKKLFEIQVYRTKENDYYNEMRSYIEKINSDNSNPLISEHLR
FT                   KEYGGDWKYNEIIGFLQFYQYGENQIRCEYWDTEATRKVRTRRKTFVQVSNSYCNEMFS
FT                   KSESNLALAQLMKNAVEHCENRLKNKNWTLDRELFDNTVDFIDWKSLLN"
FT   gene            complement(283498..284193)
FT                   /locus_tag="Pnap_4377"
FT   CDS_pept        complement(283498..284193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4377"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39655"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJW8"
FT                   /protein_id="ABM39655.1"
FT                   /translation="MKTSTSTVAPDPVRDARQLYKTHREAASRESKVKNLDILWEALEG
FT                   IRSDGGRDYSLAEVGRRLEVAGGLKTQSLRNAQGTHFREIISAYAEGGSGSTKYLSKSK
FT                   SQVEAALELITDPSIRATLRMAIEEGKRLKVVNDNLHAAFKTLQVGASISATPTTDGQT
FT                   QVNGPITQFHAVPPRLLRALKIGVDRTRLAERGMTVMEDGSITDAQGETLFPPSFVTAA
FT                   EAFLAENSP"
FT   gene            complement(284190..287387)
FT                   /locus_tag="Pnap_4378"
FT   CDS_pept        complement(284190..287387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4378"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bxe:Bxe_B0035 putative phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4378"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39656"
FT                   /db_xref="GOA:A1VJW9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024965"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJW9"
FT                   /protein_id="ABM39656.1"
FT                   /translation="MTRLKATQTPVDKTDEVAARPKNNRGRKAGQPPTPRTALQKCIWQ
FT                   KEQFVARTSELTGRTVYENQSHDQYLISPAWNQAAVQVVVAEWNARIYALPGSNRPPAG
FT                   QRAAVAALSDCVSPQAFGEGLNVLLLQEFKAKLDNEGFHFSGQQFLTQLMLAMWCKGLV
FT                   AWPLTVQEPFPSAILTLNNAGWSAEFVVVLNYVRKYLARDTLTDAVTFRFFVDMVLSRA
FT                   GVVELGDITPTTMQVQPAPTRKRKQRPMAFTGLLQALRDEYSIKQVPWVLEDFGFYQAR
FT                   SGHLRRKENFEWALEIDPTMIEWVELAKQHLAENPTNYRKRRSAVNVFIEHIAKNSTVN
FT                   RSPAGYCDIKRRPDPLFHIDGNKGRQTMVVVYQFLNEVLHKVCIQADDNAFPILMPGFA
FT                   NPLVKQTFIGVNKGETHRESMPTRLIRQAMSILTENDFAWAREVGKLSDNFRWKNPETR
FT                   EFESVWSPVRTYALMAKLILPARTYQIRHLDSSEGDSLRYEENGTWGPNTGKHAPSNAG
FT                   VERGVFRQYKRKDGSLGAVLYFNTNKTGDIDKDKDKTGFVMPWEKLDALQLFARMRNWQ
FT                   EKYNQLDGPTNWTDINELKAAKHVEDLRKLGTNLFLFRDPCHQHRPDLPVSDVRLRNLW
FT                   LRLMEELEKRLALAGETLANGEPIKLVISSTKRSAPSAALFDLHTLRVTMITAMYEEGI
FT                   PPEILMKIVGHASIIMTLYYVKLNAETISVQLDAAVQERQRKEQSEMAGFIQRASRMEL
FT                   ERAVARTHPSALDAITSGTGTGLVVMDHGVCPVAARRCHEGLASMDPSSGFIRYLAVPG
FT                   GASNCVRCRFFVSGPAFLLGLEAHVIDLSYRLRKASVSFEKSQLRFDALSNQFADALEN
FT                   VTPFSQQRDLEIAETALESVTAEVDAIALSLQCAYALTEQSIHINNLGVNKPGGSGLSL
FT                   VAVGGTGELEAVLTETHEFEQLHRICESAMLFDGLKIDWQHPNLERARLFDRMLRASGC
FT                   EPHFSLLDDEDALGAANAMGKFLYARLGPKTVHDLMDGRTTLRALGMEKAFADQLQAMT
FT                   PKSLALSRTIFIEGNSS"
FT   gene            complement(287384..288706)
FT                   /locus_tag="Pnap_4379"
FT   CDS_pept        complement(287384..288706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4379"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; KEGG:
FT                   bxe:Bxe_B0036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4379"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39657"
FT                   /db_xref="GOA:A1VJX0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A1VJX0"
FT                   /protein_id="ABM39657.1"
FT                   /translation="MVIVGEQPFLQLLAFFRERGLSLSAERAYAQAIGRFIEWLSVRTE
FT                   EFWPQENRGLIYTAFAHDLLFGSYCDGEDALGLNWTATSQKNVARLTRCLVEFSDWLTL
FT                   RHGRPALNPMQEGVTYSDQLIFWRQWNKQKSRALLAHVKSRSQKVPRSEISRRSSLPGR
FT                   RNTLLQETKAFPVEHIDALLWTGFINPGKQNAAELWVKFNLRDILITLLCLYGGCRESE
FT                   PMHLWVDDVFVDPDDPELALVLVHEPHDGMIYYVDPLTGTKRKTNRTDYLQRFCGGKRP
FT                   LTMETGRRHSGWKGNLMTHRDRNAFQVFWIDRNAGRVFLRLWRLYLEYVRPLALQTPWA
FT                   FLTRDAQPLGAEAYSDSFVAAVRRIGLTPSKWSGTSTQAMRHRYGQWLNELGIGEKEGQ
FT                   VAMHHRNVKSQEVYRQLGVAKVAAAMGDGQALSLPSFEGLT"
FT   gene            288997..289566
FT                   /locus_tag="Pnap_4380"
FT   CDS_pept        288997..289566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4380"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   pol:Bpro_5415 DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4380"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39658"
FT                   /db_xref="GOA:A1VVI0"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI0"
FT                   /protein_id="ABM39658.1"
FT                   /translation="MSMVCHRVLHLAPNKDMPSRSAQAESFSLANMVPQVHASNAGVWE
FT                   GMEGAARQMALDEGEVYVVSGPAFIGNNVQRVGNVLVPTHLWKVLYSPAQQRAGAYVTA
FT                   NDATGTYSMGSVSELEKMTGVSVLPGLPRSIRDSAMALPKPAAQHGGKKSRTKGQSQSP
FT                   SKEADDFTLRDFATSILDAIKRAGQH"
FT   gene            289579..289833
FT                   /locus_tag="Pnap_4381"
FT   CDS_pept        289579..289833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4381"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39659"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI1"
FT                   /protein_id="ABM39659.1"
FT                   /translation="MTQAFKPYANEADVLRIGELEIENRLDRVTLTGDVVLTRDKAGLG
FT                   LARQLQALAAGIVKALEADKALPDAVELKAAVTVKNPFS"
FT   gene            290219..291574
FT                   /locus_tag="Pnap_4382"
FT   CDS_pept        290219..291574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2494 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4382"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39660"
FT                   /db_xref="InterPro:IPR041427"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI2"
FT                   /protein_id="ABM39660.1"
FT                   /translation="MNTCEHLRQLLRPVVGDMKDACTNSTMPELCIAMGLPVPPEGGDK
FT                   RGRLHAAFDALPDPDIPAFAQRLVDQRSVRGELRDHVQDALWAHLPVIDIPKRSRRDIA
FT                   RALNQIELFAHWDHFAQALKDVFILQEYSFAGLSDGVLEFAHRHFVRNPEDADVELLFE
FT                   KLRAFDLPNRRFVLLLEKFASADVQVDADAQERLVKLVNPMLQAAGAELRQTSTDGGYP
FT                   IFTVVSIRSPRGRPKNLIFASSTKPDIRLSDAINNDIEIASNPGAVLVYDRPLGADGLR
FT                   WSELQRWWSETTGEPDVQKARQTLLRRLQQCLPDSSPPQRLLFRTFFMTFGESVPRLPA
FT                   LLPEVWLHWDPKTVASRGAAALLTHRMDFLMLLPGGARVVLEVDGAQHYADESGRAAPQ
FT                   TYARMAKGDRELRLAGYEVYRFGGAELQGPEPSLLAAEFFRALFQRHGIPLT"
FT   gene            291753..292514
FT                   /locus_tag="Pnap_4383"
FT   CDS_pept        291753..292514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4383"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39661"
FT                   /db_xref="InterPro:IPR014976"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI3"
FT                   /protein_id="ABM39661.1"
FT                   /translation="MTRFVEWCAHTDIPVAHHKLQILTADPAKLAAAVDIVAEVVPDHY
FT                   VMPGRLAQLLTRLGRKEVAVYVAEKLPTTKQIKSGDLGEILCTTFIHESTPFKLGIKRL
FT                   RWKDHRNMSMRGDDVLAFHIGAGAAGLQVLKAEAKSGGKMQAGTVSTARDALSAYGELP
FT                   SPHAMSFVADRLEAAVDKPLRDMLDDAQLKRNLKPAHVTHMLFTFSGNDTTAMLSKNLA
FT                   SYVGGSAQHYVGIRVEDHQAFIKSVFAAAEV"
FT   gene            292514..296014
FT                   /locus_tag="Pnap_4384"
FT   CDS_pept        292514..296014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4384"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   enzyme, res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rpd:RPD_3630
FT                   DEAD/DEAH box helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4384"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39662"
FT                   /db_xref="GOA:A1VVI4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI4"
FT                   /protein_id="ABM39662.1"
FT                   /translation="MATTLEELQANIEAAVTPGYRQKLLARGQARGMIWRAGLLPIDAP
FT                   HFSPELSEDLLSFGYSLLLHGLRYVDLGGNFSLARVAFEVAAESIEAVVARGEVNENRD
FT                   FHRLIAGAAYHLGHYSARAYSMLFEGLGQSNLSVVERCLAQLMLRDLEGVNVAVSNWVE
FT                   SGVGSDSNLIEAFDTGIDAEVEDEDAGESGVIEAMTLALEGNFLSAMSQTLLALERGEH
FT                   SLILQAQARLEEGLSVAGELNLVTQWWAHRLAIHIVGGLWANSFHSLLPSQGPAGADVG
FT                   DWVHLRKLLIASLMRRRRAEIELWPSQIDAAKRVLEFEANLVLSLPTSAGKTRIAELCI
FT                   LACLARGKRVVFVTPLRALSAQTEVSLRRTFGPLGKTVSSLYGSIGTSSSDVDALKSLD
FT                   IVVSTPEKLDFALRSDPQLLDDIGLVVLDEGHMIGLGEREVRYEAQIQRLLRRADAASR
FT                   RIICLSAILPDGDQLIDFTAWLTSDRENGLIKNDWRPTRLRFGEVDWNPVSKLAQLKIV
FT                   VGDEHPFVSKFVVGKTLNANKNAKVYPASQTDLCILSAWRLIEEGQSVLVFCPLRVSVV
FT                   PFAKRIIEMIQQGLIVPMLTPPAEVLASALAVGVEWFGPDHEILKCLRMGVAVHHGELP
FT                   ASFRKEVERLLRDGVLKLTVSSPTLAQGLNLAATSLVFHGHARKGAPIDVSEFRNVVGR
FT                   AGRAYIDIEGLVLYPMFDKHEKRRTAWANLIASTKGREMESGILQLLYSLLVRIARKLD
FT                   APDVSTVLDYVAGQGGWDFPFLRSETGWRAANAAEEWPRHLTSLDTAIFSLLGDAQVPD
FT                   EEIEATLDEVLTSSLFMRRMARRDGLIQNLLIGGLKARVNFIWSNSSALQRRGYFLAGL
FT                   GLASGQALDSKAKELESLLLQANVAVGEGEVEMAIQAIIGFAHIAFEIPPFAPNGLPGN
FT                   WKYILELWLRGVPVPHIGSNDPDGTVSLIEGAFVYNLPWAMEAVRVRAEAHLDLFSNDV
FT                   SVANYGRAHAVAAIETGTLSVAASTLIKAGFASRLGAIHAVTVTAADFDSSAGMRAWLL
FT                   SAEVKARRDNPSWPTVESHELWVDFTAPHGSGYTKPWLATAYTGPVTWHGLPMPPGTPL
FT                   RLGGGPGKENAIYTADFKEVGKIGYAFNQAAVGLSIATATGAANEIAFEYIGPNDLVVL
FT                   "
FT   gene            complement(296587..298446)
FT                   /locus_tag="Pnap_4385"
FT   CDS_pept        complement(296587..298446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr4702 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4385"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39663"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI5"
FT                   /protein_id="ABM39663.1"
FT                   /translation="MSYRLASVTGAPSQSPNLSITYCPKDVAMPIMLKEALQSLVVADL
FT                   KDLIRYVPQAEAAGRKDELIERIADAMKGAKLQSIWLKLDTLQAAAVAEAVHHPQGEFS
FT                   PQRFRAKYQGDPSFEVAGAKSSRYSSQKKSALALFIHYAFKERLYFVPADLRASLLAFV
FT                   PKPPNVRLDSSETPPTGAGLTERLTEREALHEVVVMLRTLEQARITVSEKTALPGSSTL
FT                   KLLAERLVGGDFYPVVEKTDKWDQTIGPIKAFAWPMLLQASGLALRTGTRLALSPSGVK
FT                   ALSASPADVLRTLWRKWLKTTLLDEFSRVDAIKGQSSTARVMSAVPPRRAAIEEALQAC
FT                   PTGRWVRLDDFSRFMRAADHVFAVAHDPWKLYLCERQYGSLGYDGSHGWNILQDRYMAA
FT                   VLFEYAATLGIVDVAYFDPTEGHDDFRDMWGADELRFLSRYDGLNSFRITALGAYILGR
FT                   EATYQPVAQPSHVAISVMPSLQVKRVRGILSAQDSLLLELWAEPIQEDIWHLDRQKAVA
FT                   AIEKGHDIALLRQFLENNDDLPLPELVESFLLRCARDGQALKTGASAVLIECRDCETAD
FT                   NVATHKETSSLCLRAGPKTLVVRNEHVGKFRERVHVLGLGLAS"
FT   gene            complement(298751..299263)
FT                   /locus_tag="Pnap_4386"
FT   CDS_pept        complement(298751..299263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4386"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39664"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI6"
FT                   /protein_id="ABM39664.1"
FT                   /translation="MPHIRVVTKQEQVLQNIRTFQKELETTGKNNDLVNTLSHFRAWYA
FT                   VKANGKWIFGPSKFVGYVGLTAKAYATNIVQLDGRKTEDALKPWFVEVSSGPLYDELND
FT                   KLHDFLASFGKQPSSLARFSICREGLSGADEEFKGAFSLVEALLTIYREMPEAAQQEFR
FT                   RRIKKEA"
FT   gene            299906..301585
FT                   /locus_tag="Pnap_4387"
FT   CDS_pept        299906..301585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4387"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39665"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI7"
FT                   /protein_id="ABM39665.1"
FT                   /translation="MLRPTEARYTCLLLQPSGPIFAGRQRIGQHEPVAGALKARQFLQL
FT                   ALGKHAHLAVTPEYFFPWDALKVELLAGTQPSPGNLWVLGCESIDAPALAKFQADVGDV
FT                   CDVVHEPIAGLPADRALFDPVVHIFQASREDGTFRLVALVQFKTCPSRDDTFFEEGLLR
FT                   RGTTVYKFKGQDGTLSVSTIICSDAFALTDAVMPELVDRSTLIHIQLNPDPRNSAYRQY
FT                   RKTTFETDPSTSECHIVCLNWAGAVVQHGETGPLETWPKVAGSAWYCPDSRCKSDDEIV
FT                   LPNHDLGLYYAYMQERRHALLFDYGEAAFELQIPKVVTRGKAVLANKNGPGAVERYCWN
FT                   PGASAWAPGTRPVNAGFEALLRGNPEALAALSHATQNGSPLDTERLLALTVGSANGMES
FT                   WFSAKEVDSCRIGADEVVKRVTVAQDNHADAVSFRYARIESAAELRHLLDTKTDWPPQL
FT                   AGVAKDSLIHWSANDPHFNVRTSDGRPSLIVNLGNAPEPRRLENTASKFVELLRKAGGH
FT                   HKDRLCIVYRRLGELKFAQLPSTRFDDALGDETDLLAVQPLE"
FT   gene            301600..304725
FT                   /locus_tag="Pnap_4388"
FT   CDS_pept        301600..304725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4388"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: ani:AN3906.2
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4388"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39666"
FT                   /db_xref="GOA:A1VVI8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI8"
FT                   /protein_id="ABM39666.1"
FT                   /translation="MTNIETVRTAFGRHFQHVVEMGNGVVRGERQHNGKPYAVAYVDLS
FT                   DEVVERAHGLQSYQERLIGADFFSSDNDLRWNSYLFFWAGPKSAASEEFQQAKKLIESD
FT                   RHFARKFVLNEDDLERRLGQKPQAVATPATQQGDAGIAWAELLRADSLAMLLEQRPRTA
FT                   TLELIEAGEAFKADVGAPAPAKASATDALATGMLRKLSIQQFRRIHQSTEFEFGDVNLI
FT                   TAPNGMGKTSLLEAIEAFYCGRVRRDPEAVFEGISGELEAPDGRRHAVKLTKVPATLKA
FT                   RNMAWYGRTDVHAQAISQGFTRFNFLDTDAAFRLSSEQDPEQIQLDLGRLIVGPDTTRL
FT                   WTFLSKLKDDVDTRLKALEGQQPSDELNVDLLEKEVSRLETTPSESTSLRVAFREGVVR
FT                   LRPRWVIPDANTQLNEQEKSSVAELKSAINRALAAAPVTPGNKSVLQEQLAKMKASLAE
FT                   ARRIQSSYEAAVREANAAAENQKASKENQRLAELWEKILLAGVPELEKRIGIAEQQVQA
FT                   LRTALPSYREDAIASFPEKYFPLALKDALSDAKRESDLAQESSQTASRALSQAQELGQT
FT                   LVALRRDLHDASVAVMGQTGNLTECPVCKTVHAEQDLAEKLHALIGSGDSQMSAGLRQR
FT                   AQTAKQNTDTAQRALEALLTLAKWQQAAGLADDLACKDLFTQLQHQHEKLRAALLELQE
FT                   ARQAEKTLGATGIRLDGWQLARANAQRGLSEGVNVNDRTRLRQAIEFMAVQIGFNVLAH
FT                   VLTAKKPQTLANEATMLAIATGASRGVPMLPSQTVVAVERLVQQAEARVAAAAEVERAI
FT                   DWPVDAAYETLLSEVQSCLLAYDKADHAATQETEADSVLKQKLKDLAEARARQAKHEAS
FT                   RKNLARAAATLSKVVDEHSLETVTSEALRAIRSKVSDVFSQIHSPPEYALGNFEDGQLI
FT                   VRREDGATHAVNQVSTGQRAALALSIFLALNESAGTAPPVILIDDPVAHIDDLNALSFL
FT                   DYLRELVVSSRKQVFFATADARLAALFQRKFDFLGPNRYRRINLDAPQATAQ"
FT   gene            complement(305289..306959)
FT                   /locus_tag="Pnap_4389"
FT   CDS_pept        complement(305289..306959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4389"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39667"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVI9"
FT                   /protein_id="ABM39667.1"
FT                   /translation="MLTHPPSVYARLPTFSAVIDGLASGLGIARNKEDALADLGSFGGR
FT                   IDAYSGSLHRAGLQDLLLDLLAGSDEALRSLVQVWLLDAETELTNARALPLVTEATETE
FT                   GLQRFIEVWVAPWIAQMLSDARQQTGSVLESARLLLEVHAASLTGETTSYLATWKAAVR
FT                   RAIPKGINAREFRSTLARLDQRSQRKHSSIEQDLANLRVEMQSGFSSPQELDAAVDAVR
FT                   GLYLAGMATMRLCAMAAEIIPEQDILALVVGKLLAGLDRNGDFPDEAQHSRIRMYWGYL
FT                   DPYLALSKEYDQLGAQVNDLDEANFDKLRADSRAVAPSGLLMFVIDYAEGRWHLRHGRN
FT                   ELAEQCLQKVVARADSRQLGKIAADAASILIALRLAGPGPFTFEALNPLMRVRIENMPQ
FT                   LIELCIDAIPTPFSDWSHRPKPSFYDSHLMGCVAFFHDVTCALGVSTICNPLQRFDTSL
FT                   ENLIAKSREACAKLKELERKRPAIVGTSIKPYQVLRDHLYYRSAVFGWNPSNLPGMDAY
FT                   AKLPQPDQLRLLRFVDPEQFQLDLQVHGFGPWRHPDDVP"
FT   gene            306991..307341
FT                   /locus_tag="Pnap_4390"
FT   CDS_pept        306991..307341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4390"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ0"
FT                   /protein_id="ABM39668.1"
FT                   /translation="MPAAMIALPTPRLSAINLKEPHMKERTLRPMLAMSLDWHLTRALE
FT                   QNDFSAVSDKLRDQLIERGMPPRKAAINAPVMLDGMDRALQGEFDFKRIRNELCAERRS
FT                   RDAASPLTPAAG"
FT   gene            307699..309651
FT                   /locus_tag="Pnap_4391"
FT   CDS_pept        307699..309651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4391"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4391"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39669"
FT                   /db_xref="GOA:A1VVJ1"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ1"
FT                   /protein_id="ABM39669.1"
FT                   /translation="MNQQQGKEAFDQSFSQIVGAWNQMQGDALNSALDAYSQGIKDSIS
FT                   NGSGGFTNQSIDVQQGFVAEAHLVGSFNVEASVKGLNNHRATRNSGVHNDPVADAVVTT
FT                   PDGATTTHQMKFYKDGQKTSAALSPERYDTVDSKIVPSDQVLDVKASASKQAARNQDIR
FT                   PGVSKSNQHTVDTATDKLASKDGKVSSTGLKRKGDGSAEELTKRTKENNEGAEYGEKAR
FT                   VRREFNSMQYRNAAKGGAIAGAASEGVSILIDILRSDKPMTLDDCMDAATRLVASAAKG
FT                   AGNALLITGIQHAGQAMVDAAKNQGTKAVDQAMGKHLVKGNVAAAVTQITVQLAQNLYR
FT                   FSQGEIDNLQLASATVGSTMQIVGGSLSYTAGAAVGTWLGASVPAAISGYAIAGTTFGA
FT                   VGVMASGMVFGIGFALAAGAYVNHFSTEGRTLATNQLNSALEQLNGGKIDMSSYVGKVA
FT                   TMSEMTFQWSDLLPFSGAISVLAEYGQRKNQLQATRSHIESMIDALPAQEQAIMQELTD
FT                   QYRKAIQHVDQQYMEARASITKQALDQFDTLSEQLNEHLEQKFLLFEPIRKSYIEQSKL
FT                   MDLEVRKAQEDDERAKVYRSELLDLQTKLNTFTTSDKADRALKENLRETIVVRLEMLIP
FT                   HKTGWDEACEFLELQ"
FT   gene            309664..310890
FT                   /locus_tag="Pnap_4392"
FT   CDS_pept        309664..310890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4392"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mcp:MCAP_0861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4392"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39670"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ2"
FT                   /protein_id="ABM39670.1"
FT                   /translation="MLLKWIAHTWASSNLRKEEARTQRLLSQYDSEKAASDRRIAARKS
FT                   DYQRKIKERQEMRNSELEEYIQFMNSRLQAASNYMPKLDQFQTFTFTCVDSWMKVDLIQ
FT                   QEIDIYKKKIEAIFTTIGLIDAYISELTKLSQRQGRHVWREMTSTRPLTVSNTYVDKTK
FT                   RNVDRGSKLSNDEFRNELKRLQSHREALYKEAKELIDQRKGLHFSKDEVELVHNANKQT
FT                   LETMYNEYSDQWKEILKGFESYYANTKTEHDYVNQWMSPLKDGGTLKEITVVINTSHEI
FT                   IKCAQEKYDLIKDDFESYREIIKNARNSNDYPSNYSTIKANYDKLLPIAKDRGALMASR
FT                   GFLYGRRDELRGYIDKLKRLHPDEVLDTLYALLSEEREVNTWQAFGINTYKQRVAYRDK
FT                   QKGVQRAAN"
FT   gene            310877..311263
FT                   /locus_tag="Pnap_4393"
FT   CDS_pept        310877..311263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4393"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39671"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ3"
FT                   /protein_id="ABM39671.1"
FT                   /translation="MQQIEMQFQWKRHEMKEVIVAVTKAVILGYNTKDKLLAALPMFST
FT                   YRIALAIDALITADMAENNLGVLCIHPDMQIVLELLKRKFVLPMSEEQAKSPAVRRYVI
FT                   NQLGATNPAGVETLLRVNPVSVEA"
FT   gene            311264..313021
FT                   /locus_tag="Pnap_4394"
FT   CDS_pept        311264..313021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4394"
FT                   /product="Superfamily I DNA and RNA helicases and helicase
FT                   subunits-like protein"
FT                   /note="KEGG: mka:MK0070 superfamily I DNA/RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4394"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39672"
FT                   /db_xref="GOA:A1VVJ4"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ4"
FT                   /protein_id="ABM39672.1"
FT                   /translation="MGARHSYMHNGTEVAFDFVDHIDHWLEYLTELLSTADSKSKPKVE
FT                   RQIRYLLEFRAGTNCNINHNRLLLYYYSHRAKKAGNDISLPGEDLSGDNISMTKGNGDA
FT                   QAKIDAFIAEFRTREGSTSMSIHPSKPIQSEYEPTDPAFKLILKALASEDMFFIQGPPG
FT                   TGKTTAIVEIILQVLKSKPNARILVCSETHVAVDNALDRLAKQSRPELMDSILRYPGFA
FT                   ITEFECDRTPEADAISRAEAIWQKAYGAAPELTKDLWETLEASKTHDDDIKVSRWQGRN
FT                   LADMHQVVGVTCNQIDHLIDSDTQMYDLAIVDECSKATMPEWLMAMCVAKKCVLVGDHK
FT                   QLPPTFCSEEAEVLEQMDERKERLIRNGVIERLFENLPTELKGTLGKQFRMLPHIGHFI
FT                   STHFYNGQLEHHRTTTTHEFQDFGWFTYKSGGMRVPEQQGQEKKILINNLELKIIMARL
FT                   AEIRVRLKQAKTKRKVSVAVITPYRAQCKALKTALAKYDFSDQLAVEVDTVDAFQGRQA
FT                   DIVFFSFVRNTGPATFYADDRRINVAISRARDAVYLVGDIDYIRSKRLPVLDALAKLDV
FT                   LILHRKEDV"
FT   gene            complement(313388..313828)
FT                   /locus_tag="Pnap_4395"
FT   CDS_pept        complement(313388..313828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aci:ACIAD2665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4395"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39673"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ5"
FT                   /protein_id="ABM39673.1"
FT                   /translation="MHSTQGGYGGQGFGNAPAFPPAPSLIDSANGSINLPAPAGLAPLE
FT                   AFRSLQDFNSTGNKEALRRVTTPGMFAELEGSMGSPPLRILVLNASVQDVTEEPHQTVA
FT                   SVRYTGEVTEGVNPPEPIDEVWHFVLPRSSPAVWQLAGIEQV"
FT   gene            314014..315552
FT                   /locus_tag="Pnap_4396"
FT   CDS_pept        314014..315552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4396"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region; KEGG:
FT                   pol:Bpro_1938 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4396"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39674"
FT                   /db_xref="GOA:A1VV94"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV94"
FT                   /protein_id="ABM39674.1"
FT                   /translation="MPTNRITMRQIRESLRLHLQANLSYNEVGRNLKISKSVVGKYMSL
FT                   ARVAGVDWSVAQTLSDQELEAKLYKAALPRNSKQALPDFAQIHTELKRAGVTLQLLWEE
FT                   YAKGNDLAFKYTSFCVKYREWAMGLKRSMRQTHIAGEKLFVDYAGQTVPLIDAGTGEIT
FT                   KAQIFVATLGASNYTFACATARQTTADWIGAQVLALEYFGGVPRLIVPDQTRSLIKNPC
FT                   SYDPQNNRLYEEFAAHYGCALLAARPAHPRDKPKVENAVLVVERWILARLRNRKFFSLM
FT                   ELNHAIALLLNDLNQRAFKKLPGNRRSAFEQLDAPALRPLPAKRFELFRWKSAKVNVDY
FT                   HVEFDGHYYSVPHTLVRTTVELRASDTLLECYSSNQRVACHAVSPKRGAHTTTPEHMPA
FT                   SHRAHLEWTPQKLIDWGLRIGVSTAAVVTWQLEHRAHPEQGYRACLGLQRLAREFTPAR
FT                   LEAACTRALAIRSLTYRSVASILKTGLDRQQNLPTMTPGALPAHDNIRGADYFH"
FT   gene            315594..316325
FT                   /locus_tag="Pnap_4397"
FT   CDS_pept        315594..316325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4397"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; IstB
FT                   ATP binding N-terminal domain protein; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1939 IstB-like ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4397"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39675"
FT                   /db_xref="GOA:A1VV93"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013690"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A1VV93"
FT                   /protein_id="ABM39675.1"
FT                   /translation="MNEQTLTQLRSLRLDGMVRAIEEQATSIAVSALGFDERFSLLVQR
FT                   EVAWRDERRVERLLKAAKLKVSSACVEDINWRASRALDRALVTALAGGDWLRNAQNLLI
FT                   TGATGCGKTWLACALAHQAARLGFSVLYVRAGRLFDELHVAHGDGSLNRRMSQLAKLDL
FT                   LVIDDFAISPMGAPERNDLLEVLDDRVGTRSTLITSQLPVKAWHTYLDDPTLADAILDR
FT                   VVHSSHRIDLKGATLRDPNTN"
FT   gene            complement(316591..317220)
FT                   /locus_tag="Pnap_4398"
FT   CDS_pept        complement(316591..317220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4398"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV6022 putative dihydrolipoamide
FT                   S-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4398"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39676"
FT                   /db_xref="GOA:A1VVJ8"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ8"
FT                   /protein_id="ABM39676.1"
FT                   /translation="MKTATRKLTASLTCFALLMGQMPLANARLGSPRPAPAGARPAPSG
FT                   AQYQSPGRLGSGQSVGMQRPQVMQATRTPPPAAPVRPIAPVQQAAPAPVAPVAPAPGTP
FT                   GWVKPALAGAAVGALAGYALSNHGAGNSAANNNGNGSDGNAGFNSNAAGGALAAAPGSS
FT                   GLGGLTGLLLVLLLASAAFFVWRKYRSGTLVRSTCVFQRSWTPVSN"
FT   sig_peptide     complement(317137..317220)
FT                   /locus_tag="Pnap_4398"
FT                   /note="Signal predicted by SignalP 2.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.770 at
FT                   residue 28"
FT   gene            complement(317593..318579)
FT                   /locus_tag="Pnap_4399"
FT   CDS_pept        complement(317593..318579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4399"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39677"
FT                   /db_xref="InterPro:IPR010751"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVJ9"
FT                   /protein_id="ABM39677.1"
FT                   /translation="MQHISDLFPADPQTAANGQAQGSLGARSVREIKPLSPKSAEFLRQ
FT                   KTQAALQTLGQPEPPAAPANPVQPVLQLAFSKWDEDRRGVPNPLIRGGLFSTRTSKARL
FT                   SFKSAKIASLSNADILYTGEELRQDDLSVWLAIVHLGRNRVLGEPIYFTAYAIIKDMNW
FT                   RMHSDSYARLRNSIDRLKVTSIKITLRNERSGYAGSLIRDFLFDGLDEAGKSSFVVRLE
FT                   PPIASLFLHENTTLVEWAQRRQIGSKAALTLWLHMFYSSHREPIPYSVSKLREQCLSEE
FT                   KDLSNFRARLRKSLETLISVGLLVSYAILDDMVHVKRAVLNRRLQLA"
FT   gene            complement(318941..319195)
FT                   /locus_tag="Pnap_4400"
FT   CDS_pept        complement(318941..319195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4400"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39678"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK0"
FT                   /protein_id="ABM39678.1"
FT                   /translation="MKGRYFGMYVPCDAPGKVKRTPTRTRQRKNIACLGHLAEVLPCLD
FT                   HFDGAFPACWRESPAPAEIPGFKLYINPCETLLAVHVKR"
FT   gene            complement(320087..321268)
FT                   /locus_tag="Pnap_4401"
FT   CDS_pept        complement(320087..321268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4401"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39679"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK1"
FT                   /protein_id="ABM39679.1"
FT                   /translation="MQLLDDPIFHRKELTEYYLEYLKSPESSSGVFLAAPRRTGKTTFI
FT                   KEDLVPRIRLEGATVIYADLWEDRSINPSIVIINAIRESILACDGAVLKAAKSAGLSRF
FT                   KLAGFEMDLAKIGSKEGESISTTLQRLSAATQKPIIMVIDEAQHAQTTEEGRQTLFALK
FT                   AARDALRGAGPGFRLIATGSNSDRLAVLVSAKDQAFFMAPMEELDQLGDDYLQWLLDNS
FT                   QKAAKPSLAALKRVFEMCSRRPEPLKKVMRDLYKKGGMDVAELDARLELLMIDALQGLR
FT                   NNFIQGLHGLEPLDAAVMRRMAQTGKAFTPFDTKALEHYKRLLQDYGPAEQPAPSQSAV
FT                   QAALERLRKDGLVWNAGRGLWFIEDTQHVAWIQSAMAEEDALRQAAAGGNASQ"
FT   gene            complement(321428..322165)
FT                   /locus_tag="Pnap_4402"
FT   CDS_pept        complement(321428..322165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4402"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4484 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4402"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39680"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK2"
FT                   /protein_id="ABM39680.1"
FT                   /translation="MDPTNLNCCLASILGLRPLDRVLINSRHEIGEARAFSKFADQPFE
FT                   LPWFYFQRLVGQQLEVRSPGGYGALISPLDVCDVLPGTPIAVKAITPAAFVARLSLSPA
FT                   ERNADAGPPDFADAHVLFAEKDKWGRATFCVWFTDERHNGKHPWRATLPGADAGQCARL
FT                   ARRTVMPVISRSGASHSADHGTAQAAALDARVATLFIGSALRGDAGSAARLACAGVRPI
FT                   PLARLNRDFGQGLESSRHAPTAQ"
FT   gene            complement(322286..322558)
FT                   /locus_tag="Pnap_4403"
FT   CDS_pept        complement(322286..322558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4403"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4403"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39681"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK3"
FT                   /protein_id="ABM39681.1"
FT                   /translation="MQITIDPEYLEEFQYILALHQKRGAPRTIETVEDLVLIVFREIAE
FT                   GSRCPNTYRRSVLDAMGLVADGPEHQVHREEYGAPKDKASGTQGP"
FT   gene            complement(322574..323155)
FT                   /locus_tag="Pnap_4404"
FT   CDS_pept        complement(322574..323155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4404"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39682"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK4"
FT                   /protein_id="ABM39682.1"
FT                   /translation="MLVATARGWACAHCDHTQDRAHAFMAQTAPQALSDESFAAYAALA
FT                   LRTRGRITDRQALLERIDAAIGAYRYLFLYRFALESHNDQQSELIGCARAVAPVMLASL
FT                   RRRRMALMGVGQAAGEAPAADASWTPLSEGKPADDVSVEVLYQLEEITNPFHDGFGCNA
FT                   WIESRRFCGGRILPSGGTPTHWRPAERLTL"
FT   gene            complement(323214..324647)
FT                   /locus_tag="Pnap_4405"
FT   CDS_pept        complement(323214..324647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4405"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   pol:Bpro_5402 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4405"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39683"
FT                   /db_xref="GOA:A1VVK5"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR025938"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK5"
FT                   /protein_id="ABM39683.1"
FT                   /translation="MAVFVLDRGGQPVMPCSEKRARLLLQSKRARVHRVMPFTIRLIDR
FT                   SQTDCLLQPLRLKLDPGSRVTGLAVVREKPNTPGAKNAPAFEIAVINLFELVHRGRQIS
FT                   EALTARRQMRRRRRGNLRYRAPRGLNRGNKQKGWLAPSLQHRVDTTLAWVARLRRLAPI
FT                   TALSSELVRFDMQQLANPQIEGAEYQQGTLAGYEVREYLLEKWSRTCAYCDAQNTPLQI
FT                   EHIEPRARGGSHRISNLCLACGPCNQKKAARTLQDFLKKDPARLARILAQAKKPLRDAA
FT                   AVNATRWALAEALKATSLPLELASGGQTKFNRCTLGMPKTHALDAACVGRVDAIAGWQN
FT                   HASATLTIKAMGRGSYQRTRLDGFGFPRGYLMREKSVHGFQTGDLVKAVVPKGKKAGTH
FT                   VGRVAIRKTGSFNITTARGVVQGIGHKNCRVVQRNDGYGYFFNRAQHTGCEQAGPGATD
FT                   ALHPALYLPGLNPGVSRAS"
FT   gene            complement(325225..325935)
FT                   /locus_tag="Pnap_4406"
FT   CDS_pept        complement(325225..325935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4406"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xfa:XF1762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4406"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39684"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK6"
FT                   /protein_id="ABM39684.1"
FT                   /translation="MALPQEACPYCGEAELIEILEVWPPRDFQLDTCCHGVHEAAVQFL
FT                   SENPRAAAQWLRAKGLEGLTGRRVRRVIDDGSGQLVLDWRLTIAPVSFSTAKNFVAPHH
FT                   RHCPAPAGWRFWTGIFNGDELIGCVMVGRPVARALDPARVVEVNRLCVRTDIAPELPWN
FT                   ACSQLYGWAAREARKRGFQRIITYTLESESGVSLKAAGWTIEHKVKGRSWDTPSRRLPN
FT                   ASPGLNKNRWTPES"
FT   gene            complement(325953..326225)
FT                   /locus_tag="Pnap_4407"
FT   CDS_pept        complement(325953..326225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4407"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39685"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK7"
FT                   /protein_id="ABM39685.1"
FT                   /translation="MKLPTASQGKPNMRKSKLSLVISSDVDLTKLSNARIRIVRDERGA
FT                   FEVTSTLRFYTCEKSQFLGRFLRRRLPGLKFITGNCSAPSGYYWS"
FT   gene            326471..327529
FT                   /locus_tag="Pnap_4408"
FT   CDS_pept        326471..327529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4408"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   lpf:lpl2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4408"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39686"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:A1VLC4"
FT                   /protein_id="ABM39686.1"
FT                   /translation="MKKADLDLYTDYLLSTFGAATATGLSAMVEGDVSHDQITRFLSAQ
FT                   EYTSKDLWQQVKRTVRSVERDDGVLIFDDTIQEKAWTDESELMCWHFDHCSGRSVRGIN
FT                   LLNALYYCNATSIPVAFELVKKPVQYCDVATKRHKRKSEVTKNELMREMIETCIRNALK
FT                   FRFVLMDSWFSSEENFDYITGKGRHFIAALKGNRLLALSEEDRKKKRFTRVDELIFSEQ
FT                   TPVRGWLKGYAKEVLVVRQVFKNKDDSTGIMHLVCSDLTCDYDAITTTYKKRWQVEVFH
FT                   KSLKSNANLAKSPTRTLRTQSNHVFMAIYAAFKLECLSISNKLNPFALCRKLLINASRS
FT                   AYAQLQLFQAAA"
FT   gene            complement(327773..328357)
FT                   /locus_tag="Pnap_4409"
FT   CDS_pept        complement(327773..328357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:p1B349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4409"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39687"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVK9"
FT                   /protein_id="ABM39687.1"
FT                   /translation="MIEQLIQERADLALQHQFRVALASPATGKELTPEERHAFLTRAFR
FT                   EIARGMGIDRFAQTPVERMDQFAVLSVQKNHDTAGLLLSLMNSFMIAYGCPETCDRAYA
FT                   ALVQIEGLRAEVADAKGQGRMSNKPELVAAAQALDAELSIANKAPGAQAAPPYRVMIGA
FT                   DRLFVKSAHPLANLPARIHGFAVEAVYGPVN"
FT   gene            complement(328587..328874)
FT                   /locus_tag="Pnap_4410"
FT   CDS_pept        complement(328587..328874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4410"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4410"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39688"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL0"
FT                   /protein_id="ABM39688.1"
FT                   /translation="MSEKTQIPDESEIIAQGKADYFSHRGVYANPYKAGPPAHFNAYER
FT                   GWMQSLKRDGASLVDTPPPDAGSWYRIEPLKPAINEYALLKGRDGPRRSK"
FT   gene            complement(329146..329403)
FT                   /locus_tag="Pnap_4411"
FT   CDS_pept        complement(329146..329403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4411"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4411"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39689"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL1"
FT                   /protein_id="ABM39689.1"
FT                   /translation="MTAFQEIGMSDSVFEVLRAAVGMARAEQVQRLATLKLKLLEVFPG
FT                   RQEDIASAIAFWAAHARMNRSGADQGLSLAEAKRLASTPA"
FT   gene            complement(329417..329725)
FT                   /locus_tag="Pnap_4412"
FT   CDS_pept        complement(329417..329725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4412"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4412"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39690"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL2"
FT                   /protein_id="ABM39690.1"
FT                   /translation="MGQAKLRGTFEQRAANAKTNARAQFPDSIQCNNCQAWLTEIEPLD
FT                   IRGIPGMRLAGGAVCAGCAHTTWVLDGTPEALAGMQGYLDDAQDEEAKIGFVKKPQA"
FT   gene            complement(329694..330395)
FT                   /locus_tag="Pnap_4413"
FT   CDS_pept        complement(329694..330395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4413"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4413"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39691"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL3"
FT                   /protein_id="ABM39691.1"
FT                   /translation="MQPLLPAPESPDQVRGLYWRPNEAFVAELAGALEGQRVLEVFAGN
FT                   GYLASVLASRGIEVLATSVLSSMDAHCEGLYHPVVECDAISAVDRFGAGHDVLLMSWPT
FT                   VTEQAFVAACIWGDKPICFIGEVTCYETAHLGGCATDRFFECFEPARTFSSYGGYAMEK
FT                   ACIGKMAAPSRKFRQAKLAWERQAPQAPEWLAESCMGSAALDGPLGGTLPHCTTTSGKS
FT                   SHGTGQTSRHV"
FT   gene            complement(330411..330653)
FT                   /locus_tag="Pnap_4414"
FT   CDS_pept        complement(330411..330653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4414"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39692"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL4"
FT                   /protein_id="ABM39692.1"
FT                   /translation="MTVDNTEYRHFLGKARDAQRGGRDAWSVMSTGEKVAVALALNRAD
FT                   WLASIGYTLAEAIERTGAQWLEMLPQVARAVLDEA"
FT   gene            complement(331284..331571)
FT                   /locus_tag="Pnap_4415"
FT   CDS_pept        complement(331284..331571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4415"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39693"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL5"
FT                   /protein_id="ABM39693.1"
FT                   /translation="MDSFTPENLAKATEILEQARAQLQAIGLHCMLSSTSLPQGLSVSL
FT                   HVAQTELAVVAAHVASGQGGSLAHTADGQRHFVSEVADMAADLAIDKARR"
FT   gene            331624..331845
FT                   /locus_tag="Pnap_4416"
FT   CDS_pept        331624..331845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4416"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39694"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL6"
FT                   /protein_id="ABM39694.1"
FT                   /translation="MAAAVQVFGQDAGIPETGSMHQAVPWEFVQPKVFGAQARPHPNDH
FT                   LHMAVGKYGARLNLLSRDESYFAFWLQA"
FT   gene            complement(331889..332182)
FT                   /locus_tag="Pnap_4417"
FT   CDS_pept        complement(331889..332182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4417"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39695"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL7"
FT                   /protein_id="ABM39695.1"
FT                   /translation="MTALTAAARNDKVLAVLAQADAPTRTRAQEPGASQITFDAKLAQP
FT                   CPGCGAPAKIDHAASHWKVLCSKNQRALRGCSKAGHTMHSRKEAVRVWNELK"
FT   gene            complement(332416..332736)
FT                   /locus_tag="Pnap_4418"
FT   CDS_pept        complement(332416..332736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4418"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39696"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL8"
FT                   /protein_id="ABM39696.1"
FT                   /translation="MGISWNQTTAMACWPAPLTFKEIIMQFVIGDSQNSTSIDTEERQA
FT                   AIAPDKGDRLVIVLGINRVEIEHIDGSWTITHGANVITRALPQTDPKAFCALNQKLNEV
FT                   NA"
FT   gene            complement(332760..333041)
FT                   /locus_tag="Pnap_4419"
FT   CDS_pept        complement(332760..333041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4419"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4419"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39697"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVL9"
FT                   /protein_id="ABM39697.1"
FT                   /translation="MAGACGRRQQSTRYKVQMSTQQEFLCSAMSELGMSRDAFCARLGC
FT                   AGRTLDNWLLPNDSKDHRDMDGAVWTLVREMVAHEKSNQLKTSARKLP"
FT   gene            complement(333041..333364)
FT                   /locus_tag="Pnap_4420"
FT   CDS_pept        complement(333041..333364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4420"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39698"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM0"
FT                   /protein_id="ABM39698.1"
FT                   /translation="MASTGEEWKKEGIVSTKVWSLMYRLGTTWRVVGDAANPQGRKSAL
FT                   EGAATITRNGWRVWVEHHTSGKVLYQNPAEIAHQQSLIDKPINAFAEETVPGFARQRQE
FT                   RKN"
FT   gene            complement(333381..333671)
FT                   /locus_tag="Pnap_4421"
FT   CDS_pept        complement(333381..333671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4421"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39699"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM1"
FT                   /protein_id="ABM39699.1"
FT                   /translation="MTPAERDVALQRMDEAINRFYSAAVQIGNHPFIEFAGVMTAYLKS
FT                   CQRAHDAGIDFTECSQHTGNPLPMEGFEVAYLNEKLDCIFDGRLKASNIPA"
FT   gene            complement(333813..334214)
FT                   /locus_tag="Pnap_4422"
FT   CDS_pept        complement(333813..334214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4422"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39700"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM2"
FT                   /protein_id="ABM39700.1"
FT                   /translation="MADESGLKMEDHASALALLAEVRDYLMRLPAVPITRQLCRKIDAH
FT                   LADPGIARVKDAAERALRDRTKLNGALYRVGGPCLSAELFQKKLTLKSDNLDIPGCFSS
FT                   EELLDILCRGISLELRDDEEYARQVAAAK"
FT   gene            complement(334304..335527)
FT                   /locus_tag="Pnap_4423"
FT   CDS_pept        complement(334304..335527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4423"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: pol:Bpro_0014 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4423"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39701"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM3"
FT                   /protein_id="ABM39701.1"
FT                   /translation="MSMPSKVVAVYDQPHQFEPLLPQRELAGLIERTRTVLEKAYRLQH
FT                   CVAPSTRQSLQRLVRGMNSYYSNRIEGQGTHPLNIERALSADFSKVPDVAQRQRLALAH
FT                   MQAEQELEGLLAPGAGSEREALQSSFLVQAHAALYCRLQAPDRTTEDGRVIEPGQLRRE
FT                   DVSVGRHQPPTAASVPAFLSRMDEVYPRIKGLDGLLFGIAAAHHRAAWVHPFGDGNGRA
FT                   CRLQTHCALLATSAGLWSVNRGLARQRDRYYAVLANADSARQGDLDGRGNLSEKMLREW
FT                   CGFFIELADDQVTFMTQMLRLDGLRERIATLMLVRSESSQFEHYTKHATLALHHVLLGG
FT                   PVSRGDFCQMTGMAERSARRTLAQLLKDKLLVSDNPKGPVTFNFALDALPILLPDLYPE
FT                   AATTNTEP"
FT   gene            335893..337059
FT                   /pseudo
FT                   /locus_tag="Pnap_4424"
FT   gene            337056..337331
FT                   /locus_tag="Pnap_4425"
FT   CDS_pept        337056..337331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4425"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: bxe:Bxe_A4409 two component transcriptional
FT                   regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4425"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39702"
FT                   /db_xref="GOA:A1VVM4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM4"
FT                   /protein_id="ABM39702.1"
FT                   /translation="MKPAANPQLPGVCTVRLDVPVRDARLAFERAYFSFHLAREGFSMA
FT                   RVVRKSGMDRTNVYRKLRQLGFEPDAGQWRLVPEMLQAGQCSLDAD"
FT   gene            complement(337441..337902)
FT                   /locus_tag="Pnap_4426"
FT   CDS_pept        complement(337441..337902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4426"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39703"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM5"
FT                   /protein_id="ABM39703.1"
FT                   /translation="MSLVKTKAGEVLGKLAVCPAAAKKAAQLAKAFWNTQVASGFNEGV
FT                   DTWVPRGFRLDWLPTNELFERGYRAVSKNHHWVMTTGVDAHIDRVWGPTLVLVLFNDGM
FT                   YFKQGREKTIHRPGEWFIFNDAVSHEVNPTKSSLQEAVYLGWAVQLEKT"
FT   gene            complement(337915..338196)
FT                   /locus_tag="Pnap_4427"
FT   CDS_pept        complement(337915..338196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4427"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39704"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM6"
FT                   /protein_id="ABM39704.1"
FT                   /translation="MSHAWGSFDHFPIDPSVAAAKLAAMDAKREASTRVAQCSDAVDQV
FT                   RLDIVVTANDVTCRIPKISLAPGQKDTLMARLRDGVTLELKNQSVPKS"
FT   gene            complement(338216..338539)
FT                   /locus_tag="Pnap_4428"
FT   CDS_pept        complement(338216..338539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4428"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39705"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM7"
FT                   /protein_id="ABM39705.1"
FT                   /translation="MILQLDIEQLAPGLYEAHCECQTPPTTLHGSISAALKHYGEGIPA
FT                   DFCRFVEVRYDGVNSGTTAVTRLANEPEAMARQLMGLAAAVYEACQDMTSARRASAGTA
FT                   KER"
FT   gene            complement(338536..339147)
FT                   /locus_tag="Pnap_4429"
FT   CDS_pept        complement(338536..339147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4429"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39706"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM8"
FT                   /protein_id="ABM39706.1"
FT                   /translation="MKIVQARMNTEKMSLKERRAEHNAAYELSKQGDEAAYRALTEERF
FT                   IAECSADSVAPHGMFARSRKFSNPLFMTPAGYLAAFPELDEHLFLSLESAHQAIAKYGK
FT                   PQHHALWQVRSTKLAKELRDKRYQRWLREVKNSGEPYLVPRRSLEECAAIYASGGIEAL
FT                   KKIYSKSHALKTEHRLVEAGLVQREVRHTPVLACNPRVDK"
FT   gene            complement(339167..340312)
FT                   /locus_tag="Pnap_4430"
FT   CDS_pept        complement(339167..340312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4430"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4430"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39707"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVM9"
FT                   /protein_id="ABM39707.1"
FT                   /translation="MQPTGTQKSDGAGLERLWLQVCASRGTPAPDPGQRGQFLHDLEPE
FT                   ARSTLESVLTLAARGREKPGDLGLLSWAAACTRPALLKQLQSHGLAFTGAELFACGLKL
FT                   RQDGWDMQQRIAQLHNHPEDVDTLRAWLPAVPQEEPVELVDLPLQALAAPAGQQETAPE
FT                   AFYFWPDDGPLDDDAPGWDREHMNAMDTMPAAPASGRTQALPLLPTRFERQASPASSAA
FT                   PAERDKSRLQLRLFGKAAAHTLEVTAHRRGGDFMGVHVVSIDSAHALSAGGGYAWERKL
FT                   VLQLTPEEMPAVVATLIGITPSVRFGHHGATQAKFIELRRQEGGLVLVTGEHAAIYSVP
FT                   VPTATLYYVLDLFCRAMAMEGDKPVRSVSEILALVKAAHGF"
FT   gene            complement(340322..341386)
FT                   /locus_tag="Pnap_4431"
FT   CDS_pept        complement(340322..341386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4431"
FT                   /product="phage integrase"
FT                   /note="KEGG: pol:Bpro_5390 phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4431"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39708"
FT                   /db_xref="GOA:A1VVN0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN0"
FT                   /protein_id="ABM39708.1"
FT                   /translation="MADVTALDPAAFFKSWQAARLDNQDLKPMGAAGLQQAELIWRKWL
FT                   AFCAANAVAWDAAQSTDITRFTQAIGPRSKSKKTSPVTLRRYWRVLHDLYAHALATGAV
FT                   AVNPAEDAKPAATERVPSLALPMNMWIALREGLSSGHTFKERRNRLVLLLMMRAALTVR
FT                   EIIDLTLASAEPYAGSPEDQAAQFEHAGLPLLQPESSHWQQAEPSPLYTLRVRKARTGH
FT                   ERVLLLDARTSRALHDWLEVRHIGLGLIDPESRLIVGDKIGQAIAPNGLYNICQAHLAH
FT                   CLVQQGFMAAPMPNTIVDPGGIQHMGPNTLRNTCIALWFNSGVPLAEIQRRCGFKDASV
FT                   MSRLGAHLLNPFPL"
FT   gene            complement(341958..343025)
FT                   /locus_tag="Pnap_4432"
FT   CDS_pept        complement(341958..343025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pol:Bpro_5076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4432"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39709"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN1"
FT                   /protein_id="ABM39709.1"
FT                   /translation="MMNITPCRPRDHVTAAGRLYPSAWKQSETMRSGRGQGFPDWPAWC
FT                   FLPIAATQAIVATGAGVDAQWLHVSHPERIPDAARLAGLAGWRMTQGIYRFDPAVYEAV
FT                   RDTLVAGDIPSDVLYRLPEWCVYIETPNMLLGDVQMHGAFAHLEHDVNTGQPELRFLLD
FT                   IDEAAGPALMPAVLHLGRWTLADALTRSLNLAAGNAVSAGEQLPNDFAKGMSGVLRPVL
FT                   EPLLSLLLYLCSQAAEVGDGQRRPANPEPKRVKGGLRLFVAERPTTWDVGVRLGAALRQ
FT                   AYAAEQTGQVAGHVGPRPHIRRAHWHGFRSGAMKRDDGSDIPAAQRPFELRWLPPIAVN
FT                   VSKPDDLPAVIRLVK"
FT   gene            complement(343022..343594)
FT                   /locus_tag="Pnap_4433"
FT   CDS_pept        complement(343022..343594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pha:PSHAb0292 putative HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4433"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39710"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN2"
FT                   /protein_id="ABM39710.1"
FT                   /translation="MQQRHVPHRETFGYETKFKREQCLKWPKTHANDAVAACLEDGEVV
FT                   LPMARILIKNHMASGDYQQTAGRHSQQRLPTGKLFGLRKGDKVATPHGVGFVKGKRSTG
FT                   YFAIADLDGTVIHASAKAINCIRLAARKTTQIESHTVAELILGRQVRDIRVQAEKENKK
FT                   VKKTKNSAAQPPAFYLPGLNPGVSRAP"
FT   gene            complement(343636..344595)
FT                   /locus_tag="Pnap_4434"
FT   CDS_pept        complement(343636..344595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4434"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein; KEGG:
FT                   bte:BTH_II0087 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4434"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39711"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A1VIX2"
FT                   /protein_id="ABM39711.1"
FT                   /translation="MRKDKHLPSQPKGVYRVKNWPEYNAGLIERGNVSIWMDEEMFAPM
FT                   AGASVQRGRPQAYCDAVIQMLLALKSVYRLPLRALQGFAMSLRRLALPALPVPNYSTLS
FT                   RRAKALRVTLPVLRNAGEAVHLLVDSTGLKLFGEGEWKVRKHGYAKRRSWRKVHLGMDD
FT                   ETGQVCAVLMTHKDVIDASVLPELLAQIPQETKIEVVIGDGAYDTKAARAAIAGCGALA
FT                   VIPPVEGAVHWPASQAGAPERNEAIDHIAQSSKQDWKDKSGYHRRSLVENLMYRFKVLT
FT                   GDRLWARDVDVQDAEVAVRVGIINRMLVLARPKSVRIA"
FT   gene            344685..344867
FT                   /locus_tag="Pnap_4435"
FT   CDS_pept        344685..344867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4435"
FT                   /product="DNA integration/recombination/invertion protein"
FT                   /note="KEGG: gox:GOX2701 DNA
FT                   integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4435"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39712"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN4"
FT                   /protein_id="ABM39712.1"
FT                   /translation="MRFGRQPGQRVKADRHQKRALELVAAGQSYREVALRLSISKNTVL
FT                   AIVKRDRAKQAAIPG"
FT   gene            complement(344981..345916)
FT                   /locus_tag="Pnap_4436"
FT   CDS_pept        complement(344981..345916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4436"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; KEGG:
FT                   psp:PSPPH_2948 DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4436"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39713"
FT                   /db_xref="GOA:A1VVN5"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN5"
FT                   /protein_id="ABM39713.1"
FT                   /translation="MQVNLAHRPRLSSLQPIAPAEAAEAAAEAPRKGPQRTDARTLAER
FT                   NGYNEGFLPGWKVKWPSAGDNQGDVLPVPGTRDNLLTYTNFSVMMSASRRIAMCVGVNI
FT                   SGKDSVQIPRDKDAWYFDGRIPDEAQIGEDLYAGNLLDRGHLVRREDPNWGADAQTANE
FT                   DTFHFTNCSPQMGAFNQKTWLSLENYVLKNARNSEERITVFSGPVFGTRDLEYRDVLIP
FT                   LAFWKVIAFIDDEGNPSATAYLISQKGELSALEVAFGAFKTYQRSVAYVEEITGLDFHG
FT                   LADYDGFSNEERATGTRIEAELASAGAMRV"
FT   gene            complement(345938..348892)
FT                   /locus_tag="Pnap_4437"
FT   CDS_pept        complement(345938..348892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4437"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_4640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4437"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN6"
FT                   /protein_id="ABM39714.1"
FT                   /translation="MSSGNDAKIEEALQASLAKAAMLGMFSPLELLDANDPIQLAALQQ
FT                   LATECAEVLHDHQALWQLSTDARSRTLLQLKHYGTLAQHARDAQPAKSDRLGHFLKKII
FT                   LGDDITRSRLSTDDLVYLRTALQLTVPVAERGDVSKWVEDLVAKRDAEAAVQTLLPKKL
FT                   IGRERQLRRLREFVYQNTGLADDFILWLTGVGGVGKSALLAQFVRELRGDEWGGVPVLT
FT                   IDFDRPAFYQGRLSSIFLEMSRQLELFRPQMSEALSDFRETVRRNEAKKDNTRFHDRAT
FT                   SGIALLSAWKECVRDHLPLIGEVVVVFDTLEEVSSSGNLSLNELASWLHRLRAAGFPHL
FT                   RSIFSGRAFYPEFSRGLPIHSQLDLGDLTAAAAVKLLQAMVGDQISIDVGLLRSLIDML
FT                   GGNPLMLKILAVHLRDGGRTAAHELLADRSNFDRQFAQTFLYKRLLGRIRTDDPDLVKV
FT                   AHPGLILRRVTPDLIQQVLAVPCGLGEVSNARARDLFDKLSQQVWLVQPSGENAVLHRK
FT                   DLRRLMLQAMTATDVERAAAVHLSAMAYYADYLDPVLTREQQRIEYHYHCMLTSAVELP
FT                   PPELIPAFVRALGDDIETLPPAWRASLKVGSQQKLMTAEADTLQQPESVRYAGDVERRT
FT                   VLETGYATSSKQSASDGDMQAQDPRAVLNRAQNAFESGELASVLSSAQIAIQEFGSPNR
FT                   EPDSRDFTDSTVWRVAICSLRQSNRFTSSLDRSFTRIDPKSVYQPLSFSSRDPLTLGSA
FT                   YFMLYRLHGKNPPDQRVSVPQHGSTIENVAALRCWQLGGVMPARSGFEVRLRLLCDLAD
FT                   GFEPSNAARLEPLSLDRAGNKELAIRSRAHVAGLTYSLHELNRLRPEQGCMYIEDEASL
FT                   RSEDHRKLRGLTPEIYPLVRAAARKCALKVLVEFSESMAAHRYWPSELGRVELRKNLRE
FT                   ERERWTSAFIEVVDRHGELLNLVNHLIERGRGTRPLMQVVRDYDSRLKDFFNPG"
FT   gene            complement(348889..350694)
FT                   /locus_tag="Pnap_4438"
FT   CDS_pept        complement(348889..350694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4438"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39715"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN7"
FT                   /protein_id="ABM39715.1"
FT                   /translation="MPGEHSQTDFEQLAAAVSNRERFAAIFDDVAKPCTPYVFKLLALM
FT                   TPQAPIAKALSHAAERGFLDALVERLLHANQLNMEVVAAAPAAASATVKLQALTQPKAG
FT                   IVNTEAESKSSLLAMRRLCSIVVIDGNGMPVKSGTGFLVGPQTVITSYHVVRPLLDAQD
FT                   MPLQDSRDRLKITFDAVNGMSTGTVIQPQEAWLVEHSRFHPLEDPDNQQEIDWTGADPE
FT                   GFDSHLDFAVIRLSRTVGRERGFYTLDPGRMPTIANVGAQLTLWQFQNNQPLATSRGVG
FT                   SRLWPTVHKSRLHHDANSSDGSSGGLLVDQEFKPVGLHQYGYFDAANKPLFNGAIPTAC
FT                   IARRGTALTSVVGLDAMWRLDSTDEPLIGREGFQNAVLRAIGGKVRIIAVAGAAKTGRS
FT                   FTAKILRTMLGTAQHNVVEMSASQLDVTAHGTAMEILRACGAATVPALPVSDEAESAVG
FT                   AWIRDELFAEFVRRIREHSDQRVLWLVVDDVDRYKIANTSTRTFLETLYAGMASLPELR
FT                   VVLIGLDGEVPGADPEQVDQDRTREFDRLEMEHYVQRFWSVEKPHLDAARAQDLVRGLL
FT                   AAVPDDPLTRQAQLAKALAKAARSA"
FT   gene            complement(350694..353246)
FT                   /locus_tag="Pnap_4439"
FT   CDS_pept        complement(350694..353246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pnap_4439"
FT                   /product="peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin"
FT                   /note="PFAM: peptidase S8 and S53, subtilisin, kexin,
FT                   sedolisin; KEGG: rpe:RPE_4642 peptidase S8 and S53,
FT                   subtilisin, kexin, sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Pnap_4439"
FT                   /db_xref="EnsemblGenomes-Tr:ABM39716"
FT                   /db_xref="GOA:A1VVN8"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A1VVN8"
FT                   /protein_id="ABM39716.1"
FT                   /translation="MFPQGDLFAIGYALADHLGITSAEPDLGIDVYRDPDALQPELRAE
FT                   TAFVTGLCRAEGEPPADKQWALKTTRLDSARELGDGRGSLVGHLDTGLTDHAELDADLF
FT                   ALDLAADILDGDQDPTDPLSKGMANPGHGTSTVSVLASRTTGEIVGAAPGAKVVPIRCI
FT                   EDVKVFNTAPVAKAISYATAAGCHVISMSLGGIAGRALHAAVKQAVHKDVIVVAAAGNC
FT                   VGIVVWPARYAEVIAVGGTNILDKAWKGSSKGSRVTVSAPAEFVWRAERTSLAADKHLI
FT                   SAGQGTSYATALVAGAAACWLSAHGREKVVAVARQRGITVCSLFGAALRATARRPQGWD
FT                   GDLGAGVLDALALLQLPLDAIPAASAETTATPESSLGDFLDEEIGLGQADPAFDAERYE
FT                   TEISAIALSHASFDQPLIALTEAAKSIATKPSVHLRNAANISSDLRVRRFGQTRSSSVS
FT                   LPTAPPRVPEDFSRVRLALPSGTLVEGTTSSASLEATRDFLAAGGEKILIDRARKILSG
FT                   TRATHDQANEIAQSISALLDEVKSNAPRSALGKLGLEALVAMTGRPALRVINGDVDHED
FT                   PRAESWGGAIYNIKAGASFKLRLDAVGRIDLDGEHQGTGFVVGQGLILTNRHVLQQIAF
FT                   PIPRRNKPDAWILNDGDCVIDFAEDPSYGSAPSRFKILEVLRAGDDFIDMNAIDLRKVD
FT                   AAVLRIAEKSTAGDMAAPPPLDVSLSPSLTNPTEQIAIIGYPAQPNLIRIGTTNKVDYE
FT                   VMDRLQAIFGADYGSKYFSPGKVIVAPFPGVIPGITRVHDATTLGGCSGSLVASFAKPM
FT                   NAAALHFGGAFRSGNYAHTLPELKSLGFFDGLAINWVP"
XX
SQ   Sequence 353291 BP; 75149 A; 100695 C; 102610 G; 74837 T; 0 other;
     tgccgaaagg agatcctgca agatgaatcg gtcgctgccc agaaaggctt ccaatgcact        60
     gcgaagttgg gcgatgtcct gctgttcttg cagttcaagg ctgtagcgta attcgtcggg       120
     tggaagcgtc ggcgtgggta gggcgggcag gacaggcgct gattgaagcg ccgtacgcag       180
     tcgattgatg gcagtcattt accgtcctcc gtattaataa ttgtgtttcg cattctcatc       240
     tttccagcct gaaatcggcg tggttcaaac ctgggtaaca ctttaaccgc gttcaaatgc       300
     ggatagttaa cccagccagg tgttcgagct gcgaactggg gttctaagcc ggaaccgccg       360
     aaaattccgc cgcccgttca gtcgatcaac cggcaagctg cttaatgcgc tcgaccagat       420
     gcccggcaat acggcgactc atgcatgcag gggtcacttc aggaaacgga tcacagcgta       480
     cgttaagcct gcgaggatgc cggaatccag cggtacagag tgggcacgga cacgcccagg       540
     ttcttggcca cgtcacgcgg cggcacgccg ctggccagga gttttttggc tgatgcgatc       600
     ttgctgtcgg tcattttccg cttgcgcccg cccttgcggc ccagctgacg agccacttcc       660
     agccctgcgc gggtgcgctc tgctgtcagt tccctctcca tctcggccag gctggtcatg       720
     acgtgaaaga agaatcggcc tgacggtgtt cctgtgtcga tggcgtctgt caggcttttc       780
     aaatgcacgc cctgccggtg cagctggccg accaggtcca ccaggcgctt gacgctgcgg       840
     ccaagccggt cgagtttcca cacgaccagg gtgtcaccct cgcgcagcat gtccagcgcc       900
     ttggccaagc ctggccgctc ggcccggctg ccgctcatct tgtcatcaaa gagcctgtgg       960
     cagcccgcct gggtcaaggc gtccatctgt aagtcaaggt gttgatccag cgtagagacg      1020
     cgcgcatagc cgatcagcat gccagccctc gattgagttg attcatcttc tcttccttct      1080
     cgaaactcgt tgttatggta gggcttcgag aatatagttt caagaactgt ttctgataac      1140
     aaaagagcct tgattctgtg tgcgacacga ggcacacagc aaagctgctc aaaaacctac      1200
     gtttccaaga agaccctatg ccccgtcgtt cgattctttc tgccgccgag cgcgacagcc      1260
     tccttgccct gccggctacc caggatgaac tcatccggca ctacacgctc agtgaaaccg      1320
     acctgtcaat cattcgcctg catcgcaaac cagcgaaccg gctgggtttc gccgtccagc      1380
     tttgttacat gcgccatcct ggcctggccg gagccaacga gtggcgttgt tgcataaatc      1440
     cccgtgatgg cgcgccatcc ccctggcccc caatttttag gcgatccgga cggagttcgg      1500
     gcgtgcgagc acaatcatgc ggttgaggat gcccacccgc acagcgactt cggcgtcctg      1560
     cacatccaca tcgcgtgccc acagcctgtc gcccgtcaag gtcttgaagc ggtacatcag      1620
     gttctccacc aaggagcggc agtggtagcc gcttttgtcc ttccagtcct gcttgccgct      1680
     ttgggcaatg tggtcaatgg ccgcgttgcg ctctggcgca ccggcctgac tggcaggcca      1740
     gtgaacggcg ccctcgacgg gaggaatgag cgccagggcg gcgcacccgg caatggccgc      1800
     gcgggcgact ttagtgtcgt aggcgccatc gccgccgaca atttctacct gggtctgtgg      1860
     cggcagttgc gccagcaact cgggcagcac gctggcgtca tcgacgtcgc ggtgcgtcat      1920
     caacacggcg cacacctgag cggttttcgc gtccagcgcc aggtgcactt tgcgccagct      1980
     gcgccgtttg ctgtagccat gttggcgtac cttccactcg ccctcgccaa agagcttcag      2040
     gccggtgctg tcgaccagca gatgcaccgc ctcgcccgcg ttgcgcagca ccggcaggct      2100
     cacccgcagc gacttggccc ttcggctcag cgtgctgtag ttgggcaccg gcaaacccgg      2160
     cagcgccagg tgctgcaggc tggtggtgaa gccttgaagc gcccgcagcg gcaggcggta      2220
     caccgacttg agcgtcaaga gcatctggat cattgcgtcg cagtacgcct gcgggcgccc      2280
     gcgctggcct ggcgtttgaa gcgctggcga gaacatcctt tcgtccatcc agacagtcac      2340
     atttccccgc tcgatcaggc ccgcgttgta ctcgggccag ttcttgaccc ggtaaacgcc      2400
     tttgggctgg ctgggcagga gcgtgtcttt tggcatgttc ggggcaaaag cacgtagcct      2460
     accagcgcgc cagcctgctc attggggcgc ccggggggat ttatgcaaca acgccagcca      2520
     cgacgccgaa ttttcaggcg gcatcgaaac tttccgcaat cgaaattccc cagctccccg      2580
     ttcgctggcg ttgttccccg gattcggaaa agtctttccg gctttgaaat gacggcatcg      2640
     gaaaactcat ttttcgaaac atacacggcg gcgaaaagtc agttcggcgg cgcaatcatt      2700
     ttcggcatcg aaaaactccc cgtgcggcta cggtggtcat cgattgcgtc tggaaggaat      2760
     cacggcgctg atttcagttc caggccctcg cagcggtttg agcgtttgga gattcaaaaa      2820
     agtgaagtgg ccggtgcgcg tccagccgcc ggtgtcgatg aaaaagacat tgcccagctt      2880
     catcattgct gaaatggttc ggtgtccatg taccactgcc aggatgtttt tgacaatgcc      2940
     cgtgtagcgg tagtcgtgcc gatctgcaga ccagaggcat cttcctgccg tgctgcccat      3000
     tttggccagc cctttcaaat cgatgccatg catgtgctgc cagtcgtcaa aagggcagtc      3060
     agcgtgcatc aggcccacga tgccggccga ggtcttcact tcaagcgcga tgggcagggc      3120
     ggcaaggcgt ttgccaatgc ggttgagctc gtcactggaa agatcgtcga gccattcgcc      3180
     accatggaaa aggtggtcaa cttcctgaaa aggctcgccc aaggcgcggc gccaggccat      3240
     caggtcgtga ttgccgcaga cggcatgaaa ccacggttgg tccagccagg cgagcacctg      3300
     gtgcgactct gggccgcgat caaccaggtc accgaccgaa aaaagccgat ctacggcagg      3360
     atcaaagcca atcgcatcca tgcctttttg caacgctctg aagcagccgt gaatgtcgcc      3420
     caccgcaaag tcgcggccga ccaaattcaa actgaaacgc ggtatcgcga tgtttttaaa      3480
     tttgtcgttc attttgaatc gctttaactt gacttaattt agcgaagcca tatcaagaag      3540
     ttttttggtt cttggcagga cctctaaatt tccagagtat gagtggttca attgaattaa      3600
     acaacaagtc tcagtgtcat caccacttgc ttttaatatc gataaagtaa atggattggt      3660
     ttcattttta aatattcttt cgacttcttt aattcttata tttgttctat ctgatatttt      3720
     tttaaatact tcgatttcgg tttcaagagg tagctgattt ccgtatagct gtacaagaaa      3780
     gagaagcgat tcaaaaactt gatctgctct gtctaatctg gcgtaagcct ctttaatggc      3840
     cttgacggta ccatcgtcta aatatgcctg tctctctgcc aaagtctttt gcttggcttc      3900
     atcttccttg gcaagtgcag ttcttctgag tgcattctcc cttttgattg cggcagactt      3960
     tctttggggg tcacactgag caagtgcctt gtagccgacc gttcttgcaa agaatccccg      4020
     gttgtattta aggagaatta atccgttttt cttatttaaa agattccttt ttaaaacctc      4080
     tgccgatttt ttcatgaatt tataggtttt tgggtattca ttcatatctg catctaagtt      4140
     taattcaacc ttgcaacata tgttcatttt ttccaaacct atagtaatat aaaaaagcct      4200
     ggttttattt atattcccaa ttaatacttg ctcaataaat tctttatctt ctcgataatg      4260
     agcgtaaaca tacatcacaa aggcttttat gcttttgaag ttaaaaaagc ctgtgcttgg      4320
     ctcaagtatt tttgcaaggt gaagatacaa ctcgtcgatg cgatcggctt ctgatgaaaa      4380
     tattggttcg attgcccaaa tcaaagccgt gtgatcggat ggtcgtatta ttcgaatagc      4440
     cttgctttgg agtgactcag aatgaggctc aggaggcgca aagttggcag gatctggctt      4500
     tacgctgcgc gcggcggcca gcaccggtgc atcatcgttt tccattgcat ggctgggtga      4560
     ctcgggcttt acggctattt tcttgtttat cacgaaaggc cacgactcga tgggttggac      4620
     tgcagcaggg gcatcgtccg attccttggc ggcgctgatg cgcagggctg tgttgtcagc      4680
     ggccgatcgg ctgaggcatt tcgtccagtt cttgtaggct ttggaaaaaa gctgaaatct      4740
     gcgtgaccat atgaaatcac tttttagtgc gtaccgcaca ggcgaatttc cggtgtcctt      4800
     ccgcggctgc agcaatccag actcgaccag gctgctgatc aggaggcgct ggcgtgcttc      4860
     tcgcaagccg gtcgcctttt gcaactgcgc actgcttgga agcagcctgg cttcatcgaa      4920
     ggccagcgcc aggatgagac tcgacaaata ctcgtcatag ggcttttgct gcagctttaa      4980
     ctgctcgggc gtggactgca caaacacacc gtttatgaac aggagtctgt tcaaggtgtc      5040
     tgctgcgaag atggaacgcg ggtggttggc acaaaataac agcaatgcga agtaaagatc      5100
     gcgctgcgcg acactgacgc tctgtcgatg tgctgcctgc acaaaagctt gaaacccaaa      5160
     acccttgacc accagcgtgt ccacaagcga aatcaccaca cctggatcgt aaatatcaaa      5220
     agtagccacc ggcgcgggca ccttctgctg ctgcttgacc ggcttcgcgg tgatgattgc      5280
     cacaggaccg actcccaggt tgggacggtt ggtaaggcga gctgcaactc gttggcctgc      5340
     ggatgacaaa gacttctttg ggggcccagc cgcagctgtt agtgcctgct ggtcaagcca      5400
     atcggcaaat tcggtgatct cggcagtgtc gggaggctcc gtctgcgtcc agacgccatc      5460
     aaaccagtcg ttgagttccg taaccagtcg gggatcttcg agcagcacgc ccatttcggt      5520
     tcggttcagg atgcccgtga tggtcaggtt ggccgatccc aagtaggcca gcgtgggaga      5580
     gatgactgtt ttggcatgaa tggccgagca gtggtggatt ttttccagat tggcatgtat      5640
     gaatggcagc gtccgcgctc gctcggaact cgacaaaaac gacagccaag cctcgatgtc      5700
     ggacacaagc gtccagccga tgctggcttc gatgatgcgt tgcaggtagc gcagcccgat      5760
     gtacgggctg acgatcttga tgatgctgcc ttgagccact tgcaacacgg catcgtcaaa      5820
     gggggaggaa ttagcatcgc tgccgttgga gtgataaagc agcgatgtca atttggccct      5880
     tgttattttt taagatttat cggcatcgtg ccacggcggc ggcgttaaag tttttcggcg      5940
     gcgaaattca tacgagaacg aagatttccg tcatcgactt cttccccagg gctggttcgt      6000
     catcgaatga gcggcatcgg aaaactgcat tgttcggggc cgaattggga ttttgcatgc      6060
     gcggtttggg ttcgatttcg agaagatgca tttccccaac tgatcatctg gggtgttgtc      6120
     gacgccgacc ctttcgcctc tgcagttcaa tttcatccat cgcttcgtcg atctgatttg      6180
     gatactcagc cagttcggtg gccaggtcaa aggcgagcgc gaattgtcca atatgtccag      6240
     caggcacccc gttgtctcgc agccgctgct gccagtggct tgcaacgtga acagcggcat      6300
     cgcccagcca cgtggcggcc tcccgcggat caaagccaaa gtgcgggcag gcgtccaaca      6360
     ggttgagtac cgagcattct tgcgaaccat caggcgcaac gctcagcgcc aatacgcgga      6420
     taaaggtcgg caaaggggtg atgtcaaagg ccttggacag gcgccatccc ctcccctcat      6480
     ggatcaggcc atgattgcgc gggtgatcgt ccccgttgcc caccagggcg ttgtaggcca      6540
     tgcgccgcca caactcctgc agatcgattt ggagggcagc cttatccgca atccagcgac      6600
     gcatttgttc ggccaacaca aggtatgagc gcctggcgtc accaggcgtg gtattcgctt      6660
     caagtccaag cacggtgtgg gcgctggcaa aaagatgtcg ttgcggctgg accggatctc      6720
     cgcagcggtc aaaccgctcg acgaggaaaa cctcacggcc ttcgtgttgc tccaacaaaa      6780
     tccttggtac ctgaatgtcg agttcttcag ccatttgcat aacaacaaat tccctggcgg      6840
     gaagatgcgg aacatcgccg cggtcctgca gcttggcaag ccacagccgc ccgtcgtgct      6900
     gcagcgtgac tttggggcgc tcgccgcccg cgctggtcat gccgtcgtcc aggaggcgcc      6960
     ggatggcccg gctcgatggc gcagactcct ctaggtcgtt gatgtgctcg atcagttcgc      7020
     ttagcagcct ggggcgccat tgaagtttgc gctcgatgtc ttggcagact tcgattgccc      7080
     ctacgccatc aggagggccc aattcaagca gttccaggga actcagattg cgttcatgtc      7140
     tggcattgag acgatcggcg ccgtagcctg ccggcatcgc atcgatgatc actcgtggaa      7200
     ggccatgatt cctgagaatg ggaatcccgg cagccctgcg cgtaaacctc agctccatcg      7260
     ggtcgagcgg cctcgcatcg gccatttcca tgtaagcgtc gtgatactga aactgtccac      7320
     gaccggcatc tgcagccaaa gtacccgcca gggtgggctc tgaggagcct ggcaaccagg      7380
     tccagacggg cgtcttcatt tcctgcttcc caagcgactc gttgcaaact gcgtgagtgc      7440
     tgggtctctc tgcggctcga ccaggtggtc aagctcagac aagagatcca tggcatcgag      7500
     cacgcgcgcg agcgctccaa tggacacccc cgggcgaccc ttttcaagcg ccacgatcga      7560
     gttcgcgccc acgcccgcaa ggaaggccag atcacgctga ttcatcgctc tggcacggcg      7620
     tgcgagggca atgcgctcgc caagtgcgac gagtttattg cctggaagaa tgggaaatgg      7680
     tgcagtgctc attacccgaa tcgtaatctg aaattttatt ttagattgct attcgggtaa      7740
     tttattgctc attcatgtac tttgtggttt attttcgatt tcgtccagca cccggcgagc      7800
     ttccgtgtgc gcgaccatcg gctgcaatgt gttgagcact ttgctgatca aggggtcgtg      7860
     ggtcggaccc ttggcttcga ggtggtcgcg cagcgctttg gcagttgtgg ggtcggccaa      7920
     caccctgtcg gcagcgatcg acagcggcgt gcgagggaag gggtctgagg tgcagttggc      7980
     tacttcaatt gcgccaatta accggttttc cgttccactg cacctcgaac ccctgtcact      8040
     cccttatcaa atcagagggt agaatccatt ccgcacccgg taggtgctag ccgtccgcaa      8100
     tatggcaaag ctcaatgcac taccaagccc aaagtagggt tagaccagac tttaattttt      8160
     taagcttcac ggtgcggacc actgaagacg caacatctgg aacccaaatg aaaatctcat      8220
     tcgcagacac cctgtgtctc aaacgcgaag ccaagaaact tggccacaaa tttcccgaaa      8280
     aatcgtattc ccatttgcgt tcactggccg cacaacagct gtttggcgtg cgcagtgttc      8340
     acgagttcaa caggctcagg aaacagacgg ttgagcagca cctcgtgctg tccgatggca      8400
     tggccacctg tgctttttgc ggtttacagt tctatcctaa tgtgccggaa gacagcaaga      8460
     cacaccaggc aaagcatgat gcttttgaag aggcaaccac cgtcttgaac tacacgccta      8520
     agttttacgc tcagcgcgaa gccaataaaa agcatgggta cgcccttttg agtgatacag      8580
     acccagaaac acaggtcagc ggtgctttag aagtcctgcg atcatggttc gatcgatctc      8640
     ttgatgctgc gatcggagaa tcttcttatt ggaagcgaca tcccaaattt gaggaatacg      8700
     ttggtttcat gcttggcgcc actccacctt tccctgccca tgtggttgca tcgcttgaaa      8760
     agcagtatgg gcgaatcgat ggcgtcatcg agaaaggtca ttcctactgg tatccgccaa      8820
     agtaatagtg tgtcagatga aggttggagt tttgtcccgt tccatagcct taacactcac      8880
     ggccgccttg acttttagga tgctgaggtc gatccggagc gcgttggcat ctagtgtcgc      8940
     gtcacgagca agtagtcggg taaagccgtt tgagcttgac gcgcgcatcc ttggtcgtga      9000
     attgccagtt gactttggcc tgaaggttgt cgcggcgagc ctgccaggca gcgacttcgc      9060
     tgatgacagt ctcaatgctg tcaatgctgt caatgcgccg gtccaggcac tggctgacca      9120
     tgacgttgat ctaaatttct gccatgttca gccagctgcc gtgcctgggg gtgtagacga      9180
     actcgaagcg atcccacagc gccttggcct gctcgggggc aaacgcctcg tacagtgagc      9240
     ccggcgtgtg cgtgttcaga ttgtccatca ccagcgtgat gcgctccgca tcggggtagc      9300
     tcgtggtgcg caacgaaggg tacatgcacc tgaacacgag catagagacg agcgagttct      9360
     gctgcgattc catcgcacac tggtgggaac agcacggcag caagcactac cctgatgcta      9420
     ggggcctgtt gctgctgtgc gatgggggcg gcaccaacgc gtcgaatcgc catgtgttca      9480
     aggaggcgtt gcagaacttg gctgatcggc ttggactgta gatccgcatc gcgcactacc      9540
     cgccatattg ctcaaaacac aacccgatcg agcaccgcct gtttgcccat gtgacgcgtg      9600
     cctgccaggg cgtcacgttt cacacggtgg acatcgcccg gcaattcatg gcaaagacca      9660
     aaacgaccac tgggctgaag gtgacggtcg aggtgctcgg cggggtttac atcaaaggca      9720
     aaaaagtcgc ggcagacttt ctggatgcgt atcgctttcg atgagtatct gccccgctgg      9780
     aattaccgtg ctgtcccggc cggtggctga tctcgggaag ttatttttag ccacatccta      9840
     aacgccgcag ctttctcaat gtgagcgttt tcagggagcc gcgtactggg tacgtcatac      9900
     ggtatgaagt gcgtgattgc ttcgagcacc tggtctgtga agctttcgcc cttccagtcg      9960
     cccgcaatca tccaccccag ttcgagatcc aaaacgccaa gcaccgcgac ctctgcttcg     10020
     tcgtccggat cgtgcgagcg taagcgcaac caggccatat ccacgtcttc tggcggcacg     10080
     ccagcaatcc atggcgatag ggcaggctga tttgccttgc tagccaactg aaccgagcat     10140
     gtaatcatgt gagcgttgcg caggtcaagc gcaaccagcc gcgccaatgt tgacatggcc     10200
     agctccgatt tcaatgcgac ttcaaggatg tgacggatct gtgcaagggt gttttgctgg     10260
     ttaaaaccgt ccgacgcaac aacggacttg gccagttgtt cgatggtgac tagctgcata     10320
     aattctccat tatttccttg cctctacagg ctgggacatc gcacgcaaat ggcccaattc     10380
     catgggattt gaaccgcttg cagccgtccg ggttttttct gcccggccac atcggcaagc     10440
     accaagacgc cacatccatt gcgtttcatc gccatcaccc atcttgtagg tccacgatca     10500
     caacggcatg atcagaatca ctaatgcgcg gtgcagtagc cataaaggtt ccttggagaa     10560
     cggttaaagg ttgagcatgg atgctaccgt taacttaccg aaagccttgc cttgggcaaa     10620
     tcaaaaattt tgaatacttg cttttgtcta ggcttatttg agcgaaattg ggtagggtca     10680
     gacgggatga ttcgtacatc cgccaaaaac caaggtcgac gcggcttatc caaatgagcg     10740
     acatttaact ccacaacatc cgcatgaact acaaattttc gtcaccttta ttgatagcct     10800
     tgattgcatc agcatgtcta gcggcatgtg gcggtgggga ccttccgcct ggcagtggtt     10860
     ctccagcagc tatccccgcg cctgcgtcaa ccgtatcact gacaccatcg ccggagctac     10920
     cgcccggaca aacggctatc gatgcgtcga gctgcttcaa cccggccctc tatgtagaag     10980
     gcgcaagcat tgccatcacc accaaagcaa cattcggcgc cacagatacg gtccaaataa     11040
     agactgacac aacaatgggt ggctcggtta cttacctagg cattcaggtc aagcagttaa     11100
     cggaagtgca aacttcaatg cccgatgcac ctgtttccgc ctcgggtcaa attacaaaaa     11160
     cgacagtagc gacgcgttac ttgactgccg atgcaactgc caagaacacc cgcgactatg     11220
     gtttcagttc gaaatcgacc cccctcgatc cctcggtagg ggcgacagtc gttgacacga     11280
     cctacacgcc gtttatggaa acacgctatg ccctgcaatt cgggcgaagc tttcaacaaa     11340
     ccttcaccga cgacagcaag atcacgaatc cggatgggac caaaacatcg agtgcaaaaa     11400
     gtgtggtcaa aacaattctc tatgccggca tagaagatgt gaaagtagca gcgggtacct     11460
     ttaaggcatg caagttccag gaatcaggaa cgacaagtga tttgaccaca agcactcagt     11520
     cagtgatccc aatgaaaact atctggtacg gcgtcaaaaa tggattgatt ctcaagtcca     11580
     tgatggacac tccagtcggc aaatcctatc ggacagacac cgttgaattg caatcggcat     11640
     caatcaacgg cgtagtcgtc aagccctgaa attttttatt tgagtttcat tccccggtgg     11700
     ctaaaagcca ctttatggcc cgcttagtgc gggccttttt ttaaataccg cagaacgtga     11760
     caataagaaa atcagacatc cgagaattaa ataaacttat cacccacctg atcacagatt     11820
     attcaatcct cattgcgatt gaaaataggg atgggtgctt aatcaggata tttgataatc     11880
     caatcacgct cacactaatc cttgcacgtt ccgaagcatt acagtttaat tccattcatg     11940
     caactgtatt cagaactaga gaagcattca tggcagtgag actcgcggtg aatcgtcttg     12000
     aaagacgctt tcgtcgtgtc gaaagtgaac acatggtaga gggcgatatc aaaagcgttg     12060
     tgaacgagat tgactatgcc cttgccgtct atgccgatca gctcgataaa gtgaacatca     12120
     gaactgatca aaaacgctgg cacagcaaag ctcccagaac cagcctggtc cgcacccaac     12180
     tggcccacac aggtcagaaa ccaatccctg tgcagtggct gaatcaatgc gacagatagc     12240
     tggaaggttg gagaaaaata cggtagcgag cctcaaaagc catcatcatt tgagaacaaa     12300
     aagcaagcag caaacgaaga attgaataag gataaacccg cgcatgagga atgaagggag     12360
     ggaaaataac ggtacaggcg gcctaattag gccgcctgta cccagactta gcggctttgg     12420
     ctaaattcaa aataacaaaa aggtcgaaat atgattgccg aaaccaaaat agtcggtgtg     12480
     ctgagtgcgt atctttttat gggcgtgaac gggtactact tcatgaaaat cgacaaaaaa     12540
     gcagcccgcg aagatcagct ccgtatttcc gaggctgcgc tgatagccat tggattcatg     12600
     tgcggctggc tcggtttttt tatttcatgc tgtgatcagc accgaatttg gctgatctac     12660
     gctgaggccc gccacagcga gttttcctag ggatcaagtg gattcaccat accccggtgc     12720
     tttccacaac ccgatccggt ttccatccgc ttggctccca gccgacacct ggaaactggc     12780
     tcattcctcc taggagtcag catggccaaa atcaaactca ccaagtccgc tatagacgcg     12840
     gcacaacccc aggcgcagcc cgtcgaactg cgcgataccc tggtgcccgg cttcatgtgt     12900
     aaggttacac ctgcaggccg caaggtgttc atgctccagt accggaccaa tgccggggag     12960
     cggcgcaagc ccgccatcgg cctgtacgga gagctgaccg tcgagcaggc ccgctcgctg     13020
     gcgcagacct ggctggccga ggtccgccgg ggcggcgacc ccggcggcga caaggctgag     13080
     gcgcgcaagg caccgaccgt caaggaactg tgcggacgct tcatgtcgga ctactccaag     13140
     gttcgcaaca agccgagcac gcagaaaggc taccagggca acatcgaccg caacatcatc     13200
     cctattctgg gccgcatgaa ggtccaggac gtcaagcgcc cggacgttgc gacgatgatg     13260
     aagaagctgg agtccacgcc gatggaggcc aaccacacgc tcgccgtcat gcgaaaaatg     13320
     ttcaacatgg ccgaaatctg gggcttgcgg acggatggca cgaacccgtg ccggcacatc     13380
     ccccaatacc ctcaaggcaa gaccacccgg ctcatcaccg acgaggaaat gggcaagttg     13440
     ttcaggcatc tggacaaggt ggaggccgaa agcagcgaac cacccatcgt cacgctggcc     13500
     atccgcttgc agttcgagtt cgcggcgcgc cgctccgaaa tcctgttgct ggagtggacc     13560
     tgggtcgatc tggagaaccg gcgcgtggcc tggcctgaca gcaagaccgg cggcatgtcc     13620
     aaaccgatga gcgaggaagc gcaccgcctg ctctcgacgg tgcccaggca cgaaggctca     13680
     ctctatgtgc tgccgtcgct gcgcgatccg ctcaagcaca tgacgaacgg ggagcattac     13740
     aacggctgga gccgcatcct gaaggctgct ggtgtgcagc acgtcggcac acatggtatc     13800
     cggcaccgtt cggccaccga catcgccaat tcgggcatcc cggtcaaggt cggcatggtg     13860
     ctgaccgcgc acaagacggt ggcgatgttc atgcgctaca tccacaccga ggatgcgccg     13920
     gtgcgtcagg cggccgaact ggtggcgaac cggcgcaaga cggtggtggc gggcacgatt     13980
     gccacaccag tcgatgtatc ttgacagtca ttcgtttata gacgaaaatg gcagcatacg     14040
     agattgagca ttacctgact ctcggtgagc agaaggactt ctacatcgaa tggctgaagc     14100
     ggttacgcga cggtcaagcc aaggttgcgg tggcacggcg cgtcattcgc atcgagcaag     14160
     gcaactttgg cgatcacaag ttctgtcgca agggcgtgtg ggagttgcgc atcgatgcgg     14220
     ggccgggcta ccgggtgtac tacgccttgt cgggccggcg tgtggtgttg ttgctgtgcg     14280
     gcggcgacaa gaagactcag gacgcggaca tcgctcgggc ggtggattac tggcaagact     14340
     ggcaacggag aacagatgat gagaagtaga ccccatgacg atgcgatggc cgagttgtac     14400
     cgaaacgacc ccgcgttcgc gctggaagtg gtcaacggca ttctggaaga tggcgaccag     14460
     gccgaactgc tgatcgtgct gcgtcaaatg gccgaggcct tcggcggcgt tcaggcggtg     14520
     gccgaacagg cgcacctgaa tccgacgcag ctttatcgca cgctctcccc gaagggcaat     14580
     ccggcactta acagcttgcg ggcaatcctc aaggcgatgg gtctgcggct ggcggtgcag     14640
     ccgttggctg cacccgccgt gccagcgcat gccacctgaa tgtggcattg atgtcggtct     14700
     gcgacaactg acggccacgg agacgataac gcctggtggt ggcttcggat cagtccctgg     14760
     gttgcgcacc tagccagcgc tccatgacga aaataaccac cgtgtgtgat gcatggactg     14820
     ccagccgggc ctcagacgcc acgatctgcg gcggctcaat gccgcgtcca tgaaacgacc     14880
     acgctcgcgc gttgctaagc acattcaaac gcctggctca ctgatgacgc cgaaatcacg     14940
     tgtaattcga ggtcccctgg agttcgatcc tggccggcat cgaactgatg catatgattc     15000
     gcaaaggcca gttcatgctg aagcgtgaag gcatgtcgtt tgccgaccag ttctacgcat     15060
     tcgcaggaca cttccgtctg acgtaagaag tcgctggcgc aacccggtac cactttgcct     15120
     tgcacccgct aacgcgatac aaccgcaccg gacgcccgga ccgggcggcg gtcactgaac     15180
     ggtcaaaact gcttgcgaag cgacaggaaa gtcaccaccg gatccagttt gacatcggca     15240
     cgaaccggcg cgccaccggc agtccccgtg gccttgactt tcaaaaacag cttctgaacc     15300
     gagaagccga tgctgtagcc atccgacagg ggccagtccg cgccgatcgt tagtgccgta     15360
     ccgagcccat cgtcaacctt gaggttctgc acggcgccat ctttggtgct gaaaaccctc     15420
     agataggtca gaccgccgcc gaaaaacggt cggatcggcc ccagcatgcc tggcgaatac     15480
     gtcattgtca aaatggccgg gccacctttg acactgccca attttcccaa cgggctcaag     15540
     gttccagcgc cgccgaaatc ggtttccacc ggcgaaccga catccagccg ggccgtccag     15600
     ttgggcgtta cggcgtatcc gatttccacg cccagcacgg tgtcgctgcc caccgtcacc     15660
     gcgccacccg gcaccgggtt gccagcgaac gagacatccg ccgaggggtg gaacttcagg     15720
     tggacggctc cgacgccaat ggaccatggc gacggggagt tggtgaaggc ttgtgcatgg     15780
     acgccggccg acagagtcgc tacggcaaaa caggtcagcg tggaagcgat aattttcatg     15840
     attttgtctc cttatatttt taaaaaacga acttcaattg tccaaaatgg acgcttttgt     15900
     ctcttctgaa tcccgccgct tcatttcggc ctgatgcgta ccccgtaccg acacgcagga     15960
     caacaaaaag cggcgctctt gccccttacg cgtgccgcag gaagtcaatc accaggcggt     16020
     tgaattcatc ggcatgctcc cattgcgccc agtggccgca cttggaaaac acgtgcaagc     16080
     gcgcgtcgtt gatgccccag accagcttca ggccatggtc aaggggaacg aagcggtcat     16140
     cgcgccccca ggtgatgaat gtcttggcct tgatttcgcc cagccgggcc gacacgtccc     16200
     aagtcgagag cggcgccttt tgcgcgctga cgaggaagtt cttcaggtgc tccgggttgc     16260
     gctgaatggc ttcccagcgg ccctgcagca actcctcggt gataagggac tggtcgtaca     16320
     aaaacacctg aagcatctgt ttcagcgtct cgtaggacgg ctcggcatac agcttgaaca     16380
     gcagcttgat gccttccatc ggcatcggcg cgaacatgct ggggcccagg ccgccgggcc     16440
     ccatgaggat cagtttgccg atgcggtcgg ggtattcgag cgcgaagttc agcgccgtgg     16500
     cgccccccat cgagttgccg accaggtgcg cccggtcgat gtccagcgcg tccatcagac     16560
     ctttgacggc acgggcgttg accaggccac gctgctcgtc catcaccacc gcgtccgact     16620
     tgttgaagcc gggcgagtcc ttcaggatca cccggtagcc ggcctcgacg aacgcgccga     16680
     tgttgcggta gtagttgctc cagccgccag cgccagggcc gcccccgtgc agcatgatga     16740
     cggtttcgcc attgcccgcc tcgttgtaat gaatctggaa gtcggaaaaa cctttttcat     16800
     tgattttcac gaacttgctg gtggaacttt cggtgagtgc agtcattttt aatctttcaa     16860
     gtgaataaag aggaaatagg tcaggcgacg cgctgcatgc cgcgtcaggt ttgaattcaa     16920
     gcggcggcca aggtcaaacc acgctcacgc gccatggtca tggcagtgtc ttcaatcatg     16980
     tcttcctggc cgcccaccat gccgcgacgt cccagttcga ccaggatgtc gcgcgccggc     17040
     acgccgtact tcacactggc gcgcttggca aacagcagga agctggaata gacaccggcg     17100
     tagcccagcg tgagcgagtc acggtcgatg cggatgatgt ggtccatgat gggcaccacc     17160
     aggtcttcgg ccacgtcctg gatcttgaag acgtccaccc cggtctcgat ccccatgcgc     17220
     gcgcacacgg cgatgaacac ttccatcggc gtgttgcccg cgccagcacc caggccagcg     17280
     gcggccgcgt cgatgcggtt ggcaccggcc tcgatcgcgg caatcgagtt ggccacaccc     17340
     atggccatgt tgtggtggcc gtgaaagccc agttcggtct cgggcttgag cgcggcgcgc     17400
     acggccccca gacgcgcttt cacatcgtcg ggcagcatgt agccggccga gtcggtgacg     17460
     tagatgcagt tggcgccgta gccttgcatc agcagcgcct ggctcaccag tttttccggg     17520
     ctggccatgt gcgccatcat caaaaagcct accgtgtcca ggcccagcgc gcgcgacttg     17580
     gtgatgtgct gctccgacac atcagcctcg gtgcagtggg tcgccacgcg gatggtgccc     17640
     acgcccaggt ccttggccat cagcaggtgc tcgacggtgc caatgccggg aatcaacagg     17700
     gccgacacct tggcctgctt catcagcggg atcaccgcgc ccaggtattc ctcgtcggtg     17760
     tgggccggaa agccgtagtt gacggagctg ccgcccaggc cgtcgccgtg ggtgacctcg     17820
     atcagcggca cgccggcggc gtccagaccg caggcaatgc ttttcatctg gtccagcgtc     17880
     atcaaatggc gcttggggtg catgccgtca cgcaatgtca tgtcgtgaac ggtgacttgt     17940
     ttgccttgca aattcatggg gttctccttc gggttcaggc gtggacgggc ttgagcgtga     18000
     gccggccggc gaggatttcc tcggcgaaca tctcggcggt gcgggccgca gcggcggtca     18060
     tgatgtcgag gttgccggcg tacttgggca ggtagtcgcc caggccttcg acttcaagga     18120
     agacggagac gcgcttgcca tcaaacaccg ggccgttgac cagtttgtag ccgggcacgt     18180
     acttttgcac ctcttggatc atggcgtgga tggattcggt gatcttggcc tggtcgggtt     18240
     cgctctccag caggcaatgc acggtgtcgc gcatgatcaa gggcggctcg gccgggttga     18300
     ggatgatgat ggccttgccc ttcttcgcgc cgcccacttt ctcgaccgcg ctggcggtgg     18360
     tgcgggtgaa ttcgtcgatg ttcttgcgcg tgccgggtcc ggccgatttg ctcgagacgg     18420
     tggcgatgat ttcgccgtaa gcgacgggct gcacgcggct gacggctgcg accatgggaa     18480
     tggttgcctg gccaccgcag gtgaccatgt tgacgttcat ctcgcctttg ccgacgtgtt     18540
     cgatcaggtt gaccggtggc acgcagaacg ggccgatggc cgccggtgtc aagtcgatca     18600
     tcagggcgcc ctgggcgttg accttgcggc tgttctcggc atggacgtag gcgctggtgg     18660
     cgtcgaagac gatctgcacg ccgtcggcct gcatgtgggg aatcaggccg tcgacaccgt     18720
     cagcggtggt cttgataccc atttcgcggg cccgcttcaa gccgtcggat tcggggtcga     18780
     tgccgaccat ccagaccggc tcgagcaccg cgctgcgctg cagcttggcc agcaggtcgg     18840
     tgccgatgtt gccggggccg atcagggcgc atttgatttt tttcgtcatg ttcgaaattt     18900
     ccaggaaagt cagtgaaaac gcaccgagca gccgccgatg ccgccgatgg tgacgcggaa     18960
     gtggtcgccc gctttggccg ggaacatggc ggccagtgcg ccggagagga ttacttcgcc     19020
     ggccttgagg ccgatgccca ggcggcccag ggtgttggcc agccaggcca cggcattgac     19080
     cggcgagccc agcgcggcgg cgccggcgcc ggtggcgatg atctcgccgt ttttctccag     19140
     caccatgccg caggtcatca ggtcgagctt gcgcgggtcc atggcggtgc tgccgagcac     19200
     gaacatgccg caggaggcgt tgtcggcgat ggtgtcctgg atcttgattt tccagtcgcg     19260
     gatgcgcgag tcgacgatct cgaagcaggg catgacgaag tcggtggcgg ccagcacgtc     19320
     ggcgttggtg acgccgggac ccatgaggtc ttttttcagg acgaaggcga tttcgccttc     19380
     ggccttgggc tggatcaggg aagacatggc gatgctgccg ccgtcgctga cgatcatgcc     19440
     gtcgagcatg tagccaaagt cgggctggta gacgcccagc atgttcatca cggccgcgct     19500
     ggtgacgccg attttcttgc ccacgatgcg ctcgccggcc tgcaggcggc gcgagatcat     19560
     gcgctgctgg atgtggtagg cgtgctcgat ggtgatgtcg gggtggcgag tcgtcagcgg     19620
     ctcgaccacg gtttgggtgg tcatagcgtg gtacagctcg tcgcccaggg tttcgatcag     19680
     ttcaggggtc atgtcggttc gggttttcca gaaatagttg gcgcatgctt tgggcggcag     19740
     tgcgcagagc gggccgcctc agcggccctg ggagactgtt cagtccttga ccaagccttc     19800
     ggcgcgcagt gctgcctgca ccgcttcgcg gcccccgaca cggcccatga aggcctgcag     19860
     cgcgggccag ggcgacagat ccaggttgac ataggcgccc caactgagca cgacaaacag     19920
     gtaaatgtca gccacgctca atgaatcgcc gagcaggtac ggtgcatcct caaaccgcgt     19980
     ggcaaccacg ccaagacggg cggcaatggc ttgccgcacc gcgttcctcc agtcctcgct     20040
     ggcggcaggg ttgaacagcg ggctgaaatt cttgtgaagt tcggtcgaga tgaagttcag     20100
     ccactgctgc aagtggtagc gctcaaagct gccattggcc ggcgccagca gcttgccggg     20160
     cacctgatcg gccacgtatt gcaagatggc cgggccttcg gtcagcgtgc ggccgtcgtc     20220
     aagctgcagg cagggcacgt agcccgcagg gttgatttcg aggtagttct gtccggaggc     20280
     ggtcttcttg ctcgccagat cgacttgtac cagctcgaag ttcaggcccg cctcgcgcaa     20340
     ggcgatgtgc ggggacaggg aacaggcacc ggggctgtag taaagcttca ttcaaaaact     20400
     cctgtatggg tcagcttgtt gttcatgctt tgttgcgcac cgacttgtgg ccccacatgc     20460
     tcgggctgtc gtgccgtgcc accacccagg agcggtcaat ggtgcgggcg gcccagccgt     20520
     actcgacctc gactccggac ggggtcgctg catagaacga caccatatgg tcgttggtgt     20580
     ggcagcccag cgtggaggtg atcaagccgt cagcgtcaag ccggtcaaac gcaaaaccga     20640
     cgtcattgag cgacgagact tcgagcatga agtggtgaat gcgcttgggc agcggaaaag     20700
     ctgcgatcgc gagggtgtgg tggcgttcgt tacagtgcag aaaatacgcc ggcaccgtga     20760
     cgtctggacc cattttcatg tcgatgacgt ccgacaactg gaagccgagc acctgggtgt     20820
     agaacgccag cgccttctcc gaatccggta cgcaacgcac gaagtgcccc agcccctgtt     20880
     cgccggtcag gaaacccgac accgccgcgc cgggcatgaa cggtttttcg aagacctcgc     20940
     tggcgccata ataaatttcc agtggcagac caaacggatc ggcaaacgaa atcaagccca     21000
     tcacgccgcg ccgcttggcc agttcgacat cacccgtgac cacttcgatt ccggcctgcc     21060
     gcagtttttc tgtcatctgc gtcagacccg ccgcatcggc cacctcgtag ccagcgtagg     21120
     ccaaatcgtc tgcctcgccc tgctggacgg caatccgcca ggcgcgcgaa tcgatgcgga     21180
     acaaggcacc gtcatcggtg acacccgcgt ccatcaagcc caatttttgc gtcagaaatg     21240
     aacgccaggc ggacacgtcc ttgaccgcaa accccatata acccaaactt ttaacactca     21300
     tttttgtctc cttatttgat attcagtttt tcgagcaagt ccttgccccc tgctgccgag     21360
     aaaaatccac gcacgcccat gccgccgtcg tagttcagca aggcgccggt agcgggtacc     21420
     gtatcgcctc gcgtggcaaa aaacacatag gcaccggtgt actcctcggt gtcaggcatg     21480
     cggccaatcg gcagcacgga ctccagcatg tcggccagcg gcacggtcga aatcgcttga     21540
     ccgctcatgc caagcgagga agggccgcgc aaatcggtgc tcatgccgcc cggtgccacg     21600
     ccgttgacgc gcacgtacgg cgccagctca aacgccaact cgcgcactag gcccaccacc     21660
     gcgtgcttgg ctgcggtgta aagagggccg ccaccattgg aatagaagcc cgcattcgag     21720
     agcgtgaaga tcacgctgcc acggctggcg accagggccg gcagacaggc cttgacggcg     21780
     tggatatagc ctttgacatt gatgtgaaag acctcgtcga acgcggcatc gatgcggtct     21840
     tccggcagat cgaccagcgc cgtcgagtag tcccagatgc ccgcgttggg aatcagggtg     21900
     tcgatttttc cgaacttggc cacgcagcgg tcggcggcct gtttctggtc ttgcagtgag     21960
     cgcacgtcgc cgacgatgcc gaccaccttg tcaccgtggt cggattccat ttgctggagc     22020
     cgctccgccg acttgtcgag caccgccacc ctggcgcctt cggcaacgaa ccggtccacc     22080
     agggcgcgcc ccaggccgga ggcgccgccc gtgatcaata ccacttcacc tgtcaatttc     22140
     attttcaaac tccttttgtt aaagcaaatc gccggtcacg cgcatcactg cggtttggct     22200
     ttcagcaggt cccgcaggtt caagccggcg tcttgcaact gtccggccga aacaggaacc     22260
     cgtgcgccca ccaatcgggt cgccacggaa aattctttcg cggcattgat cgccgttgcg     22320
     gcttcaactc ggccatcgag cagccggaac aacaccaggg gctgaccgtt ctgcgcatcg     22380
     ccgcgcggaa caatttctcc gggcccttcg gcgtcgccaa tcatctggat gcggtggccc     22440
     gcaatctccg tccacgaagt cggcacctgg agcgtcggca cgggtttgcc gagcatggcg     22500
     gcggcggcgg tgtcggcctg cgcctggctg ttcagatagg tctccagcga acgctgaccg     22560
     ccgccccgca gcggccaggc ggccacgtca ccggcggcga acacgtccgg acacgagctc     22620
     gcccccgtgg cgtcaaccag cacgccgcgc gcgcaggcaa tgccggccgc ccgggccagc     22680
     tcgtctgccg ggtcggcgcc aatgctgacc agcaccccat cagccgccac ccggcgtccg     22740
     tcggcacaga tgacggcgcg cacatgcccc tcgccttcga agcgcgacgc ctgcgcattg     22800
     cgttcaatct gaacgcccag gcgctccagt tcggcccggc accatgcgcc ggttctgcgg     22860
     cccagcacgc gcagcagcag ctcgtcgccg gcttccagca gcgtgaccgt gacgccggcc     22920
     ttgcgggcgg tggtcgccac ctcgcaaccg atcaggccgc cgccgacgat gaccagcgac     22980
     tggcccggtt gcagcgcctg ccgcagcgcc aggctgtcgg cgcggtcacg caaaatgtgg     23040
     atgccggcca ggtcgcaacc tggaatcgcc acgcgccggg cgcgcgcgcc agtggccagc     23100
     agcaagcggt cgtaggccag cggggcgccc gattcgaaac ggacctggcg gctggccacg     23160
     tccaggccgc tcacccgccg cccgagctgg acctccacat tggccgatgc gtaccaggac     23220
     gcatccatga tcgcgggcgg ttcggcctgc tcgcccgtca gcacctgctt ggacagggtg     23280
     gtccggtcat aggcctgctg cgactcgtcc ccgatcaggt ggaggcgtcc cgcgtagccc     23340
     tgggcgcgaa gcgcgcgcgc ggccatcgcc ccagtcaggc cggcaccaat gatgacaatg     23400
     ctctcgatca tggcgccagg tgcccggcat tgaagtcaac aaacacgtca ttgccctcga     23460
     tacggatcgg gaatattttc aacggcacac aaggcggcgg cgacttgacc ttgcccgtgc     23520
     gaacacaaaa cttgcccatg tgcagtgagc attccacaac gtcgccgtcg agatagccgc     23580
     cctcggccag agaccattcg ccatgggtgc agcggtcctg cgtcgcgaac agctcaccct     23640
     ccacattgaa aattgcgacg gcggtgtcgc cactttcgac cttcagggct tcgccctgcg     23700
     gcacctcgct caaactgcaa actcgggtga attccatatc gttttatctt ctcttcaatc     23760
     tgactcaaat gatccggctt gtgccggacg cactgcgcgg catccttgcc ggggcacttg     23820
     accttgaatt tttctatagg gaaccgcact aacgctccaa acgggcggcg cgccagacgc     23880
     gaagccccca tacgatccag gccgcatgca ccaccagcaa cgccagccaa aaacccagcg     23940
     ccatgcggcc ccatgccatg ctgtaaaaat cccagagcgc cgtgaccact tccgtggcga     24000
     tgacgagcgg gacaagcgcc aggtagcgct gcggatcacg cgccccccac agggcgacga     24060
     cgccaatcgc ccccaactgc aggccgacaa cgaaccaggc atcctgcagc aacttgaaca     24120
     tcggcaggcc aacatccatc tccacccccg gatacatcat gtcgaacagc cccagtgccc     24180
     tgaaaggaag cgtgccaacg aggttgagca ggtaaaaaac gcccacggcg agcagaaatg     24240
     ttcgagcttg tctcatggca gcgtcctcgg ttcaggtggg ctccggcttc ttgctcagaa     24300
     gaacatgctc aggttgttcg ccagcagcgt gctctggtcg agcaggatgg tgcgcttggc     24360
     gatcttgaag cccaggccgt tgtcggcacg gcgcaggacg tcccggcgct cgcccgcgaa     24420
     aatgtcgacc tggcgctcca gacgattgcg gtacaggatg aaggccgaac tcacttcgaa     24480
     ggtgttgggc tcagccgcct cccgaaccat gacattggag accaggtggc gtgtacggga     24540
     aggcgggttc tccgcccaac ccagctccga ggtcaccttg cggatgcgcc cgtacatggt     24600
     ttcatgggtt tcgtcgaaat gggcgaaatc ttggtcgccg gaatactcga gttcgctctc     24660
     ctggagcctg cggttggtgc gcaacggcat gaagtagcgg atgtcttttt ccagcagagc     24720
     gaaccaggcc tcgtaggccc ggtggtcaag caactgcgct tcgcggtagt aaaactgctc     24780
     gatctcgttc tgcaactcaa ggccaacggc tttgcttggc cattcgaatg ctttgaacaa     24840
     attggtggat ggggttgtca tgactgttta tctccaggtg aatatcaggg gccggaacac     24900
     cggcgcgttg tctgcacgcg cacgtccggc ccccgtgatg aagttttcat ccgattgaaa     24960
     gattcaacga ttgcgtccct atcagggttt tagcgtggcc cagcttggct ccgacatcat     25020
     gcgggcccag tggtggtaca tgccccgcgc cgcctcttcg gcgtagacat aaccaatctt     25080
     tccgggaaaa tcaggatggc cggtctgcga ccgacccagg cccatctggg cattgagcgg     25140
     ctggctcttg gccttatggc cgcgcagcac tttctggatt tcgacccaat tctcgccgtc     25200
     gtcctgctcg aacacacccc cagcggagaa ggtgcgaatg ttatgccggc gatattcttc     25260
     cttgatctct gcgggtgcat cggcatcgac cagggtgaac gcccacacct cgatttcatt     25320
     ggggccgcga gggtgccagc ttcggatggt gttgatggcg ggcaggaacg aacaggttgg     25380
     gaagatgttc atgtgctggc caaacatgcg tcgaaccggc agagccagac gtttttctgc     25440
     aagttcagcg gcgggacctt cggtccagta ctgggtgacc ttgggaccca tcacggccat     25500
     gagcatgcct ggctcgtcaa caaaccatcc cgagccatgc ccgccccaat gggctcggaa     25560
     ctgattcccc ttggtcggca cctgagcatt cgacaaatcc atttctggcg gcatgcccgc     25620
     cagaatcccg gacaggtgtg acatcgtccc ggcgtggtac atgtcactgc aaaactgctc     25680
     ggcggcgtac ttccagttac acggaaccac ccacttttgc atgccgccta tagcctcggt     25740
     gccagccgga gtacgatcca gcatcacatc catgtaggga cgcgcgtcac cgaggtaggt     25800
     ttccagatcg ggcgcttcgg catcccagtt ggcgaagacc aggcccttgt aggtggccac     25860
     gcgcgcttgc agcggacccc agtcggcctt gtcaaagccg cagtctccct ccttcttgtc     25920
     gcaaaacgcc tcctgctcga acggcacgtt caccaggtta cccgcaatgt cgtaggccca     25980
     gccatggtag ctgcaggtga acgccttggc gttacctgcg tccgagcggc agatgcgcat     26040
     gccgcggtgc cggcactggt tcagaaacac cttgatgcta cggtctttct gccgcaccat     26100
     gactaccgga tcttcgccca tgtaggtggt caggaagtcc ccggttttag gaatgtgact     26160
     ctcatgccct agcaacagcc aggagcggcc aaagacccgc tcaagctcca gctcgtaaag     26220
     gctttggtca gcatagatgc gggggtcaag cagccctttt tcctgatcga ccaacgcccg     26280
     gatcgcctcg ggcgtccaat tgcgagtcca cttcacagtg gattcctgca cttcttttat     26340
     tgttgaactc atgactcaat gtctccttta aaaataccct tgacggggct aaaaaatacc     26400
     aacctctttc atcacgccga aaacaaatat ccgcggtacg gcgtcaccgc aacaacccga     26460
     attgctgaac caccgatatc gatgactcaa tgtgcgcccg caacaacgcg gtgcagcgct     26520
     cggcatcacg cgcgagtgcg ctgtcacgaa gtgcctggtg ctcctcatgg acattcctgg     26580
     caggtgggtt atgcacagat gtcaatcggc ggtagcgttc catttgcaaa tacaggatgg     26640
     acaggaaccg ccgggtccag caggacggac aggctgagat cagggcttcg tgaaagtcgc     26700
     ggttgtctcg ctcccactca ttgaacaggt gaaccgggtc gcgcatcgtg cgctcttcaa     26760
     tcaacgacag tcggtgaaac gaactgacga cccgcgtctc ccattcggcg tcgccattca     26820
     gaatgctttg gcgcagcgct tcgcactcga gcgcgatccg cgtggtggcc agatcccgca     26880
     tgtcacccaa ggacatcggg gttacgtgga acccgcgctg ggcctgcgtc tgcaccaggc     26940
     cttcggccac cagcagggaa agtgcctccc gcacggtccc gccgctgacc ccataacgcg     27000
     acttgagatc ttcgatgccg agtctggcac ccgcagcgag ctgcccctcc acgatgtccg     27060
     cccgcaaccg ctgacacgcc gactcaatca gacttcgcgc attcgcgcgg ggcaccggcg     27120
     catccgcaaa tgacttgtcg cctcccatgg tgaggcggtt tgaagttctc gtactcattg     27180
     tagttttcac ttggtcatta cagaagattc cgccacactt caatacggac cgattcaggg     27240
     ctcagtagcg tgcggattgt tagatgtcga tattgtaatc tactatcgac atttttgcta     27300
     taggcgctga cccgatgtgc gtgcgataag cgccaacacc atcaacgatt gatgccaggc     27360
     cttgcaaaat ccttttctga tcgtcctgca aggtatggtc aacgttgagg ccaagatgct     27420
     gctgcacgac tttccagagt gggccaattg tctgcttcgc cggcatttcc agccgattta     27480
     tttcgatata ggtcttgcac agcgcttcga tgatggcgct ggatgccgtg atcgccgcat     27540
     gagggtcgcg gtcaatctgt gaaattgcgc gaccaaactc tgcttcaatg gacgcaaagt     27600
     cccgggcctt gaaatagtca gcgagtgtct tggcggccgg actcgatccc gccaacgtaa     27660
     tgaagccatt ggtctgatac gacaactggt tcgtggccaa actcgctctg atgcgttctt     27720
     gatccgcgcc gacgtggggc cataggtcgg atacctcttg atccatgaat cgctgaatga     27780
     gctgaccgag aacctgcagc gcatcgatgc ttgaatcgtc gttgcagcgc ttgagccaga     27840
     tactgcactt ggcttcgagg ttcccttccg gtggatctcc tggcgcaccg ctctccctca     27900
     gaagggaatt cagtttggag tgactgtagt aggccgcagc aatgaccggg gcaactgcgc     27960
     cgatgaccga atttggaatc ttgttgttca aggtgtgctc cctctggatt gagacgaaat     28020
     acctccagtt tcgcgcaatc cgggcatctc ggcgttccgc cgccgggctc gcgggcgttg     28080
     ccccatgcct cgtgtcgagt catggccatc cggctttgat ccctgatgcc tccggccgtc     28140
     tctgcgttcc ctgcctgcgc gctgcgcttt ccctccaggg gatcggcttg acagcccatc     28200
     cccgccgcac tctgtttggc gcccctcgaa gactgccgaa caggctacgc ctgatcggcc     28260
     aacagacatc cagctaggcg tgccctttgc acgcaggggc gcttgccgcg cggcgttggt     28320
     ttcagcgcat ccctggccca tcggccgctg ttcgtctttc cccaagttca tcgctttctc     28380
     ccgcgaccgt agccagcggt gcctggctgt caaggcgcgc agggccgagt cctcgccgct     28440
     ggctgtgggc cgcaccaacc ctgcgcttgc ttccttgaca gccagtccct cgctggcccg     28500
     gtctttcgcg ggcgatgaac tcaggaaaga cggcggcaaa cagggaccgg cccaggtctc     28560
     tgcgccgaac ccaccaaagc cacaacgggc tccgaatctt ggaatccggt cagctttgaa     28620
     accacagctt caatttttgg agaaagacca tgcaactcag ttcccgtttc gcttcccgct     28680
     ccccggtact acgcgccgat cacccgctat cggatgacca aatccgcacc gtggctccgt     28740
     ccatctttgc agaagacaag cacgcaagcc gctccgaccg ttatcgttac atcgcaaccg     28800
     gcgcggtgtt gtccgaactg cgcaaggaag gattccaacc cttcatggtg tgccagaccc     28860
     gtgtacgtga tgaaggcaag cgcgagcaca caaaacatat ggtcaggctc aggcatgccg     28920
     accagatcaa tggcgcggag gccaacgaaa tcattctgct gaactcacac gatggcacca     28980
     gcagttatca aatgatggcg ggcttgctga gatttgtctg taagaacggc ctggtctgcg     29040
     gtgacgtggt ggccgatgtc cgcatccccc acaagggtga cgtgatcggc catgtgatcg     29100
     agggtgcata tgacgtactg gacggcttcg accttgtgcg cgaacgccgc gacgagatgc     29160
     gcgccattac gctggaccgg ggcgaagccg aggtattcgc ccatgcggcg ctgtccctca     29220
     agtacgacga cccgacggca cccgcgccca tcaccgaatc gcagctattg atgccgcgcc     29280
     gccgcgatga cgaccggccc gacttgtgga gcgcctataa ccgcgtgcag gagaatttga     29340
     cgcaaggcgg attacatgga cgcaccgcca ccgggcgcaa gcacagcacc cggcccattc     29400
     aaggcattga ccagaacgtc aagatcaacc gggcattgtg gatgctggcc gaaggcatga     29460
     agcggctcaa ggcttgaccg gctgaatcag cgagggggcg caatgccccc tcgataccgt     29520
     aggcacacgg cacagcaaaa cggcggccag gccaggccgc cgcgcgccca tccgttccgt     29580
     ctgggcgcgc ggcggcggcg gtcgctatgc gaccgctcga tggctgtagg tgttcgccat     29640
     catcggcaaa ggcattcatg gcagtgctct cgtgtcatcg cgtccaacga tgcgagatca     29700
     tccttctctg agcctcttgt tggccacctt cacttgtcga caaattccgg ccattcccga     29760
     gcctccaaat gtcagtttta tggcgttcaa caatttcaag aacacccaat tcaagtcgtt     29820
     aagatcgagc aattgaccga ctacttccct ttgattgcct atgtcctcac ccccggtgct     29880
     caaaggttcc attgttcggg atacgttgaa tcaatcgtct tcgagcaaca attcgtccca     29940
     ctaccgtttt tgttccgggc aatgccaagc tgaccgtccg acgggaggtg gtgtcgaaat     30000
     ctctgccggt aattggcgtt gtggggtatg ttgggcaagg ttttattcac gattgcgcaa     30060
     aagtatttga gatcatctca gaccacctac aatccaattt ggtgttttgc acctcccgtg     30120
     tcacctccct gcacgggacg cgtttacgcg tttcaaaccc ggcctgcgtc gggttttttt     30180
     tcgctcttca atcgtcaatg gtggctgatg caatggcgta tgagttggga gtgctatgga     30240
     gcttcaacgg tctgttcagc gacaccaaaa cgtgtgtccc ggcgttccgc cgtcgggctc     30300
     gcgggcgttg ccccgcgcct cgttccgagt cgcggccatg cggctttgat ccctgacacc     30360
     ttcgtccgtc tctgcgttcc cggcctgcgc gcttcgcttg cccaagggca atggagtgtg     30420
     gtggtggggt ggccttgctg ttcccttcaa cgtaccacgc tgttctcgct gtcaaggtct     30480
     gcgcgcactg tgtgcgcttg cgtcctggcg gccgtctgtg aaccctgaca actgcgctac     30540
     agcgtgctgg ggccggtctc gggcaattcc gcccgctaca gaccggagca gaccatgtcg     30600
     caactttctc tttccctcga ttcttccctt ctcgttcgcg atgtcgcggg cgactaccgt     30660
     ccggccaatg ccgacgaggt gctgcaggcc gcgcagcggc tactgggtgc gcaactgcgc     30720
     gggcgtgagg ttctgacttc gccgcaggcg gtgcgcgact tcctgcgcgt caaactgggt     30780
     ggtttggagc acgaggtgtt cgctgtactg atgctcgatg cgcagaaccg cctgatcgaa     30840
     tacgtcgagc tgttccgggg cacggtgagt caggcatcgg tgtatccgcg cgaggtggtc     30900
     aaggaatcgc ttgcgctcaa tgcggcggca gtgatttttt gccataacca tccatcgggt     30960
     gtcgccgagc cgtcgcgggc ggacgaggta ttgacgcaga cgctgaaaac cgcgttatcg     31020
     ctggtggacg tgcgggtgtt ggatcactta atcgtggcgg gcaatgaaat catgagtttt     31080
     gcggaacgtg ggctgctgta gcccgagggg gcatcgcccc ctttttgctt cgctcgtata     31140
     cggctgcgcg ctgcgcttgc cctccagggg atcggctggt cagcccatcc ccgccgcact     31200
     ctgtttggcg cccctgcaat gccgccgaac aggttatacc tgatcggcca acagccatcc     31260
     atctaggtgt gccgctggca cacaggggcg ctcgccgcgc tgcgttggtt tcagcgcatc     31320
     ccttggccca tcgaccgctg ttcgtccttc cccaagttca tcgctttctc ccgcgaccgt     31380
     agccatcagt gcccggccgt caaggcgcgc agggccgtgt cctcgcctgc ggctgcgggc     31440
     cgcaccaacc ctgcgcttct tccttgacag cctgtccctt gctggcccgg tttttcgcgg     31500
     gcgatgaact caggaaagac ggcggcaaac agggaccggc ccagggtctc tgcgccgaac     31560
     ccaaccaaag ccacaacggg ctccgaatct tggaatccgg tcagctttga aaccacagga     31620
     gagtgcgcat gcagataccg acaccgtgaa tcgacagcga gttttgttct tccatttttt     31680
     gttttctttc gtcccgacac gggacaggag ctatcaccat gaacaccgtt acccatcaag     31740
     aagtccaagc ccttgaagcc gctgcgccct cgcaaaacat gctgctggtg ccgctatcgc     31800
     agcttcgccc atccaagcgc aatgtgcgca agaccttggg cgcttccatc accgaactgg     31860
     ccaccagcgt tgagcgcgta ggcctgctgc aaaacctgac cgtgactctt gccagcgatg     31920
     gcgagcatta cgaagtggtg gccggtggcc gtcgccttgc ggcattgaaa ttgctggcta     31980
     agaaacggcg cattgccaag gattacgcgg tgccttgcct gctggtggcc gatgcctcgg     32040
     cccgcactgc cagcctgacc gagaacgtgc agcgcgaagc catgcacccc gccgaccagt     32100
     tcgaggcgtt cgccgacttg atcgcggaag gccgacccat cgaagacatc gccgcagact     32160
     ttggcgtgac cccgctggtg gtgcagcgcc gcttgaagct ggcgaatgtc tcgccgcgct     32220
     tgatggccga ctaccgggcc gataccgtga accttgacca gttgatggca ttggcgatca     32280
     ccgacgacca cgccgcacag gaagccgcgt tctacgatgc gccgaactgg cagcgcaacc     32340
     cgaccgcctt gcgcgaacga ctgaccgagc gggaaatcga cgcccatcgc catccgctgg     32400
     tgcgctttgt cgggctggaa gcctacgagg ccgcaggtgg tggcatccgg cgcgacctgt     32460
     tcgcggatgc tgaccaaggt atctatttga ccgatgcggc attgatcgac cggctggcgc     32520
     aagacaagct ggcaggcatt gccgacgagg tgcgccgcga gggttgggcg tgggtggagg     32580
     cggtgcccgc cgccacctat gccgacctgc aagccttcca gcgtgcgccg aaggaacggc     32640
     gcaagcccaa tgcccgcgag gccaagcgca tcgccaagct gcaagcgaag gtactggaag     32700
     tcggggaagc cttggatgcc gcccttgagg ccgaggatga agagaaggcc gaggccttgc     32760
     aggaagaagg cgaacgcctg ggtgagcaac tggaggcgct agaagccgaa ttgctggcct     32820
     atggctcgac tgttcgcgct gctgctggtg ccatcgtcac ccttgatcgg cagggcgagc     32880
     ctgtcattca tcgcggtctg ctgcgcgatg ccgaggccaa ggcgttgcgc acgctggcga     32940
     gggtgcaagg cggtatcgac tcggaagaca ccgaggacga ggacagcccc gagccgaaga     33000
     aggccggaat ctccgagaaa ctggcacgcc gtttgagcgc ccaccgcact gcggcactgc     33060
     aaatcgaact ggcgcgcaat ccgcaggcat cgctggccgc gctggtgcat ggcatggtgc     33120
     agcgggtctt gcaggacgcc catgcggtag agctgcccat cggcatcagc atccgtccac     33180
     aggacagact ggaaggctac gccccggact ggccgcaatc gcctgccgct gtcgccttgc     33240
     gggaactaca gcaggcatgc ggtgagaagc tgccggagga cgatgccgaa ctgttcgcgg     33300
     tgctgctggc actgtcgcag gatgaactgg tgcggctgct ggcggtgtgc gtggcatcga     33360
     ccgtggatgt agtttcttcg cgggaacacg atgcgtcggg taaggtgttg gctcaggcgg     33420
     tcgggttgga catggcggca tggtggaagc cgactgccga ggggtatttc tcccacgtct     33480
     ccaaggcggt gattctggaa gctgtgcagc agtttgcacc cggaaatgtc agccgactgg     33540
     cgaagctcaa gaaggccgac attgccagcg aggccgagcg gctggccgag ggaacgggct     33600
     ggatgcctgc catgttcaag agcgaggaca gcactagcgc ggcgcaggac gacgcgcagc     33660
     aggaaagttc gcagaacgcg acgaacgaca cgccagagga agctgcgcag gaggctgtca     33720
     tcgagatgga ggcagtggcc gaggcgctgg ctgcgtaagg tagcaatgac aaatggcccc     33780
     ggcgcaaaat gcgccggggt attttcttga aaaatcgggc gcggcaagtg tgccgcgccc     33840
     ggtctaacag ccgacaagcc cccccaaaaa accaaaagcg cgccccgccg tcatggcggg     33900
     gcgccgaatc gacaggcact ccggcccatg ccgggcctgc gcgtgcgatg cacttgccca     33960
     ggtagagccc ccgccgcagc gggcgggggc tggggtgcgc tgcaccttgc tgctgccggt     34020
     tgtgcaaatg cgcgccgtcc atgatgctga cggttggccg tcagttacat cacgaaggac     34080
     ggttcaccga cacgccgcac agccttgcca tgaagatttc acgccacgct tcaacccgtt     34140
     tgccgtctga taccgggagc gttcccgcca gtcgttccca gccagacctt accgacatca     34200
     aggcgcatgc cggcgctgcc ttcctgcggg aatgccgagt tagccatcgc tccattcggg     34260
     ccagttcgac ccctgcgtcc ttggcttgtc gtgaatcctg gcaagggcac ggcttacgcc     34320
     tcgggcttca tggctgcaac cgtctggccc aaacaatttc cctggcgctg tgcgccttcc     34380
     tcgcgcaaca aattctttgg gcctcccggt cctccacgct gttgcggccg ctatgcggtg     34440
     cggccagccc gtccctcgcc gggcggatca ccgacaagga cgcgatgggc gcgatcttgc     34500
     aaccccgaaa ggaaacttca tcatggctaa catcggcacc ttcaccgcag acaaagacgg     34560
     cttcaccggc acgcttcgca ccctgacgct caacgtcaag gtcaaattca tccagaacga     34620
     caagaccagc gagaacgctc ccgactaccg catccaggca gccaacgggc tggaagtcgg     34680
     cgcagcatgg aagaaaatca gccaggccga gcggccttac ctgtcggcga gcctggacga     34740
     tccttcgttc ccggccaccg tctacgcccg cctcatcgaa ggcgaggacg gcacgcacaa     34800
     cctgatctgg tcgcgcagca agggcgactg acgccgccct tgcgccccgc ccatcgtggc     34860
     ggggcattcc ctgacggtca gtgctccggc tcggaagcag tcagacggct ttccgtcgcc     34920
     gtcatcaagt cggccgaact gcaacccagc gcccgtgcga tcttgagaat gatcgccagc     34980
     gtgggcatgt gttcgccgcg ctcaatcttg cccatgtgcg agcgttcgat gcccgccagg     35040
     tgggcgagcg tctcctgggc aaccccttgc tctgttctca gcgcgcgcac cgcggcgccg     35100
     aaggcttgtg ccggttcggc ctcgaatgtg gtggcgccgg ccgggcggcc acgctggatt     35160
     gatcgcttct gcatgcacag aagcgtcgat taacagcaca attaaaacca cgttatcttt     35220
     aactcattgg ctatttcggc ctaccatgtt ggatagcggc ctctcgctct ttattgcgct     35280
     tttgcgcttc tgcgtaaagc cggattcgtg tttctgtgct tccgtggatt cgttgacttc     35340
     catctgtacg cttttgcgat cttccgtaaa tccttattgg cacatccgag gctttctgtg     35400
     catccagcaa tacggtttcg tgcgtcatcg gctttgtggg catcctggcc gctctcaggt     35460
     tcaccccgca gcggaaaagt gcgcgagtct ggcgcacgcc gcttgccgtc aaccccggcc     35520
     cgcaccggac cgtgttgggg tatgacggct gcgcttggca cgtgcgcccc agtcgccttg     35580
     ctccgccgtg gagtgaaccc tttgaaggaa gcgaccatga cccaatctct tatcaccgac     35640
     gaacaacgcg cccaactgct cgccaatagc cgagccagtg ccgaaggcca ggacattgac     35700
     ccgacgcccg tcgtcaagct gttcaccccg gacgcgcacg cgacctggct gctcaccgaa     35760
     ctcgatcccg aggatggcga tacggccttt ggcctgtgcg atgtcggaat cggcatgccc     35820
     gagctgggca acgtgcggat atccgagctg gcgtccatcg tcggaccgtt gaagctgccc     35880
     atcgagcggg atctgtattt cgttgcgcag cgcacactgt cagactatgc gcggctcgcc     35940
     cgcatcaacg gttcgatcat cgactgatag aaccgcatgg cccgctgcgg cgggccatcc     36000
     aggcgctgcc gcctccggcg tactgtgtct atttcggtct cagttcagac cctgatcgca     36060
     tcaatccaga ctatgcaccg cagcggtgca aacacgaccc aaacagtcac gatgcctggt     36120
     gagccttgcg gcaccgtgtt cggatactgc gcaccatttc cggttgcgca gccgtcgcat     36180
     tcggacaccc cctgcaacgc ttcggagtcc attgggcttg acactgccag tttattaaat     36240
     gccccatgac gttttgacga tgactccata gcttcgtagc accgatgccc gtggcgactg     36300
     ttcctgctat ccgacaggag gttgcgccat ggcagagttg agttccgatc attggcgtcc     36360
     gagcgccgcg tatctctatg tcctgcacct ggacggcccg gccttggcct gggaatacct     36420
     gcggcgcgac ctggactacc ggcgcgactg gctacgccgt cagcgccacc ccgaggtggc     36480
     gcagcgctgg ggcctgcgcc tgctggaaga tcccggccag gatgcgcggg acgcgcaccc     36540
     ggcctggttc cccgaccacg ataccgtggt gcagctctat cccgatgctg atccgccacc     36600
     caatgccggc ctcttcgaat tctggcgcat tcccggccac aagcaactga tccatgacgg     36660
     ccggcgcctg gtgctgatcg ttcggcaacc gggctgctgc ctgcgtatgg cgctcgcgcc     36720
     cgcgctggag gacggcatgg cttacgtcta cgccatccgc gcctgccaag ctccttgcgt     36780
     ccgctatcgc gcgctggcgg gcgaactgaa caagctgcag gaggccagca acaccacgcc     36840
     tgcgggagtg gtcaaaccgc gtccatcccc gtcgtcattg ctggaactac acaccctaca     36900
     ggcgctcgac ggcaccctgg cgggtgcgtc tttgcgcacg gtggccgacg tgctgttcgg     36960
     ccccgatgcc gtggccgagg gctggcacgc tgatggcgat ctgcgcgccc gcgtgcgccg     37020
     cttggtgcaa cgcgggaaaa agctgatgcg cggcggctat cgccgcctcg cacagcttcc     37080
     gccgcttgag cagggacgtt ttgcatcgga cgcaaaacgt ccctgagcag aacgccgcgc     37140
     tttcttgaga ctggcctcca tccggtcacg ctcttgtggc cggcgatcct gaccgatgga     37200
     ggttcacacc atgagaccag tccccttgcg gcccgctgcc gcacccgctg ccacgcagca     37260
     acccgcacag cctgtgcgct acctgaccaa cgacgaggcc gccgagttcc tgcggctgtc     37320
     gccgcgcaca ttggaaaaac agcgcgtgat cggcggcggg ccgcgcttcc gcaagttcgg     37380
     tcgacgtgtc atgtacgcgg tggccgacct cgaaacctgg gcggatgccc gtagcttcga     37440
     ggccacttcc gaccccgaat acgccgagcg ccactctggc gacagccgcg atggtcagca     37500
     tggtcgccgc tgaccttagg caagccaggc acgccggtga cgctcgccat gtccagccca     37560
     tcgctgctgc cagcgcagac tatgcagcag cacgaacagc tcgacctgtt tcgcgcgctg     37620
     ccgggcgaca tggcgccgcg cgacgcccag gacttgatgg cctatccgtt cttctcgcta     37680
     gccaagtcgc ggcgtattgc gccgatcgac tttcgttccg gcggcgtaac cgtgcgcgtg     37740
     gaaggcacgg ccgagcatgg catcgccacg atctgggatg ccgatatcct gatctgggcc     37800
     gccagccaga tcgtggaagc gcgggatgct ggcattcgca gttcgcgccg gatgcaagcc     37860
     actccctacg agatcctgcg cttcatcggg cgcggtacgt cgctgcacga ctaccagcgc     37920
     ctgaaggcgg cgctggaccg cttgcagtcc accagcgtgg cgacttcgat ccgggaaaca     37980
     acaggcagac gcctgcaccg cttctcgtgg atcaacgagt ggaaggagcg ggccgacagc     38040
     aagggggttc cgctgggcct cgaattgatt ctgccggact ggttctatgc cggcgtgctg     38100
     gacgaagccc tggtactgac catcgacccg gcgtatttca agctcacggg cggtatcgag     38160
     cgctggctgt accgcctggt gcgcaaacac ggtggcaaac agcccggtgg ctggcagttc     38220
     gacttcccgc acctgcaccg caaatcgggc agctcggcac gcttctcgga cttcgcctac     38280
     gacctgcgtg ccttggtggc acggcagtcg ttgccgggtt acaccctgag catcgagcga     38340
     ttgccgggag agccggaaat cctggctttc cggcccgtgc cgcaaacggc acggggataa     38400
     gtcgtggaca acctgtgaat gacctcgtgc tatcaggcgc aaggtggctc gtgctatcgg     38460
     gagtacgtct ctcgtgctat caggagtacg aatcgcccgc aaagccagta acggcgcggg     38520
     ttcccgcctc ccttaactta cctaacttaa aacctctaac ttttaataag agcgtgccgg     38580
     ttcggtggat aagtgctgaa accggctttg aaccccgctt tcaaaaccgt ttgccagcag     38640
     gagcaaggcc atgatcatcg ccttgctcaa ccaaaaaggc ggggtcggca agaccacgct     38700
     cgccacccac atcgccggtg aactagcgat gcagggcaag caagtcatcc tgctggatgc     38760
     cgatccgcaa gggtcatccc tggattggac acaacggcgc agccagcaag ggctgcccag     38820
     attgttcagc gcagtcggct tggcaaggga aaccctgcac caggaagcgc cagaactggc     38880
     caggcgctgc gatcacatcg ttattgatgg tccacccaga atcgccgcac tcgcgcgctc     38940
     cgcgctgctg gcggccgact gcgtgctgat cccggtgcaa cccagtcctt acgacgtttg     39000
     ggccagcgcc gagatggtgg cgttgatccg cgaggcccag gtcttcaggc caacgctgcg     39060
     cgcggccttc gtcatcaacc ggcgggtcag taccacggtc atcgggcgcg aggcgcgcaa     39120
     ctcgctcgcc gatcaaccgc tgccagcact gcgtgcggag attcgccagc gtatcgtctt     39180
     tgccgacagc gtggccgctg gtcggcttgc acgcgaactg gtgccggaca gcgctgccgc     39240
     gcgtgagatc actgcgttgg ttgatgagct gctgcggtgg tcgccatgac cagcaagcgc     39300
     atcgccatcg gcgcacgtcc accggcgaat ccgcaagccg aagcctggat tcgccagggt     39360
     gaaggtgcag acatcaacaa gggcgatctc tacaccgcgc gcctgaccct cgacgtgacg     39420
     cccgcgctac gcgctcgcat caaggtctca gctttcaccc aaggcaccac ggtggccgaa     39480
     ctgctgcgcg ccttgctgga acatgagttc ccggagaaga caccatgaat acaaacacgc     39540
     aggtccaacc aacaacaagc gcggctgcgc caccgccatc gctgcccgca cttaccggcc     39600
     aagtcggcaa tgtgccgctg acccgcgtgg cactcgctta cgtggacaag cgcatcaacc     39660
     tctatctgcg cttcggcaac ccggcgcgca ctatccagct cgaccgctgg cggcgcagcg     39720
     cggtgttcct gccggcgttc atcttctgcc gcatccgctg ggagtccaac gactacggta     39780
     cgacccgctg gcagctcatg gtgatgcagg cctgcacgcc gctggacgca gtgcagcgca     39840
     ttcccggcat acaccccggc gcgcgcatcc tgctgcacgc cgaaggtgaa cgacaggtgc     39900
     aggccgtgct gccattgata gacgccatcg aagcactggg tatcgccccc atcgacgtgt     39960
     cgccagcgta ctggcgcacg ctgggcaacc gtctctccgc acacctggcg ctgccgcaat     40020
     acaccgccga gcggcatgcc gcctggctcg ccgggaagga attgcaatga ctgccaaacc     40080
     tcgctcgcgt ctgtgcgctc accttgtgtt ggcagtgctg tccacttgcg gccttgctgc     40140
     gatggcctgg gcatcctttg cgatgccttc ggcacatgtc gtctacaacc cgtccaacag     40200
     tgtgccggtc ggctggtatc gcatcgaatc ggtcacttcg ccagccgact cgctgcacgt     40260
     cggcagcatc gtgctggccc ggcttccggc agaagcggcc gcactggctg cgcagcgtgg     40320
     ctacctgccg ccacacattc cgctgctcaa acgtatcggt gcggttgctc ctcaagacgt     40380
     ttgcatcgtc aatggtgttg tgcgcattga cggcgtgccg gtggccgccg tgttgcgcac     40440
     cgaccggatg gggcgtccgc tgctttcctg gcagcagtgt cgggcgcttg ccgaaggtga     40500
     actgtttctg ctcagtgtca ccaatccggc gtcgttcgac agccggtatt tcgggccgat     40560
     tgctgcatcc gccgtgatcg gtacggcgca gtcggtctac ctggagaagc aaccatgaaa     40620
     tcgaccggct gcatgcagac tgaccgagga tctttacggc ctcgcttttg cgttgacgtg     40680
     ctatcggact tgtcgttgcc gatgctggca caacctcatt gtgcgtgcag cttgaatgca     40740
     tttgcaccgc gctttgccct gcatccgttg ctgcgtttga ggaacagttc ttcgcacgct     40800
     ttcgcgcacg tttgcgtgcg ccccaacgtg cagatggctt gccccgagcg cgccatgccg     40860
     caggcatggt tggcgctcgt cggctggcag gctgcgcggg acgcagcgcc gccggggcac     40920
     cgcagacccg tgccgtcagg cagggggaag gtgcagggca agattgaagg gtccggcacg     40980
     ctgccggccc ataagcgagt ctgcacgtgg ggttggcgcg gcacgcgcta tttggcggca     41040
     ccgtgccgtc aagttcgcca aagccttgtg ggcattggcg aaaccgcgtg catggcacgc     41100
     cctggtcgga tggccgtggc tggagtatcc gcatgagcag gcgcggcaac tcggatggtg     41160
     aagaccgttt tagcatccgg cccggcgcac ccaagcagcg cggccaagcc ttcgtctcgc     41220
     aggtgctgcg gcaggccagc aagggggcca actcgactgg ccgcaaaccg ggaaagacac     41280
     ccggatcacg tctggggcgg ggccatgtgg ctgcgcgctt caccgggcag tcgctatctg     41340
     cgacctctcg gcgtgccacc gtcaaggtgc ggctggtcta cctcaagcag gccggtgcgc     41400
     gttcaaccat cacgcacctg cgctacatcg agcgcgaagg cgtcggccgc gagcaggacg     41460
     ccggcaaggc ctatgggcca atgaccgatg aagcggactt gccggctttc gaggaacgtg     41520
     gccgggaagt tcggcaccag ttccgcttga tcgtctcgcc cgaggatgcc gaacagctcg     41580
     atgacctgcg cacctacacg cgccacctga tgggccgtat ggaggccgat ctgggcagcc     41640
     ggctggactg ggtggcggtg aaccactgga acaccgacaa cccgcacacg cacatcgtat     41700
     tgcacggcaa ggatgacacg ggcaaggacc tcatcatttc gcaggcctac atcacccgcg     41760
     gcatgcgcga gcgcgctgcg gagctgtcca ccgaatggct ggggccgcgc atcgaactgg     41820
     agatccagcg cacactggtg cgggaggtcg atcaggagcg gtggaccagc ttggaccgca     41880
     cgctgcaacg cgaggcaaag gatgggctga accatgtgga tcagccggcc agcgatccga     41940
     atctgcgaca gcagcgcgtg ctactggtgg gtcgtttgca gcggctgcaa cgcatggggt     42000
     tggcgagcga gcaacagccc ggcgtctggg tggttcacgc cgatgccgaa cccgtgctgc     42060
     gagcgatggg cgaacgcggc gacatcatcc gcaccatgca gcgggccatg ggaggtgcgc     42120
     agcgcgacct ggccgtgttt cagccaggcc aagatagccg ttccgttatc ggccgggtag     42180
     ccggtaaagg gcttgcggac gagctgtacg acaagggcta tctggtagtc gatggcatcg     42240
     acggcaaggc gcactatgtg gcgttgcctg ccaagatgga gctggcgcag tacccggtcg     42300
     gcaccatagt cgaagcacgc ggttcagtcg aattccgggc ggctgataag aacattgtcg     42360
     cgctggcagt cgatggcctc taccgtaccg atcatcacct cgccgttgcc aaggcgcagg     42420
     ccacgtccgg acgcgatccg cacgaggtga tcgatgcaca tgttcggcgg ctggaggcac     42480
     tgcgtcgggc tggcattgtc gagcgcatcg ccgagggcgt ctggcgcgtg ccagtggaac     42540
     tgcctgagca aggtcggcaa tacgacatgc agcgactggg tggcgtgtca gtggagttac     42600
     gttcgcatct gcccattgaa cgacaggctt ttgtgatcgg tgcgacatgg ttagatcagc     42660
     aattgatcgg cggagccagc ggcatcgccg acaacggttt cggcggagag gtacgcaatg     42720
     cgttacggca gcgagccaac ttcctgatcg atcagggact ggctgaacga cgcgggcagc     42780
     ggctaatcct cgcccgcaac ctgctggcga cactgcgcgg cagggaggtg gaggctgcgg     42840
     gcgggcgcat cgcggccgaa accggcctgg cgcatcggcc ggtggccgat ggcgagcgca     42900
     tcaccggcgt ctaccggcgc agcgtccaac tcgccagcgg ccgcttcgcg atgcttgatg     42960
     acggcatagg cttcagcctg gtgccgtgga agccagtgat cgagcaacgg ctggggcaga     43020
     ctttgaccgc cgtagtgcgt ggtggcgggg tgtcgtggga gttcgggcgg caacgcgggc     43080
     cgtcaatcgg ctgagatggt tcggctttgc gtctctcaag ccacaaccca aggcgaaacc     43140
     ggctggcatt gggatgccag ctcatccact acgacgcgcg ccttggtcga caaatgccgg     43200
     gtttgcagcc acgaggcgcg aatcgaaagg gccagagttc tctctggccc ttttcacgtt     43260
     tgctgtagca caagcactga cgcaggtttc cggtgacaag tttgacccag aatttaattg     43320
     acgctggcaa caaagcgtcg actcgcggac tttgcgacgc gcactcatcc gaaaattcac     43380
     ttgcaaggtg ccaatggcga tgttctaata aacgttcgtt tagtttcaga atcgcccgac     43440
     tcaggaggaa ttcgatggct gagaaagccc ccaagaagaa aaagatgcgc gaagaggtgc     43500
     tggaacggtc ggttccgctc ttcgcaacgg tcggatttga cggggtttcg atgcgtgata     43560
     tcgcggctgc cgtgggtgtg acgcctgccg ccctctacca ccacttttcg gacaaggagc     43620
     agctctatct ggatgcggtc ggctatgcct tcgaagaaaa ggtggggccc ttgaagacac     43680
     tcctggacgg tggaggaaat ccctgggagc ggatcgaggc attcatcacg cggcttgcga     43740
     acctactcgc cgccgagcgg gactttctac gcctgatgca atgggtgctg ctggacagcg     43800
     atgaacggcg ccaacgtagc ctggtggact gcgtttttag agacctgttc aacgcactgc     43860
     gcgatttcgc cgcagaactc gctccgggcc atgacgccca tcggcttgcc gtttcgataa     43920
     tcggcttggt gctctatccc tttgaaaccc agtcggtgcg acgtttcctg ccgggctaca     43980
     cccaccagca ggaagacccc gaggccattg cgcggcatat cgtcggcttg ctacgcaacg     44040
     gtctcggcgg aatcaacgag gaaaatccat aacaacgccc tgtctagggc aaacgtgcgg     44100
     agcagacgta ccctgctcta taactgcaag gagaagaagc gatgaaacta caaaaatggt     44160
     tagtcctgtc ggtactggtg atcggcgcaa gtgcacaggc ggcggaagac cccgcggcaa     44220
     agccggtcga gccggccaag gtgtccgtgc tgcagaaagc ggaggaaggt gcgaagaagg     44280
     cggccgagga agccaaagag gcgacgcgca aagccgcaga agccgccaag ctggctgtag     44340
     ataaggctga gcaggccgtc agtgaagcct cgcagaaaac cgcggaagct gcccggcagg     44400
     cggcacggga tgctgatgaa gccgccaagc tggctgtacg caagaccgca gaagccactc     44460
     gaaaagcaac cgcagccacc aaggaagccg cgcagaaggc cgaggaagcc gctaaaaaag     44520
     cagccgtagc caccaaggaa gctgcacaga aagccgaaga agccgccaaa aaggcggcca     44580
     aatctggcaa agaggctgcg cagaaagcgg ccgaagccac gcgggacgcc gcacagaaaa     44640
     ccactgaagc cacccgagag gctgccgaca aggcgcttga ggcaaccaag gaaacggctc     44700
     ggaacgtcaa agatgccgtg acgaagtaac ccttatcggg caggctgctt gcccgataaa     44760
     ttttcacagc gttgcgcttt cattttttat ttttatcact gatcgagagg tatgccatgt     44820
     ctaaatccaa cacacccagt tccacgacca aagacaaact gattgccgac ataaagcaga     44880
     ttgtcgccga tgccgatgcg ctcttgcagg ctactaccga tcaagccagc gagaaggtcg     44940
     ccgacttgcg catcggcctt cggaaaaacc tgaagacggc ccaaggccga cttgccgagt     45000
     tcgaggccac cgccgtcgac aaaaccacgg aagccatccg ggaggcactg caaaaaatct     45060
     cggaagcggc caatcaagcg actgtagcca ccatggaagc ggcgcagaag gccgaggaag     45120
     cggccaaaaa agtggcgggg tccggtaaag acgcggccca gcacgccgca gaagccgcca     45180
     gggatgcagc ccagaaagca gttgccgcca ccagggaggc cgccaacaag gcactggatg     45240
     caatgcagga ttggatgcga tgacggaaat ggcccggaag gccaaagaca ccatcaacaa     45300
     gtagctcttg gcacgcacga cctggtcgca tcggcggacg ggtcgtggaa ggcccgcgcc     45360
     taggcgacgc gatgaggtaa cagctatcgc agccaccagg gctgctggta tttttatgcg     45420
     cggcaccgcc atgacacccg gttgttcagg tcatcacttc aggaggatca ctatcatgca     45480
     aaacgaaaca ggcaacaata ttggcggcag taacgatgca gtgatgctcg aagctgaagt     45540
     gcgtagcgcc gtcgagcagg gtcacgatgt gcaggaaatg gtgcggcagc tcaccttgcg     45600
     caagatcagt gcgcgctcgc tcgatatcga atccctgcga cagatcgcgc gtgccgtgct     45660
     gagcggcgcg cgggccggcg cacaaaagga gttgcagcag tcagcggcac aaaccgaaat     45720
     catgcggaca cgcctcaaac aggccgtcgc tgggctggac gcggcgttgg cgcagtttgc     45780
     cgaagcctcc aaactggcgg tggaagaagc ggcggtccgg gcgcagacat tttcccgtga     45840
     ggacctcgcc cgtgcgcgca ccgacctgga aagcctggag gcgatgttcc tggaaaccct     45900
     gcaaagctcg gcctcgggtg ccaaggatgc cgcaggagaa atcctgtccg atctggcgag     45960
     gcacgcccgc ctctatggct ccgccgtgcg cgcacagttg aaggaaaccc tggccgtcat     46020
     cacgcaccag cttggcacgg cgggacgcac tcaggttgtt gccggcttgc atctggcaca     46080
     agccacttcc gacctgctgc gccaaatcgc tgccggcgtg ctcaccggcc tggccgatca     46140
     cgtcaaaccc ggccattccc aaggcaaggg caactgatgc tgtggcaggc cctgaccgca     46200
     gtgcgcgaca tcggccgcct gcatgacatc acctcgatcc tgatccgcta cggctttggc     46260
     gacatggtgc gccggatggg actggccaat gccctggagc gggccgggcg ggcgctgcac     46320
     tggaacgaag cgcaggaact ggctcatctc gacccgcccg cccgggtgcg gcgcgcgctg     46380
     gaggaattgg ggccgacctt cgtcaagcta ggccaggtgc ttgccacccg catcgacctg     46440
     ttcgagccag aatggatcgc cgaattcggc aagctacagg acagcgcacc cgctgcctcc     46500
     tacgccggga tacgtcagca gctcaccgaa gacctgggcg caccgcccga ggaggtgttc     46560
     gccgccttcg accccgagcc gctggcggcc gcctccgtcg cacaggtgca ccgcgcccgc     46620
     ctcgaagacg gcagcgaggt ggtagtcaaa gtacgtcggc caggcatccg gccgatcatc     46680
     gaagccgacc tgcgctggct cgccagactg gcgaaactcg ctgaggggga aagtccggaa     46740
     ctgcgcgcct ttcgcccgca ggaagtggtg cgccagttta gccagtcgct gcggcgcgaa     46800
     ctcgatttcg ctggcgaatg ccgcaatgcc gagcacatcg cggagaattt tgccggctat     46860
     accgacaaag acgagcccac cggcgacgcc tctgccgaag ctgcgcctga accgcctccg     46920
     gcgctcccaa tcatcatcat cccccgcgtc tattggcaat ggaccggcga acgggtgtgc     46980
     gtgcaggaat tcatagccgg catttccggg cgcaagcttg ccaccgtcga cgaggccggc     47040
     ctcgaccgca aggtcctcgc ccgccggggc gcgcacgcag tgttgaagat gatcgtcgag     47100
     gacggcttct tccacgccga cccgcacccc ggcaacgtgt tttacctgcc cggcaaccgc     47160
     atcgccttca tcgacttcgg catggtcggg cggctcaccg aggtgcgccg cgaccagttg     47220
     accggcctgc tgctggggct ggtcaagcac gagccgcgcc gcgtcgccga cgtgatgctc     47280
     gactggaccg gcgacggcgc catggatgag gacggcctgc ttgtggaaat ccagactttt     47340
     gtgcagcagt accacggcgt ggcgctcaag cagctccggc tcggtgccat gctctccgac     47400
     ttggtggcca ttttgcgtca gcaccagctg gccttgccgc ccgatctgag tctgctgatc     47460
     aaggccttca tctcgctcga aggcatgggc cgcgagctcg accccgactt cgacatggcc     47520
     ggcgaggcga tgcctttgct ggaacaggcg ctacgggcac gttatgcacc cactgcgctc     47580
     ctccaacgcg gctggcgagg ggtcagcgaa gcgctttccc tggtggccgg cctgccccag     47640
     gatatctccc ggctgttgcg cgccgcccgg cgcggccggc tggaaatcca cattgacatc     47700
     acgcacctca agcgtgtcgg caaccagctt gacagcgccg ccaaccggct ggtggtcggc     47760
     atcgtcgtcg ccgccctcat catcggttcc tccatcgtca tgacggtgcc cggcggtcct     47820
     accttgctgg ggctaccctt cttcggcctg ctcggcttcg tcggcgccgt catcggcagc     47880
     ctctggctgc tgctttcgat ctggcgtagc gggggcaagg aatgagcgga tcgcagacag     47940
     cgcaggggtt cggtgctgac ccgctcatcg cgctggcgct ggcggccgcg ttcaccctgt     48000
     tggtcgccct ggcatggctt gcgctggtgc ggcaacgcag ccgggcgcgg cacccggctt     48060
     cggacgtgcc agcagcgagc gatgtcggag ccgccccgcc cagaaagatc gtcatcttct     48120
     actcgtccat cggccacggc cacatcagcg ccgcgcaggc catccaggag gagatcggcc     48180
     ggctggcgcc gggcgcgcgc gtgatcctgc aggacatccg cgagttcatg catccgctct     48240
     ggcgctgggt ggacgagcgg ctctactggt tcatcgccgg caatctcccg gaaagcttcg     48300
     acgcgctgtt ccatgccctg caggcgcgtg gcaaccgggt gccctcgctg gcatggctgt     48360
     ccaacgacta cccggaagac caggtgcgcg ccttcctgga ggcgcaggcg cccgacgcga     48420
     tccttgccac gcattacgga tcggcgcagg tgctcggaac cttgcgcgag cgcgggctgc     48480
     tggcgcaggt gaacatcggc tggctgcaca cggacttctt cgaaggctat ttcccgcgca     48540
     tctcgaaacg gatcgaccgc acctttctcg cccatcccga gctggaagcg cgctggctgg     48600
     ccgccggcgt ggcacccgac aaggtcacca ccagcggcat gccggtgcgc gttgcggccg     48660
     ccgacggcag aacccgggag atggcgctca cggcgctggg tctcgccccg gatgcgccca     48720
     ccgtgctcat cacctcgggc aaggaggggg tcggcgacta cgcgcttgtg gtggagagcc     48780
     tggcccgcca ccaccaaggc ccgctgcaga tcatcgccgt ctgcggcgcc aacgcgcgcc     48840
     agcaggcgct gctgaatgtg ttgcggatgg cgctgcaaaa acgcctgccg gagccggtgg     48900
     cgctgaaggt ctgcggcctg gtgccgcacg ccgacctgct ggcctggatg cgcgcggccg     48960
     acctgttgat caccaaggcc gggggcatga cgccggccga ggccttcgcc gtgggcacgc     49020
     cgacgatcct gctggacgtg gtgagcggcc atgagcgcga aaacgccgcc ttgttcgtcc     49080
     ggctgggggt ggccgagctg gccgacaccc tggcgcaggc gggcgagctg gcggccgccg     49140
     tgctggccga cccgcagcgg caggcggcga tgcgccacgc ccagcacgcc tttcacgaca     49200
     gtgccgacct cgggcgcatc gcccgcttcg cgctcgaccc ggccctgccc gcgccgggta     49260
     tgacgccgga cttcggcgcc gagcacggta gtgccgtcac cgacatcgac gcggcgctgg     49320
     cgcggctcca ggccgaggcg ccctgcgaca tcgagctgct gctgtcctac tcgaccgccc     49380
     aaacaccgca gcgcgtggtg ctggaaaacc cgttcgggca cattgccatc cgcgtcgaca     49440
     acaccgtcta cagcgccaac tatgtggccg tgccgggaca cgacccgaac ctgttgcagc     49500
     acgtgacgct ggccgattac ctgtacggcg tgcagccgcc gtcgccgtcg caggtgcaca     49560
     ccaacaccta cggcatggcc tacggccgcg agacgctggg cttgcgggtg gcgggcgtgg     49620
     cggcagagcg caaggcggcg atggtggccg aggcgcaccg gatcgaagat gagtttgggc     49680
     aaggccgcct gctgtgggat cgcagcgagt tcaattgcgc cgacgtggtg gtgcgcatcc     49740
     tgcgtgcggg cggctacgac cgctcgccac cgctggggcg gcggtggctg ccggtcatgc     49800
     cgctggacat tttcgaggaa gcccggcaga cctgcgagga agacgcgtcc ttgtacatgg     49860
     aactggtggc ctaccggcag ataccgggcg ccaacgcggc ctatcgcttc tcgcgttttc     49920
     cgctctcgct cgggcaaccg ctgcgctcgg tggcgcgggc gctgcgcgag gcgccgcaag     49980
     aacccctcga agcggccgcg accaaacagc tgaccggtta tttcggcgac caccagcttt     50040
     atttcgagga tctgcgcggc cacggggctg gcgccctggc cgacgatccg gcgcatttca     50100
     gccgcgtgca gcgcagcttg gccgacgccc tggcgaccga cctgcggcgc ttgctggcgg     50160
     cccaagccag acggcccctg cgcgagatcg ggcgtctggg tgagcttgat ggcgcccagg     50220
     acatccggcg cctgctggag cgcagcctgg cgctggcgcg catcgccacc gaacgggccg     50280
     acgaggtgct gcaagaccgg ggggcgcggc gcatgcgggc gctgtttacc gaactcgtgg     50340
     acgggtacgg ccggatcggc gcctggcacc tgcggcgcca ggagatcgag gcctatctca     50400
     agcgcttcca ggtcttcgaa gccgccgtgg ggcgtgaatt ccctgcccgc catggcgcgc     50460
     ggctcgcgcg ggccacgacg ctccggcgct cactgcggta cggtatccgg cgtctgtgcc     50520
     ggcgcgtcgg tgggcggcac cggcccacgg gtcatgggcc ggacaagggg gcaagccaat     50580
     gaacgaacca caaaccagca aagccccggc ggcaagcctg acgccgccca agcggccccg     50640
     gatcggcctg gcgctgggca gcggttcggc gcgcggtctg gcgcacgtcg gcgtgctgcg     50700
     cgccttgaaa gaggccaaca tcgagatcga cctggtggcc ggcaccagca tgggggcggt     50760
     cattggcgct gtctttgcct cgggcaagat tgacggcctg agcgccagac tgcgcaatct     50820
     cgactggccg ggcatcgtcg ccctgctcga cccggtgttt ccccgctcgg ggctgatcga     50880
     cggccagcgg gtcgccgaat tcgtgcgcgc ccatgtgcca agcgcccata tcgagggcct     50940
     gttgctgccc tttgccgcgg tggccaccga cctcatgacg ggagaagaag tggtgaccac     51000
     ggcaggcgac ctgaccgaag cggtgcgtgc cagcatcgcc gtgcccggca tctttacccc     51060
     ggtgcgcagc aacggccgca tcctggtcga tggcgggctg gtcaatccgg tgccggtgag     51120
     cgtggcgcgc gccatggggg ccgacctggt catcgcggtc gacctcaacc acgacatcgt     51180
     ggcgggccgg ctgtcccacc ccgccgccca cgccaatggc aacggccatg gccccatcat     51240
     ggcgcgcctg ctggagagcc tgcgggccat caatagcccg gtgctggcgc agttcgaggc     51300
     ctggctgcac aagcccactc tggagccgct accaggcatt ttcgaggtgc tgctcgcttc     51360
     gatctacatc atgcaggcgc gcgtcaccga agccgacctg cggcaaaccc aacccgacct     51420
     cctgatccag ccgccgctgg gcgcggtgcg cttcatggag ttcgaccgcg ccgaagaaat     51480
     catcgacatc ggctaccgca gcgcggccga gcaactggcc cgctggacaa gaacgccaac     51540
     ccatgactga cacgcatccc atgaacttcc ccgagaccgt gatcgccggc gtccacgccg     51600
     ccgtggcgag caccctgacc tgcgaggccg tgccggtccg cggcgccttg cgcctgttgc     51660
     tgttaggcca aaatacccct atccgggcac tggtgacctg cagcctccat gcagggcagc     51720
     ctggcatcga cgccggcacg gcgctggacc tgatccacat cggcctgcag cagttgcatg     51780
     cccacgttga cgcgacgacc ggcgcgtccg cgctactggg caccggcgcc accgtgctgg     51840
     cgggtgacta cctgaccacc ggggcttttc gcttgctggt gcgctgcgct gacctgcagg     51900
     tcctggccct ggtttccgat gcggtcaacc gggcttcgga actggaggcc acccaactgg     51960
     gcctggatcc agacgcccga gacgatccgt cgcggctgtt gcagacccgg caacaactgg     52020
     cggcaccgct gggtgaggcg gccggcgcca caggcgccac cctcgcgggc tacccggagc     52080
     cgctcgccgg cacggcccgg cgttacggcc aataccttgt ttcaagccac gttttgcaac     52140
     aggaagccga tgccatggac atctccgagg cacgcacggc cctgcaggac gccgcgctcg     52200
     atctgtgccg ccaggcaagg cgggaagcgc ggaccatcgc ggcggccaca ggcaatgggc     52260
     gcccgctcga actggctgaa ctgatcgcgg ccagccttgg cgccaaggca tcggcatgca     52320
     aacccaaaac tattacctcg acatcatcat gaaagaccct cttgtgaaaa aaagaaaaaa     52380
     cctcctcctc tacttggcgc cgctggcgct ggccgcactc ctgggtgctt gcggcaaagc     52440
     gccggaggcc cctgccgcat caaatacgac cagccgcccc ctgccggtca tgaccgcgtc     52500
     cgccggggcg ccgctcgaat acacggcggt cggctcggtg gtgtcggacc agcgcgtcga     52560
     ggtcgcctca cggctgagcg gctatatccg cgacatgctg gtgcaggagg gtgaccgggt     52620
     gcggcgcggg cagttgctga cccgccttga cgcatcggat gtggaaggcg gcatccgcca     52680
     gggccaggcg gcgggcggcg cggcagaggc ggcgctgcgc gatgcgcaga ttgacctgga     52740
     gcgcttccag cgtttgttcg agcgcggcag cgtctcggac aacgaattgc gcaaggtgcg     52800
     cctgaaattc gaggccgcgc gcgaggcccg taaccaggcg cgcgccggtc tcgacacggc     52860
     gctggcccag cgcgcctacg ccgaaatcac cagcccggtg gacggcgtgg tggtggcgcg     52920
     ccacaaacga acgggcgacc tcgccctgcc cggcatgccg ctgctgaccc tggagtcggg     52980
     ccgcggcctg ttgttcgaga ccttcgtggc ggagggccaa gtcgccgcca tcgcggccgg     53040
     ccagccggtg caagtcaaca tcgacggcgt gcccgcggcg ctcaagggca cggtgagccg     53100
     ggtggtgcgc tcgggcgacc cggtctcgcg cagctaccag gtcaagatca ccctgcccga     53160
     gacggcgggg ctgatgcccg gcatgttcgg gcgtgcggcg ttcgggctcg gtgcgagcca     53220
     ggcgccattg gtgcccagac aggcgttggt cgagcgcggc gggctcaccg gtgtcttcgt     53280
     ggttgatgcc gaaggccggg cacgctttcg ctggctgcgc atagcccgcg agtggcccga     53340
     tcaggtcgag gtgagtgctg gtctggccgc cgatgagcgc ttcgtggcag cggctacacc     53400
     ggccctgcgc gagggcgacc gcgtcaccgc cgcgaaggag gcgcaatgag ccagcacaag     53460
     ctcaacagcg ccggccgcct ggcgaatctc tttgtcacct ccaagctgac cattttgttc     53520
     atgctggcct gcatcctgct ggggctgctg gccgtgacgc tgaccccgcg cgaggaaaac     53580
     ccccagatcg tggtgcccgg cgcccaggta tgggtgacac tgcccggcgc ctctgccgag     53640
     gaggtggagg aactggtgat ccgcccgctg gagggcatcg tcaagcagat tgccggcgtt     53700
     gatcacacgt atgcgaccgc catgaattcg atgggcgtgt tgatggtgca gttcaaggtc     53760
     ggcgaggaca aggaaaaatc gctggtcaaa ctctacgacc gggtgctggg gcagcgcgag     53820
     cgcctgcctg cgggcgcggg cgagccgctg attcgcagcg tggatgtgga cgacgtgccc     53880
     attgtcaccg tcacgctggc ctccgagatc tacgacgatt acgccctgaa gcgtctggcc     53940
     gaccgcctga tggaaggact gcgcagcctg gacaaggtct ctgccatttc cgtcaagggc     54000
     gggcgcgacc gggaactgcg catcgagctg gacccgcagc gtctgcaagc cttcggcgtc     54060
     acgctggacc aggtgcatgc caccctgcgc gcaagcaatg ttgccgcgcc cctgggaacg     54120
     gtggtgcaac agggccaaaa ccgccaggtg ttcctggacg gctttctcag ctcggcgcaa     54180
     gacctcaagc gcgtgatcgt gggcagccat gccgggcgcc cgatctatct gggcgatgtg     54240
     gcacaggtcg tcgacggccc gccgcaagag cgcacgcacc tgagccgtct tgcatttggc     54300
     ccggccgatg cgcgctttgg caagacgcag caggcggaga tgccggccgt cacgctggca     54360
     gtggccaaga aagccggtag caacgccgtc tttgttgcca acgatgtgct tgagcgcatc     54420
     gatcggatga aggcccaatt cgtaccggca ggggtcgaac tggtcgtcac ccgcaacgac     54480
     ggcgagaagg cggatgccgc cgtgtccggg ctgatcgagc acctgggtat cgcggtgctg     54540
     gccgtgttcc tggtgactgc tgcgttcctg ggtctcaagg aggcactgat cgtgggcgtg     54600
     accgtgccgc tgatcctggc cctgactctg ggcgctgcct atctctttgg cctgtccatc     54660
     aaccgcgttt cgctgttcgc gctcatcctg tctctggggc tgctggtcga tggcgcgatt     54720
     gtcgtgatcg aaaacatcca ccgcaactac agccgtcttg gcaagcagga caaacggctg     54780
     gtcacggtgc aggccaccaa cgaaatcggc aaccccacca acctggcgac gctggcggtc     54840
     atgctggtgt tcggctcgct gctggtggtc agcggcatgc cggggcagta tttctacccc     54900
     gtcgctttca acgtgccggt cgccatggcg gcctcgctct tggtggccta cgcggtggtg     54960
     ccctgggccg ccaaccgctg gctcaagccc ggtgaagggc acgatctgga agaccacgat     55020
     acccaggacc gcctgcatcg tttctaccgt catgtgatgt cgccgctggt ggatcgctcg     55080
     cgcagccgct ggcttgcgtt cctgttggcg ggattggcca ttgccgtatc gctgttgcaa     55140
     ccggcctggc agttcgtgcg cccgtccggt ttgggcgggc cgcagtcctg gttcggcgtc     55200
     gagctggcca tgatgcccaa ggacgacaag aacaccttca acatcacctt ggacatgccc     55260
     gcgaccgcgc cggtggaggc gactgatcgg ttcgcgcgcg aagtcggtgc gctgctgcgc     55320
     gagaacgcct acgttcgcaa ctaccagagc tggatcggcg aggccggcgt gatcgacttc     55380
     aatggcttgc tgcgtggttc cggcaataag caaggggcac acgtcgccga gatccgcgtc     55440
     aacctgctga acaaggctga tcgaagtaag acctcgatag ccatcgtgcg cgaattgcgg     55500
     cccacactgc aggctatggc cgcgcgttac cccggcagta cggtgcagtt ggtcgaggac     55560
     ccgcccgggc cgccggtgcg cgccaccgtg ctggccgaaa tctacggcaa ggacttgcaa     55620
     caactgcgca cgctgtccgc gcaggtcaag gcggccttcc agcagacgcg cgacatggtg     55680
     gaggtgaccg actccgaggc ccaggacgtc caccagtacc gcctgacggt ggaccgggaa     55740
     aaggccgcgc tgtccgggct gagcgtggcc gaagtagccg tcgcgctgcg tcgcctgatc     55800
     gacggcgagg aaatgggtcg ggcccgcatc gccggcgaga agaaccccgt gcccatccgc     55860
     ttgcagattc cccggcgcca ccagatcgac cccgcgctgc tggcacgcgt gtctgtgacc     55920
     aaccggcagg gccagcgggt gccgctgtcc gaggtggtgc aagtcgtccc cggctcagtc     55980
     gaccgggcga tttcgcacaa ggatggcgaa cgcgtcacct acgtcggcgg cgaactggaa     56040
     tccaccgccc ctgtgtacgc cgtgcttgac cttgaccggc gactggacgg cttgctgctc     56100
     gccgatggca gccgcctcac caccggcaac ctgcgcctga acccggtcgc gcccgacacc     56160
     ctggagggcc cccgcctgct gtgggacggc gaactgcgca tgacgctgga cacctaccgc     56220
     gacatgctgg gcgcgctggg cctggcgctc accttcatct ttctggtgct ggtggcttat     56280
     taccggtcgt tcagcctgcc gctggttgcc atggcggcga tcccgctggg actggccggc     56340
     atctttccgg ggcactggct catgggcccg cccttcaccg ccacctccat gatcggcatc     56400
     atcgccctgg ctggcgtggt ggtgcgcaac tcgctgctca tcatcgactt cgtgctggac     56460
     taccggcgcc agggcatgga cttgcgcgag gccatcctcg aagctggggc ggtgcgcctg     56520
     cggcccatcc tgctcaccgc tttggccatc gtgctgggca gcgccgtgat gctgagcgac     56580
     ccggtgttcg gcgggctggc aatctcgctg atttttggca cgctggcatc caccgtgctc     56640
     accctgatcg ttgtgccgct gttgctgtat ctgctgctgc gctacaagga ccagaacgaa     56700
     gcaagcctga aaaaaggaac cccatgaacc gctcgataaa aattcgcggc ctgttgccgc     56760
     tggcggctct ggccgctgcg ctgcttgccg gcaacgccgc cgccgagtcc ctgcaacagg     56820
     catgggacat tgcactgacc gttgaccgtg ggctcaaagc ctcacgcgaa agcaccgccg     56880
     ccgcgtccag cctgctggat gcggccaaat ccgcccgcct gcccaacctg gcgctggagg     56940
     cgggctatac cgccctcgat aaggcaccgg cggccagggt tgattttttt ggccagtcgc     57000
     tgcaaatgcc gctggcgcaa aaggacagcg ccgcctaccg cgccatggcg acgcttccgc     57060
     tctacaccgg tggtcgcatt gagcgcggca ttgacgcggc cacggcaggc atggatgcgg     57120
     cgcggctggg cgaaaccgcc gatgcacaga acctcaaact gcgcgtggcg gatgcctatg     57180
     tcaacgtgct gcgcgccagc cgcatgctga aggtcactga gagccacgtc gccagcctgc     57240
     aggcccatgc gcgtgacgtg ggcaacctgc acgagcaggg catggtggcc aaaagcgacc     57300
     tgctctctgt gcaggtggcc ctggccgatg cgcgccagcg ccatctgcag gtggccaatg     57360
     ggctggatct ggcgcgcgcc gcctacaacc gcctgctggg gcggccgctg gatcagcccg     57420
     tcgcgctcga cgacctgtcg cccgagacgg cgcaagagcc gctccccgcc ctgagcgagc     57480
     gggcactggc ccggcgcagc gagctggcgg cactggcgcg tcaaattgaa gcgatgcgcc     57540
     accaggccgc cgccgtgcgc ggcgaaaccg ccccgcaggt cgcgctgtcc ggcggttacg     57600
     gctaccagga gaaccgctat caggtgcatc aagggcaatg gatggtcacc ctgggggtca     57660
     agtggagcct gttcgacggt ggcgtggtca gccaccgcgc caatgctgtc gagcgccagg     57720
     ccgcggcatt gacggagcaa cgcgatgagc tggcctccat catcgccctg caggtccgcc     57780
     agacctggct ggacgtgcaa gagacccgca agcgcctcat cgtcacccag tcagccatcg     57840
     cccaggccga ggagaacctg cgcgtggcgc gcgaccgcta tgccaacggc ctgtccaccc     57900
     ataccgaagt gctcgatgcc gagaccttgc gcaccggcag cgagggcaac cacgccaatg     57960
     cgctgtctga tgccgcactg gcggggttgc ggctgaagcg cgccacgggt gagctctgag     58020
     tctgaggaga tggataccat gaaaacaccc tcaaaacgct ggctcgttcc gatgacggtg     58080
     gccctgcttg ctatcatggg cctgaccgtc tggtggtttc tgctgcgcca gccgccactg     58140
     cccgctggca tgatccaggc caacggtcat gctcgatgac ggcatggggt tcagcttggt     58200
     gccatggagg ccggttattg aacagcgact tggacagcaa ctcgccgcaa cggtgcatgg     58260
     aggaggagta tcttgggaaa ttggacgaca gcgagggcct tcggtcattt agctaatttt     58320
     tccgcccgtt ttgtattctg accaaaccag tcggagggtg ccacaccttc ccaacgcttg     58380
     aatgcccgtc tgaagtttgc tatttctgta tagcccagta aataggccac ttccttgaca     58440
     gtgactttct ttctgagcag ttccaatgcc atgcggtgcc tgactgactc agcgacttct     58500
     cggtaggaag ttccttcctc gattaggcgg cgatgcagtg tccgaggtgt catgccaagc     58560
     aaccgcgcgc agaatgtgag tgttggaaat gaagggctgc gctcaagaat aacaccctcc     58620
     agtcttgcgc tcgcgctttt gttacttcgg agtgtcttga actcatcggt acagatgcgc     58680
     acagcttctg ccagcaccag cgcatcatgt tttggtacgt cttcttctgc tgccgacagg     58740
     gcaaaagaca agcccgacca cttctgacca tactgaacct gacagccaaa aatatctcgt     58800
     gccagtgcag aatgaggtgg ttcgggaaag ctgaagccaa ccctgctgca ggcactgcca     58860
     tgatgaatca agtcatctgc gatattcttg accgccacca tcgcgatttc ggtcaccggg     58920
     ttgcttgcag ggcccaaacc caatacgggc tcgaaaaaga cctcgaacgc cccattcgcc     58980
     acgcgggtcc gaatgtcgat gacacccgtt ctgaggctga ctaaacgctc gacgatttgc     59040
     atggcttccc ggatgttggc gcttgccgca gccgccatac cgacaatgcc gtgactgcct     59100
     ggaatcaaac gacaaccggc tagcaccccg aagcctgact cccctgaccg agcgatggcc     59160
     gcggtcacga gttctccgag tttctcaatc ggaatcaagg ccgtcgcatc gaccagatcc     59220
     cgctccttga gctccgaaat agccagccac gcagccaaat cgacgccaag ctcaaccgcc     59280
     tgatccgcga tttgccgaag ataagtgacg cgtacgtttg tgatgtgcac cggttgtctc     59340
     actcatacta tttgtacttg gtcacgaaaa acgcctcgtt ttttcgcctt ttcgttggaa     59400
     gaaagaactg cgattgttcc acgcgaaccc cgcatagtgg atgcacttgt caatacttgt     59460
     caataactga cccccgtttg tcagtttgaa cactcacgac ctcaagggcg cgcgtgacat     59520
     gctagaagac taaaaaacat taggagacaa ctgcgatgcg ttctttactc aggcggtcct     59580
     cacacgaggc cgaaatcaat ggcaaaacca ttaccgtcca gcccgatgaa accctgctgc     59640
     tggcagcgtt gcggcaagac attcacatcc cttccatctg tcgcgtcggc ggctgcggta     59700
     cttgcaaatg caaactcaag ggcggcaagg tcgaagagct gaccgagacc gcctacctgc     59760
     tgtcggaaaa ggaaatcgcc gacggcttca ttctggcctg ccagagccgc ctgcgtagtg     59820
     atgtcaagat cgagctggac caagaaggcg cgatcgacgg ccctccagtc aaaggcgtgg     59880
     ttgtcggcaa gcagatgctg acacatgaca tcgcccgtat cgacatccgg ctggaccagc     59940
     ccatccgcta ccgcgccggc cagtttgcgg aagttgcgct gcccgcactg cccgattgtt     60000
     ctcgtagcta ttctttctcg actgcaccag gcaacgaccg ccaggtgagc tttaccgtgc     60060
     ggcgtgtgcc tggtggacgc gtatccgggc atctggtcga caaggcacag gtgggcgagt     60120
     ccctcacggt ccgtggcccc ggcggccagt tctggatgcg cccgggccag gctccggtgc     60180
     tcatggtggc cggcggcagc ggtctggccc caattctggc aatgctggaa gacatgaaaa     60240
     accgtggcga cctgcgcccc gtcaccctct tattcggcgc acgcgcccag cgggacttgt     60300
     acgcgctgga cgaactggcc gcctattccg ccagttggcc aaacttccga ttcgttccga     60360
     ttctgtcgga agcagacgct tcacaagcct gggagggccg cacgggtctg gtgaccgagc     60420
     acattccaga gcttttgggc agcgccacct cagcctacct gtgtggccca cccgccatga     60480
     ttgactcggc cgtcgcggtc ttgcgaaagc aaggcattac tgatgagcac ctgcacgcgg     60540
     atcgctttgt cgatcaggct ccaaagctgc ataccggctt ctatggaact gtcggtttgc     60600
     ccgaggttga acgcgcacca gcaaacatac tggactacct caaatttttc ctggtgcacc     60660
     tggtcggcgt gggaggggtc ttgtccattc tggctggcgg cgtctacacc agtttggggc     60720
     tgctggggct tctgatgttc tacatcggcg gcgacgcgtt gctgggccgc gatacacgca     60780
     ccccggagta tcggtcgcct tggatcctga ccgtgcagct ttggctggcc ctgccgctgc     60840
     tggcgctcgt gatgttcagc tacatctgga ccctctcgcc gggagatccc ttgggcttcg     60900
     gcgcctggat cagcggtctt accggatacg acgtactcgc cgcccgggcc ggcacgggct     60960
     tttggcatca cttggcgggc ggcgtgcatg ctggcctgac gatcggtctc ctgggtacgg     61020
     tgactggcca tgaactgaca caccggacat gggaccctgt ctcgctgctc gtcgggcgct     61080
     ggctgctggc cttcagctac gacaccgggt ttgccatcga gcatgtctac ggtcaccacc     61140
     gctacgtctc gacagaacat gaccccgcta cggccccacg cggacgtaac gtctacttcc     61200
     atgtggtggc ctccaccatc aagggcaaca tcagcgcctg gcgcctcgaa accgagcgtc     61260
     tgatgcgcaa gcaccacgaa gtcctgtccc cgcgcaatgc ctacatccgc ggcgtgctca     61320
     tgagcgtgct gctggtggcc attgccggct ggatggccgg ctggtccggt gtgctggcct     61380
     tcaccggatg cgcgctgttc gcaaaagccc tgcttgaaat cgtgaattac atggagcact     61440
     acggcatggt gcgcatcccg gatcaggcgg tgcagcctcg acattcgtgg aacaccaacg     61500
     ctcgcatgag ctcctgggcc atgttcaacc tcagccggca ttctcaccac cacgcacagg     61560
     gcgaggtgcc ctatcaggac ctgatgccgc tgtcagacgc gcccatgatg atcaacgggt     61620
     acttggccac catcgtgttc accctggttc ctccgctatg gcatcgcctg atgacgccca     61680
     agctcatcga atgggatcgg ctctacgcca cccctgagga gcgggcgctc gccctgcggg     61740
     ccaaccaacg cagccacctc aaggctctgc gggactacga cccgcgccgc tggaacaccg     61800
     ccgccgccca ctgagcggcc cacggccccc tcattcctgt caggtccggg acccctggtc     61860
     ccgcaatgga gatcttatga attttgatta cgtcattgtt ggcggaggtt ccgccggcgc     61920
     aacacttgct gcaagactga gcgaggaccc cagcaccagc gtgtgcctgc tggaggccgg     61980
     tggccgcggc gacggcatct tggtgcgcgc cccggctggc atggtggcca tgatgccggg     62040
     ccgcggcaag attaacaact gggtcctgca caccgtgcct cagcccggcc tcaatggacg     62100
     aaggggctac cagccccgcg gacgcgccct gggcggctcc tcggcgatca acgccatgtt     62160
     gtacatccgg ggtcagcggc aggactatga ccactgggcc aacctcggct gcgacgggtg     62220
     ggactgggaa tcggttctgc cctatttcaa gaagtccgaa aacaacgagc ggggaccagg     62280
     cgccttccac gggggcagcg ggccgctgca tgtctcggag cagcgaagcc cgcgcccgat     62340
     caccctcgct ttcattgaag cggccaagca ctgtggtatt gcgcctcggg cggatttcaa     62400
     cgatggagac aacgaaggcg taggcctgta ccaagtgacg cagttccacg acgccgctcg     62460
     ccgaggcgag cgttgttcca cggcagcggc ctacctgcac ccgctcaggc gacagcgacc     62520
     caacctcacg atcaagacga acacacgggc cacccggatc atctttgaag gcaaacgggc     62580
     cgtcggcgtg gcctaccgtt cagccgggcg agagcaagaa attcgggcga agcaagaggt     62640
     gatcgtggca gctggtgcct tcgggtctcc gcaacttctg cagctctcgg gggtagggcg     62700
     tccggaagac atcacccacc atggcatccg catggtgcac gagttgccag gtgtcggcca     62760
     gaacctgcag gatcacctgg acttcatcca cgcattcaag agcaaggaca ccgacaactt     62820
     cggcattggc ctgaggggca cgatgaacct gctgggccac atcgcccaat ggcgcaagga     62880
     cggtagcggc atgctggcca cgccctttgc cgagggggcc accttcttca agagcgaccc     62940
     gggcattgac cgaccggatc tgcaactgca ctttgtgatc tccgtcgtgg acgatcatgc     63000
     gcgcaagctg cacgccggct atgggttctc gtgccatgtc tgctacctgc gtccgtactc     63060
     gcgcggggag gtgttcctcc agtcgcccga tccgttggac gatcctggca tcgatccccg     63120
     gtttctgtcg gacgaacgcg atctcaaggc cttgatgcac ggcgccaagg tgacccgcga     63180
     gattctgctg gcaccaccac tgaagaagta ccgccaccgc gaactgttcg gcatgaccga     63240
     tggcatgaac gatgcgcaat gggagcagca catccgctcc cgtgccgaca ccatctatca     63300
     cccgatcggc acctgcaaaa tgggtgtcga cgccatggcg gtggtcgacc ccgagctcaa     63360
     ggtgcgcggc ctgcaaggcc tgcgcgtggt cgacgcctct gtcatgccga cgctggtcag     63420
     cggcaacacc aatgcgccca cgatcatgat cgccgaaaga gcggtcgacc tcatccgtgg     63480
     ttttgccaca cgctattcaa ccgctataag gaactgaaaa atgctcggaa aaatgatgcg     63540
     cgagcctctg ctcgtctcca gcctgatcgc tcacgccgcc agttaccacg ccgacaccga     63600
     gatcgtctct gtgcaaacca ccggaggcgt cgaaaagacg acctggagcc aggtcgaatg     63660
     caatgcacga cgcctgtcct cggcattggc caagctgggc gtccggcaag gagaccgctg     63720
     cgccaccatc gcctggaaca accgccgcca tctggaaatc tactttggcg tgtctggcgc     63780
     aggcatggtg tgccacacga tcaatccccg cctgtctttt gaagcgctaa cctacatagt     63840
     caaccatgcc gaagaccggg tgctgtttgt cgaccggacg ttcctgccca tcgtagccaa     63900
     gctgcgccca gcgttgaaca cggtcaagca cgtcatcctc atgggccctc gcgagaccga     63960
     ggcacagggc atggtggatg atctgttgtt ctatgacgag gtggtgacca ctggagacca     64020
     agactcccag tggcccaact tcgacgagga tcttccctcg tcactgtgct acacctccgg     64080
     taccaccggc caccccaagg gtgttctgta cagccaccgc tccacgatgt tgcatgcgct     64140
     ggccggcaac catccggacg gactggcgat ttcggcccgc gacaccgtca tgccggtggt     64200
     gccgatgttc cacgtcaatg cctggggtgt tccttacatc gcggcatcgc aaggggcaaa     64260
     gctggtgcta ccgggcccga acctggacgg tgccagcctg gcggcgctga tcgatgcaga     64320
     ggaggtcagt ctggcgctcg gtgttcccac catttggatg ggactgcttg cggcgttgag     64380
     ggcgcgtggc accaagccca agagtcttaa gcgtaccgtc gttggcggct ccgcgctgcc     64440
     accatcgatg tttgccgcat tccgcgacga atttggcgtt gagctgatcc acgcctgggg     64500
     catgactgaa accagccccc tgggcacgct gaaccagcca ctggcccgcc acgcccacct     64560
     cgacccgcaa agccagagcg acttgcgact ggggcagggc cgccctcctt atggcgtcca     64620
     actgcgcttg gtcgacaacc ttgggaccgt cttgccgtgc gacggcaaga cacaaggcag     64680
     ccttcaaatc aaggggcatt ggattgtcga cacctacttt ggcgccacga ccagcgctct     64740
     gaccgcggac ggctggttcg ataccggcga tgtggccacc atagacgcta atggttacat     64800
     gatcatccgc gaccgtgcca aggacatcat caagtccggc ggcgagtgga tttcctccgt     64860
     cgaggtcgag aacatcgcga tcggccatcc cgccatcgcc aatgcggccg ccatcggggt     64920
     accccacccc aagtgggacg agcggccggt gctggtcgcc gtgaagaagg aaggcgcgac     64980
     ggtatccgac gcagatgtcc tggccttctt caaggaaaag gtgcccgatt ggcagattcc     65040
     ggacaaggtt gtcttcgtcg atgcattgcc gctgagtggc accggcaagg tgctcaagaa     65100
     caagctgcgg gagtcctaca aagatttgtt gaccgttgac agggcggagt ccgcgtaatg     65160
     gaaaacagcc atttgccaaa caccgaggtt caggcggcgt tggatcagga cctgcaggcg     65220
     ctggaagccg ctaagcacgc atgggcgcga acgtcggttg ccgaccgcat tgcgatcctc     65280
     ggacgcatca agcagacgct gatgcaggtc gcccagggtt gggcagagac cgccgcccgg     65340
     aaaaagcgca ttccgcacgg ttcaccgctg gcaggtgagg agtggatatc cggtccttac     65400
     tccgtcatgg ccgcctgcaa tggcctgatg caaacgctgt cccaactcaa gcgcaaggaa     65460
     tttcttgcgc acttgcacat gcggcgcctc aagaatggcc aactggcggt tggtgtcatg     65520
     ccgcattcgg tctgggacag cttgctgttg tccggcgtct ctgccgaggt ttggatgcaa     65580
     aaaggtgttt ccgaggtcaa tgtggacgag catgccgcag cggcctacga cgtgccggtc     65640
     gatcagcgaa gcggcaaggt ggcactggtc ctcggcgccg gaaacattgc cgccatttct     65700
     ccgcttgatg ccttccagaa gctgttcatc gagaaccagg tggtgctgct caagatgaac     65760
     cctgttaacg actacctgac cgactatctc cgggcggcgc tgaggcccct gatcgagtgc     65820
     aatgcgttgc gcatcgtgcg tggcgacggc gctgtgggcg cctatctgtg tgagcacccg     65880
     cgggtggagg aaatccacat caccggcgct cgggccaccc acgatgccat tgtctggggc     65940
     gtcggtgagg aggggctccg gaacaaagca gcgaataccc cgaagaatca ccgaaaggtc     66000
     acgtctgaac tgggggcggt atgccccacc atcgttgtgc caggtccatg gtcaagagcc     66060
     gacatccggt ttcaggcaga acagatcgcg acacagaaac tccacaactc cggcttcaac     66120
     tgtgtggcct gccagacgct gatactaccc caaggctggg cgcacacgga acctctactg     66180
     gcagaggttg gccgtgtcat gtcgcgcaac ggccagcggg aggcctatta cccaggcaac     66240
     gagcatcgca cagccgactt tgcagcccat gccggtcgtt cagatgcgat tgaacgaggt     66300
     ccgggggcgc cgccctgcgt cctggccgat atggatggcg gtgatgaacc ctggctggcc     66360
     gaacacgagg tcttcggcac ggcactggcg atgaagtccc tagcctacca ggacgccgag     66420
     tcgtacctga aagcggcgat tgactacgcc aacaaccgcc tgtacggcac actgggggcg     66480
     aacattctca ttcaccccaa gaccctgcga cagatcggtc aacagcgctt cgaagagctc     66540
     ctgcgggaac tgcgctacgg aacgattgct gtcaatgcat ggaccgggtt ggcgtttctg     66600
     ctggcaccct gtccgtgggg tgggttcccc gggggaatgg ccatcgatcc gcaatcgggc     66660
     gtcggcaccg tacacaacag tttcatgctc gaaaagaccg agcgcactgt cgtgtttgcg     66720
     ccttggcgcc ccttcccgcg tggcttgttc tcgctgcaat tcacgctctt gccccggcct     66780
     ccgtggttca tcactaaccg gcggcaacac gagctgggtc ggcttctgac ggattttcag     66840
     ttccgtccgg gttggaccaa gctgccaagg atcttcatca acgccctggc agggtagacg     66900
     ggcgaaacac cgacgaccag aacagctttc cctcgtgcat tccattcaag caatttgctg     66960
     gcgatgacca gcttacggag acaagatatg ccaaaaacca aaaccacata cgccttcgcc     67020
     ttcgccgcag ggcttaccct tgcctttggc agcattggcg catatgcgca atccgaagat     67080
     gccgccaaca cactgaagat cggctacgct ggcatcacct tcaacacgaa gtccggccac     67140
     ttgatcggac ctcccggcac cacaccaccg ggcattcaga ccgacttgcg cgatgcacgc     67200
     acctttgcgc tgatctatga gcggcggatc tcggggccgt ggtcggtcgt ggtgcaggct     67260
     gccaccccgc cggtggtcaa ggtcgatggc gccggcacgg gggccccgct cggctcggtc     67320
     gagacgacca aggcatggtt cccggcggtt ttggcgacct acaccttcgc cggcctgccg     67380
     ggcatccgac cctatgtggg tgccggggtg aactacgcat tcttcaccga tccgcaggtg     67440
     agcgccgcat acaccggcgc cttcggtggc accagcagtt cctccacgct gaaaaactcg     67500
     tgggggcccg tggtgaagct cggcgcggaa ttccctatcg cgaagaactg ggttctcgac     67560
     gtgggctact cgcgctactg gatcaagacc acggccacca tcaccacgac aacacccggg     67620
     gtgggcgaca ttgcacggac gatcaatgtc aaggttgacc ccggcgtgtt cggtctgctg     67680
     gtggggtatc ggttctgatg gtgcactcat ccgcagccac gccggattca gcgcatgaat     67740
     ctctcatcca tcccatcttg ccggcctgcg ccggctcaag gaaccccatc atgctgctga     67800
     gtccaccgac tgacctcgca gcgcgcttcg aggcccagcg cagaccttcg cgcgcggact     67860
     ctatccgaca tggcaagtca ggatgtcgcg cctggatcgg ctgctcgccg tgaccgagac     67920
     acacgaggac gccatcgtgc gcgcgatcag cacggatttc cgcggccgat ccgcccagga     67980
     gtatcagtag tcttccaaca atccccagtt gtggtcgtcg aattttcccc acccatcaac     68040
     gccaaggagc aaacgatgaa aggggaattt cgacaggttg cagcgccgat ccgggaccgc     68100
     gcagcccagg acccgagggc cctggtctgc gcagcggcta taagccaatg tgcgcgcaat     68160
     tgcttccatg cctcaatgag actcccagca cattgttcac tggatagcgt tcgcaggttc     68220
     gaaccgaacg atcgtgaatt gtgcgaatag cagataagtc agacaacatg gagttacgtc     68280
     atcttcgttg ttttatcgca gtggccgaag agttgcactt cgcccgtgcg gccgagcgcc     68340
     tgcacatcga gcagtcgccg ttgtcgcgag ctatcaagga actggaatcc aacttggctg     68400
     tgcagttgtt cgagcggacg acaagacgca cgcggttgac ctgggcgggt aaggtttttc     68460
     tggaggaggc ccatcgcgtc ttcgcagcta tcgaccaagc caaagccagt gtcaaggcag     68520
     cggctaccgg gtaccgcggc cgcctgcgca tcgctctgtc cgatggcatc gcccagccac     68580
     gactatcggc tttgctggca cagtgccgcg aggaggaacc agaggtagag attcgtttgt     68640
     cggaaacacc gttgtcgcag cagatcaagg ggctgaacag tgacctgtat gacgcggggt     68700
     ttgcacaatc cgatgaagtg ggtgaaggca tcatcgctga ggccatctgg agcgagcctt     68760
     tggtgatcgc tgtaccggcg cgccatccgc tcctggtgca ccgtcgcatc ccgctcgacg     68820
     aagtgttgcg ctatccgctg gtgctgtgcc atcccgaaac ttgcgaaggt ttctggcagc     68880
     aggtcaagcg ggtgctacgc acggtggatg ccaagcccat cgtggtggat cgtgtgccaa     68940
     cgctggactt gatgatgacc ttggtggcag ctggttacgg cttggggttc gcaggcgaaa     69000
     gccagattgc agcatgccgc aatcccgatg tgattgcccg cccactggcc ggtcgttcgc     69060
     cgatgctgac cacctacctg ctgcgcccag aaattgaacc ttccgagcag ttgagccgct     69120
     tcatcgacag ggtgagccct gtcgatgagc aagcatcgaa tcccgccact gttcaatgag     69180
     aggccatgcc atgaagatga ttgctgccct gatgctcgtg ctgcagctga ccgcctgcgg     69240
     ccagtccgca cccacggaga ctgtcgaatc actggctgcc aaccccgagc ggttgaagga     69300
     actgcgcgcg cagtgcaaag ctgatcgtgc caagctgggc gatgcattgt gcaacgcagt     69360
     ggccgaagcg acacataaac gcttcattgg caacggcacg ccgtacacgc ccgaaccgac     69420
     accgaagaac tgatcgcttc acgcagatag cgaccttgcg gccggtcaat gcccgtcgca     69480
     tgtctccgta cgtgccaatt cttcacatcg gcaaaaaatc tttcaacaaa tcgccataca     69540
     cgccgcaacg cgcagccgct tgcagcattt ttcttgtcta cgcccctact ggaagtcttg     69600
     ctttttctcc ttggattgtg ccgataacgg tctttgaccg gcactgaccc aacaccgaac     69660
     ctcacgtctg cggcacctct ttgtgcacgc gatgtgcaga agaaattcgg aggtcgggat     69720
     gcaagggacc agtgtgctgt tcggtcaggt gttgacggtg ttcggcatcg tcttagccgg     69780
     cgtgtggggt gccacacaat ggaccgccgc tgccctgggt taccagctac gccttggcac     69840
     tccctggttc gatttcttcg gtacgccggt ctatcaccct tggcgtttgt tcgagtggtg     69900
     gttcttcttc gacgcttacg caccgcatat cttcaacacg ggtggcagca tcgctggcgc     69960
     cagcggcatg gtctcggtgg tggtcgccat cggcatgtcg atctggcgct cgcggcagtc     70020
     caagctggtc acaacttacg ggtccgcacg ctgggccgat gccaaagaaa tccgcaaggc     70080
     gggattgacc aatccagccg gtgttttcct cggcctgcat gacgatcagt acctgcgcca     70140
     tgaagggccg gaacatgtcc tgaccttcgc gcccacacgc tcgggcaaag gcgtgggtct     70200
     ggtggtgccg acgctgttgt catggcctgc atctgccgtt atccacgaca tcaagggcga     70260
     gaactggaac atcaccgctg gctggcgctc acgcttctcg cactgcctgc tgtttaaccc     70320
     gaccgatccg aagtcggctg catacaaccc actactggaa gtccgacgcg gcgcgcatga     70380
     agtgcgcgac gtgcagaaca tcgccgacat cctggtcgat cccgaagggg cactggaacg     70440
     gcgcaaccac tgggagaaga cttcgcacgc tctgctggtc ggcgcgatct tgcatgtgct     70500
     ctatgcgggc gaagacaaga cgctgcgcgg cgtcgccaac ttcctgtcag atccggcgtg     70560
     cccgttcgag gtgacgttgc accggatgat gagcacgcgg cacttgggcg agagcaccca     70620
     tcctgttgtc gcatccgccg cacgcgaagt tctcaacaag tcggacaacg agcgctcggg     70680
     cgtgctgtcc acggccatga gttttctggg attgtatcgc gaccccaccg tggccgaagt     70740
     gacttcgcgt tgcgactggc gcatcgccga cctgatctct gccgagcatc cagtgtcgtt     70800
     gtacctggtg gtgccgcctt cagacatcag tcgcaccaag ccgctgatcc ggctgatcct     70860
     gaaccagatt ggtcggcggc tcaccgaatc gctcgatggt tccgatggtg tggagcgcaa     70920
     gcacaagctg ctgctgatgc tcgatgagtt cccggcattg ggccggctgg acttctttga     70980
     atcggcactg gcattcatgg ctggctacgg cctgcgcgcc ttcctgattt cacagtcgct     71040
     caaccagatc gacaaagcct acggccagaa ccattcgatt ctggacaact gccatgtgcg     71100
     cgtgaccttc gccaccaacg acgaacgcac tgcgaaacgc atctccgaaa cgctgggcac     71160
     ggccaccgag ctgcgcgcgc agcgcaacta cgccggccat cggctggcgc cgtggctggg     71220
     ccacctgatg gtgtcacgcc aggagaccgc gcggccactg ttgacgcctg gcgaagtcat     71280
     gcaactgccg cccgatgaat cggtggtgat ggtctccggc catgccccga tcaaggccaa     71340
     gaagctgcgc tactaccttg acgccaactt caagcgacgc gtactcccgc cgcccgcgct     71400
     gacattgggc cgttatgccg acgtgccagc ggcacgcgcc gacgactgga gcgccttggc     71460
     tgtgcctacg gtgtcggccg cttcggcgac ggctgggctt ggcgaatcgc tcgatgacgg     71520
     cggcccgcgt cagcagcccg agctatccga agtcgccacc tacagccccg aacccgatca     71580
     gtcggccagc gacctgtcgc tgcttgatga cgacgacttt ccgcttcccc tcccaaacca     71640
     gctcgacccg cgcttgcagc gcacggcacg gctggccgct ctcgaccctg acgacggaat     71700
     ccagctatga cccaagcccg cctgaacctc ttcattcaac ccgaccatgc caagcgcttg     71760
     gatgaactgg ccgcaaagaa aggcgtgtcc aagtcgtcca tcgtcgcggc ggcgctggcg     71820
     tcctggctat cgccggacgc tggcgaccag cgggaagcgg ccacagccaa acggctggac     71880
     cggctatcgc gccagttcga gcgcttggag cgtgaccaga acatcctgat cgagacgttg     71940
     gcgctgtacg tgcgctacta cctgacagtc agcacgccgg tgccggaggc ccatcaggaa     72000
     gccgcgaaag cacagggcaa ggcgcgcttc gagcagttca tcgaacagct cggccgccat     72060
     gtgctgcgtg gacgcagcct ggtcaaggag gtctacgagg aaatccagcc tgatgctgcg     72120
     cggctggcag aagcagcgat gcaagaggac ggagcatgag cgccgtcctg aaagaccagc     72180
     cgccatcatc cgctgccaca tcactggatc ggcgtatccg catgttgcgt acggcgatgg     72240
     gaccgctgat cgctgccgcg ctggaagatc cggacgtggt ggagatcatg ctcaacccgg     72300
     atggctcctt gtggattgat cggctgtcgt cgggccgctc gccgatgggc gtcaagctgt     72360
     ccgaggccga tggcgaacgc atcatccggc tggttgccgc ccatgtcggc accgaggtgc     72420
     atcgcggcca gccgttgctg acggccgaac tgccggaaac gggtgagcgc ttcgagggca     72480
     tcttgccacc cgctgcgccg gggccggcct ttgccttgcg taagcgcgcc gtgagcatca     72540
     ttgggctgga gcgctatgtc gccgacagca tcctgtccga ggaacaagcc gagttcctgc     72600
     gccgcgcggt ccgcgagcgg ctaaacatcc tgatcgctgg gggtaccagc actggcaaga     72660
     ccacgctggc caacgcgctg ttggccgaga ttgccgccac tggcgaccgg gtgctggtgc     72720
     tcgaagacac cgtggagctg cagtgtgccg cccgcgacca cgtatcgctg cgcacccgcg     72780
     ctggcgtggt gtcgatggcg gagctggtgc gggccacgat gcggctgcgg cccgaccgcg     72840
     tgatcgtcgg cgaggtgcgc ggcggtgagg cactggacct catcaaggtc tggggcaccg     72900
     ggcaccccgg cggcatcgcc acgatccacg ccagttccgc tcacggcgcg ctactgcgct     72960
     tggaacaact gatcctcgaa gtcgctttga caccgccgcg tgcgctgatc gccgaggcgg     73020
     tgaatgtcat tgttttcatc gccgggcgcg gccgtggccg ccatgtgcag accatcgccc     73080
     gcgttgtcgg tttcgacgtc cacggctacc agctcgacga cgcgctcgcg ccgccgcttc     73140
     caactctttc gcttccttcc tcaaccaccc ctggagaact gccatgacgc acatcgcttt     73200
     ttcgacttcc cgtttttctg caaatccgca tctgcggctg acgttgcacg ttgtcgtgct     73260
     cgccgcgctg atgctgtgcc tgactttgcc ggcacatgca gccggctcca gcatgccttg     73320
     ggaagggccg ctgacatcca tcctcgaatc aatccaggga ccggtggccc ggatcgtcgc     73380
     ggtcatcatc atcatttcca ccggcttggc gctggccttc ggcgatacgt cgggcggctt     73440
     ccgcaagctg atccagatcg tgttcggtct gtctattgcg ttcgccgcgt cctcgttctt     73500
     cctgtcgttc ttctcgttct cgggcggggc ggtggtcgca tgagcaccga gaccgaattt     73560
     gcacagggct tcgccagtgg tttcgagatt ccgctgcatc ggtccttgac cgaaccgatc     73620
     ctgctgggcg gcgcgccgcg caccgtggcg atcgccaacg ggacgctggc cgccgccgtt     73680
     ggtctgggcc tgcaactgtg gattcccggc ctggtgctgt ggatcgtcgg ccattcgctg     73740
     gcggtctggg gtgcacggct cgatccgcag ttcatggccg tgttttcacg gcacatcaaa     73800
     catcgcccac tgctggacgt gtaaagcgaa cgaggagaac acgccatgat gaatctcgct     73860
     gaataccgca aacgtcccgc actgctggcc gattggttgc cctgggccgg gctggttgcg     73920
     ccgggcgttg tgctcaacaa ggatggctcg ttccagcgca cggcgcgctt tcgcgggccg     73980
     gacctggaca gcgccacgca gggcgaactg atcgccacgt ccgcgcagct gaacaatgcg     74040
     ctgcgccggt tggggtcagg ctgggccttg ttcgtggagg ccgaacggcg cgccgctgcc     74100
     gactacccgt actcggattt tccggagccg ctgtcctggc tggtggacga agaacggcgg     74160
     gcttcgttcg aggaagacca cagccacttc gagagcggct accacctgac gctggcgtac     74220
     ctgcccgctg aggaatctcg cgtccgcgcg gccaagctgc tgtacgagaa cacgccacag     74280
     cgcggcgtgg actggcgcga gcggctggag tcgttcatct ctgagacgga tcgttttttc     74340
     gacttgctcg atggggtcat gccggagatc gtctggctgg acgacagcca gaccttgacc     74400
     tacctgcatg cgacggtttc ggcgcggcgc taccgggtgg cggtgccgga acatccgttc     74460
     tacctcgatg ccttgctggc cgattccgcg ctggtcggag gtttggcccc gatgctgggt     74520
     gaccagcacc tacgggtggc gtcggtgcgc ggtttcccca cctcgacctg gccgggtctc     74580
     ctggacgact tgaaccgcct gggcttcgcc taccgctggt ccacacgctt tctctgcatg     74640
     gacaaggccg acgcggaaac ggagttgggc cgactgcgcc gccagtggtt cgccaagcgc     74700
     aaaaacgtgg tggccttgct gcgcgaaacc atcttccagc aggaaagccc gctggtcgat     74760
     accgatgcct cgaacaaggc caacgatgcc gatgccgctt tgcaggaact gggcagcgat     74820
     caagtcgcct tcggctatgt tactgccacg gtgacggtgc tcgatccaga ttcttcggtg     74880
     gccgatgaaa aactgcgtcg gattgaacgt gtcatccaag gccgcggttt cgtcacgatc     74940
     ccggaaacgc tcaatgccgt ggaggcgtgg ctgtcctcga ttccgggtaa tgcctacgcc     75000
     aacgtgcgac agcccatcat ctcgacgcta aatctggcgc acctgatgcc agtgtcggcc     75060
     gtatgggccg ggccggagcg caataaccat ttggacgggc cgccgctgat cgtgacgcgc     75120
     accgatggcg ccacgccgtt ccggctggtg acgcacatcg gcgacgtggg ccacacgctg     75180
     gtggtcgggc cgactggtat gggcaagtcg gtgctgctgg ctaccttggc gatgcagttc     75240
     cgccgctatc ccggttcgcg catctttgcc ttcgacatgg gtcgctcgat gcgcgccacc     75300
     accctgggac tgggcggcga acattacgac ctgggcaaag gatgggagga aggtggcgaa     75360
     atcgccttcc agccgctggc ccgcatcgac caggacggct accgcacctg ggccgccgaa     75420
     tggctggaag gccgcttact gcatgaaggc gcagccgtcg gcccggaaga aaaggccatg     75480
     gtctggtcgg cgctgggaag tctggcgggc gcaccggtgg agcagcgcac cctgaccggg     75540
     ctgtcggtac tgctgcaatc gaatgccttg cgccaggcct tgcagcctta cgtgctgggc     75600
     ggcgcgcacg gcaagctgct ggatgcggat tcggatcgct tgggttctgg ttccgtccag     75660
     tgcttcgaga tggaagagct gatgcatagc aaggccgccg tgctggccgt gctgggctat     75720
     ctgttcgccc gcttcgatga gcggttcgac ggcgcgccga ccttgctcat tctggacgag     75780
     gcctggctgt ttctggatga cccggtgttt gccgcgcgca tccgccagtg gctcaagacg     75840
     ctgcgcaaaa agaacgtcag tgtgatcttc gctacgcaat cgctggccga catccagaac     75900
     tcgtccatcg ccccggccat cgtggagagc tgcgccagcc gcatcttcct gccgaatccg     75960
     caggcgaccg aaccacagat tcgcacgatc tacgaaggct ttggtttgaa ccgtcgccag     76020
     atcgacatcg tggccgaggc ggttcccaaa cgcgactact actaccagtc ccggctgggc     76080
     aatcgcttgt ttgacctgga cctggggccg gtcacgctgg cctttgccgg tgcttcgaca     76140
     ccgcaggacc aacgcgacat tgatgcggta tcccgctcgg agtcgtcttc cgacttcgca     76200
     gccgcctggc tgcgccatcg cggccttgac tgggccgccg accttgttcc gtcctttcca     76260
     tccattccac aggagaacgc accatgaaaa agaccatcct cgccattgcc gccgcagcgt     76320
     tggtgaccct gatgcccgtc gcacacgcgc agtgggtcgt gatcgatccg tccaacctgg     76380
     cccagaacat catgacggcc gcgcgcacgc tggagcagat caacaaccag atcaggcagc     76440
     tccagaatca ggcgcagtcg ctgatgaacc aggcgaagaa cctcaccggt ctggacttca     76500
     gcgcgttgaa tgaactgcgt gcgtcgctgt cggcgaccaa ccagcttatc cagcaggcgc     76560
     aaggcctggc gttcaacgtg tcgcaaatgg agaccgaatt ccagcggctc taccctgatg     76620
     cgtattccgc ctccatctcg ggaactcaga tgacgaccga cgcgcgttcg cgctggcgca     76680
     actcgcttga agcgttgcgc accgcgacca aggtgcagtc gcaagccgta cagaacttcg     76740
     cctccgatga gcagacgctg acggacttgg tgaaccgcag ccagtcggcg gtcggcgctt     76800
     tgcaggccac acaggcgacc aaccagttgc tggccttgca ggcgcggcag tcgatccagg     76860
     cgcagcaact gcaaatcacg caggaccgcg ccaccgcgct ggaacaggcg cgtgtcatcg     76920
     cggcgcagga acgtgcgcgc gaagtgcgcc gccgcttcct gggtgagggc acgccgtata     76980
     cgccgcagac catcgatttc tacaggaact gaggggcatg ccatgaacga catttccgtc     77040
     atcgaccgat tcctcaatgt tttctcgcgt tacatcgatt ctggtttcgg tctgctgggc     77100
     ggcgaagttg cgttcctgac cgccacgctg gtggcaatcg acatgacact ggccggtctg     77160
     ttctgggcga tgagccatgc cagcggtggc ggcgacgaca tcatcggcaa gctcatcaag     77220
     aaggtgctgt acgtgggtgc cttcgcctac atcatcggca acttcaacct gctggccggc     77280
     atcctgttcc gatctttcgc aggcttggga ttggtggcgt cgggttcgac catcacccag     77340
     gccgagttcc tgcagccggg gcggctggcc aaggtcggca tcgatgccgg ggcgcccatc     77400
     ctggagcaga tcagcgcgat ggcgggcttc cccgaggtat tcgtgaacct cgatgccatc     77460
     acggtgatgc tgctggcctg gctggtggtg gtcatgagtt tcttcgtgct ggcggtgcag     77520
     ctcttcgtca cgctgatcga gttcaagctg accacgctcg ccggcttcgt gctggtgccg     77580
     ttcgcactgt ggaacaagac ctcgtttctc gctgaaaagg tgttgggcaa cgtggtgtcg     77640
     tcaggcatca aggtgctggt gctggcggtc atcgtaggga ttggcacggg gttgtttgcc     77700
     gaattccagg tgacgccgga tgaaccctcc atcgaccacg cactgaccat catgttggct     77760
     gcactggcga tgctgggtct tgggatcttc gggccaggca tcgcgactgg gctggtatct     77820
     ggggcaccgc agttgggtgc aggtgctgtt gccggaaccg cattgggtgt cgcgggagca     77880
     gcggttgccg tgggtgctgc cgccaccggc gtgggcggtg cggtggctgc cggtgcgcgt     77940
     atggcgccgg gtgccgcaaa gatggccgcg agcggtgccc gctcgatggc ctcgaccgcc     78000
     agcagcgcga agtccgcgtt ccaggccggc tctgccggtg caggtggtgg actcaagggt     78060
     gcggcagcag gattgggcaa cgtcgccaag acgggcgcgc aatcggtggg gcagaaggtc     78120
     gctgccggag ccaagtcgat gaaggaccgg actgcggcgg ccatcaagcc ggatgcctcg     78180
     gcatccggga ctggcgctgg tgccggagct ggctcggccg ctcaaggcgg caacgatgcc     78240
     gcacccacag atacccagca acccgcgtgg gccaagagcc tgcatcgccg ccagcagatc     78300
     agccatgccg cttcgaccgt cgcccacacg ctgcgcggtg gagacggcgg cggctcgggc     78360
     agtagcccca gcctgcgcga cccctcggat tcctaaggag aacatctcat gcgattcaaa     78420
     cgctcattgg tgcggtatgc ggacacgccg cagcctgcca ccccgtacca atccgccgaa     78480
     caggtctggg acgaccgtat cggttcatct cgcgtgcagg caaagaactg gcggttgatg     78540
     gctttcggtt gcctggtgct ggccttgctg atggctggcg gtttggtctg gcgctcggcg     78600
     cagtccatcg tcacaccctt tgtggtggag gtggacagcg gcgggcaggt gcgcgctgtc     78660
     ggtgaagcgg ccacgcccta caagccgaac gatgcgcaga cggcccatca cttggggcgc     78720
     ttcgtcacgc tggtgcgctc gctgtccatt gaccccatcg tcgtgcggca gaactggctg     78780
     gatgcctatg actacaccac cgaccggggt gctgcggtac tcaacgacta cgcacgcacc     78840
     aacgatccct ttgcccgcat tggcaaagag tcggtgacgg tgcagatcac cagcatcgtg     78900
     cgcgccagcg aggcatcgtt caacgtgcgt tggaccgagc gccgctatgt caacggcgca     78960
     gctgctggac tggagcgctg gaccgctgtt gtgtccatcg tccttcaaac gccgcgcacc     79020
     gaggaacggc tgcgccgcaa tccgctgggc atctacgtca atgggttgtc gtggagccgt     79080
     gaactcgatt cttccgaagg agccaaacca tgaaaccgtc tttgcgcatt tacgtatttc     79140
     tgtctctact ggtcgccaca tcaatgaccc tctcgggctg cgccacgccg ggcaagccgc     79200
     cgccgaccat cacgctcgat gagccggttg cggcgcagcc gctacccgag ttgcccaagc     79260
     ccgtcgaagt ggtcgcggtt ccgcagcctt tgccattacc cgagcagttg aagctgttgc     79320
     cggatgagct ggaggccaag acggcacctg aatcggccga cgagaaggta cgcgttacgc     79380
     gggccaatca ggaggcccgc attgcaccga cgcgagaggg ctacgtcaat gcgatccagg     79440
     tctggccgtt cactgatggc gcgctgtacc aagtctatgc cagtcctggc cgggtgacgg     79500
     tggtttcgct ccaacccggc gaggaactgg tgacggttgc cgctggtgac accgtgcgct     79560
     ggatcgtggg cgacacgtcc agcggcgcgg gggccagtct gcgcgtgagc gttctggtca     79620
     agcccacgcg cagcggtctc aaaaccaatc tggtcgtgac caccaaccgg cgcacctacc     79680
     tgattgagct gacctcgacc gagaaggcat ggatggcatc cgtgtcctgg gactatccga     79740
     aggaccgcat gctggccttg cagcgccagg cgcaggcggc acagattgcc gcaccggtcg     79800
     atgcgggcct gtcgttggag aaaatccgtt tccgctacgc catcacgggc agcaatccac     79860
     cctggaagcc gctgcgcgcc tttgacgatg gcgagaaggt ctatatccag ttccctggcg     79920
     gcattgcgca gggcgagcta ccaccgctgt tcgtcatcgg cgcgcagggg gacggccaac     79980
     tcgtgaacta ccgtttccgt tcgccgtact acatcgtaga ccggctgttc ggcgcggccg     80040
     aactgcgcct gggcgctgac aaaggtgacg tggtgcggat cgagcgcacg gatgggactg     80100
     tgagcgggac gcggaggaac tgaccatgag ccaagcgaac aatgcccctg ataccccaga     80160
     ttccgcagtg ccagacgtgc cgcccaaagt ggccccggaa aacgtgacgc tgcgctccca     80220
     gccgcgtcca gttacgcgcc tgaaccgacg catgctggcc gtcctcgctg gagggctggc     80280
     gaccgccgta ctcggtggca ctatctggtc gttgcaatca acgcagcgcc gtggcgctgg     80340
     cgaccagaag gagttgtaca acgttgatcg cgtgtcgcgc tcggaagggc ttgatcgact     80400
     gccagcggac tattccaagc tgccgccgac cctgccagcc ccagtgccac aactcggtgc     80460
     gccgctgcca ggcgacttgg gtggcccgat ccacaaggcc gagcaacagg cgcagggtta     80520
     tggctatcag cagcccggcc atgatccggc cgaggttgag cgcctggcgc gtttgaagca     80580
     ggccgaggaa gcggcggcgt cttcagtgtt cttccgttcg ggtggtcaaa aggtggccgc     80640
     agccgcgcag ccgcaggcct tgcctgtggc caccgcgttg gccgcgaatg ccgcctttga     80700
     tccgatggcc gctggcccgg catcgactgc cgcgcagtcg gctgacccca ctgcggtgca     80760
     gaaccggcaa gaccagaagg aggcgtttct gtccaaagcc ggttctacgg aaacccgtaa     80820
     ttccggctcc ctgcaaatgt ccgcatcgcc gtatcaagtc atggcgggca cggtgatcgc     80880
     cgccgcgctg gtcacgggca tcaagtccga cctgccgggc gatgtgatcg ccacggtgac     80940
     ggagccggtc tacgacacgg ccaccggcaa gtacgtgctg atcccgcagg gctcgcgcct     81000
     gctgggcaag tacaacagcc aggtgagtta tggacagagc cgcgtgcagg tggtgtggaa     81060
     tcgggtcatc ctgccggata cgtcctcgtt ccagctcgac aagctgatcg gtaccgatcc     81120
     ggcgggctat gcgggtctgg aagatggtgt ggactggcat tgggatcgcg tctttgccgg     81180
     tgctgcgctg acgaccttat tgggcatcgg tgccgagctg gccgcaccgg agaatcgcaa     81240
     tggcggcgat cgcgtaatca tcgccggacg cgacagcctg aaggactctg taaaccaagc     81300
     gggccaagag atgacccggc gaaatatgaa catgcagccg acgctaaccg agcgacccgg     81360
     cttgccggtg cgcgtcatcg tcaaccggga tctggtgctg cgaccgtacc aaccactttt     81420
     ctttgtgcgt gggggattgc gatgagcacg cctacaaaga aactgagact cgggccgctg     81480
     ccatccatta ccagcaccaa gctgaccttc acatgcccgg ccagcttgaa ggccgacctc     81540
     gaccactatg cggcgctgca cgcccaggcc tacggcgaaa ccgtggatgc ggtgacgttg     81600
     attccgcaca tgctggaagc gttcatggct ggagatcggg gattcaagaa aaggaacaca     81660
     tcaaagccga cgttgcagaa gtcaccccag cgagaggcaa cgcctccgta ggcaaagtca     81720
     cagccaagca cccttgaacg cgcagtctcc gaactgcgcg ttcgcatttt ggggatcagc     81780
     cttatatatt gctcacatat gattacggag gacgcgaccg acgcctgcat ccatgttgcc     81840
     cgctctggca cgccaagacc tgcaaccgca aggctcctat gtggccccca gcctgcaaac     81900
     ctacagcggg ctgaagtcct caggaaatac cctaaactat tgctttatat agggttttcg     81960
     cgttatgccc ggcatcaaaa aaggcttgac agcggacatt ttttatcgct atgaaatctt     82020
     tcaagcataa aaccaaaaaa actgaattca agattttttt gaagctcgca gcacttttca     82080
     acattatggt gctgtggatt tatttaagcc tagcttgaaa tgcaaaacat gcattttgta     82140
     ctggatgcgc aaccgtttgt attaccaggt gattaacaga ctggcaatgt gatatgtagc     82200
     gggagtgcca agctggagct aatgacacct caggcaaaaa gcaacaagaa gcctttaaat     82260
     gctaagacgt tttggggttt ggtccgtatt tattttctcc tggctggcta tccatgcata     82320
     gcatgaacca gcccaagaat ggaacaatta accgccatcc gctacggcca atatcatgca     82380
     ttcgccgaac tccaattgcc acgctaggaa taagaatagc caacgaaaaa ccaatgtttg     82440
     caattcctgc gagatctaca cccaaatgca gaaccgattg aattatggca aggattaatc     82500
     ccatgaaaaa tgaaataagt atgacaaaaa gcaagaacat ccagtaggcc ttacgcctcg     82560
     ctctcccctg aaatactgca tatttgatca ttgcatctaa aaaccagatc atgatctacc     82620
     ctttttaaaa ttaaaatatt cttaactgaa agactaaatc ggcagtggtc caattactga     82680
     aagcaacgct ttttccgaag ctgtcaaaac cacttttatt tcttcaggcg aaaggccatt     82740
     ttgtgacaac gctacgtgtg caatagcagg aggcattcca taagccagtt caattccaaa     82800
     agcgtcggca aaggtatgca gtggactttt ccaagatgaa atcagcacat ccatcgcatc     82860
     gttgactgcg tccgtaacgc acaggtaaac ctgcaccgca tcaatcgtat cgatgagacg     82920
     ctgggattta aggcctagcc atatggccat cgctttgctc atgacaatgc ggccaatctt     82980
     gaacagatgc acccacaaca aggcatgcgt ggcatcaagg ttcatcggta gcttgacgat     83040
     aaaggaagtc tggccatcgg caggcataaa accatcccat agcatgcagc gcaaaccagt     83100
     cacatgaata aatttatgca tatttattat ttattattta ttaatttcaa gaatcgcttt     83160
     ttgttgacct aaattcgaat taatgcgtgc attctcaaaa tcgaaaaaat cataatcaaa     83220
     ctcctgttgc tgcgcatttc tgccaacaag cgagcaagaa tcatcttcat ccaaatcaac     83280
     ttcaaatact ggctctacaa atggtttttg cgacctgcaa atcatggtaa ctgaaaggac     83340
     caaaaaaact atacctatga tcaaactgtg gatgggaaat ttcaaaaaca ttgcccctac     83400
     aaccaggaca taagacacat aaaataatcc cataggatat tttttgatac ttttatccac     83460
     tggctgcggt tctttttccg aagtcacttt ttggtcatga atcccaatcg gaaaattggt     83520
     tttttgtcgc gtaatcgggg gcgatagact tgagcattgg tcgtcaagtt gtcgagaaag     83580
     tacatgcatg gtggtttagt ggttttgcgt taaacgcttg agttcaatct aattcccaaa     83640
     gagatacttc agattactca tcaaaaacct gcaggcaaat tcaaatgaac attgaaaata     83700
     tgcgtcaatc aaattaagtg atacccgcaa gcctcgagcg cctgatggac agtgctggcg     83760
     ctgggtcagc agacttcgac agggcggtgc gtgtgattac aacgtccaag gacagtcagc     83820
     ccaaagacac tttgtacgga ctcagctgac caggctcggc cagttatagg ccggattgcg     83880
     gcaaaaaaag tttttcttag cgtttattct gctgcgacaa ctaagcccca accttgcagc     83940
     ttttccataa tggcatgctg caaaggcgaa aaaagtgaag catcgacgtt gcgaccgttt     84000
     ttcgtatttt gcgtaagcac aacatggccc cctacgccat ctttgatcac gtagtgggta     84060
     tcaccaaagc gcccacttga atacgtgacc ctgaacttgc tgctaagggc tcgtgcgatc     84120
     cagccatggg taatttcagc ggcaatgggc cgcattcgat agtttgtttc catgattctt     84180
     tttttacagc aaagcgctgt tcaaaccaag atatcactca ctctggatca tgcaaacatg     84240
     cttgatgcgc tcagggacag ggaacctgca cgtcctccac tacgtcgttt ttctgggcaa     84300
     atagagtgcc tttcccatcg atcgttacgt gcgtatagcc attgtcgaaa acagtgcgaa     84360
     aaatgcatgt gccatcgggc cttgtgtaca acccttcgcc ctggcggggg ttgaaggcct     84420
     tacgaaagtg actttcatgc ggctgtggac cgctttcttg ttcactaaca aggatcaccg     84480
     aattttcctc atcaccggcc tgtgcggtaa ggctggagag cagtagggcg gcgaaaatga     84540
     actgatattt catgagcagc gtgaaaagtt ggaatcacgc aagactaaac ctgtcgtgca     84600
     ccctcgctta ttgaaatgtc gctgctgaat ggcgtcattt tgacttgact cgctagcgcg     84660
     aagcaagccc ggtacgctta cgattttcta cacaatttag attgcgggca tcgtctttaa     84720
     agcttatgtt ttaagatgaa taaaagtggt tattatttaa cttaacagag gtaatcctta     84780
     tgtgcaacga gtcgctcggc atcttcacaa cagccgttgt ttttggaatt tctacggttg     84840
     gttatctagg cattgtcatt cataaaatac tcatcaatcg ccataagcga cagcagttag     84900
     ctgcttgccc tatgcctatc taaattcgcc aactgctttt atctcccatt tagacgctgc     84960
     caaatacatt tccgtaccta aaggcattct ggttcgacat tcaaccccca cttatgcggg     85020
     gaatactggt gctcatcgtc aatgcgacgt aattccttca accccgccac gcggggaata     85080
     ccaaagttgg ctgctaattt ttgaaatctt ccttcttcaa cccccgccat gcggggattg     85140
     aagctaggtg gacatggtct gcgggtttca agagcggtat tccccgctca agccgggggc     85200
     ggtgcggcct aattaggtcg gcaacggcat caaataagaa cgaaaattga gtcacttttg     85260
     actgtgaaaa acttgttaaa accgtgtaac ctattggtgt tggccaagat cgcatcagcc     85320
     gtcttggttc gacctagttt caatagccgc tgacttttca gcatgaattt catcaccaac     85380
     ccgcagggat aacatccttg tgggtgtttc cttgcttttt caaggaaacg taatggcaca     85440
     tccaaaaaca gctcaatcag tgagcaaaaa acctgtccgg gttatcagtc cacgggtgac     85500
     tattttcagg ccaggattta cagaggttga cgaatggcgt tcagcacttc ccaacgaagc     85560
     actgcatgtc ttctcaaact ttacaggcag ccttgatgct cctgaagtca tgcccgccgg     85620
     tggcatgagg aaatccgcct acggcggtaa aacgcttttt gctttccgtt cgctgtaaag     85680
     ctaaatacat ggaactccat agcaacgagt tgagggatta catcctacgt gctccaaagc     85740
     gctggacctt caatggctgc gaaatggtga ataactctga agcctgctac aggtggctgg     85800
     agcagctatg caggggtact ctcgatcaac gtatcaaccg cagggcagga ttggttgaga     85860
     agtggtttcc ttactggcgc acgcccacca tgaagtcaat caagcggcat catgaccgtg     85920
     agcatattaa gaaatacggt tacttcatca atcggtaatt ttcaaaccag aacgcggcct     85980
     caaggtcgcg ctcccctcaa aactaacttt ttcaagcgaa gccgcttctg aaagtttgct     86040
     ttagtgcggg ctgtgaattt caactccgct ggatctccag cattcaaatt cacatttcaa     86100
     ggatcaagat gcaagaaacc aaaacagttt tgtctgaata cacacagatg tcgccattca     86160
     tcaaaagcga cacgaaggta tgctgggatt gccttcgagc aaaaccattg agggaattaa     86220
     aaccctacaa ccctgtgcca ggcctcttgg tgtggcaatg cggatgcggg caaagcgcat     86280
     taccgccgtt catgaccgta gccgggggca aggtcatcat ctgtgaggac ctcacgggtg     86340
     attcgcttcc tgacgagtgg actggagtat gtgtcagcgg aaacgatgcc aagtcctttt     86400
     ggtatatcgg gcacgactta ggtgaacgga gctttaataa gctgccactg gaaatcgtga     86460
     cgatcaaggg agcggtagcg tatgtcgaga ataatgctgc ctgcaagaac actctggcaa     86520
     tgacagacgc ggccatagca gtctggaaag cggttgaatg cgctcaggcc gttgtttgtg     86580
     aaagtcttcc ggaaaactta ccgaaagact ggcttgtcat gaatgcgccc aggcctatcc     86640
     ttggcgacca gatcgctcag ggtgcgttca tgcatggtgt ttactacgca gcgattaacc     86700
     caagcgttga gttcgcacag gacctggttc ggcgtaattt gataaacgat gccagagttg     86760
     tctttgtggc cagcaaggta acacaggaag cgatggcgtt ggaaaccatt tcgccggaat     86820
     accaaaatgc gtaccgcaaa atgcccgacc acaatcgcgc taacgctatc agctcgtttg     86880
     tgcttaagct caaccgtggt aagacttatt gcgaaattaa ggaacttgcc cggcgtgctt     86940
     acgttgcaat gcaggaagaa gaactactca aggtggtacc gactgcctga gtcaatatat     87000
     ccatcaaaac gaaaaagcgg cccaggccgc tttttcgttc ctgattgaaa actgattttc     87060
     caaagcgtct gcgtttcgga aagttcgttt aatcacgttc acttgaagtt ttctagcgct     87120
     ggttttccag catcaacttc aacgaaagaa aatgatgagc aatcaaacac aattcaattc     87180
     tccaaagtct ggagaagtaa aagtaatcac tgaaaaacaa taccaccgcc acttaggtgc     87240
     tctgcctcct tgcaagtggg aaagggtagc tccgaactgt tcggtatttc acatgagcga     87300
     actgattgac atggatatag ctcgttggat cattaagatt catgacgatt actacacctt     87360
     gttcgctagt tacgagctca tgccggtaca agcttatgaa cttgtcaagt ccagcctcca     87420
     gattccaacg gaggcaatat gaacattcaa aacatcaagc gcaattcaat gggaacgttg     87480
     gacttcgatg gaaaattcga tggaatgcgc aaaccccaag atttcattac ttatcccatc     87540
     ggtgccaatg acgacaaaac tcgggtaaag atccaatccg atacccgaat tggattcatt     87600
     aatcttacta atggtcatgt gcttatgtcg ccatctatca agggaggcgc gtacaaccat     87660
     cacctgagtc agataaacga tgttggcaag ctcaaccagg aagaactttt cagcctgaaa     87720
     gctcaactcc tggattcagc cagcgccaaa gcaggaacca acggcatcgt gaccaccgac     87780
     aacagtggtg ctgctgaagt ctttgccaaa cagccataaa gtaactcaac cctcgtaggg     87840
     cagacaccaa ggggtgctgc ctaacgactt caaaatacat gaaagctcaa catgaaaacg     87900
     atgactgaag ctgaatggga tgctacgcat gatgatttca agaaattatg gactgcagag     87960
     cgaactgact ggaccgactg ggaaagagtc agaaaccgct acatgggcaa aaggaccgtc     88020
     atgtcggacg gcgttctgct ggtagaagga atgggcttgg taattacacc caacccgccc     88080
     aagtcaaaag acgacaaggt ttacctgcgt gacattggac gtgcgcttga gaaaaatatc     88140
     tatgcgcaga ctgacacctc cctccattgg ttggcagtca tcggcgaaga cagcattcag     88200
     ccagtaccga caaaagagtg gtattacaac gatgccctca ttcaagtggg cgttgtcaat     88260
     ggtaatagcg aagggagttt gatctacgtt caggctcaga aaaacaggta ccagcctgaa     88320
     ctgctggtac ctttgttcag gatcaaatta ctttgctctc cgatggcggc atttgctgaa     88380
     gcgaaaattg tctatgaatt ctttgaatcc caagaattca tggatatggt cagccacaca     88440
     taaaaattgt gctgttaaag ggcagggcgc gaggtaacac ctcgcgccct ggcttttcca     88500
     ctcagccatg aaaagctgat ttaccaaagc atattctgct ttgttaaatt tgcccggcca     88560
     ggcaatcaag ggttatccag cctgcaattg cagcacgata aataacccac ggggagcaat     88620
     tctccggata gcttcttgtg atttcaaaac cactggaagt tacaatgcaa caaaaaatat     88680
     tcactacgtt cagcctcttc caagatgagg aggccgatga tttgaaatca gagttgattc     88740
     ggatcaatga gttaattgcg cggggcgcta ttttcgttgt caatcattca gggggaaagg     88800
     attctcaggc gatgtttcac ttcattactg atctggttcc gagaagccag atttttgtag     88860
     tgcatgccga actcccagaa gttgaatggg aaggggtttt ggaacacatc caatcaacag     88920
     tgctgggaat gacggtacac acctgccgtt ctcgtcgaat gttactggaa atgatccgtg     88980
     aaaggggaat gtttccatca ccctccattc gtcaatgcac gagtgatcta aaaaggggac     89040
     caattgaaag aacgatacga agaaccggtc ataagttgat cgtcaattgc ataggactga     89100
     gatcggatga gtcaagtaac cgtgccaagc tcgctacgtt caagtattct gaaaagaaca     89160
     gcaagaatga ccgggaatgg tatgactggc tgcccatcca tcactggacc gttgaagccg     89220
     tttttgcaaa aatcaaagct accggacaag tacctcattg ggcatattcc gtagggatgt     89280
     ctaggctttc ctgtgttttt tgcatcatgg catcaacaaa ggatctgacc attgctgcgc     89340
     aacacaatcc gaaactctac agcacctatg tagggctaga gcacacaaca ggacaagtca     89400
     tgatgatgcc ctcaaaaagc aaaggcagac aaaccctgga gcagataact ggcgttatcg     89460
     ctgaaccgga agccgagctc gtaccggcct aatcaagtat tgaaaacgaa actttaaaac     89520
     ctgaacggcc aagtgcaacc tctcaggttg cacttggctg actagccaat gctttcccat     89580
     gaggctgttg ggcttcatag gaaagctacg tgcttgcgtc tttttaacta cctccactga     89640
     ggaatgaatc gacgctatga aaacgaaaat tcaagtaggc tttcacggat ggagagccag     89700
     cacgcaagtg tcactaggca gcggccgtgt actgaacatc tcaacgggta aatgcacagc     89760
     aggaagcgtc agaactactg cacttgtcag ccatatggaa ggcatgtttg atgtttcatc     89820
     ttcaaatgac tttctgatga ttctttcgca aacccgatac tcactgtgct cgaagaaagc     89880
     agttcgcaca caacacgaaa cggcgctaaa aaatctcaag agcgttaagg cccaggcact     89940
     cgctcattac acgatgagtt aaatctggaa tggccatgat caacatggcc gctttttaat     90000
     acccagccta cgggccaaac ctccctcgag aggctttcta ttggcttgac acatcagacc     90060
     aacagaaagc ctttggctta atccttttta accactcttt attgagtatg aaaggtaatt     90120
     tttatgagca gtgaatatat ttatgaccgc gctgcggtcc gcttgaaggg tgttcgcttt     90180
     gagtacatag cactttatat tctgagccac tccaacaacg ttgacccata tattcccaac     90240
     tggaatctct acggcttttc aaaattggaa gatgctcttg atattccact gaagtattgc     90300
     tactactgtg atgatgggat tacgcgcggc aagaaaggtc aaatgatcag tggtgaattt     90360
     gacattaata aatggcgcgt ggcaatcgaa agagcgccga tcatcaagga tgagttcagg     90420
     ctgcaattga aattttgtga tgaaaaacat agtgaatcgc atcctctgct taaacttgaa     90480
     aaaattaaag catttgcggt tcagttagat ttgcatttgg agatcgaaag cattctaggg     90540
     cactcggaag ctgcatggct tgtgttggac ctgaacaatc ctgaacatgt tgatttggcc     90600
     tgggctacaa ctcgggacat gagcgatgct gaatccaatg attcctataa aaggctgatg     90660
     ctgcctttta attttttaca acgtcaagtt gcagaaaggt tttttggcca tcttgggtat     90720
     tgtgacgaga agagagcgtc agccacagtg ctacggaaac agtccaactt cgatctccca     90780
     gaaacaatct acaaatttga attccctgtg gatgatcaac ccgtttacaa ggatgtccgg     90840
     tttgttgtgg tcaattggct gggcaggatt ttgagctgca gtccagatcg ctggttttgc     90900
     ctgaaattga tcgagctgga aaagaagcat ctgggaacgg ctgagtctgc gtacatcaaa     90960
     tttaagaaac acatgaaagc tctccaagtc acttctcacg aagggatgac gattgaagtc     91020
     atggcatcct tatccggcgc acagcgtgca gaaatgacgc agtgggacat ggacaaacgc     91080
     gatcgactgt ttgcccggtt gcataaaccg ggcatgtccg ccatcttcac cgaagtagtt     91140
     aaggaccata tccaggcaat ggcattggcg ccatacattg agtgcaatct tgcgatttca     91200
     gaaatgaaaa ccgccaaaaa gcctcaagtc gagcaaatga ctttcgacat ctaaagtttt     91260
     attttttcaa cccaaaaagc cacttttgag aagtggcttt tttatttaaa agaaggtttt     91320
     atgcgaatca ttcaaggttt cccttttcgt actgacggtg gagtaaatac gcaactggaa     91380
     ggcggtcaat gcatcattgg tgcagacggt tcgacctgct tgggagaact tgttgccgat     91440
     gaggagttca cttcaaaggt gatcaccgcg ttgaaccagc atgagaagct ggaagttcca     91500
     cgattcatcc tgctgagtat tttggaaatg gctgaaagca attaccaaga tgtatctaca     91560
     ggcttggacg atggcacata cacagccatt gaaaacccaa acttcattgt gcacggtcaa     91620
     gcccttgatt acttcaaagg cttgctcaac agtcacgtga agatagctgc aatcgcagct     91680
     tagccccaca taagcacttg tctgaaacca ccttggtggt tttttattaa cgccctatcg     91740
     gcaaagtaaa tgaaaaatga cttctacacg tatgtttgaa gtgatcattg ctggctccaa     91800
     cggccagctg ccaattgcat atcccaatag caatggcctg gatgcgctaa aagtgatgcg     91860
     cgctctttct actcagggtt tcagatcgac agccgaaacc accgcattag gtattacaga     91920
     acggttgggc cttgcggata tggaggccat ctatgctgac cagttggatt cggccttaga     91980
     tgacgtgcaa tgcctggttg aacgcattac gcaagacata gctcggcttc gtgacatcac     92040
     cattgatccg atgaatatcg tttttggcga caaccctgct ttcgagatcc gtccagccag     92100
     tgatggaaat ttatttaatg ttttaaacaa ggagcgcggc aacgtcagcg ttcattacat     92160
     tcatgagggt gtgaaatgcg atgttttcgc tcaagactca ctagagccga ttgatactgt     92220
     ttcggtccaa accactgagc ttgtgaaact gatggaaagc aaaatcatta cctgactccg     92280
     cattaaagcg tagtcatcgg tcttagaaaa ttaccgcccc tcgattgggg tgtttttatt     92340
     ggtgaaagca tatgaacaca agaaaagcac acggaattcc aagtcaaatc aacagctttg     92400
     tttcagataa ggaaacagaa atgaccgggt atggacggca caaccgcctg ctcgtttttc     92460
     actcaaatga aaaacgagca ctcactttgc gcgaggacct ttccaagggt ctcgcaatga     92520
     gcaccgagga agaccgaatc aaggttctca atggttttca acgcatgcat ccattaggcg     92580
     caaggcctgt cagctctggg ccttcgattc cataccaaag cgcttttggt tcttctgtcg     92640
     agcacgtcta tgcctactaa gcccggacgc attttttaaa tcaaatctat ggccttaacc     92700
     tggccggaaa gaaaaggtca atggcaaaaa ttgtaaacct gcaagtgctc atcgatggcg     92760
     ataacgatga agagataaca gaatttttga gagtggctct catgactgct cgacccgacg     92820
     gttcaagcac aattgaaatt ctcgacttcc atgtcgcctc tatcgatcag ccaacagatg     92880
     aactgaccga cagcatcgtc aatgaaactt atctaactgg ccaggcattc gatagctggc     92940
     tcatctactc agcgtctgaa gcgaaggcga caggcgaacc aaacgacggc tactggtcat     93000
     atcagtacgg ctggacctct cgggatctgg ccaccaggtt tgaacctgtt gccagggaca     93060
     tgccacattc tgccggcaac gatgcctgca tgatcatcga catttgaaaa ctcccccaca     93120
     ctggcttgtt cggtgcgggg ggattttttt tgcctgtact tgttgaaatg ctgcatgccg     93180
     aagcgcttaa atatttggca gtactatatg ctttttaatc ttccggagaa ttaaatggaa     93240
     aatccaatag atgaagtcgt caagctcaat caacaaattg cagagttgca aaaaaagtcc     93300
     gaggaactga aaaaaaagaa tcggccggtg gttgttgctg agttgcgcga acgcatggca     93360
     gcttacggca tcactgccca agaactgacg cgtccagttc caaaggcgcg aatgctgaag     93420
     gaagattttg cgacacccat caaagctgtc aagggcaaga tcaaatcttc gccactgcca     93480
     gccaagttcc gcagccccga tggcaagaat gagtggagcg gtcgcggaat ggcaccgaag     93540
     tggatgaaca ccctgattga acaaggccac agccgggacg agttcctgat ttcaaaagac     93600
     gcgccagcac aagataaggc agcggaatcc gctaaagcct aaatccagag cttggcgtag     93660
     caatacacca agctggctga ctacgggcaa gcggccagtc cgtcacgccg gcaccgggtt     93720
     gcttgggctt ctatcgaatg cgtccttagc tagcagcact gttaggtgct tgctgtcttt     93780
     gtcgagaggg aagacaccga acggtgtgca ttaacgcagc agcaggactt aaaggtggcc     93840
     tttcaccacg gggtaaaact cagcgctaat actgactgcg gcaaaaaaca ttctcgctcg     93900
     cggattgacg agtctcgcag gaggagcctt agcatgaaga ccgggaatca gaatccccgg     93960
     ccttcaggcc ggggagcagt caacaagtac agctgttttt tcggtccaaa aaggcctaga     94020
     aaaaccggac aaaactacat ccagcggcta cgatacaggc actacacaac aacctggatt     94080
     cagtttaaac agaactctcg ctaccgcatg atgctgactt tttaatgcat ccatctattt     94140
     agcgcgatgc taacgtgtat agcgaatgtc aaaatggaag catttttcgt aatatatttg     94200
     atcggcggcg cagcaggcgt gtttttcttg atccattgaa tccaaaggtt caggcatgga     94260
     ggcgcacgag gtgctgccgg gggtacaccg ggtggcgtct ctcgtaaaaa ggtggctgct     94320
     cggcacccac cagggctctt tcagtgcgga tcatatgcaa gcctacttgg atgaattcgc     94380
     ctttcgattt aaccgccgag ggtcgcgagc caggggaaag ctcttctacc gactccttga     94440
     acaatcggta gccatgatcc catctccttt cgggacctcg tcgccaaccc aaaccccaca     94500
     aaagcggggc aagtccgacc tgagccaccc cgcactggca ggactgcgcc tgcgtcgctc     94560
     gacatggaaa tccacgtcag cccatggcgc cgctgaatta ccgcatttat ctggataccc     94620
     cgctaactta atggcattga catgctcctc acccctgtca tcgagcaact ttagccttcg     94680
     aaaagttgca catcgcgtta attaggtcgc ttactgagcc gtagaaggac tatgccgagg     94740
     tacccagggt cattcttttc acaagaagtt gtgtttgctg ctctgagacc ttgagcattt     94800
     tttcttgatc gaaaatgcgt tttggtactt ctgagaaaac aaagtcacgc aagacatacc     94860
     aaaaattgat cactgccaac tcaatttcct gctgctcatt aaggcgttca gacacaacag     94920
     gcctgcgctt ccagggtctc gcccgcatcc acatcgcaat gtagccgttg gcattcaggg     94980
     gaaagttcga gacttcgtcc tttcgactcc attggacaga gcagtccatg ttggaatcaa     95040
     atccaaaaag tacgtctgat gcacccaaaa attccagaaa ctctttgata tcgtcctgcg     95100
     ctgcgaatga actcaccatg gtctcgtaag gaagcaccat tgaaaaaaca cctttctgcc     95160
     tttaagcaac atcagtcgca acacgctggt gcgactgaga tcgccattag acctgaaccc     95220
     gaagcatggc gtgctgcctt tttctgaagt tggaatcgat tgcagtttgc gatatgttca     95280
     ttcagggtca gtacaccaga cttttctttg atgtagtcag ccagaagtgc cacggtttcc     95340
     ctatcaagct tttggtacat tttgcttgcc ttggtcgcgg aattgcacaa tctgggaata     95400
     tacgaaatat cctgcgcagt caggatggta gcggggaggg tgggagatat ttgcacatcc     95460
     gtgccaggca atacaacata gtatttgatt gcaattctgg catccagata gcccttcatg     95520
     gcctgaaatt tttcagagcc ttgtgcaacg ggatcattca catgcttacg atcgccgtta     95580
     gcttgttcga gataccactg atgcccagcc tcaactttct cacggcctac caggcattga     95640
     ttccagccct tcacctcgaa caggtagacg ccggcattac aaatcacgat gcaatcgtat     95700
     tcggcagttg caagcctggc gccttctgga agcggtagga caacgccggt taaaactcga     95760
     acgtcatcga acgtgcgctt gaatgcggtg gtgagatagt ttgcagcttg agcttctgaa     95820
     ttgttgatgc acatgatttg atttctatgg atagattgga atgaaatcat ggtgacactg     95880
     attggtcatt gtgcaatcag gaaaacggcc aaataaggct gcattatttg tttttttgaa     95940
     agcgcaccga aaagtgccgc ctttcgccca tcttccgcgc tcgtgagttg ggaagatgca     96000
     cgcatgcaca acagggaaca catagaaggc caaatcgcgc tttatcttca tccgatcaag     96060
     tccatccttg aagacgcaga agtctctgaa atcatggtca cggccgatgg ctgcgtttgg     96120
     gtagaaaaaa gggggaacat tgaaaactcc ggcgtcgttc tcaccgagga aaaaagaaag     96180
     ctgaccctca tcaatgtggc caaagcggtc ggcagggaca tgctcgcaaa caccgccaac     96240
     gccatcgtca gtacctccgt gggcgggctg cgctttgccg gggcgctcat gcccatcgac     96300
     gaacgcggca caacgctttg catcagaaag catttagacc ctgacaaacg gcccagtctg     96360
     gagcagctcg tggaatggaa gatgctcact gcggagcagg ccgagctatt ggtccgcctg     96420
     atcatcgttg agaaaaagaa cgcagtgttt ctcgggccga cctccggagg aaaaaccact     96480
     ttagccaatg ccgtgcttgg aaagattccc agttacgaac ggatcggttc gatagaagac     96540
     gcccacgagc tggcgatcag ggtagccaac aaggattgct acctcaccaa cccgcagatt     96600
     ggcatcacgt caagggtctt gattcagcac gccatgcgct cacggtacga ccggctgatt     96660
     cttggcgagt ccaggggcga ggacacgttc gatctgatcc gcgcattgtc cagcggacac     96720
     aacggctcga tcaccaccat ccatggctca agcgcaaggg aaggcttggg aacgctggaa     96780
     atgctgtacc aaatgagtgt tccagaggga tcgaatatcc ctgtggaaac cgccagaggc     96840
     tatatcgccg ctgccatcaa tcttttgatc tataccgagc gacgctatga accagcagac     96900
     ggcggtgtat ttaaaagtgt tcgaagtgtc aaagaaatag ctttagttaa aggaataaaa     96960
     aatggtgaat atgaaatcga ttacctctaa gcgcctcaaa accgctgcgg ttattgcctt     97020
     ggcattggtg gcaggaccag tctttgcgca atcggcagat accacggggc tgtgcaacct     97080
     tgtcagcttt atcaaatcga tcatcggcac agtggccgtg ctggcaatac ttttgtatgt     97140
     gatcaacagt ttcttcggta aaagcgccct gattggcgag atcatcgaaa aggtgttgat     97200
     tggatgcgtg gttgccgttg gcgcaacatt cctggtcacc aaaaccggtc tggttgtcag     97260
     ctgctcatca ggtctgatct aagcctgctt atatggccag tgtcgactac ccggtacttc     97320
     gccgccctcg gttaaggggt ggaatcggtg gaaacaccgc agtgttgata tgggcaatta     97380
     cagggatggt tggactcgtc attgggttgc ccgagggttt attcgtcatc attcccgcgc     97440
     tgctgataca gggcgtcatg ctttgggcat tcagaactga ccataaggtg atggaagttt     97500
     atgcgttgta tgccactttg cctgatgaat tcgaagcggg cattccggca gccgattcca     97560
     agaaatcgtc acgccctcaa tttttcggta aaggggtgtc ccaataatgg tcattgctct     97620
     taaaaaagaa gcgtcggaat caaagtcctc gcattcggaa ttgctgccct ggctctgcca     97680
     tgcatcaccc gactggattt tatgcaagga cggctctttg ctatccggga tggagtaccg     97740
     gtgccttgat attgacaata tctccgagca cacgctcaaa aaagcgttgc tcgaacttca     97800
     ggcgtcactc aaaacgcttg atgagcggtt ctatgtctgg tggaccatcg ataagaaaag     97860
     ggacagcacc cggcacaaaa gcaactttcc caatgatgcc gctcagaaac ttgacgattt     97920
     gataggcaaa gccctggacg ccgggaagat gttcaacatt acctatcgca tgtacatcct     97980
     gtacacgggc gagacgggca tgtacgcata catggacaac gtcagaaggc tggtcaacga     98040
     agagaatacc tctgtcatca ctgcgatgct caagagcctt aacccggcta cctttaccag     98100
     cgcatcagcc ttgtcagatg cgcgccagct cgaccaaaat cttgccactg ccgagggcgc     98160
     agtccagcag ttcatgaact cgcacagcat catgagctta aaacggctga gcggctggga     98220
     cctggacaat gcgctgcttc aaagcggcaa cctgtccatt gccttgaaca gcacctacaa     98280
     gccgccagtc ggtgcgatgc tcgatgaata ctgcgcattg agcgacgtca aaattggccg     98340
     ggaagttatt tcagtgtccg gtcccaatcg aaccatcttc gcagcaaacc tcacactcaa     98400
     gaactacccc accaatctca cgccgggcct gatggagcgg ttggtggcga gtcctttgga     98460
     attcaggctc acgcatgtga tgcgctgcct ggggcaagct gcagcggtca aaacgctgaa     98520
     ggaagtcagc aactattact tcatgaacca gagcacgttc atgcaaaggg cgattgccaa     98580
     agcaacatcg tctgagccgg gcgtcgatcc tggcaaagcc gacctttaca tggaaagcct     98640
     cgaagcattg cgcagacaaa cagtcgaagg gcttggatgg ctgtaccacg ccatgacagt     98700
     gaccgttttt ggaacttcac tgaatcacct ggagcaagaa gtaaacgagg tggggcgaaa     98760
     tctcagcgat gtgccattca tcagggaacg gctgggcctg aaagcgagct tttactccat     98820
     gattcccggc cagtggtcga tgcagcagcg gctcatgctt gtcaacgccg aggtcgccgc     98880
     ggattgcgct ccaatctaca cgattgacca gggctcgcca aaaagccagc acttcagcga     98940
     aaccacgggc acctaccagc cgagcctgtg cctgttccaa acggtctatg ggaccccgta     99000
     ccactacaac cctcacgtcg ggcaactcgg gcacaccatg ctcgtgatgc cttccgggaa     99060
     cggtaaaacg acgttcgcca acttgtgcct ggcgcagttc cagcgctacc ccgatgcaca     99120
     ggtgtttatc ttcgacaggg atttttcctg ccggatcatt accggcctcg ttggcggaac     99180
     gcacatcgac ctcaagtcgg gcatcaagct caacccgatg gcagccgtca atgaagggcc     99240
     catggggcgg ctctgggcgc gggagttttt gcttcaaaga ctggaagaga gcggcactca     99300
     agtaacgccc gaagatcgaa atgtgatcga tgacacgctg cttgcgctgt ccaagaccga     99360
     ccagcccata tccatgggca cggtggccgg tgttttgcca cgaaaactcg aagccgcact     99420
     ggcggaatgg gtcaacaacg gtccttacgg gatgttcgac agcacggtgg acgagctgag     99480
     cctggaatcg tggacctgca tcgagatgaa ggacatcatg gccgtggacc ggctggcccg     99540
     ggcatttctg gaccatgcct ttcgcatgat catgaaacgt ctggacgggc ggccgacctt     99600
     tatctatctt gaagaagcgt cctttctgct caacagtccg cagtttctca gggcattcga     99660
     tgactggctc aagacgtttc gaaaactcaa tgcgtttgtc tggctgacca tccagtcgcc     99720
     cgagtcggtt tccggaattg acgatgagcg cgtgcgcgcc accattgccg acaacatacc     99780
     gaacctgatt cttggctaca accaacgact ggaaaaccat cgggaactct acaaatccat     99840
     gtttggcatg cacgacgaac aagtcaactt gctggcaaac ctgaaaccca aacgcgatta     99900
     cctgctagtt gccgatggta tttgccgcgt gatgggcaca aacctaagca aagatgcatt     99960
     ggcttacttg cgatcggaga tgccctatca agacctcttc acgaaagcgc aagaaagcgg    100020
     gcgcacagac tggcgcgact tctatatcgc cgaagcactt aaaaggagct aatcatgaaa    100080
     ctgaatatca aaaaaagcct cgccattgcc accatcgcgt gtgcgggttt cttgccgacc    100140
     ttctcgcaag ccatgctagt tttcgacgca gccaattact cgcaaaccac catcaccgcc    100200
     atccaacaga tcaaggcgca aattgatcag gtcaggcaac tgcaggagca gatcaaatct    100260
     aacagtgcca actttgccgg caaagatatt gccgacctca aaagggagta tgacaaagta    100320
     aaaagggtct atgactccgc aaatgccttg cagaacactt tgcttggtgt gcagcaaaac    100380
     tttgacaacc tcaaggcgat gtttggctcg ggcaactacc aggacttcgg atcgatggcc    100440
     gtgtccatcg gggatcgcgc aaaagccggc gatgcggtgg cgaaaaacct ctatgacaac    100500
     tccaggcggg cgcaagacca aatgaaagat gcgtttgacc ggcaccaaaa aattgttgac    100560
     caagccagca acgtgagtgg cgtcaccgaa gcgactcaag cgacgaccgc tgcagtcggg    100620
     gtgctgattc aacaaaataa cagcatgctg gccatgatgg cggccgatca gacgaaaaaa    100680
     gccgttgatg cctcagaaat caacactgaa aagcaagagc gtgcccaggc agagatgaaa    100740
     taccagcaaa acatgtcatc agaactcaag aaaatcttga agaagtaatc tttcatgcgt    100800
     gtcctggtcc acatcaccat cgggttttta ctttccctga tggcttgctt ttcatttgcg    100860
     caagatcccg tttccattcc agcgccagtc agtgcagcgc ttgctgcgaa taccccggca    100920
     gctgtgaaag attccgggaa tgcgcagagc ctgacggtta ttcaaaccgt catcgagaac    100980
     ctctttggca aaagcaacag cggtgagagc ttgataaaaa ggttcacggg ctcaggcttg    101040
     accattgcag gcagtcttac cagcacagtt gccttgcccc tggcaggggc gctggcactg    101100
     gcatccatgc tatggcacat catgctagcc atggctaatc gcaaatcgcc aacggatgcc    101160
     gctatcgaag gcattttatt tgcggtttta accgcattcc ttatttccca gtacgcatcc    101220
     atcgtcaggg atgttgtcaa gttcggcgat atggtgatta ccgccaccgg cgggaccgta    101280
     ggtgaatctg tcactaactt tatgactggc ttcctggtca aatttattga tgtcatcgtc    101340
     aaggggttca gtgctttcag tatcacaagc tggctgactg gctcggcaga tatgctgttc    101400
     ggcgtagcgc tcatggtgct agcgtgcttc tttgccttca cagcaatgat tgaactggta    101460
     ggcgttttgc tgatggggcc tgtggtggtc gggctggcca ttgccatcgg acctattttt    101520
     atcgcctgcc tggccagcac ctttacccgt agatggttta accagtggtt caatttcctc    101580
     gttggcggcg catttctcac tgccgtcacc gtgatcgttt tgaaattgct tacggaagtc    101640
     gtgacagcgg gggttggcgc tattggggaa ggaagtgttt cgggccaagc cctggcgatg    101700
     gcgatgattg cagtcggcac ggccaaaatc tttgccgcca tccccaattt tgctgattcc    101760
     attctccctg gacgaaccgg tgctggccag gccgtcacga gcggagacgg gttgggcaat    101820
     tcagcagttg ccgtcatggg caaagctgca gatccggcga aagctgccct ggcgacagcc    101880
     aaggcggcag caaaccctgg gaatgcacta gcccaaacat ctgcggccat tagcaatgcg    101940
     aggacgggcg gggcagtcaa caacattcgc tcaggtgttg ccactgcagc ctcggctgta    102000
     agaaaagcct tgccttgatg ggttgaacca aagctggctt gctatggtta gcaacggcaa    102060
     accacacata ggcggcctaa ttaggccgcc tattttcttg ggaaaagcct tttcgtggcc    102120
     gttttgttcg ctctatttga aatggcacca tttaagagaa agctttcaat ccttttttga    102180
     ggcttcttaa agtttcaatg tctgtctgga atacagaaag actttgaaaa atgacctggt    102240
     tgaaaaagtg gaaactctca agcactcaaa cacttgtttt ggctgctctg gcttttggat    102300
     cgctttcagc gcaggctcaa agcaagattc attgcctcta caacgcggac gctgcccgat    102360
     acgaagcacc attggcgtgg caaaacaccc tgggtgcggc tcgcgccaat gcaatgtgca    102420
     gccgcgtcac tggggcggtg attcctgcca ccccgatgat ggcggcctcg ccggtgatcg    102480
     cggccgcgcc ggttgcacct atggccccag ctgctgcacc accgcctgag cgcatatcag    102540
     cgcctgcgca acccgtctat tcgatctcca gcggagaaaa agtgtctgaa gtgctgacca    102600
     aatgggctgc agcacagggc tactccctgg tctgggatgc ccctggccaa tctgacctgt    102660
     cattgctcac gggaactgtc gaggctcagt cgctgaccga agccgtcggc aagctggtca    102720
     cagctctcaa ctccaagttg gccggcaaac gctcggctaa caaccaggag actcaatttg    102780
     ctttcccggt cgaagcaatt gcctattcaa acaatgtcat cgccgtcacc gtcaagcagt    102840
     gacaccgaac tcacctattt catccaaatc cattatgaaa accaccatcg tccttgtcgc    102900
     cctcatcgcc acttccggac tttccttttc ccaggtccgg ttcatcgatg ctccctatcc    102960
     aagctccgtc agtcggccag ccctccaaat gccagtggcg cagcaagtgg ccatgccggt    103020
     gtatcaggca actcccgttt cagctccagc catgcaggca ggttttgaag cgacgccggc    103080
     agacgcaaat ttgcgcaagg cactcgtgcg ctggacaaag atgattggct ggacgttcga    103140
     gcctgagcat tggacgctcg accgtgacat tcctatcgcg ggctcggcca gccttggcag    103200
     cgatttcaag atggcgacgc gtttgttgct gtcgagcacc gaaatgactg atttgcctgc    103260
     acaaccctgt ttttacagca acaacgtttt gcgcgtcata ccgctgaacg agctctgctc    103320
     acgccagcag gtcaacaaga cacagtaagc gacgcttgcc caagactttc gctcaaagcc    103380
     acatcgctct caacaactct caggatttcc atgcgtcaac atcttttaag ccttttcgtt    103440
     acggctgccc tcgccacgat tgccttgccg ggctgcggca cctacaacgg caagcaagaa    103500
     atcaaacaat cgctcggcga gacaaggcag cacatcgatg ccatggcgac tgcatcgaat    103560
     agccgcgcgc gtgacatggg catcaacaag ttcaacggcc aggatgttgg cgcaccctgg    103620
     atagcgggca agagcattcc gctttccaaa gaagtcagcg tgccttccca acttcgcaaa    103680
     aatgtccgca ccaccgtttt gtcttctgaa tgcgccaatg cagtgacctt gcgagttgtg    103740
     gccaattgca tcaccgatgc aaccggcttg ccagtgcgcg tgaaggccga cgcaaacctg    103800
     ccaatcgcat cgtttgttcc ccgcgcttca gcaggagcgg gtcccgcacc agccccagct    103860
     acgcggccag gtgaagccgg caactcgggt gcaaacacaa cacgggtttt tacccctgaa    103920
     gcggccgaca tttccctcac caggctgctc gacacaatct ctgcggtcta ttcggtttcc    103980
     taccgattga ccaatgattc ggcgctagag ttctataggc tggacacgcg cacattccgc    104040
     atcaaatcac tggctcagaa gttgacagcc aaaacgacgc agtccaccgg ttttgacaac    104100
     aattcgatca ccacgtttga aatcaaggaa gccgatgcaa tcgatgctat cggcaaaacc    104160
     atcacggcga tgggcacgat ggccggcagc atcaatgtct cgcacgaaac aaaagcggtc    104220
     actgtcaccg atacgcccga agtgctcgac agcatcgctc gttaccttga agaagaaaac    104280
     aagcgcctca cgcgccgcgt gacgttggtt gtggatcagt tctatgtcag cgacaaagac    104340
     aaccgcgagt tcagtctgga ctggaatctg gtttacggtg cattgaacgt gagcagcgct    104400
     agcagagcgc caacaacatt ggcgcccgac actgccggcg catttggagc ggttgccaac    104460
     acagggcgct ttgctggctc aggcctgttg gtcaaagcgc tgtccgagca ggggctgatg    104520
     gtccagcaac gcagctttcc attaagcacc cagaatggct cgccggtatc tattggattg    104580
     cccaccattt ttgattacgt ttcagaagtc actttgacgc aaacgaatgc aggtgcagtc    104640
     aacagccaga ccgctcccag cgtgaagcaa aaagaagaaa aaatcggcac ttacttgacc    104700
     atcacgcctg aagcccagga tgacgggcaa gtcatcatca gcgcgaactt ccaggaccgc    104760
     accggtgtct tgacacctta cacggtgcag gccggcggca actccagcac gattcagcag    104820
     cgcaacattg acgaggtgag caacatcgtt cgcaccgtgg tccgcgtggg tgtaccaacc    104880
     gtcattggag gcttgtccga gaccgttgac aacagcaagg atcgtcgcct tgtcgatgga    104940
     gccccaatcc tcctgggtgg ctccgactct ttgaaaaaga acaggcgctc catgattctg    105000
     gtggttaccg ccgttgctga ggatggcgtt taaatgtcag caaacaacca gttagctgaa    105060
     ccggtcctac tgggagatgg ctccgttgcc ccgccaggag tgacaattat tctgggcatg    105120
     acctggaagg tgttgctggg gcaaaaatta ggtgcgatgg ctgtgcaggc tgctgtgctg    105180
     gccaaggcca gccactacac ccatacgccc aacatcggca gtgttggtta caccaatctc    105240
     aagccgggag tcaagacgac ctatatttct gctgcaggca ttgtggcttc acagaaaacg    105300
     atgggtgact ttctcatcgg cctggccctt aacgagactg atacgtggct ttgcggagtt    105360
     tcaaacggct cggttgtctc gggatatgac atcgttgtta acgatgcgct gaccttcgag    105420
     aagatcgtca atgcgttcaa ggtccgtttt gaagaggcac acctgattgg tgatgtcgag    105480
     ctcgggttcg cagccgagta cggatgggat gcaatttcag aagggctcgc atcgaaggaa    105540
     tttcgtaaaa atgcgacgat ccgaccgaca agcaaaggat tgagcgaaag gttcgaggcc    105600
     gttccgaaaa aggttcttta catcggtggc attgcactga ttctgctggt ggggcagcgt    105660
     ttcatcgttc cagccatctc caacgtcttc cacaagccca aggaaattgc ggtcatcgac    105720
     cctagcgaag cgtggaaaga cgctttggac gaatgggtcc gcgctcatcc ggtgtcgagt    105780
     caaggaagct tgaatgaatt gcttgacgct ctggcaaacc agcccctggt agttgcaggg    105840
     tggcaggcat cagcgttcga ttgtgtctgg ggccagaaat cctggcaatg cacaactaaa    105900
     tactctgcaa gcaagcgcag ccataccaat caagccttcg aagcggcgaa acccaaagac    105960
     tggatcacta cgtttacacc gatgagggac gttcaggtgc gctatgacat agcagccagc    106020
     gctgtaaaac tcgatgtgaa gtcgctcaaa cctgtcgccg actatgagct gatcaccatg    106080
     tcacagctgc agcagatcac cccccttatt gctgactcgg cagcgcccat gggaacgttt    106140
     gtaaaagtgc cagtccccga gccaaaaaca aacgaaggcc agcctattgc attgccagcg    106200
     gacatgctca ttccaaaagt cagcatgctc aagatcatcg ctccgctgcg tgacattgca    106260
     gcatttcaga cttggattaa tgacgttgca tggaccaacg tatcactgcg gatcgaacgc    106320
     ggcaaacaac cgagcgccaa ggactccgcc atcaccatgg aactcaaggg aaacttctat    106380
     gccaaaaact aacttttttt cgcacttcgc actgtcattg ctcggcgcac tttcactgca    106440
     cgcatcggct caaaatgtgc ccgccgtcgc tggcaccgct ttggcagcgt ctgcagcggc    106500
     tgcttcggct gcacgtcccg ctggcgctgc ctcaggtgtt gcggtagccc gggtcagcgc    106560
     agataccaaa agggcagaag taagcaagca agagggcaag gggcccgtag gaacactgag    106620
     cagcgcaaaa acaatccgcg agctgcttga aatcgacgac cagatagcgc tttccaagga    106680
     gcgcaaggca ctggctgacg aaaccaagaa aactgaaaaa gagcctgttg ccaatgcacc    106740
     agtgaatttg acgcttgcag taacagcacg caaagcggca gaaaacaaag ccaatgccat    106800
     caagcaagcc aatgccgtgg catcgagcat taagatagac gccatcatgg gcatccaggg    106860
     tgagcgagtc atcaatgcaa acatcgccgg cacccagacc tggattcgtg aaaccaaccc    106920
     aacgccgata gcaggctggc tcatggttgc ggtaaagggc agctgtgcca cttttgagcg    106980
     caatgaagca tcggccccta aagccaagaa ggtcagggcg gcaaagggca aaaaattgca    107040
     ccaatccaat ggcgttcaga ctacggagca aacggtctgc ttcaagcggc ccgaggcatt    107100
     tttgccgccg ccagcattcg gaagtagcgg gggcggcgca ggtgcaatgc ctatgcctgt    107160
     tccactgccg tttcccgcac cgttctctac ccctccccgc gttgcaccgg tagcgcctat    107220
     tgccaccctt tgaatagatg gccatggtga acctttttag aaaacttttt ttacgacccg    107280
     cactggttga aaatcaagtt atcgcttcgg acattgcagc agccgtcaat tttcgcccgc    107340
     gcaagcccct gaaggtttcg gtggctgacg ccatggccga cagtgaagac atccctagca    107400
     atatcgaagc gttcgctact tccgtagctt ctacaaatgt ccagcacggg ccatttggaa    107460
     aatccatttc cgtggaaacc atcaaagact ttgcaacgct tcctctgttg tttgaaggtc    107520
     tcgtcaatga cttccagctc ggcagtcacc ttggctataa cgtccagccc gcactgtttg    107580
     gaggcgttca gggaagtgag gccgcaagga ttgccatcct cgtcaatcct ttgtatgcca    107640
     actcggatga agtggtagaa ctcctttcga tcttggcaaa tcccaagcaa cacaagcacg    107700
     aattcaaact ctgggaacac gcctccagag tcatcattcc gcattcgctg atgctctcgc    107760
     taagccgcgg ggaaattgac aaaaacagct tgagcaatcg cagaaaaata aattccgatc    107820
     cgaagaagca ttccttttac gtcgcgctgg aaaacatcat ccagtgggga gtgcggcaaa    107880
     acgcatctga cgttcacttc aacctgaact tcaacgaaga acacagcgag gtccgcttca    107940
     ccatcaacgg ccgttatgtg gctccacaga tgtggcgcat gccaacacaa accatgttcc    108000
     agattctgag cgttgcctgg atgtctggca cgggcggcaa tgggcctagc tatgacacgc    108060
     gcgtcgagca gcaatgccgg atcgcattga aaattgacga taagccgatc atgcttcgat    108120
     gggcctcagc atcgaccgaa tcgcctggcc cctccgtcac gacgcggatc atcaaatcgg    108180
     atgccaacat cctgacgctt gagcaactct cgtatttgcc agaccagatt gccacctaca    108240
     accgggccat gaatgccgag aagggcgcga ttatcctggc aggtgttgtg aactccggca    108300
     aatccgtcac gatcgcgtcc ctcatgggca gcctgcctga ttaccgaaaa aagctgggca    108360
     tcgaagatcc ggtagaaatc ctgatccccg gcatgctgca aaagtccatc aatcggccgc    108420
     tcgaaggcga cacgggcaag gaatttgacg ccatcgcaaa aaccgccaag cgctttgcga    108480
     tgaatgacat tttgatcggt gaaatccgtg acaaggctac cggaatgctg atggtggaca    108540
     ttgtgctgat gggcacatcc gtgtactgca cgacccacac accttcagca ctgggcgcct    108600
     tcgacaagct agcgagcgac atggtgggag tttcgcgtga ctttctctcg gttccgggaa    108660
     acgtcaagct catcacatac caggcattgc tgcccaagct gtgtacctgt gcgctgccac    108720
     ttaaatgcat tacccagcaa ggccatgcag agtacaaggc ctccggtaat gactacatca    108780
     aacggctaca aaggctctat gacctggacg aatccatgct gcgcatcggc aaccgggagg    108840
     gttgccccaa atgccggcat gaaggactgc ccgagctcaa tggctttaaa ggaagaacac    108900
     ttgcagcaga aatggtggag cctgacgaaa cgctgctctc gatggtcaag caggccgaca    108960
     gcattggaat gcggcgccac gtagccgagt tgcggggcag cacccgattt gacgacccgt    109020
     tgatggtagg aaagagcgca atggaatgcg ccgtttacaa aatgtccacc ggcatcctgg    109080
     acccgcgcga gattgagccc cggtttcatt cgttcgaacg ggaagaaatg atgcgtgcgt    109140
     cttcgaagca ctacgctgaa cacgttgaaa agcaagttta cacagcactt aaaaaggtaa    109200
     ggtaatgagt caaacccatg atgttgaaac ggtaggagga aaaataacct tttccggagt    109260
     gctctccgat attggtcagt tttttaaaat cttcaatgac ccggttgctt cagctgcccg    109320
     aaagttcaag aaaagcttgc ccgagtttta tcaatcaaca gccgaccgaa tcgaaaatgc    109380
     gaaagagctt aaatactcaa ccatgttcga gcgtgatgca gttcggtatt ccaaaaatga    109440
     ggatggcaaa ccgatcaaga cgccgcgtgg tgtgttgtca gcgcattggg caacaaaaat    109500
     catggatagc ggtggtgatc tggccttgac ctttaccggc acgctgccca gggaagacat    109560
     tgcgctgatc agaatggggc aagcggctgg tgcgggcgcc ttgccttcga cgctgcggga    109620
     tctggccaga atttcactgt tgatcagcag ggcaaagtcc atattcatga cttcgacatt    109680
     catgggcgtc ctagccattg tcatcatgct tacagtgatg atcatcacgc cgatgtacac    109740
     cgttcccatg atcaaaaaaa ccttcgtgat accgccggag tacataccgg caattgccaa    109800
     aaaacttttc gcgttttctg acttcattga aagctacctc ctttatattg ttggtggcgt    109860
     cgcgatgctt ctctatgggg tgatctggtc gcttcccaat tacgtgggca agtaccgcaa    109920
     aaaacttgat caatacttta tctggggttt gtaccgtgat ttgcagggtg ctctgtttct    109980
     ggccgtgttg agtaccatgg ttaaaaagcg tggaaatgtc agtgacaatt taatggttgc    110040
     attgcagcag atggccaacc acacgactcc ttggaggcgc tggcacatca cgaaaatgat    110100
     cgagaacatg caaaatcttg atctttcatc gctggacaac agcaccgcga tcacgaatgc    110160
     cttgaacacg ggcatcatgg accgtgaatc gttcttcttt cttgtcgacg tccaggatgg    110220
     gcagggttta gccatcggtt tgcaaaaagc cggcgaacgt gtcgagggtc caacgctcac    110280
     ttcagttcaa aagcaagcca aaataattgc aatgttgttg cttggggcag ccttcggtat    110340
     tgtgggtata tgggtaggtg ctcatctttc aacttcaaaa gcaatgatcg acgcgctcaa    110400
     gagctttatg tcgtcttgac tgattccgtc atgcagacct atcgccgcca cttgccagag    110460
     gcggcttttt ttttgtgcgg aatctggtgg caactgaaaa ccaaataaaa agcgcggttt    110520
     tatgcctcac attcacccgc aagatggtcc caacaaattc aacaatgttg gacatatggc    110580
     aactatccct tctataaaaa aagcgactga gagcgaaaag aaatctgttc tcggcacggt    110640
     gcccggtccg atggcccaag cagcaatgca ggtctatttc gagcgtggat cgcttgaggc    110700
     tatccagacg catcgctgga ggcttatttc aatttccatg attgttgtca ccgtcttgca    110760
     atcggcggcc ctggcactct tgataccgct caaaacggta gaaaccatcc agatcaaccg    110820
     ggacggccag ggcagggtag cggttgccaa cgcagatgcc cagcggttta cagcagacga    110880
     cggcgtcaag caggcatggg tcatcgattg ggcgacagat ctgactgaga tcaattcggc    110940
     aacctggcaa agaagcgtcg agcgagcttc gtccagatca cttggtgttg cagtggatca    111000
     gatcagagac tatctgagcc gcacagaaaa ccagccggcc cagctgctcg ccgacaaacc    111060
     gagctacatc cgtgaattca gccgccagac agtcaacatg atcgatacca atgtagcgct    111120
     catccgctat tccttaacgt cacgctcggc accaggggct ccgaaggtag tgaagtccta    111180
     tgcgatgacg gtcacgcttg ccacggtcaa gcagtactcg cgcgaagacg tgcttagaaa    111240
     cccgacagga cttgcagtcc aaagcttcaa tatttccgag gaactaccaa aatgattcgc    111300
     tttcgctttc actcagccac cactgcactt gtcacgggtg ggttactggc catgtgctgt    111360
     caaggcaatg cggccgtgtc cagcccgccc aacagcgcag tcaatggcct atcggttgcc    111420
     gtgccaggcg gtctggactc gcgaatccgg gtttttgcat attctcccga tgtggtttac    111480
     acgctgccgg tgacggtcgg catgcacacc catatccctc tcgggccgga tgaagaattg    111540
     atcgaaaagc ccaagatggg cgagacgatt caatggcggg tatccgggaa ccagaacaac    111600
     atttatatca aggcgctgaa ggcagatgtc agcacctccc tcacactggt cacggacaag    111660
     cgcgtttacc agttcgagct cgtcgcgaca acccgtgcaa cggagcggat tcaaaaagcc    111720
     tatttcgtct atccggacga tgaggagggc atcctgctca accagcaagc caaaaccagc    111780
     aagcgagcgg acgcggcggc cgcagaagaa gagcgcaagc gtgatcaaga gctttccccg    111840
     cagcccatca gcccaaataa tctggtgttc tttcgcgtcg aaggcaacaa ggagtacgaa    111900
     cgcatgcacg cctatgacga tgggcggatg acgtttatac gcatgccgcc gggcattcag    111960
     gatctgcccg cgttgttttt ggtggacacc gataacaaac tcgtgccgat caattacacg    112020
     gtgctcgacc gcaagggaca cgatgaccgc gacgttctca aggtggagcg taccaatccc    112080
     aaatggctgt tgaagatcaa gaaatctgtc gaagtcaagc tcacgaaaga atagcaagcc    112140
     atggcctcga atgtgcagcc tccaccgctg atgaccgatc cgctgaacat gtcagccccg    112200
     gaggaattga tcgatccgat ttccagagaa caacaggatg aaatcagcag acaacaagag    112260
     gcgatggagc gcggcaagcc aacgcgaaac cttaaaaaat taggcatcgt gcttgtaggc    112320
     gctgcagtag ctggctatat gctttacccc tccttgtttc caccatctaa ggaaaaaaaa    112380
     actgtcgtgg ttgaaaagtc agatgcccat caggaaacac ctggctccat catcgaacag    112440
     ctcaagagtc agcccaagcc tccgcctcca actgtagagg tttctgtccc gcctccacaa    112500
     gttcatccca cccctccggc cggaatgtca aataacccgg acggagccag cgtcttgacg    112560
     ccccggcaaa tcgaggccaa tcgacgcgaa accatcatgg ctagcgcaat ggagccgagc    112620
     gacatcaaca ttacgctgcg ggatcaaccg agaaaaaagg ctgactctga agcagacggt    112680
     ccggactctg cattggcaag ggcactggcg caacaaaatg gcatccttga aaaatcgctg    112740
     gcccaacccg ttgaaaaacc tcaaccgctc gccaagggca gcaatcagga cgagttttta    112800
     ctgcgcacgc gcaacgcctc gctagaggaa gcaacaaaac tcgcacccgc aagagctgca    112860
     gcggctttgt accagggcac gattgtgcaa gtcattctgg accgcgccat caacacagac    112920
     aacccaggca cggccagggg tagggtgcgc agtgacgttt atgactccgt gacccagagc    112980
     attttgctga tcccgcgtgg ctcgctcgtc atccttccct acctgaacag tatgctggtc    113040
     ggcgactcgc gcatcctcgt ggcaggtgaa cggttgatct tcccgaacgg taaaagcatg    113100
     tcgctgtctg gcacgccggc agcagacatg caaggcgcca gcggcattcc ggctgatgtg    113160
     gacaatcact tttatgagat gttcaaaacc tcgttcatgg tcggcgcagc atcgttgcta    113220
     cttccgaaaa gtcagcaaaa cgtgtccatt tctgacacgg tatctggtgg cagcagaacg    113280
     ggtggctcga ttttgggaac aacgctttac gacacgatca agcagatttc agcacgcaat    113340
     gccagcatca ggcccacggg aagtatcgaa gtgggtgagc ctttcacctt gatgctgtcc    113400
     aaggacatcg agctcgaacc gtacaggggc cgcaagtgaa catggcaaaa atcaaaattg    113460
     cttcagcggt agtgcttatg gctgcatctg ccttgctcgg tggttgcgct ttccagagtt    113520
     ttagagtcga tgaagccagc atgcgctacg ccgaagcgct gcctcaaggc ttgtcatacg    113580
     cttggcgcca aggtggcaaa gtgtggctcg tgccagctaa aaatgttttc ctggggtctg    113640
     ccagaacgct ttccggtcaa actatgatga tggcctcaga ggggtcgtac ttcacgattg    113700
     cagatgctcc gccgtccttc tacattgaga tcgatagcag gatcgagcca ttaagcattc    113760
     caattcaata gcagcccggc cagcgcgagt tccatcattg ccggggctgc cgccttgttg    113820
     aggcaaataa tcaaatttca ggaaaacaag tcgatctgat tccctcgcga gggcatgtca    113880
     gatggcttgg ccaccaccgg cgttggctgg catgtggact catcaaagaa ggcgcctggc    113940
     atttgcccgc cttcaggcag ccaagccttt ggaatccttc gcaagggcac tgcagccgcc    114000
     tcgggagctg ccggccggtc gggcaccacg gcgtactgcg cagcaccggc gttttgcctg    114060
     aatcggtctg tgtccatctc catgctggac aggaacgcca gcatggtgtc attaagctgc    114120
     aactcatgcg ttgctcgggt caagacgaca tagtacaagt tgacttcctg cctgctcagt    114180
     tcctctgtgg ccaacatttc cccctggccg ttgagcaagt cagggaaatc atcggccagc    114240
     cgaaccgacc tcagtgtcga gcccttgcac ttgtgggccg tggacagggt caggtgggcc    114300
     ttgctcaagt cctgaacaca ggcttcgtgg atcgccggca cgatctgcag gacgctggcg    114360
     ccataggtct ggaccgcttc aatggtgcgc ttgacctcca gatcattagc gttttcagcg    114420
     tactcggcca gttgctcaaa attgtgaaag tccttgagaa acggatcacg gatttcgccc    114480
     gtttgtccat ccataaggta ccaagtgtcc acaatcttgt tgaagttata gccttgcaca    114540
     ccgcctatga agccaatctt ctggccggcc tgcatggcaa taacagcttg cgagaagatg    114600
     gccgcgttgg tccgtgagat gaccgcgtgc ggagacaaaa aattgattgg accgaccctg    114660
     gtgttgggtc cgagcccttc aaggggggtg gtctcagcat agaaacccca aagaagcgca    114720
     ttggcaatct cggccacata ttgcccaaac ctgaagcttt gcgtcaacgg gaatgtctgc    114780
     accgcctggg catccgtcat ggcgttgcag gcgccacgga attgataaat cgattggtag    114840
     gggtcaccga cgatcaccag cggactgctc tgccggcgca tgatgtccca agtcaccggg    114900
     ttcgtatcct gggcctcatc gagcatcaaa tacggatagg acaggcgcgg ctggctgagt    114960
     tggtagagct tcaagatacc gtcgtgggag attggaactt cgtcgtgcag gtcgatcatg    115020
     cgttcccata attgcttggc cactacagcc gcatagtcca gcatgtcagg cggaccgaca    115080
     ggcgggccat tgaatgacat ggctgtcttg ggaaattcgt gcgaatccga ggcgcaccaa    115140
     aaattcagcg tatcgagaac ttgcttggcg aaaatccagt tccaggccag tcccataaac    115200
     ttgatgacct cgatggactt gagggaataa ccacgaaatt tccctttata cctgggcgat    115260
     acaaccccgt gggccaagcc atttatggtc ttgaccgtaa cccactcctt cgggaagcgc    115320
     ttctttgcat cctgctctgc gcttttgtta aacacgagag acagccctga gaggccctga    115380
     ccggcttgga cttttgcaag gctttccagc gttgtcgttt tacctgtccc agcataagca    115440
     accactttgg tgacgccaaa gagattagcg gttgagattg cagtttgctg ggcagtaatg    115500
     agcatgtttt aatttttatc cgtttactat ttgtaaattt gtcgtaactt cttgatgggg    115560
     cggatcgcac gccattcgtt cgagccaaaa tcgcacgttc tcattagatc gcagttttcc    115620
     atccataacc gaacttcgtc ttcgctcaaa agcgttgtcg ggcctggtgg aaatctcata    115680
     gattcttgag attgcaaaat atcatcgagc gcaagataac ctcctgacca agagctttga    115740
     atcggcttga ttcgtgccaa gcctgccctt gctggctcag gatagctcat catctgataa    115800
     ttcattgcaa tgggcataag ccacatcggc cagcgatggc catgccgaat aatgtttgca    115860
     ttgcgcatac catcgaagta tattttgtcc ccatctaaag gatggcacat ttcaaacact    115920
     tcgcaagctt tgggtgttcc atgaatcggc acattcatgt gaaatgttcc gatcagaaac    115980
     ggaattggct ttttaaaact gagtattgca gtctcaactg gatctgagcc gagggagaca    116040
     agtttgacgg tggggggaga tgatgggcat caagcaacga tagtgctgaa aagccagcta    116100
     aaacgctcaa aaatgttgaa ttggaggctg caattcgagt tcacttcaaa aggtcagccc    116160
     aattggcggc ctaattaggc cgccattcgc gctcgaatac ctccctgatt ttgcgaacat    116220
     cctggtcaat gttcaaatta ctgaaaaaag agccgaaaca gagcgaggga acacatctcc    116280
     tgcaccgtgt ggttcggtcc ccgcataccc gtttttttgc tctgctgggc ctgttccttg    116340
     tctggcagcc atcggcaaat gccttttgct ttgccgaggc cagcgcacgc tatacagtca    116400
     acgagtacat cctgagggcc atcgcgctac atgagtcgcg gatgaatccg tcgttgcagc    116460
     tcgtcaatag caacggttcc gtggacattg gactcatggg catcaatacc gtgcatatca    116520
     gcccgggcga gcgtctgtac cgggcgggca tgacgggctc aatgctcctg gacccctgca    116580
     ccaacgtcat gacaggtgca tacctgttgc gtctcaagat gaaccgattt ggcaacacct    116640
     ggacggctgt tggcgcctac cattccatca ctgaccagta caacgtcgct taccaaggcc    116700
     gtatccgcgc ttcactcgat aaggttatgc ggcaggctca agctgctgta agagtggaca    116760
     actaactcgg tggggagtgg catcaacgtc aaagcgacct aattaggtcg ctttgacgta    116820
     tgaccgtttt gcgcaaaaaa tggtcaattc aagcgaaaac gcaagaaaaa ggtcagatta    116880
     ttattgaaat cgctttgcaa cttaacataa cccaaatcgt ggaatattag caagggctgc    116940
     acccagtttc ttttaaagcg cactacctgt ccttgacgaa ctcacagaca actcaggtgt    117000
     attaaatctt ctgccttgtt actgtgactt aagtttgcga acgagtattt agtaaatttt    117060
     gcgcgaactc gatatattgc tctggtgttg gatcacccca gaggtgccgc attaaccatt    117120
     gattaaaagc tgcctgggaa ggtttcgtgg gtttggactt gagcaaaaga gttttcatgc    117180
     tttgctgatt gttgtacatc gagatcaact cgctttggtc accaccatcc agctcttgaa    117240
     agtattcatc agcttcatcg atcttgctgg ccttgtacat tgcgggtatg tcttgctttt    117300
     gcggtcttac tgctggtgca accttgtcca cagcatcttc tatatcaact gatgcttgcc    117360
     atcgttggga cagtgctttg cggaaatatg cggcgggatt ttccagtttc tcagctttcg    117420
     tacttgctcg tcgctcattg gtgtatgcca atgcttgctc aatagtgctg gcgggatttt    117480
     gttgaagcat gcgttttgct tccgagtgca tgattcccaa taggaccatg ttaccaatga    117540
     gttttgcttc atctgcggaa acatcctcag ttgaagtggc ggcaagtttg ggtttttgga    117600
     ctttaaaaaa aacgccttct acagttttgc caacttttgt ttctcgcaat tcaatttgga    117660
     tagcgccttc agcgttaatt tctgctatgc atgggtttaa tactttttgc ttgaaactct    117720
     tgtattcctt ataagatttc ttatcggctg aaacacccaa aataatgtcg cgaaactctt    117780
     gccatggaat ggccggtgtc tggttgattt tttcaaaacg aatgcagtgc tcataaattc    117840
     ccgcagatgc tgctcgtcga tatttacgta aaacagcttg atcaattaat gcgtacatct    117900
     cgggtttgag gatgtgagct tgaagttggc tgctgatctg gtacttgatg agataccgag    117960
     tgatttcaac ttcaggaaat agaactgagg ctttccatcg ggctcgcttt tcttcagggg    118020
     caagtacgtc ccaggtgaag atgattctca tcagcgcttc ggaactttcc tttagataag    118080
     accggttgtt ggaattaaat ccaatctcat tgcacaccgc gtcaattcgg atcgcccacc    118140
     acccttcaga atcgtgtggg gtgttagcgg catttttaag ccaggaattg agcaactttc    118200
     tttgcacaag cgagagtggc gccattggtt tcgaatgcac aacctgaacg gctttgcgaa    118260
     atgcattggg tacatctttg gtagaaaaga gtccaatttg atcatctatg ctttttgacg    118320
     ccatgtgcac ttgttttgtt tgaaggtatc ttcttgtgat tggcgatagt acctcagtac    118380
     cagatgtaga acaagttccg atccttcttc gttttaagtt ttgaactcga cactcttttt    118440
     tgctgttgtg tattctttgt taaacacttt aataccttta atacctttag gcatgctgga    118500
     accctgtatc catgcgggtt cccagcctct gtggtacctg tttatggtaa gttaggtgcc    118560
     catctatggg tgtgtaagta ccaatctatg ggagataggt atccttccat gggagtgaag    118620
     gtatgtggat atgggacttt aagtaccctt ttatgggatg tttgcaatat acgactgtga    118680
     cagcattttc ttagggcatg gctcagtcaa gtacctcttc ttgggatttt gtgaaggtat    118740
     ccgtttatgg gatatttttt gaccttactg cttggcgcaa cttttaaatg acctgatccg    118800
     caaagtgctt gggtgtcagg ttgccacata tcgaattagc aaaattttgc tatccggatt    118860
     tgcgtgtgga atcgtccggc tcgcgtgcgc ggtccattgc acgctccagc cagtccgtcc    118920
     cgaggcgccg cagtttctcc cagtgttcat catcgaggcg caccgtgcgc gggcgtttat    118980
     ccctgcaaga tgcaccggct ggcaataacg ggcgcccgac cagcggcgtc ggctcttggc    119040
     ctgtcagccc gtcgcggtag ccgcgacaat actcgtcctg gcgcacctcg ggcagctcat    119100
     gctctcgctg gtcgcagaac tccttgccgt ggtggtggcg gcgccgacgc gtctggtagc    119160
     ccgcgccgta gtcgcctgtc aaaaccttcg cccggcgggc gaggctctgg aatcgagcct    119220
     cgtccattgt cacagcgtct gctggccgcg gccaactcag cattgcgggc aacgccctgc    119280
     gcggccatct cgcacagctc cagccattca ttcgcaggaa tttgttgcgt gtccaggtag    119340
     tggctgacta gcatcacaaa ttccacaagc taatccggat cgcccaaaat tgaacgccct    119400
     cctctactgt cagaactttg attttggttt aggcagcgac cgtagttaat ttctctggta    119460
     cctgaccatg ggatttttga taggtaccaa tctatgggaa ggaatcaaag tctgaccaac    119520
     caaaggattt gtttgacctt cactgggcag tggattcacg tccgctaatg atcaagagcc    119580
     aatctctagc caaaaggctt aaccctttca aaggtatcca ctcttagtaa ttgcatgtct    119640
     gaaggtacca atctatgggt ggatttcaac cctgtttggc catcaattgg tgctgcaact    119700
     aagtttgagc tttctatggg ttcaaatttg agtgttttct cccataagct ggtacctaac    119760
     atgatttccc ctttcttttg acctgaaata accatccaaa tgcttcactt ttcgctccac    119820
     gtcccataac ttggtaccta ttgcgacgcc gacacagctt gatctgatgc ggtagcgctc    119880
     aagtgactgc agatgtggct ccaggcgcaa ccctatttga cattgaccga gcggcggggt    119940
     ttaaagctgg gtatcaaaat cagcttagcc aagtgttgcc gcggactcaa ataatttgtc    120000
     cgcgctgcaa aacacgcaag ctcttgatct gtctggaaaa tctacggatt ggtgagggct    120060
     ggatttgcag gaaaacaaat gccatccatt tgatttcctg caagtttcga cgaggttttc    120120
     ataggacccc gaccgcatgc accgcagact gatgagttgt ctcgcccccg cctggacgag    120180
     cagctcaaga tgagccatcc gctggttcgc ctgaccaact tgatgaactg ggatgaaatc    120240
     gaacgcagtt ttggcgctca cttcgcctca agcctgggac gccctgcact gagtcctcgc    120300
     ctgatcgccg gtttgctgta tctgcagcac gccaatgacg cttcagacga agcggtggtg    120360
     gcgacctggc tggaaaatcc ctactggcaa tacttttgcg gccaaaccta cgtgctgccc    120420
     attgacccct ccagcctgag ccgctggagg aaacgtgttg tccaagaagg tgtcgaggtc    120480
     ttgctggccg tcaccatcga agcggctcgt gcagcgggcc tgatcaagaa aagcagcttg    120540
     gacaaaatca tcgtcgatac caccgtgatg cccaaagcga tagcgcatcc caccgacagc    120600
     cggctgctgg agaaaagtcg ccagcacctg gtcaagctct ctgatgaaca tcatctggcg    120660
     ttacgccaca actacaacag gcaggccccg cgcatggccg cgcagattgg tcggtatccc    120720
     aatgcgaagc agtacaaccg catgcgcaga acaagtccat cctcgaccaa agttggttcg    120780
     aattccggcg gcagctggag tacaagctcg attggaacgg cggcattctc attgccgttc    120840
     cagcgcacta caccagccag acctgcccat gctgcgggca tgtcgccagg gaaaaccgga    120900
     aaacgcaagc caaattcgag tgcgtcgatt gcggctacga gaacaacgcc gatgtcgtcg    120960
     gcgcgatgaa catatttgtg cggggacaac gcgcggcagc ctgtggagag gacggctctg    121020
     gccttgtgcg taagcgcaag acgaaaccag cctcggtgaa gcaggaaccc accgaagtga    121080
     ctattcgtga ggtaactcat gcgtaacgcc gtaggaatcc ccttcctttt gaaaagggag    121140
     gaagtcacat ctttttgaac actgctcgga tcttggttcg tatctcctcc gtatcctccg    121200
     gcgataggcc tttcaatgag agctctaagc gaccatcttc ttcaaaagtc ctgagttcta    121260
     cgttcacgcc tttaaaatca agcgcctctt ttgtcgaacg agtgcgttta actggccctt    121320
     tctctgcggc cttccgtctt gccacgacat ctcggtagcc aagcgaaagt tttccggcct    121380
     cgaaaattag ttccagggta ctttcttcgc ccttaactgc aaaatattcc ctgattgcgt    121440
     tgagcatttt caaagacaac aatcctggat tttctgcagc tgcatgtatc actttagaag    121500
     gtaattcatt caatgacatg accctgctca catgatcttc acctaatttc aatgcctttg    121560
     ctaaaccaga ttgcgatgga tatatcttct ttgctaaaag ctctttccat ttaatggcat    121620
     catccagtgg cgtttgatct cgcctttcga cgttcgcagt tcgcgcttct tcgtagagtg    121680
     cagcatcact attcggacgc gttttgattt ctattctgag tgttagtagg ccaccagcgc    121740
     ggcatccacg caaacgagtt tcaccttcta tcagcacgac agcaccgaac tcgtcaatga    121800
     atccggtggc agacatcatc tgacctccac tggtcagtga tgttgccatt tcatcaatgg    121860
     cagtatttgt gtaaaggtaa cgtgggttga atggattgga tttaatttcc cccaatggaa    121920
     cgtcatatac ccgacctacc tcgtaagtag atttcagaat ctcgacatct tggctcgcgc    121980
     caagattggg attgaccttg tctgattctg gtattgaagg tgagagcctt ggatcaccaa    122040
     ttaaggtcga gcccgccgca gctgcctcga cctgggccac tcgatcgctt gaaacgatgc    122100
     gttttttgaa accggacatt atttgtttcc tgcgttaatt cgcttcaata tctctgtata    122160
     gagagcctga atttcctcag tcgccttcac tgagcgatca cgactgttaa gttcatgcaa    122220
     agcacggcca gttttgccag atgccaacca agaggctctt tgcgcaattt gcgtatcgaa    122280
     caccgaaaga ccctcttctt taaagtactc gcgaagttca gttgttgctt ttgctgtttc    122340
     tgttgttgag actcgcgtca gaacaatatg agcaggaata tgaccaagtt catgtcgaga    122400
     atccatctct ttgagatgag aaaagacatt taaagttgat tcgatttctt gctggtcagg    122460
     gccgcacggc acaagaacaa gatcgctcaa aagggaacat tcaagcattg ttctgtaatt    122520
     ttgtgcgccg atatcaacaa caacgagtgt gtattttccc gacaaatttg ccaattctct    122580
     ggctgggttg gggggaagtg ctaatactgg aattgatggg acgatcccct cctcgttccg    122640
     aattcttgac caacttgttg ctgaaccttg tttatcagtg tccaagagaa ctacgtcaac    122700
     accattgcat gcggccaaag ctgcaatgtt cgttgcaagc ctcgacttac ctactccgcc    122760
     tttttctgcc ccaattgtta taaccataca accctttaat taaattgctc attattcaat    122820
     ttaatttaaa gaatgtaaag aacttgctgt aacttgacac gtagtttgct cattctcatc    122880
     gacaaaaacc aaaaagaatt cataaatagt tgcttaagtg tttagcattg gaagtttgaa    122940
     cgtactcctg ctgcatattg gatcgagcca agtcgaataa atttcgaacc ctttgttcaa    123000
     gacgatagac ggatgaaaag ctacgaagga tttgttggtt cgcaaaacga ttgccaactt    123060
     ccaaagttgg ctcgcgccaa gagttcttaa ataaatcctt ctaggccgtg ttcggaaagt    123120
     cagtggagcc atttcatcat gccggcgatg tgtacaaagc ccagaaacgt gacgtcgagc    123180
     ttgtcaaagc gagtggcgac acggcgaaag accttcatgc gctggaagag gttttcaatc    123240
     aggtgccgcg ccttgtagcg gtgtcggtcc aggacgcgct ggtttttttg cggttgaccc    123300
     ggcaagggat gatgacctgc atgccacgct tttctgccgc ctggacaatc ttgtcgcggt    123360
     cataggcttt gtccgccaga agggctttgg cctgcagccc atcgagcaac tcgggcacgg    123420
     gtttggagac gtggcgctgc cctggggtca gcacaaagcg cagcgggttg cccagtgcgt    123480
     cgcagacggc gtgaatcttg gtattgaggg ccccgcgcgt gatgccgatg gcctgcgggc    123540
     cgctggtctt gcgggcgcct gccggagctt gatgcgcccg gcagcaggtc gaatcgacca    123600
     tcacctcttc catgtcgggc tgctgcacgc cctggaaaag gcgctcgaag tgccctttgc    123660
     cgcaccatta ggcgtagcgc tggtacacca tgctccattt gcccagccgc tcaggcaggt    123720
     cgcgccaggg cgcgcccgtg cgggccatcc acagcagggc aaagaaaaac gtcctgtgcg    123780
     ccccgccagg gcgacctttg cacggtggca tgaacggctc gatacgctgc cattgcgcat    123840
     cggtgaaggt gtggcgtgca tgggtcattc tggcctaatc gggtgattag accgcatcaa    123900
     tatctgaacc tcaaactttc cgaacacggc ctagcctcaa aaagtgccga aaagtgaaaa    123960
     tattggctcg agccaactat cagggcatga aaaaaacaag ccacaagcgc tgtgcgttcg    124020
     ccatctaact cccgagcctg cggtggcgga tttctcggga gttttgatga tttatgtaaa    124080
     agctttgctt agctcttcag cacgccgttt aagcggcgca cgcccataga tcgacatggt    124140
     tgtttcaatg ctggcatggc ccatctgcgc ctggatcgca tccatggcta cgtcccttgc    124200
     gactgatcgg gcgccgaacg tatgtctgag ccagtggggt gaggcccgtt cgagctgggt    124260
     tcgttctttg gcgggaagtg tcgagtattg aattgcgcgc agcgtccacg atttgacatg    124320
     ctggtaaaac ggccggtagc ctactggctc catcgaatca agcgtactgg atattaaggg    124380
     tgctttcggg tcggcagttt ctatgccgcc aagcccccgg aattgcaaat agcgttgcag    124440
     agcttcaaat gcctgattcg ggataaaaac atagcggttt tttgcgccct tgccatgcac    124500
     atacaaaacc cagccctcgg gctgtttgtc aaaatccttg agccgtgcat gtagaaattc    124560
     catggaacgc agtccgactg cttcgaggaa cttgaaaata aaccgaatcc gttcactggc    124620
     cgcagttggt ggttgtgcat ctatataacg gattatttcg gaatagccga attcgctgat    124680
     ggatttgctt tccttgacta ttcggttttt atcatcgcct gtttttctat taaccaaaac    124740
     ccagggattc tggttaatgt aagaggctga gtgaagccag aggaataatg ctgaaaccac    124800
     aatgaccgac tggcggtggc tgtcgtggct gagctggcca cgaaatggag cccaccccgc    124860
     ttcaaagggc ttggctttgc gccgagaaat ccagctcggg ggtatgttct gcaagaaggc    124920
     catatacgcc aaacagtcct cgaccgtcat gtccttgaat ccaattgcgt gacgctcctg    124980
     ctgcagccac agcattaagc gcacagcttc acgcaagtaa acagtcgcgg tgagtttgga    125040
     gccagagcgc gctgctatcc aggcattaac tgcgtccata tcgttatcgg ccttgagaac    125100
     cgaactgccg gacaaaatag gcgttgaccc gcatgcagga ctttcaatgg tttggatttc    125160
     gcggtagggc gtgtattgcg agggcatcat tgcgagggcg aaggccggcc gggtgctcgc    125220
     tgctgtggcg ggcatgatcg agccgaggaa ctgcgcgatc cgctccgcct tgagtttgcc    125280
     gacaccgggc atgaatctgt accagcggcc tgccgagtcg atggcctggc gcagcatgcc    125340
     caggttgatc aagcccgctg tgaccagctt ggaggcagtc acgtcatcga accagccggc    125400
     cacgggatca ctttcggtgg gaacttcagc gctcaatgct tcaagcttgg acagcagagc    125460
     gagctggcgc tggcgcaagc ggttccgcct ggtactggat gcgacgcctt tttccgacgc    125520
     tgggtaggca tccctgtaca tctccagcac ttctgccgcg ccccaatcgt ccagatcgtg    125580
     ctcttcaatg tattgctcaa gagaaggcat tcgcgccttg tcgatattga cgaagccatc    125640
     ttcgacggac ttcaaaaacg ccaccgtctt cggcttgacg gtcagcccga tgagccgcca    125700
     ggccgatttc tcgccatgac gccttgctat ggacctgact gcttcaatgg tctgtcggct    125760
     tgcggtaatc gcttcgtgtc cgtgctcgac cccgaggtac agcttgccgg cctcccgcgc    125820
     atcgacgcct tcggcaatcg cacgcaaatg agcgaagtga tgaagaccga ttttcatcac    125880
     gtacttggtg ggcgcaaaaa agggcgttga tttcattgga gatttccgaa tagggcaggt    125940
     ttccattttg caccattcaa atatgaaagc aaaaaattgc agtcagataa tgcggctaat    126000
     ctgatgccta tcgccaaaaa aaaagtgcca agcgccgttc attcacataa aaccgtacct    126060
     ggttttcaca taaaactgta cctgcgtgcc tgaagcgtcc gctaccccgc tcggcggcgc    126120
     tcatccccga ctgatttcgt tcagcccggg aacggtttca ggtgaaattc catgcgggga    126180
     acatttttgt gtgaaaggac ttcacacaat tttggtactg gatttttgaa aatgcaagga    126240
     aatcaacggc cagtgcttgc tgcgatgaga acagttttat gtgaatggac gaccggcctg    126300
     acgacagccg gcaggccatc aatatcgccc acgttgataa gggttggcgg cagccagcga    126360
     aaataaagtt tgcgcgcgtc aagagagatt tcagtaccgt cctcacgctt gcgtggtccc    126420
     aatcgaaagc catgccagtg cgcgcgccgg aagtgcccgc gcgggctgct gtgttcgcct    126480
     cctgcgccgc tggtttgctc cgcctgatat gccgcccgca gcttggcgcc caggcgaacg    126540
     ccaacgtccc actttgtagg gccagcagcc gggaacaagc gccagccgtc gcgccgtgtg    126600
     cgcgtgagtt cgggattggc cggatgtccg ggcttgccgc gccgggtgta ctcgacatca    126660
     gcgcacaggt acagcagcag gttgaggacc ggccgcagcc agctgtactg ggctgcaatg    126720
     acctcatttt cggactgggc gatatagttg cctccagctt tgacccactc ggccagcgca    126780
     gaacgcaggc tgtcgtccag cgagcctaca cccagctcaa ggtactgtga cttcggcatg    126840
     agctggtcgc ccgtgtcggt acccgtagtg gtctaaagcg tttattgaag tcaacgcgaa    126900
     aaatccattg ctagctccac ttttaccaag catgtaactg gttacatgct tggtaaagca    126960
     cttatcattc gtaggtgaaa aaaacaacgt ggctggttgc ctggatcggc aaaaccgacc    127020
     atgaggccgc agaaggtctc tccagtgcca accaagggcc gattgctggt gcgttgctgg    127080
     gtgcccagag gttcgacaag gtttacctgc tgacgaatta cccgcatgcg cgcagcgtgg    127140
     ttttttgcac atggctggag gccaccacag gctatttacc tgatcaggtc gagctttacg    127200
     acatcgattt gcccagtccc atcgactacg ctgcgatcta ttcagcggtc tgcagcaacc    127260
     tcctggcggc gcgtcttccc cgcgacgagg tgcaactcac gttccatctc agccctggca    127320
     caccggccat ggcggcgatc tggatcatcc tgtcgaagac acgttttcct gctcgcctga    127380
     tccagacttc acgcgagcgc ggtatcgagc cagttgattt cgaattcgat ctggcaagtg    127440
     actttttgcc cgagtttctc gaacgtggca gcgcgcggat cgagcgcctg tccgccagtc    127500
     ccgtgggcgc ggttgcgcaa gagtttgtcg ccatcgttca ccagagcacg gtcatgcgcg    127560
     agcagatcga attggctcgc cgcgtggcgg tgtatgacgt gcccgtgttg attctgggtg    127620
     agtcaggcac gggcaaggag ctgtttgccc aagcccttca tgccgccaat ccgaaacgca    127680
     agaatgccct ctttgttccg gtcaactgcg gggccattcc gactgagctg gcgaactccg    127740
     agctgttcgg ccacgccaag ggcgcgttca cgggcgcggt caaatcgcat gatggttatt    127800
     tcacccaggc cgatggcgga acgctgtttc tcgatgaaat tggcgatcta ccgctggatg    127860
     cccaggtgcg cctgctccgc gtgctgcaga acaaggaagt cacgccagtg ggatcaggta    127920
     cggcccgcaa ggtcgatgtt cgcattgttg ctgcgacaca tcgtgacctg gcggccgatg    127980
     ttgccgtagg gcgttttcgg gaagaccttt ttcaccgact ggccgtgggc attcttcggc    128040
     tgcccccgct tcgcgagcgt cgcggcgatc tggatgtact gatcgacctc tttttgagcg    128100
     ccttcaatga cgatgcccgt gatcgccccg aggcgcagca taaagtgctt tccgagtcag    128160
     ccagaaaact tttgcacacg catgagtggc cgggcaatgt acgggaattg cagcacacct    128220
     tgttgcgagc tgccatttgg tcgcctggcg agtccatcga tacgcgcgat gtcgaatcgg    128280
     ccatctttca ggtgcgccga atcagcgatg ccgtcctgaa tcagccaatt tcgcagggca    128340
     tcgagctcca gcagcttctt gatcgggtgg ctcgtcacta catggagcgt gcgctcgagc    128400
     acacgggtca tcggaaagcg gctgcagcca agctgctggg tttttcaaat caccagacac    128460
     tgctcaactg ggaaaagcgg cttggcgtcg ggaaggggga atccgatgat tgaccgcaaa    128520
     gggtctcgaa cggttcgtcg ttcacaaaac atcctttgtg ggatgaaaaa atgaatgttc    128580
     gcaagataac ttgcataaag gtaattattt ttaccaatat gtgtactgac gcgcgcttaa    128640
     gtcgttgatt tttaatgaag atcacttccg ccttgtgtcg gcacggttct cgcgatgact    128700
     cttgtatccc atcaggagtc attcatgttc aacagcatca cgtcacttcc tccgcctttg    128760
     ttccccttga gcctcacgaa ccacgcggcc attcgcatgc agcagcgcgg tatcagcagg    128820
     gcagcattgc aggcggtcct ggactttggg cgccgcatac atgccaaagg gctgaccttc    128880
     tatgtggtgg ggcgcaagga agtggctctt tatgccgatc gtggtgtgaa cctggccaat    128940
     ttcgaggggc tgcaggtgct ggtcgcggct gacggggcgg tagtcaccac ataccgcagc    129000
     cgcgatctgc atgccatcaa ggtgcaggca cgcggtcgcc cttccaaaca gcatcactaa    129060
     atttcatcca acaaaaggag tcctccatgg gctgggccag ttaccaagaa gacaacgaga    129120
     gtcgttttca ccaagcaacc attattcgca acaaggaaca cgaagccatg aaatccgcac    129180
     cgtcagattc agcgaaaacc acgccagccg caacccggct taaagccttt gccgcaccgc    129240
     aggcacgtcc gctgcccgtt atcgtgctgg ccgatgtgag cggcagcatg agtgaaaacg    129300
     gcaagatcga tgccctgaat gtggccctga aggagatgat tctcagtttt ggcaaggagt    129360
     ctggtcttcg cgccgagatt caggtcggct tgattacctt tggcgggcgt gaagcacacg    129420
     agcacctgcc gctggtagca gcgaaagtta tcggcggtgt ggaagcgttc aaggccaatg    129480
     ggggtacgcc gatgggctcg gcttttgcgc ttgcgcgcaa gctgctcgaa gacaaggagc    129540
     agattccgtc acgcgcctac cggccggtct tgatcctcgt ctcagatggt gcaccgaccg    129600
     atgcctggga ggcacccctg gcagacctga aggccagcga gcggggccag aaagccacgc    129660
     gctttgccat ggccattggc gccgatgccg atctggacat gctggcccag ttccccaatg    129720
     acagagaagc ccccgtgttt aaaacccacg aagcacgaga catcgggcgc ttttttcgcg    129780
     ccgtcacgat gagtgtggtg tctcgctcca ccagtgccgc gccggatcag ccggtgacgc    129840
     tggatatgga ggatggcttg acggacgatc tcgatctgga cacgctgtaa gtgttgcgtg    129900
     ctgcaggggc gtgtgtcacc gggccggccc acctgagcga cgggcaagac gggcaggacg    129960
     cccttgcgct gcggggatgg cgtggcggct ggatcgcggc ggtggccgat ggtttggggt    130020
     cacgcaccaa cagcaggaca ggtgcccggc tggccgtgca ggctgcccag caggtcgctc    130080
     ggcagttgcc attacaggca ggcgcctggc gcgacgtacc agctcgggaa gtggctactc    130140
     gcatctatcg tcgctggctg gccactgtgc cctggacgga aaaatcaagc gcggccacga    130200
     cgctgctact gctggcctgt gatgcgcaag gatacgcgcg catctggcag atcggcgatg    130260
     gcctggtgct gtgccgcctc cggggggaag tgcaggtgat cacaccggag cgcacggggt    130320
     ttggcaacca gacccgggcg ctgggggtcc agcgtgcctg gtcggactgg aacacagcca    130380
     gcttcaggct ggaaaaaccg gatgacctgg tgatgctgat gaccgatggc gtggctgatg    130440
     atttgccagc gccaacgctg gacggtttta ccgccgtggt gcatcgcgag ctggcgcagc    130500
     gcagccggcg ccaggctcgc cggtggctga cgcacgagct gacacattgg gccacgccgc    130560
     agcacgccga tgacaaaacg gtggccgtgg tattcaagga taaataaatt ctcatgaaca    130620
     caagcaataa caaaaatcag ggcagcgcgg tcaagaaaca acgcgtgcag gacgaccggg    130680
     gcacggtgta cgaattgagt gaaaagctgg cagaaggcgg gcaaggtgtc gttttgcgta    130740
     cccgacacga cagccgcctg ctcgtcaaag tcagcaaatg gcctgacagc gatccacgca    130800
     cccaggcctg gcagcgccag atccaagtgg tgcatcgcat gcccattgtt gaaaatgaac    130860
     tgcccattgc catgcccatg gcactcatcg tcaagccgcg agcgggttat gtgatggagt    130920
     tgatggaagg cttggtgcct ttggaagatc ttttgatcca ggcgcaggag gcttttaacc    130980
     aaggcaacgg cttgcagggc ttcgtggcat cgggcgggct ggaccgcagg ctgagactgc    131040
     tggcacgcct tgccagagtg atggccaaag tgcatggact ggccattgcc catggggatc    131100
     tttccccaaa aaacgtattt gtctccagtt cccatgagca tgcccaggtg tggctgattg    131160
     actgcgacaa cctgagctac gcggtgcgca acagcagctt gcagctctac acccccgact    131220
     acggtgcgcc tgaactcctg cggggagaag cgggcatcag cacctacacc gatgtctgga    131280
     gctttgcagt gatggccttt caattgctgg cggcgcttca ccccctcaag ggtggcgaaa    131340
     tggtggatca ggacagcgag ctggagacgc cggcattgcg aggtgaactg ccctgggtgg    131400
     atcatccgga cgatgaacgc aaccgggcct ccatgggcgt ttctcgcgat ctggtttgca    131460
     ccccggcgct tcagcagttg tttgaccgct gttttcgtgt cggtctgatc aacgctgaag    131520
     agcgtcccgt gatgtccgaa tgggccgagg tgctcgaagc tgccgctgcg cagcaggtgc    131580
     tttgcagtac ggccagtgag ggctgtggca gcactttcct gtggaacgca gcgctggttt    131640
     gcccgttctg cgacacccgg catgcagccg gcacggctct gcgcctgagc cactttgtgg    131700
     tggcgccgct cagcgagctg ggtgaggatg ccaagccgcc agatcgctgg ataccaactt    131760
     atttccatca ggtcattgca ctgcagccag tcgagctgag ggcggctcct ccgggaaccg    131820
     caaattattc agagagcgaa cttgtcgcaa cagtctggat cgatggtgat gaattggtga    131880
     tgcggcctgc cagcggtgcc aatgtgctgt ttcaggcgtc tggcagttcc aagctcgtgc    131940
     ctgtgcccag acgtttctca ctgccacgca attcggttcc gcatgccttg catttcggcg    132000
     ggtcagcaca cattcatgac gcctggcgtt tcaagtggtg agatacgcat gaaacttcag    132060
     gaaactcctt tcatgctcaa ggacctgctc ggcgcccgcg tgacggccag ggatttcgac    132120
     ccgacccagt ggcaagtcgg ccaggaagtg gtgctgcggc tgcgacagga cgaattgctg    132180
     ctacggcaaa acgatcaggt gacggccctg gcactgacat cggagtctgg atcgatggac    132240
     tttcatgccc agaacctcga tgccttgtgg ctgctggtgc gtgtcaagcc cggcatggtc    132300
     tggcttcaat gcctggtgcc gatgcagacc tgccagtgcg agcctggctt ggacttcggt    132360
     gcggatcaac gcacggcaga cagcctgcat cagcagcagc tcatcgggca gcccgacatc    132420
     gccgaagcaa tgcgctggct gatggaggaa tttgtctgca cgacagaaga tggctcgtcc    132480
     agccgcgtgt tcatggccat ccatgctcgg caggatcagc ggcagatgca attggtcggg    132540
     cgccgttacg tggtggactt gaagcgcgat gccgagcagg cgctctgggt ggagcgcatt    132600
     gctaagcgtc gacgtgaaag tgacgaacct tttgccctgc tcaacggcca taaccgattc    132660
     gtcgatgcca gccagggcat gcaggcgcaa accggtgcgc agcgggcaat actcgatgca    132720
     gcagtcaaca gtttcggcac ttatttggaa ctatggcatc tctacggcca gaaagaatgg    132780
     gacaaggatg tgcagcgagc atccgagctc aaggcgttgc gctacagcgc ctgccagcct    132840
     gccagcgagg aaggcggcgg atggcggctg agcgtgcagc gtgatgaatt gaaagagttt    132900
     tcccagcgtt ggcgcactct ggctggtgat gatgaccagc ttgaaatcga tgaagacgcg    132960
     ccggactgga gcagcgagca ttacaccgat ctgagtgtgc gcgacaagcg gcgcctgttt    133020
     cgcggcaaac cgcagtggcg tgccgagcac ctgattctgg agggagaatc cggaacacga    133080
     ccgccacagg ctgggtacgt gtacctgtcg ctggcgggaa accgcacgca gcaggaacgg    133140
     cgccagcatg cacggcgcgc catcgaggcc gggctgggcg taccggccct gcgcaatctt    133200
     ctgcaggact tgcccacgcc aacccagcgc ccatctcgtc ttccgggact cactgtctac    133260
     gcacgccaga gttttaagag cggccgtgcc acggacaagc aggaagaagc gatccgcgtg    133320
     gcgctgaaca caccggacgt cgcgctgatc atcggcccgc caggcacggg caagacccag    133380
     gtgatcgcgg cactggagcg aagactcgct gaactcaatg agggtcaggt gattgcgcaa    133440
     gaagtgctaa tttccagctt tcagcatgat gccgtcgaaa acgcgttgga ccgcaccgat    133500
     gtctacggtc tgccagcggt gaaagtaggg cgatcgagcc gacaagaagg agtcgaccca    133560
     gtacaggcgt ggtgtcacaa acacgaggtg attctcgata aacgcctcga tgaacttagt    133620
     agccaggagc ccacgcaggc ccttttgcag caattgggca aactgctcaa cagtctgctg    133680
     atcctgggca cgccttcatc tcggcgcgag gaatcctttc tggccttgga aggcttgctg    133740
     gcccgactcg cgaccgaggc ccgcatccgg ccatcatcgc gctggcagac ggactgggag    133800
     gcataccgcg agcatgcagc cgaccagccg accagcggtc acgacctgat gccggggcgg    133860
     cgcaggcagt tgacgcgcct ggtgcgcgga ttgcgcaccc tggcgagctc gttcgaagac    133920
     gatgggccgc agcgcgcccg cattgcactg gggctgctcc aggaagtgcc tggcctgctg    133980
     acccagcaag acaaggcgct gctgcaacgt gcctccagcc tgaacgccgt ggagccaaca    134040
     ctgctggcag aacttgccgt cctgcgtgac cagttgctcg atcggctgcg ccctgactcg    134100
     cgttctgcga ctgttcgttc gcagttcgac gcatcaactc tcgcgctgct gcaacgcttg    134160
     cacacagaac tggctgacaa ggtggcggcc acgcgccacc atcagtacgg ggtactggaa    134220
     cgctaccgag atgcctttcg ttcccaccca ggctgggtgc gcaaggcgat cgaaaactac    134280
     agcagcatcg tgggggccac ctgccagcag tcagccagcc gccagatgag cgagctgaaa    134340
     aatacggctg gcgactccat ggccggcatg cagttcacca gcgtggtgat cgacgaggcg    134400
     gccagggcca atccactgga tctgtttatt ccgatggctt tggccaagcg acgcatcgtg    134460
     ctggtggggg accaccgcca gctcccgcac ctgctcgata cggacatcga ggaagacatc    134520
     cgtgccgagc ggggcgatca ggtgcacagc aacacctaca aggacagctt gtttgagcgc    134580
     ctgtggcgcc agttcaagca gcgcgaagcg gccgatggtt tttcgcgtgt ggtgatgctc    134640
     gacacccagt ttcgcatgca tcccaggctg ggagatttcg tcagtcagca gttctacgag    134700
     aacgccggct tgggcaaagt gcactctggg cgcaaagccg aagacttcat cgcagaagta    134760
     cctggctttg gcggggccgt gtgtgcctgg agggatgtgt ctgcagaggc aggccgcgag    134820
     gagtctcatg gcaccagccg gcgccgccgg ccagaggcga agcaggtcgc ccgggaggtc    134880
     cagcgcctac tgacggtatt gcagcaggac atgagcgtgg gggttatcac cttttatgca    134940
     gcccagcgcg actgcatttt cgaggaactc gctgggcttg gcatctccga aaaaggggag    135000
     ggtggctggc gggtgcgtcc cgagcatgcg gccaatgtgc agtgcgccga gcggctgcgc    135060
     atcggcacgg tggatgcctt ccagggcaag gagttcgatg tggtggtgct gtcagtggta    135120
     cgcagcaatc cactgcctct gggcttgcgt gaagaggcgg acagcgaaga ggcttatgaa    135180
     aagccagcca gccgcaagta cggccacctg cgcacctcga atcgcctgaa cgtggccatg    135240
     agccgccagc gtcggctgct ggtggctgtg ggtgatcagg ccatgttcag cggcaaggcg    135300
     gcctgccagg ccgtccccga aatgaacgcc tttctggaac tttgccaaca ggaggctcag    135360
     catgtcagcg cctgagcgtt atttgcgctg gaacgggcgt tccccacgtg gaaagaagct    135420
     gcccctgctc tggccggtgc tggtctggac ggtgctggca ccgcaggcat cgttgcgtct    135480
     gaatgtcttt caggaagcca tcctgggttt gctgcatgca ggcgaacgcg acctgaatcg    135540
     gctggcaagc ctgctggagt tggcgccgga attggtggcc tacatcatcg ccaaggaact    135600
     gcagccaatg cgttttgtgg attcgcggca gcacgttacc ccggaaggcg tgaagttgct    135660
     caagggcgag actggccgcg aaccgcgttt gaccttgcag tatgcatttc aagacgccgt    135720
     gtttggccaa tggcttcccc gcctgagtac aaacttgcca gaggtgatgc cgcgcgaggg    135780
     cggcagggcc gagcgcccgg agtttatgtt caaccgtgac agcggctggg tggatcggcc    135840
     attcctgctg cctcgcagag attgggcggg cccacctgag aagaaactgg tgctgcaagc    135900
     ctggcggcaa tgccagcggg cacaggcgca atccagccag gacgataccg gcttcgtggc    135960
     ggatttcagc agcgaggaca tcgatttcgt cggtgaccag ccgatgcagg ctagggtctg    136020
     gtgcgacctg tatatcaatc cggatgaccc gcagccctgg ctggtcagcg acccatggca    136080
     tttaactggg gctgcaaaat ggttgcgcga gcctttgcaa aaggaattgc ccaggtttgc    136140
     acagctggcc gagcgcattg gaaagctttt gcctgaagtc ggcgccagcg ataaggagac    136200
     cgaacttcag gttgagctaa agctggccgc gatgccccac ctgaccaagc ccgagcatgc    136260
     acttctgcgt gagcatttgg gccgtgtgat gcgtcaacgt ggccggctgg agcagcagga    136320
     gaggactcac caggaagaac tgaacagcct ggcgcaggaa tgcgcatcgt tgctggaggc    136380
     cattgtgaaa tggttgctgg agcgctggcc ggtggatgcc agtgactggc cccgtacgca    136440
     ttggagccgc caacacggga gcgagttgtt gagccagttg cctttgcggg ctgatttgag    136500
     ccgccaagtg atcgccatct tgtgtggtca agaagccaaa gtggtccggc tggcggtgat    136560
     gctcaaagac cgccctttca aggctctgct gttcggcgcc ttgctgtgta cgcatgagca    136620
     tgccgaccac cccttgcgcc accttccggc aaacagcctc caatgggatc gggtgcttga    136680
     attggtggac aagcgcaaca agggcagcca cgccagcggc cagagcatgg agcgccacga    136740
     aatgcttgaa tgggcggact tcaccctggc atggcacgag caattcaaac cttatttcta    136800
     ataaaaaagc taaatatcac acctcatggc aaaaaagaat aaaccgaatt atccgaacca    136860
     aaaagcttac gctgcgggta cgacacccgc acctgcatct tcatctgcgc cgagtgggtt    136920
     gttcgggcga atgtttgcga cggttaaaca ggccgcccct gtgctgaaaa tggatgcgcc    136980
     acattgggat gaagatcagg tcaaggattt atggggaaaa ctgcccacac cagagcagct    137040
     tcggttccag gtctttactg atcagttcac acaacttgga actcagatga aggaagcgca    137100
     tgagcgcttc gtcgctgcgg aatcggattt caacgcgcag cagcaggctg gggacgccaa    137160
     actggcgcag gaaatttccc gacttggcgc cgaacaccaa gcgatcagcg atggccatgc    137220
     tgcgttgagt gcagagcgtg aacacttgcg caccacccag gcagcgttgg agaacgagcg    137280
     agccggactg cagcaacacc gtctggccat cacccgccag gaagaacacc ttaccgttcg    137340
     ggaggccgaa ctgcgtggtg gcctggtggc cgagcgtgag cagtcgctcg cagagctgcg    137400
     caagcaggtg tccgatctgg aaacgctgag aaaccgcctt cctgccgaca tggacaagga    137460
     gcgccagaca ttgctggccc aagcccggct ggatgcacaa gccttgatgg ccagtgccga    137520
     gcaacatgcc gccacgctgc acggacggga aatcaggctc aatacgctgg agctggagct    137580
     ggacaagcgc aatgagcgcc agcagatgaa cgaggagttg ctccaggtaa ggtgcgcgtc    137640
     gctcaccaag gagattgagg aaggctttca acgccaattg gatgacaaag aggaacaact    137700
     ccagcgcagg ctcaaggatc tggacaagct gcacaacagg atagaccagc agcagtcaga    137760
     actcgatggc ttggagagtc tgcgtgatca ggtgggagac gatccgcagc gcatgctgga    137820
     tgaacttgat gccttgcggc aggacaagcg cgctctggat cgggaagtgc aggcactgcg    137880
     cgccaatcgc tcggaagatg acgccaatga actgcgcagc cagcgtgacc ggcttcaaga    137940
     gcggctgacg aaagatgaaa atgaactgtt cgatttacgt catcgcgagt cggtgtggcg    138000
     cagcagtgtc acagaacagc aagactggca aaaggcacgc aaggtcttag aaaaaaatcg    138060
     ggaactgctg cacgatgtcg ttgatcgctt gcagagcgat gtggatggaa tgctcagcaa    138120
     gcaaaaggaa aatactgtat ttcctgaact gacccgcatg gacctggaac tcatcaagcc    138180
     ggttcacacc gatccagtgc cagagctgaa gcacctcgtg ggcgatttgc aagcgcgcat    138240
     tctgtatgcc gagccgggca aagagttgca ctttcgcaag gaggagttgc agctcttcgt    138300
     gggcggcctg gccatgagcc agctgcacat ttttcagggt atcagcggca ctggaaagac    138360
     cagcttggcg acggcctttg ccaaggcggt gggcggggaa tgcacgattg tgccggtgca    138420
     ggcgggctgg cgtgagcgcg ccgacctgct gggccacttc aactctttcg agaagcgcta    138480
     ctacgagcgc aacacgctgc aagccctcta ccgcgcacag accgaagctg atcaggatcg    138540
     ccttcacatc gtgctgctgg acgagatgaa cctgtcgcga cccgagcaat attttgccga    138600
     gttcctctcg gcgatggaac tgagcgagcg ggatcgctgg atcaacctga tggaggcacg    138660
     acctgcacat ggtgcaccga ccaagctgag aaatggacgc gacatcttgc ttccgcccaa    138720
     tctctggttc attggcacgg ccaaccacga tgaaaccact aatgcatttg ccgataagac    138780
     gcatgaccgg gcctttgtgc tggaattgcc caagcaggac accgtgaaag aaaagatcgc    138840
     caagccgcag tcgcgtgcga gctggagctt tgagagcctg aaccggcagt tcaacaaggc    138900
     tcgcgataaa tacaaggatc agattgccga gctacagacg ctcatcaacc aaagcagcct    138960
     gactactttg ctcagcgaaa cattcagact gggctggggc aatcggctgg agtcgcagat    139020
     gcagcgcttc gtgccggtgg tgttggaagc gggcggctct gaagcgctgg ccgtggacca    139080
     tctgctggcc agccgcatgt ttcgcgatgg caaggtgatc ggccggcatg acgtggatgc    139140
     aaacaaactg catcaggtgg aagatgcact gagagtgatg tgggaggact gcgagctcac    139200
     gggcgaaccc acccgttgcc tggccgcact cgaaagcgac atcgagcgcc tggactcggg    139260
     cagatgaagg tctttgaccg ctatgtcggc gccgatgtgg agttgcctgc cgaagtggat    139320
     cccgggcgct accgcttgct tgcaccggtg tgtcttaacg ggaccctcct attgcaggcg    139380
     ggtgaagtgt tgtggagcga cggcggcagc cgctgcctgc tgacggaaag tctgtccgat    139440
     gagcaggtcc gcagtttcag gacttctccc gctgagcagg acgggcagac gcctggttct    139500
     gtcattgacg cggccgtgct ggctgtggcc gagcaagtgg aatcgatgaa cccgggggac    139560
     agtctgccat cgccagtgat gccaacgaag ctgggagagt tggcgcagat gtaccccttg    139620
     gagcgactgc tggaaacaac cctgtcggca ggacatctgc aaaccatcgc caagcgcccg    139680
     cgcatggaca tgcgttacga caccgaaatg ctgcccgtgt cccgcgtcca gcggatggcg    139740
     gtggatgcgg tgacgcgtct ggcctcgcat tccgaggact ggatccgccg cgagatcacg    139800
     ggcgtcgtgc caggacggct caaggcggag atcagccagg acgaactggt aatttatgag    139860
     aacattgtct tcgctcgact gcttgatcgt cttcgtaaaa cgctgcgcaa gcgtctgcgc    139920
     gatctcgatg ccttattgtc caagcaggct gaagctggaa agctggagaa tgcccagcac    139980
     tttgaccacc gtctaaggca tgacttgtgt gaactctggg gtcggtcttt tgccgatcaa    140040
     cctggagccg gcaaatcggt gcatgtcacg cgcgaccaaa tcagcgcact tttgggcaag    140100
     gtgacgcagc ttcagcgaag cacggtagtt caggcaattc ccccgatgca gcaggtgccg    140160
     ctgtctttgc gcagcaccaa tattttgcag catgaccccc attaccgcca tctgcggcct    140220
     ttgtggttgc tcgcccattc caccttgctt cagcaagcac gcagcccgca agactggctc    140280
     aacgatcagc ggcaacgggc tcaacgctac agcgcttata ccgggttgct ggttcgccat    140340
     gccttgcatg ccagcaagat ggttgatccg cagggtgaag gggcatcctg gcgcttcggc    140400
     ccatcgacac tgacactgcg cagcgagcgc ggggactgga tcttgcaact gcgcaccggt    140460
     acggggtcag ttgagcagct gaccgtggta cctgcttggc gtggttgccg tgactgggag    140520
     ggtcaaaagc ttgatcgctg tgtgttgttt tgccatccag acgagacgga ggcagatgac    140580
     agcgcaacag gcagcgacag tgtgctcaat ccgttgcagt tctatggtgt tgagcgtgtg    140640
     cggcaggcga tcgagcgatg gctgctggct caactgctga ttcggtatcc gttccacgtc    140700
     aagaatgtgc cagcagcctt agccaacgat tgcaaaaatg ctgcgcctaa tttcatcaag    140760
     gttgacgggc gatcactcag catcatcggc gcaccagacg cgcaagtcag agcgaaactg    140820
     gaagagttca tgcgtgccgg caagaccagc caggaaacca ctcatgcaat cactaatgcg    140880
     ctggatcagg ccaaactgct ggccaaatgc cggctttgtg gtcaatccgt agcacccagt    140940
     gactttaaaa aatctgcaca tggattcaag gccagttgtg gctgtggtca cacctggacg    141000
     tttcagcgat caggcgatgg taccctgcag gcagcgtacc ggcttggcgc tcaacagcgt    141060
     ccgttttctg agatcgggag tcgagaactt ttgattgggc cggcttcttt tgcgcaactt    141120
     cctccacagt ccacacagaa aaagcagtgg gtttcgtaga ggccgtcagg cctgaatgaa    141180
     aaggccgtgc agacgaagga gttcgtttcc atcgacgcca agccgagcag catagcgttc    141240
     attgagccgc gtcagcatcg acaggacaat ctctccgcgc aattcgtccg ggcgcaacgc    141300
     cgtgagtcgg tagaccaggt cggcgaattt cctggcctgc tcatccaatc cgcctgtttt    141360
     gccgtctacg gtggccaggc tgcgcgcgat cgcaacccaa aagcacgtgg cccatacttc    141420
     gagaaagtca tccggaactt gctccaggct tgcgtcgagc tggaacgctc gggccaacgg    141480
     ccgggattgt ccgaaaaagg tgaaaagcag gatgccgatc agccgcatcc atccctcatc    141540
     gccatcggca ggaagtatct ggtgcttgtg caggcctttg cggtccttgg ccagtgtgcg    141600
     ctcgctgcga gacgtgcccg caccggcgat gactgacaac aggatgcgca gtttcagcgc    141660
     ctgggcggac cccaagcctt gggaatccgc cagctttttg caaagttcgg tgaacttcat    141720
     gaccgacctt gcgtaatcct gcggcgtgtc tgtctttcgg atttgctttt tctccggttc    141780
     gcgttcagcg tcgggttcgg ggatgctctt ggatccgatc atgggggtgg tggatgcagg    141840
     caacgaagcc agttggtcct catcgccttc gcggtcggtc tggctcttgt ctgtcaagga    141900
     cgtctccagc gcctggttgt cttccgtttt gtcgaagaac acctcttggt gtgacttcag    141960
     caggcggttc aggaagattc gggcggcact tagctcgctg ccaccaagcg aactccgggt    142020
     caccttgaac tcgtcggcgt gagcccggcg gccagcgatg aacaggtcgt acgcaaccgc    142080
     tgcggtggag gcaggaaggt cttcttcctt gggcttgtgt cgagccatgc ttcgtgccgt    142140
     ggcggtatcc aggctctctt caactggacg agcgtcgttg cgctcggcgc gctctgccgc    142200
     ttccagcgta tcgatgacgt ccaataacca gagtccttcg tcctcttccc cgtccaggtc    142260
     ttgcaacgct cgctcggttg gtccccgccg aacctcacgc gcggcttgct gcaactggtc    142320
     ggcccaattt atgacagcca agccggatat cgttccgtcc agtcgatgca ctgcggcgaa    142380
     ccgcggcggg tgagagaaag cgccgagccg aaagcgcttg ggcacggtgc cagtgctgcc    142440
     tggaagggcc aaaagtgcaa tggcaagcgg ctgaccatcg atgtcgaaga gctgcagcag    142500
     ggaaggctcg acgtcagcat cctgatcctt ggtgggccac cagaagagcg tcatctggtc    142560
     cagttcgaag cgcccaggat tgaggcgctc accttcgtcg agcgcgatct catttgtcat    142620
     aacgcactgg cagttggcca gttcgtcaga ggacattgct tgcgccgaca tcgcagcttg    142680
     cagaccgagg gactcgatca tggagccggc cggaaggagc tggtacaggc tggcctcctc    142740
     gttggtcccc gcaaacgttg agttgcccat ggcggccacg gtgcagttgg cgctgccagc    142800
     gagcacgtgg tccgcgtcgg ccgtctgcgc gatgatgatc ttggcatgga caaaccggtc    142860
     cttggcgggt ttcaccccgg cgcttgcaag gtcgatgaca cgcaagcccg ggatgcgtcc    142920
     ggcttggggc ccagggaaca attgcatgtc tttctggatg agcgtgatga ccgattcggg    142980
     ctgcagaata ccgacgagat ggtcgagcgc ctgaagcgtg gagtcccaat agggactgac    143040
     aacgatgagc tgctttacac gggctggccc gatggcctcg gcgaagcggg tggcaattcc    143100
     cgctccagag cctgtggaga agaaccgggg cgttgcagga ccgtcggcat gggggcggtt    143160
     gagcgcagtc ttcaaccagt gcgcgcgatc aagggtccag cttatctggc gttcgatgcc    143220
     cgactgtgcc cggtcggcat gccgcagcac gaagcgccag gcagccacga gggccgcttg    143280
     ctctggcgat tcgctctcgt cacaaatgat ttcgctcgtc acctctaggt tgccggaaag    143340
     acccgcggcg gtcatgttgg cggaaccgat gacaagtcgg ccctgcgtcc ggccgatttg    143400
     cagcaggatt ttcgggtggt agacccccga tccctcggga cgaactcccg tcaggctgta    143460
     gaagcgacca gccaagcgag gcagtgccac agggttctca agggccagcg cgagcatcct    143520
     gtggtcggcc agcaggaggt tgttcgtgca cccattccca cgcaggcgcg caagggccac    143580
     gttttcgtac gtatcgaagt cgataccgaa tgtggtgacg acgctggtgt gataaccccg    143640
     agccgcaaat gcctcataca gcttcattgg atgagtcgac gcccaaggtc cgtgatgctt    143700
     tttgagtcca gcaggtgaat gtctttcagg aagtcgatcg aggtgtccag gcgcggcgtg    143760
     gtctgcaccg ggccgtcctt gcggcgcagg cgaacacggc cctcatcggt ctcgacaagg    143820
     aaggtgtatt cgccttggta ccgcagcttg cgcagcgcga cccacaggtg ccggtgcagc    143880
     actcggtcgc gaatcagact ggcaacgact tctttgaaag ggcgctgtgc aacgctgtcg    143940
     aggaaggcca tctcggtatg gatggagcgt gcgccatcgt tgtcggactt cgcggtttga    144000
     gttacgaacc cagcgctgtc ggctttcgcc cgttggctca ggacaaccag cagttccagg    144060
     ctgttcaatg catcacctgc ctggacgctt gcattcgggc gtgctgaacg gagcagccgc    144120
     tcgaggcggt ggtattcggt ggctggttcg ctggaacttc cccatccgac ggctgacgcc    144180
     gtgcctgtgg tgaactgggc ccagctgtct acaggtgctt gccgttcatc ggcaatgcgt    144240
     tgcgtcgcct ccgcgatcaa ctcgcgcatt gacaggccga tgggataccc ctcgaggatg    144300
     tcaagcgtgt atttgagcag cgactccagg cacatgtggc acaggtcgtc gagctggtac    144360
     agccaccagc ggtctcgatg ggcgcgcaag gcagggtcgt gcagttgcaa tggctgccca    144420
     tcggcgagct ggccagtgta gaggctccat cgcacatcgg tcgaagtcgg acaggagccc    144480
     atctggttgg ccagctgcag cagcaggatc agcgtcatct tccggttctg gtcaccggcc    144540
     ggcgtgtttg ccatgcggca aaacaacaga tcctcgtaag cggcgcgttc ctggctgtcc    144600
     ggcgggatcg ctgacggggc cagcggggcc agtcgtgtca gctcctcgtg tgtgacgctg    144660
     ccgcgcgtca gaacgtcgaa gaaggtttct cccagctcgg ctcgtgcgtc accgaagagc    144720
     cgtgccagtc gatcgcctga ggcctcgctc ggcaccggca ccgggtgtcc atcggccttg    144780
     gtgagcaccc cggtggcgac cagctggctg taataggcac ccccatacgc gccccattcc    144840
     tgcctcaggt acggattggg agccatggga tctgcaccgg cggcaaagtc gacggtacct    144900
     gtcggttgat tcagtgcgac atgggcccag ttggtgccag ccacgcccct ttccccagtc    144960
     tttttttgag ccacgagtgc gtacagcaac tcggcccgcc taacatgcca cttccatgtc    145020
     tcgatgtttc cgacgcccac ctggcgggcg tagcggtccg acagccaggc gtacaggccg    145080
     tagtaacgca ttcgcagcgt cacattactg atgcccggga ccagatcctg gtacttcgat    145140
     acgctggcgt tctgcatgcc cagcgggtca acgccattct tcacggtcga atcggtccat    145200
     tcaggaggca ggctgcgggc gttcacgtgt tcatggtcta tgtggggagt cggtttgtat    145260
     caccgtgtaa aagtatacgt ggcgtcgaag ctttcgcgca ccggaatctt cggcaaatga    145320
     ggtcgaagtc ttaacgcatt ccgggcaagt ggttggcccg tgtacggagg aattcatgtg    145380
     gaaggtcgtc acgcatgttg gctccgatgc gcttttgatc caggtgccgg cattgcactg    145440
     tcttcggaca tcaccttgca atcccaatgc aggcaacggt ttgcctagcc atgcatgggt    145500
     caacgagtac ggcacctggg tcaattcctg ggtagccgca ccaagggttt gatggaaggg    145560
     ttttggcgct gagttaaaac gcatgaaggt cggcatcgga ccattcggta tagagcaaac    145620
     gctcgacatc aagcatcgtc accgggtact tttccagcat ttcacccaga tggcgccttt    145680
     ccatcagatc gaccccgttg agtacggcgc tttcatgcgc ctggacgttg aaatgctggt    145740
     tcgtcaagcc gactttcttg aaggtgacgc ctggatggcg gcggcggtaa aaagcttcgc    145800
     cggccaccac ttccttgacc gtgtcccagt tcaaacttcg atcgtccgca gctgaggtct    145860
     tggtctgaac cagttcgccc aggttcccgc ggatgcccac cacatccacg ccgttgtcgc    145920
     tcgatccagg cgtgcaatag acggtttcga agccgcgttt acacagcaaa gcggcagcca    145980
     ggccctcgaa atggcgccag tccatgcgca aggccaggtc cagggtcacg cgctcatcga    146040
     tcgagccgac gtccgcatcc ggaataacgt cctcgatctt gaactccgcc agcgagatgt    146100
     ccggcgagcc gttgagcatg tcgccggcga gcgagcgctt tctctcgagc aactggtcga    146160
     gcttgacgtc aaaggtggtg aagtcctgag ccgcgaccac cgggcagtag acgtagacgt    146220
     ccctggtctg gccgatgcgc caggcccggt cggatgcctg gtcttctttg gccgggttcc    146280
     aggtgcgtgt gtaatggacc acatggttgg cggcctggat gttcacgcca aagccgaccg    146340
     caaccggtga caagatgatg acgccgaagc ccggctttgc ctgaaaggcc ttgatgcgct    146400
     tttgacgact tgccgagtgg ctggcagacg ccgaggtatc gccgttgatg atgtcggcct    146460
     gcaaggcgaa cacctcttcg atatagtgct gcagcaagcg ctggatgttg cgaaactcgc    146520
     aaaagatgat ggctttttcg ccctgagact gaatcagtcc gagctgattg agcagccagt    146580
     cgagcttggg cgctgaggca cggtattgcg agatgggctc gggcttgaag atactcaagc    146640
     catgacgcct cgggtcagtg cagaccagcc gcaggtagtg cagcagccca aggtgattct    146700
     taaagggtgt gcgaaacgag ggatcggccc gtttcttgaa gtcgccaatc gccttggcgt    146760
     acaagttcct ctgcgtggat gaaagcggca agcgcctgca agtgtcgacc acgattttcc    146820
     tgggcaggtt cttggccacc tccagcttgg tgcgccgcag gatctgcggc tcgatcaggc    146880
     tgcgcaactc ctcgatgcgt gtctggcctt ccttgtcacg tgcatcgatc tcgatgggac    146940
     gccggtactt gcgaccaaag tcgttgagcg caccgagcag gccaggttgt acaaaatcaa    147000
     agagacacca caaatcagcc agcgtgttct cgaccggcgt gccggtgcat gcaatcttga    147060
     actgggcatt ttgcttcttg gcagcgcgcg tgaccatggc ggccgggttc ttgatgcgct    147120
     gggcctcgtc gcaaaccatc agcgaccagt gctgcgtagc gaacgagaat tccaggtcgc    147180
     gcaaggtttc gtaggtggtc agtaccagtt gggcattgcc cacccagtcg ggcttgagga    147240
     agcggaccag gccgtcttcg ttcctgagcc gctcctcaat gctttcccgc ggtacgcgaa    147300
     ggggtgagag cgcatcgcca taggcggtca ggatgcgcag ggctccagga aagaacttgt    147360
     gggcttcttc gagccagttc tccagcaagg aaaccggtgc gatcaccagc atgggcgctg    147420
     cattggaatc gctttctacg atggacacca tcagcgataa aagctgcagc gtctttccca    147480
     gtcccatgtc atcggccagc accatgcctc gaacctgaaa tgtgtgccgc aagctgtaga    147540
     ggtgctgcag cttggccacg ccttcttcct ggtgcccgag cagacggtgg tccttgctca    147600
     gggagttcga aatcgtgggt tcgcccagcg cgacgatcat ggcctgccgc cgtttttcct    147660
     cgtaatcgac cgtctcgatg ttggcgcgca gcatcaaggt cttgcgtgcg gacggcttgg    147720
     tcgccccttt gcggtccggg tcgaattttc cttttttgac gtcttccaga acttcatcga    147780
     aggtttgggt gattctctgg gcttctgcca gtggcattgg tttgggaagc cagggcagct    147840
     ccaccgcgct cttgcctgcg gcttgggctt tttgcgtctg gtctcgcagt tcttccaggg    147900
     catggttgtt cacgggaacc gtcactgctt catgctcgcc ttcaggggtg aaggcgatga    147960
     ccggaaagac gttctctggg aaccagctgt cctcttcctt tttcttggca atgtagggcg    148020
     agtagtaggg tggctcgacg ccaatgcctt cgacacgaga ggaataatgg gacaggtcat    148080
     gcacctgtgc atgggtcacc agcaggcggg gctcggtgcg ttgcgccagg gcctgcttga    148140
     gcgcatggag gtggtcgggc gtgtcgccca ggatttcgag ttcgctgcct tgccagaatg    148200
     ccagctgaag gccgcggctg atcgcctgct ccacgctggc gatgaaggcc ctcagttctg    148260
     cgtcgtccag atactgcgtg ttcgagccgg tgggaccact ggaggacgcc gactcgatga    148320
     ggatgccgac cttctgcgca aagcctgcac catcacgctc gatgacaggg gtgaagcgct    148380
     cgaattcgag ccccgcatct tcgcgggcct gctcgaattg cgcttcgtcg atgacctcgc    148440
     tggccgcttc accaagggtt gcgaacggat tgagcaaaaa ggcctgtgca cgggagccgg    148500
     ccacgcggcg cgccggaaac cgtttgatct gctgcaggac cgtcttgacc tgcggggaga    148560
     gaacgatctg caccaggccg ccgtcgtcca tgggcaggtc gtagcggtcc agggtggtgt    148620
     caaaccggtc gaactgctcc agccagttgg gcggagcccc ttcgaatccg gggatcactt    148680
     cgaccacggt gtctttgccc gtggcgtcgg acttgcgaaa ggccattttc agccgctctg    148740
     gcgtcagcac gacggtcttg accaggaagt cgctcatgtg agcgctcgca gccagcgctg    148800
     atctgcggat ttggccccag gcctgacgct gccgatgatc ggtgtggtct tcaggaaagc    148860
     gctcggcgaa cgccaccacg cgcttgaaca gatcccactg cggcgcactc atcagctctg    148920
     ccttgccatt gagttgcagc acggggccga catgatgggg cgacaccgcc ttgccactgg    148980
     catcccgcca ggcacccagc gagatcgaaa aatcgctgtc ggtcaacgca tggcggctgc    149040
     tcagggtcgg acgcaggccg gtggtcgccg gtaaatcgag ggcttgcgac aactccgcat    149100
     agccgggcag gtccatcgcc tcgtaaagcg agtcccaggc caggaaatag cggccgtgct    149160
     catcctcctg ggtcagtccg tcatccgaaa gctgggtcat caagccagtc agcgtgggga    149220
     aagacaagga atgatcgcca gcacgcttgt cccgatggac atgaatgccc gaggcatcca    149280
     ggctgcgcag ccaaccgggc gcttgagctg cctgtggggc aggcgccttc ttgaagagtg    149340
     acaggatatt cattcgattt ttttccacca gcccttgccg atggtgaatt tgaaacccca    149400
     gttcgtcagc agctcccgga tatgcggtat gtgggccggc gccatcaccc agagggcgcc    149460
     acctctgtcg gagcggtcct gcaccgaggc cccgattcgc atgcagactt cacgcaggtt    149520
     gtccatggtg aaaggcagat cgggggcaaa aggggcagac tgatcagtgg cgaaggccgg    149580
     agccgtcgat tttggaactg gagctggtgt tgtgaaggtg cgtggcatgg gccgcgttga    149640
     ggcagcagga gccaaggtgc gtgcggcgaa gagcggtgtc tgcggtgatt tgggatgcgg    149700
     cggcgctggc gcatcattcc attgacgttc aaccacgacc cgctgcggcg atgtcacccc    149760
     ggggcggatg ttgaacttcg tcctcaactc gtcctggaag cgaccttccc agccattgaa    149820
     gcctaaaaca ttgtcctgat gacgcagata aagtgctctg gagctgtttt ttaaggaatt    149880
     ttgaccattg acaggcgtgc gtaccggctg cgtcagatca aacggcatgc ggtttttcac    149940
     gttgtagccg taaaaggcat tcgacgcccc gctgaactcc actgcgacca aatcgcccat    150000
     cgtcatgatg aacgcgttgt tggcggcgat gttgtcttgt aaggggacga tcagtccctt    150060
     gagcttgtcc ctgagctcga caaagtcgcg ctcccgtgag tacatcgcgt gaggacccag    150120
     tgcgaagtgg atttcctcaa tggcaggcac gtatttggcc cagaatttca cgcgtcgggt    150180
     atcgctcagc ccatcctggg cgagcttggt gaaaaacagt tcaatgaact ccagcttgag    150240
     ccagttcgac accatctggc gcgcagccgt ttgcacgccg ccccagcggt cctggttgga    150300
     aggcaaccag gggttgcccc aacaggtgac cgcatagtcc cttagggacg ggtgttgggg    150360
     gggctgtgga atcagggcat aacggtcaag aaggatttgc aggccacggt cgcgcaaaac    150420
     ctcattgccg ccgagcaggc gcaacaatcc gctcacggca gcatggaatg cctgatcgcc    150480
     cagttgcgtt gcttgacgga tctgcgcgat gatgagctcg cgcgtgaacc acgagccgtc    150540
     gctgatgccc agcagcttgc ggatgtcacc gacaaggtcg ctgttgcctg ccagcaagtc    150600
     tgggccataa gcagcgcagg gctcctcggt gaagaggccc gtgttcgaca aggtacagct    150660
     cacccagtcc ggattcaggc tggcatcgcg aatgctggct gcgttgctgt tcaaataatc    150720
     acgcagctgg cgccagttca cctttccaac gtcgggcgtg ctccggccca tgccgtcgta    150780
     gtcgaagtag ctgcgcacca gtccttgaaa acattttcgg tactgtctcg gcgcaccctg    150840
     ccaggcatcg acggcatcaa gcgcggatcc gaacaggcgc ttgtcttcca tcaggctgcg    150900
     ccggtcatcc cagggtgtca ccgccaggcc aaaggccacc aggcgggcct cgcgcaaggt    150960
     ttcgacgtgt cctgtcttcc agaagcggcg aaccgcctcg atctgcaggt ccttgggttc    151020
     gtcgtttcgt cctccggact tgacctgctt ttccaatgcc aggagcacct tgtcaatgtc    151080
     gtcgctggca cgcacatcca ccggcgagtt gagcgccgct tggttcagca tcgaggaaaa    151140
     gaggttgagc aggtccatca gatggcgcat gccccgaagt tgcctgaggt ggcaggagac    151200
     gcaatcggtt tttcctcgac gccaaggaat tccagacgca tttcgacgcg ccggctttcc    151260
     tctgccgtgt ccttggagga attgaaggca aagccgccca ccaggaacac atcgcgcacg    151320
     gcatctttct gagcctcagt caacgcatca gcgccgctgg tggtgaacat ggcgcacagg    151380
     acacgctggc tgcgcatcag gctgaggttg agattgccca ggtaggtgcc ggcacggtcc    151440
     gtgtagcctt cgacgacaac gcgcttgagt acgcgtttgc agctcggtgt ctgcgccatc    151500
     gaaagcagtt cgggaacgaa gcggcgcaag accgcctcct gctccggcgc cagcaccgag    151560
     ctgccaaaag cgaagcgcgc ccggtcgccg aagtcgatta cgcggcggtc gagatcaacc    151620
     ttcaccccct tgtgccgctc ggccgcggtg acagcctgcg ccatgcaatt gtccacgtct    151680
     ttcttgtgct gagcctcgag cgcttcccgc gcagaaacgg tacgggtcac cgccagcagc    151740
     gccacggcca tcaccaccag gaacaacacc atcagtgccg tcatcaggtc ggcaaaggaa    151800
     atccagaagg gtttttcggc ttcgccctgc gagcctcgcc gggtgcgagc gcgtgagccg    151860
     atcatgcgat ggctttcttc ttgggcgttg cggtcaccag cacgtcatcg agctccttga    151920
     tggagctgcc gagcatgccg acagcggccg agagcttctg ctggaactca tggttagctt    151980
     tgcccaggct ggtggtgacg gaaacgcgaa actcctcatg ggccttggcc agcacggtcg    152040
     cgacgcccat catgaatttt tcagtctcaa aatgagccga ggcaagcttg tcgctggcct    152100
     gctcaatgcg ctgcagaacg ttcgacgtga tgctgacgtc tgacttggcg ttgttcacca    152160
     aaccattgag ttctgccacc atcgcggcga ccgcttcgcg gtgcgatcgg tagtcctgga    152220
     tgccttgttg cagcgccgtg gaggaggccg tcagatgtgt tgtcaggtcc gacagctgtc    152280
     cggtaacgct ggacacctgg tggatggtgc cggcggcctt gtcactggcc gcggcaaagt    152340
     ttcgcgcggc cgagttgacc tggtcggcgc catcgctgag tcgggaaatg gccgaagtcg    152400
     tcgtcgtggt cagtgcggcc acgctctcct gcatccgggc ggaagcctgg gcgatctgct    152460
     ggacgagact ttccaccgag cccaccatgg cgctgacgag ttcctgggtt ttttgggcgt    152520
     tttgctcttc tcgctggcgt ccggactcca atgcagattg ttgggcgccc tgaaactcct    152580
     gcagcatgct tcctacctgc ccgccaaggg cctgcatggt ggatcgaacg ccggcgtcgg    152640
     tagcggcctg gctcctggag agcagctggc ccacctcgtc aacgaatgtc tggctgcgcg    152700
     cagcaagcgc ggccacggcc gactcggtct tgctggcatt gtctgcctcg cgttgctggc    152760
     cggtggccag agcggcctgc tgcgccgcct ggaactggtt gagcatgtcg cccacctggt    152820
     ctccgatggc ctggagcgtg ctttgcacct tggtaccggt ctcgttttgg gaacttgaaa    152880
     ccactgcctt gatttgctcg acgaattcgc gcgtgcgctc gttgatgctg tcttggcgct    152940
     gctccatttt ttcgattgat tcggccattc gacgggccat ctcgtcgctg gagttctgca    153000
     cgccggcaga tgtcgccgta tggctttgct cgatggccag cttgagttca gccaccagtt    153060
     gctgggtcga ctgcgtgatg gccgcttgcc tggcttccat gtcgctcaag gccctggcca    153120
     tttgttcgcc catcgaagcg ctcgaactgc ggccggcttc ctgcaggttg gcgaccagct    153180
     cgttgagctt ggtgacggca ttttgcatgg tctcggccgt tttatggttg agttcgttga    153240
     tgccattgat ctgaccgccg aagaggtcgt tgagcttctg gctgaagctc accatcacgt    153300
     cctggagcat cttgatggca gtcgccgact gatcgcccga tgcctgcttg acggccgcct    153360
     tgatttcttc aaggggcccg gacagtccat tggtgatggc gcctgagatc gtgtcggcca    153420
     tggccgtggt gttgtcccgc gaggcttcaa tctggttgtg cgatgcttcg ctcatccgct    153480
     cctgaaagga gcccgccagc cgctcgagca tcttggactg tttgtcgctc aactcgtgaa    153540
     ggatgggcgt gaggtccttg attaattcgc ccttgagctg cttgagttgg gtggccgatt    153600
     cctcggtgta ggacgcggtc tgctccagga atttttccgc ggaagcggct gcaaacttat    153660
     cgtcaagcaa ctgggcaatg tagtcgacct tggcgtaaag ggagttgagc agcagctttt    153720
     caagaaaggt cgccagcatg gccaagctga tggccgctgc cgagatgaga aatgcatcgc    153780
     ccacagagtg catgagcgat tcaaggcttt tttgcgctgt ttgcgcgacc gagtcctggg    153840
     tggcggcatc tccgccttgc gtcaaggcac tcaccttgaa gttgcgcagg ccctcgatca    153900
     ggccaagaaa tgtcccgatg atccccaggc ccgtaaagat gcccggcacg tgcttgaaaa    153960
     actcggcgtg cacccgggat tccaccacca gttgcccgtt ccagaaattc tcggccgcca    154020
     ccgtggagcg ccactgcggc gccaccacgc cgcccgatgt gggcatggcg tcgtacagcg    154080
     tcttgcggta ttcattccag aggtgcgcca agtgagcgtc tttctcgaac acctgcgaca    154140
     gctggtcggg attgcgctcg tccttgaggg cagggcttcg caaggtccgc agtaactcag    154200
     acagtcttct cccatgcttg aaggcgggaa cgagaaagta gatgacgaag gacagtgcca    154260
     gcaggagcac taatgcgcct gaaatcaaaa ggtgcggcgc aatggagggc atgaggtgag    154320
     agcctgtggg atatcttgat gttgtggagg gcgtgctgtg attacggtga ccgagaccaa    154380
     cgggcgcagc ctggtaatgc ctgacgggct actgcttcag ccttgctgga cgtccgggcc    154440
     gggtgccgag gctgaatcaa ggcggacgtt gatttgcctg gcgtattgcc tgaccatgac    154500
     ctcgaacatg ttggtcagac tgcggcactc ctgggcggca gatctttgcc agagatcgcg    154560
     cacttcgggg gtcatcttca gggtggtggt ggatgttttt gtcttgggcc gtggcatggt    154620
     gcagggtgaa agttagatcg cgtataccaa acgtaaatac gttatcacgt ttgtaatcaa    154680
     atgcagtgat ttttaccaaa taagcgagtg tgtgacccag tgaaaagtta ggtggttaac    154740
     cccctctcgg tttgctccac cgcggtgtta cctgttgaac ccgtctcaac cactttgctt    154800
     tgcccggttt tgatggtgtc gttgcgccgg tccaagactg gctcagcatg atgtccctcg    154860
     caaatcgcca tcatgcgtaa tcgcatgggg ttgtgcccga gaatgccgtg tcagttggta    154920
     gtgcaaaaac agcgctgagc cagcggcaac cgatcaggcc gggttggcgt cttgtggtac    154980
     caatgacaaa gcgcaacccc ccggcgcccg cgcgcccgaa acaaactcat cgtgaacggc    155040
     actgtgctgg tcctggcgac cggcttgtcc ctgcatgctt gcctcacgct tcaagcccgc    155100
     gccaccggca tatccgccca gcacgtgatg tagcccggcg tgcgccgctc ctgtttcatc    155160
     gtccaggccc tcctgtcgcc cgccagcccg gcgctggcca tctgcacggt gctcgggccg    155220
     tagcgctggt tgatgtcatc cagcgttgtc atcagcctgc gtctgtctgg tgcttcgtcg    155280
     cgttgcaaat ccagctcggc ctgcagcacc gtggtgggct ggaggtcgaa cagcatgacc    155340
     ccggccttgg ccagctggta gccaggccgg taaatggcgt gcaggcccct gagcgctgcc    155400
     gaaacgatca caccggtatc ggcgctggga cggcgcagcg gcatgctgat cgagcggctg    155460
     aactgcgctt ctggccgaaa cgggctggtg cggataaaca ccagcacctg gccggccagg    155520
     ctgccttgct ggcgcagttt gtgcgccgcc cggctggcga actctgtgac cgcttcattg    155580
     aggtccgcta gacgagtgac cggctgcccg aacgagcggg tgcaggcaat ttcgtgctta    155640
     cgcgccgggg ccaattccaa tgcaatgcac gccatcccct gcagctcgcg caccgtgcgc    155700
     tcgagcacca ccgaccagcg ccggcgcacc atcgcggggt cgagcccagc caaatcttgc    155760
     gcagtgtgga tgccgcattc gctgagctgg gccgtcaggc gccgcccgac gccccagacc    155820
     tcattcacgg ccgtggcggc cagcacttct tgcagcgctt ccggcgccag ggccgacagg    155880
     tcgcacacct gcgccatggt cgcgggatag cttcccggct tgcgctcggc agttttcgcg    155940
     atgtggttgg ccagcttggc cagggttttt gtcgcgccga tgccgatgcc gcaggggatg    156000
     cccgtccact gcaggatgcg ctcgcgcacc ttgaggccgc gctgcaccag gtcaccgagc    156060
     acgccagcca ggtcgatgaa cgattcgtcg atcgagtaga tttcctgcgc cggcccgagg    156120
     ccggcggcca ggctcatcat gcggtcgctc atgtcgccgt acagcgcgaa gttggccgac    156180
     agcgccacca gcccgcttga ctcggccagg tgctcgatct cgaaccaggg cgcgcccatg    156240
     gcgatcccga gcgcccgggc ttcgttgctg cgggcgatcg cgcagccgtt gtttctgaat    156300
     gaccctaaca gttagtagga aataagtccg caatttcact tgctgagtcg ggactaacat    156360
     ttttaacgaa aaacaccaat caagaaaccc aaatgtgcgc ctggtttagg ccacaaagct    156420
     gctattcacg ccatgccgtt gtaagtcagg ttgccgattg ctgacgttcc tgctcccaag    156480
     cgttaaggcg gccgtgggcc atatgcagtc acttgcgact gtccgctccc aagtctctca    156540
     cttgtcagac tgagacggaa gcaatcaagg aactcacggt agtcgagtga attcagaaat    156600
     cgaaacgctt gcctcaatgg acttcacccg cttccgtaga catatttcaa cttccattcg    156660
     accttaacag gtgtctattg aagcgggtga agtccacaac gctcgacgag gctgctgaac    156720
     atctgcatgc atctggttgt tgttgaaggt atgacgtgag aaatatgctg gcgtagcgct    156780
     cgtgcacaaa tcaaaatccg aaaacggacg gatttttaga ctcttcatct aacgcttcgt    156840
     tcagcagttt cttaagatgg atgttgtcgg atttgttgct catttccaaa aaatattttc    156900
     tagttacgtc gggatttttt gataacttga tcgccaaaac aaatgctccg atggcaaagg    156960
     tgtcatactt tatttcattg tctaaagtgg caacagatag gccaaagatc atccatgcgt    157020
     tagtgctctt tggcgccaat atcggcagca ttgtcgcgcc catgttgagt ccattgaggt    157080
     agccaatttt gtagctggaa agccccatgg caacataata gtcagggttg agtggggcgg    157140
     cttctacggc tgctcgcgca tttaggacgg catcttcgaa ttgagccgaa tttgctgccg    157200
     ctcttgccgc cagcgaatac caaatccccg ctgcttcatc cgaagcaatg ccaacatgcc    157260
     ttccctcatc tatcgtttgc aacgatgcct tgatagacgg agatctcgac gaaattgcgg    157320
     aaatagcttc agaaacagcg tcgtccatcg gcttgatttg agcttgaaca ctgtctaaac    157380
     gcttttcatc tgatctttga tcaacatact ggcgagcaga taggtttttc aatcgctgaa    157440
     aatcgtcctc aggaatgagg agctctgatg cgatgaagcc cagagttgaa tcgaggagct    157500
     tgacccttgt aaacgatcca gtcacttcga taaattcaag gatttccccc tgctttaaaa    157560
     ctcttagctg acgtgatcgt gcggtaggtt tttcacggac gtttgcggaa agggacgcga    157620
     cagcgaaagt gatctttgga accgtcgctt ttggggggac ggagacttca acataagtgc    157680
     tggcagagtt cgcatcattt tcagcaggcc ttgtggcatc gttggatttg cttgcaatta    157740
     tcgaaacgat gatgacgcag acagtcaatg cacccactat gaacactttc gatgacccta    157800
     cataggttac aggtggaggg ctggaactag tcttctgagc ttgtgggcgc actgattgag    157860
     ttgcaggaat agaagccaac gtgctcgggg aggatggcgc tgatgccccc gatgcggctt    157920
     tcgtcgaagt attggtgcga tccggctgag tcggagaagc tgaaagcgcg gacggggagg    157980
     gtggattctt ttctgttaca tcaacattgg actccaagga agaaaggccg gcaaaccctg    158040
     ttttgttttt ttctggagcc gtcattacgc tgctttagcc atgtaaatac tcgcaaaggt    158100
     tgttaaggct tatattttcc ctcaaacgat cacgacgttc agcctccaac cggttgcccg    158160
     ttggtgaaac cagtcacctc ccaaaaaaaa taaaattttg tgtttttggc atctcgtcct    158220
     gaacgcaacg accctattcc gcctgataga ctaagccgta aaaaaagcaa ctaaatgtag    158280
     gtatttagct cgctctaagg agtgggtggc cattgacgtc tatcagggga aatatggaag    158340
     aaaacgccat catgactgca aacaatttgc gtcagccgtt catcgatctc gtcatcgaaa    158400
     gttggcgttt ttcaaagctt ttcagccgcg tgcttggcaa gatcgaaaac acagaggcca    158460
     ccagatacgc aaatcaactg cgctactttc aaaagaaact ggacgacagc cttgaagcag    158520
     ccaacctccg cttagtaagc cttgagggtc aagcgtttga ccccggtatg gctgcaactc    158580
     ccttgaatat cggcgatttt gggccagaag acaacttgat cgtcgaacag atgatggagc    158640
     ccatcctcat gggtccagat ggcatcgtca agtccggaac aatcttactt aagcgagcag    158700
     actgatcatg aagaactacg taggcattga cctggggact accaacagtg cgatctcaac    158760
     ctttgatggt gcggatattc gtctctacaa aagtcccgaa caaaatgacg tgacgccctc    158820
     agcgattttc attgacaagc gtggcaacaa atatgtgggt cagagggcct acaacagtgc    158880
     ggctcaaagc ccactaaacg ctgcgactgg cttcaaacgg ttcatgggca caagtacacc    158940
     aatcaaactt cctgccgtaa acatcgtcat gacacccgaa gagtgctctg ctgaaatact    159000
     tcgggtcctc tacagctatc tgccagaatc tatccgcaac gatcctgaaa ccggaactgt    159060
     catcacggtc cctgctgcgt tcaatcaaat gcagaaggat gccacgatgg ctgctgctga    159120
     gagtgcaggc ctcgggaaag tagcccttat gcaagagccc gtggctgcag tgatgagcgt    159180
     gatgcgtcaa cgtaaaactg atggcatgtt cctcatctat gaccttggtg gcggcacgct    159240
     ggacgttgcc attgctgaga gcaccaatgg acgggtgagt cttttggctc acggtggcat    159300
     cgccatgtgc ggcgggcgtg actttgaccg catcttgatg gacaacgtga tcaagccttg    159360
     gttgctggag cacttcgatc tgccggaaga tttttccatc ggcaaggact acaccacctt    159420
     gcgccagatg gccgggtggg cgacggaacg agcaaagatc gagctctctg ccaaagaaga    159480
     ttcagtgatc agcctcgatg acaccgaact ccgtgtaaaa gaccgctcgg gtgccgacgt    159540
     ttatctcgat attccgatta cacgcaagca gtatgacgac ctgattgctg agaaggtcct    159600
     cgaatctatc gtctcagcac gggagaccat ggagaaggtc ggcctaagcc cgcatgacat    159660
     tgggcgcgtg gtgttcgtgg gaggacctac ccaatacaaa ccccttcggg ataaagtcgc    159720
     cttcgaatta gggattgcag catcgaccga cgtaaacccc atgaccgcag tgtctgaggg    159780
     agccgctgtg ttcgccgaat ccattgattg gtccatggaa agtcgtggac gcaagagtgg    159840
     acgtggtact ttggcagcca gtggaagcct aaatgttggt tttaactatg tggcacgcac    159900
     ccccgacatc aaagccaagg tggtagccaa gattgacggc aaacccgttg ctggattaag    159960
     ttttcagatc gatagcattg ataccgggtg gtcttccgga aaagtgaccc taaatgatgg    160020
     cgcttcaatg gaggtagcgc tgaccaagcc aggagagaat cttttcaaga tttttgtgtt    160080
     tgatgcggcc ggtggcccta tcaccatcgc cgaaaacaag atcatcatca cccgaactgc    160140
     tgcgcaaatt gatgcgattc cggcctctca ctccattgct gtgcaggcac gtctaaaact    160200
     tgatggtcca tatatcttgg actacttggt aaaagaggga gaccaactac caaaaaccgg    160260
     gaaaaaatca tatcgtaccg aagagttgct cagggcgggg tccacaaatt ccatcaaatt    160320
     caagctgtgg gaaggatcca tcgaagacat cgtgactgac aatcgattca tcggtgtttt    160380
     cgaaattagt ggagcggact tctctgatgg tgtgattgcc aaaggtgctg aacttctggt    160440
     tgactacaaa gtgttggatt cgggaaacat cgatcttgaa attacgatcc cctcaattgg    160500
     tggaaaattc aacagtggtc gcaattttta ctcgcgccaa atcggtcaga ttgactacag    160560
     taatgccgcc aggcggattg aggaagagtc tgagatgctc tcgtcacgga ttgacgctgt    160620
     cgcctccaga gtggatgacc ctaaacttga tcaggcccgc gagcgtctga gcagaacaac    160680
     cgattcacga aaaattgaat ctgacaatgt agccgccagc caagccatgt cggatattca    160740
     agaagcaaaa aaactattgg ctcaatcgcg taaggacaac ctcaaagtca ttcgtcaaat    160800
     ggacctagat agttgtgtcg atgcattcaa tgaagtggtc cgcaagcatg cacgccccat    160860
     tgaagccact gcattcgaca agctggctat aactgcacaa agtgcaatcg acaacaacaa    160920
     agacgacttc gagagccacc tgcaaggcct gcgcggcaag aactgggaaa tcatattcaa    160980
     acaagattgg tttgtcatcg accgattcaa tcgtattatg aatacccccc atcttttttt    161040
     ggataccaat gagttcaatg aactggtgaa acagggtaag caatctcttg ctgccgatga    161100
     catagacaag ctgcgccaag tcgtcgacca tttggaaaac gtgcgtatcc gcatgggtgg    161160
     tgaagaacaa atgctttcgg gttccaacat tttaatgggg taatacatgg ccattgaaag    161220
     ctggtttccc gtcggctact ccatgcctga tggtgctact tgcagacgtg cagtctttgg    161280
     tgaggcccag tggcaaatta tcaagactga tggtgccggc accgtcctca ttgtccgtag    161340
     tgaattgatg gatcggtgga aggcgctggg cttgatcgaa gtaggtgtat tcaacacctt    161400
     taaatttggg ccagacacct ttcatgaaat ttcttgtgga cctagtgaaa ttattgcacc    161460
     agttgatcaa tccaactcgc ctgactccag aaacgaagcg attgcgttcg cgatggcttt    161520
     gaaggccacg cgtgaaattg acccagaatc gcctttgcaa gatgcaattt atgccgaagg    161580
     cttgggtcga ctcctcccga tcttctcggt ttctccgaga gcagatgatg acgtgatcct    161640
     tggctattgg cttactggag gtgcgcaggt ttcagccaaa tcgttcaggc gactgaatca    161700
     gatgatgagc tggatcacac cctccggcct caaagatgtg gtgtccgctg ctgggatgac    161760
     acaactcacc aaagatgcgc ccagagacga ccatttccaa gatgaagctg aactggaaaa    161820
     gatcgactcc tccaaaatag aatgttcctg cgacgatgaa gtctccagcc ttgagagcgg    161880
     ggtgccattc gttcttgcag gccgcccttt gctggaagac tttttcaacg agcacgtcat    161940
     cgacattgtt cgaaacaagg aacgctacgc agctttgggt attgggtttc cctccgcaat    162000
     cgtcctgcat ggtccacccg gttgcggaaa aaccttcgcg gtggagcagc tcattgaata    162060
     cttggggtgg cccagctttc aagtggatgc ttccagtgtc gctagcccct tcattcacga    162120
     gactagtaag aaggtcgccg aggtctttga taaagccatg gtaaacgctc cttctatctt    162180
     ggttatagac gaaatggaag cttttttggc cgaccgcgag tcaggcagtg gatcgagcat    162240
     gcaccgcgtc gaagaagtag ctgagttctt gcgccgaatt cctgaggcta ccaagaacga    162300
     agttctcgtt gtaggtatga ccaatcgggt ggagatgatc gattcggcca tcatgcgcag    162360
     agggcgtttt gatcacgtga tccaagtgga tcctgccacc gaggttgaag ttaaagctct    162420
     gctcgataaa ttgcttgcga aactaccttg cgacaaggac attgaaactg gtcctttgtc    162480
     caggcgcctc tcgggacgtc ctctgtccga tgtgacattt gtgatccgcg aaggtgctcg    162540
     cctgtgtgcc cgctccggct ccaacaagat cgcccaacga ttcctggtcg aagcactgga    162600
     ttccacaccg gaaaggacag gaagcggcac gcatcgcagc atcggattcg tttgatcacg    162660
     aactttcaaa agataagact caaggcattt tcggaccgaa caactcacac ctgatgaacg    162720
     atcaacctac ttgctcaatt tacaacaatg cattctggct gttgggcgcc actacacgcg    162780
     atgcacgctt gagcatcatt gagaagtccg aggagcgttc cttacacgaa gatccagata    162840
     aatgccaaaa ggccaagtcg gatctaacca atccaagagc acggattgcg gctgaagttt    162900
     cttggcttcc tggtgtgtca ccgcgcatgg ctgggaaatt agtctctgat ctggcatcga    162960
     atccccttga aatcgcctca cagacgggtc tacccgaact tgccagagcg aacctgatgt    163020
     cctcagccct ggagttggca cactccgatt cgttaacgtc caaaacgatg gctcgcttca    163080
     tgcgcgagtt aggtgaagtc gccgatgaca tcgacacgga tgctgtattg cgagacatca    163140
     acgaggatcg ctctgttgca ggattccctg aagtgcggga tcttggagtt cttgaagacg    163200
     aactagaaca gcaaaagaaa aaatataaat ccgctctcaa aaatgctcta aacaacatgc    163260
     catcagccct gttggtggag accatgtttc tgctcgtcaa tgaaacgaca ggaaacggtg    163320
     aacaggcggc cccgccacta attgatgatc tggtcgatag ctatgaagtc gaaacccaag    163380
     gatttctaac caaagaagaa gagaaaattg ataagctcgt cgagggtgct ttaactgcag    163440
     caccatccgg cgcgcgatca gtcgacccgt tcctagagaa agtggaactg gttgttcaca    163500
     gttggtcgca ggtgattaaa cccattcaag taagcatgaa atcccgcgga cttgagcaca    163560
     aaaacagctt gaaaattggt tacacaattc gtaacttagg ccttgaactc tacaacactc    163620
     ataacttgtt gccgcaatct cagcgaacga ctgcactgct tttgaaattt tttggcgata    163680
     tgccagagtt caaagagcag gttcaaactg atgctaacac tttggcccgg ttcaagaatg    163740
     aagctgccaa atctgaactt gaagatgctg agcgtcgccg attaattacg ttcaaagcac    163800
     aagtaggcct tgtttttaag gacgaactga gcatttctcc tgatggtatc aggtggaagg    163860
     acaaacatta cgatcttgag gccatcaacg gtattcgttg gggggcgatt aagaaatccg    163920
     tcaatggcat tccgactggg acggactaca caattgcatt tggtgatgaa cgtggctcct    163980
     ctgaagtcag tatttcaaaa gaggccactt attcacaatt tgtcaattgc ctctggcgtg    164040
     gggtaggagt taggcttcta tttgaaatgg ctaaaggtct taaggacgga cggacgttca    164100
     gctttggaga tattgaagtc gaagacgtcg ctgtgaagat cgaacgacac aagtttctgg    164160
     gtttcgccga gactgtgcga cttcccatat ctcagataaa aatttggtct tcggatggca    164220
     aatttattgt cggagcttcc aacgacagca aggtgtatag cagtgcgtcc tatatgcatc    164280
     actggaacac ccatgtcctg gagcacttaa tgcgaacttc acttgaaaaa ggttctcgtg    164340
     gcggcctgag ttcctgtttt ctgagctgat taggcttatt aacttacgca gccgcccgcc    164400
     actgtagaag ttcagcatag gcgatgcgcg atgcgttgat aagaagtgtg agcctcaggg    164460
     caaacgggtt gattctggtc ttgatggctc aggcactgga gcttgaacac ggcgtaaatg    164520
     gccgtgaaga cgtggttgct ttggattctg agggtttgcg tcggtgacct ggccaggcta    164580
     gcgttggact ttaatgattt ttgaaaaaca cctccatttg ccaccgtttt ttgtggcttg    164640
     tggtggcggt tgagggagta attcctcacc ctatgttggc gccaacgcgg ttttgatcca    164700
     ggctgccgat ttcaactgac ccatgcgaaa ccagccagat gccgctcttc gcctgggttt    164760
     ttcgggtgtg tggatgggtc aacgatttcc ggccgcctgg gggtgcggac aaaaacttgg    164820
     actggttatg ctgtaagtcc gaggctctct cggtactcga ggggactgag tgagccaagg    164880
     gagatcttga ttcgcttttc gttataccag tggatgtagg agtcaacgac ctgaatgaat    164940
     tgttcaatgg ttgtggtctg ccagtttcga gggtaaaaca gctccgtttt cagccgcccg    165000
     aagaagcctt cacaggccgc attatcgggc gagcacccct tgcgcgacat cgagcgaatg    165060
     agcttcgcat cgcccatccg ggtgagccag ccaggccagc gatagtgcgc accgcgatcg    165120
     gagtggacga cgggccggtc attgctgttg gctaccctct cgatggcagc gtccaacatg    165180
     gtgttcacaa gatcggcgtc tggacgcgtg ccgattgtcc agctgatcac cagcccatcg    165240
     aagcagtcga tcatgggcga caggtacacc ttgccagccg ggatctggaa ctccgtgatg    165300
     tcggtgagcc acttctcatt cggggttgca gcctggaagt cgcggttgat gagattgtct    165360
     ggcgcagggc tgatttctcc caggtaggag ccgtacttac gccgcttctt agcggcaacg    165420
     accaggcatt cctgcctcat caaacgtcgt acgaccttct ccgagatgaa cacgtgctgc    165480
     ctgcccagtg acgcccgtat ccggcgatag ccgtagcaac ggtgattgag ctcgaagatg    165540
     tcagcgatgg tgccgcgcac tacaacatac ttgtcagcgc atcgtagccg tgcccgatga    165600
     taaaagtagg agctgcgggg aaggcccagc gcggcaaaga gttctgatag cgaatagagc    165660
     tgtctcaggg catcaaccag ccgcgtcttc tcctgattgc tcaggagagg caggtcgacg    165720
     cccaggcctt tttttagcag ttcattggcc ttcttcaaga ttgtcgtgtt caagctgcag    165780
     ttgccggacg tcgcgtcgaa gcgattcgac ttgccgctcc agctccgccc gctcaggatc    165840
     tgagggtgaa tcgttgttgg gtttcatgga tgcgggagcc tcaggaccca gtaattgatt    165900
     tttccattgg tacagcgtcg gcctgctcac ggccagcttt tgtgcaatgg cttgcgcact    165960
     tgtctgccgg atgcacaact cgatgacggc tgcctgcttt agcgcttgag ggcgcggcac    166020
     gctgcgcgct ttgccgacaa cgcgtttcct cgttttggga tgcaactcat cgacccaggc    166080
     tgcgagcgta tcgcggcacg ggtatcccag tgccttcagg gttccagcca ggcagcgatc    166140
     atggtccagg tagtgctggg cggccacttt tttctgctca tctgaatact ttggcctcga    166200
     acgcgcatag cccaccggca aatcgcggcc ttgttcgtat tctcgatgcc agctcttgag    166260
     cgcgttcttg gtcgggtacc ccagcttgcg aatggtcgct ccagtgcgtt tgccgagttt    166320
     gatatagagc ttgacggctc gaatgcggtc ttcgtaagaa tacatgaact atcttcccaa    166380
     gtagtccaag atttccgccg caccccccct gggtcaattt ggcatcggca ccaacatgct    166440
     cagccacttc aactgacaga ccggaactgg ataaatgccc ggtgcattcc tgccatccac    166500
     ctcggtgctc ctgttcaatg cgccgacctt gcactcaagg atggatttca gctctctcgc    166560
     taatttggtg agtgatgcca aaaatggcaa cacgcattta tttttggcaa aagtgccgca    166620
     gttctccgat tgaaggcagt cgctttcgtc gctggagcaa gaacattggt cggcctcatc    166680
     agccgacaga cgaggtggca tacccgatgt attcgtcatg gggcctcctc acaatatccc    166740
     atcgattctg tgcttctgta ggccgttgtc tctggtcggc tacggtcagg taaagccgac    166800
     tcttggcgcg cgagatgccc acgaaaaacg cggatcgttg ttcatccctg tcaccccaaa    166860
     acgtctgctg ttccactccc agtatcacaa ccgtatcgaa ctccagacct ttgcacttgt    166920
     ggatcgtcat gatgcgtacg gcactgtcct cggagaagtg cgacaaggca cggacaggat    166980
     cggcttcgcc tccgagaagt tccgtgagtc ggtcaaaagt ttgcgctaca acctcggtca    167040
     gccggtctcc gcgctcgtag tcagatgaga gcgccacaac cgcttcccgg ccgagcattt    167100
     ttaagaacgt catcgcattc gcccgcaagg aaatcgcatt cagcggctgg gcttggccgc    167160
     cgcgcatggc ccgacgtgac tgctcaagga agcgcagcca tcgagacctc tgttcataag    167220
     ccgtttcttc gtcaattcct gttgcaatca gaacatccat cagccgaccg aacgcagccg    167280
     actgacgctc gccggcaacg actgtcagga agtcgacaat cagccgtgca gcaggttcca    167340
     ccgacaagtc ctgcaggagc tgttcgttac gaaacgcgat accgcgccgt ttaaattcgt    167400
     tcatcaacaa ttcggcataa agatccggtt gcctggagag gagtacggcg atctccgatg    167460
     gtggaatgct ttcaatgccg atccagtgct gcaccaggtc ggcgatttcg cgcgcttctt    167520
     cggcgctgtc gctaaagtgc agcacgtcca ctgagccgcc aggacccatc agcatgtcgt    167580
     ccggcaccgc agccgcaggg tccatgaccc gaaccatggc gttttgcata cggcgcaagc    167640
     gcggtttcga tcgaaaattc tggtacaggt tgagcggtac cgcctggaag tcggtggcga    167700
     aggtcaaaaa cacgccttcc agtgcgccag cccagcccat gattcgctgc tttgtgtccc    167760
     cgaccgctgt caggcgtgct gacgagccga ggaatgccac cttgatgagt tggtattgct    167820
     catcggtaca gtcctggaac tcgtcgagga acacatggct gtaggtttga cgcacggcat    167880
     tgcaggcgat cgggcaagcc ttaaggattt gcacggccag cggcaccagg ttcccaaagt    167940
     ccaactgttg accctgcacg cgcccgaccc cgatcgtgta atcggggttg agtgcatccc    168000
     tgccggtcag aataggcctg aagcggtcga tgatgcgctt ggcaaaggca tggaaggtat    168060
     ggctgtccag acgggccgcc agctcggcac cacagcgctt gcgcacccgg tccttgagat    168120
     tgcggctggc gtccaccttg aaggaaatgg ccaagatgcg ttgtggatac cgactggttc    168180
     cggttcgcag cagaaagtcg gcgcgctgcg caagcatctc ggttttgccg gctcccgggc    168240
     cggcggtcaa ggccaagctg cgcaggacct cctgggctgc cagcagcgca ttgggctcga    168300
     gtgtcagtcc gtcggacgga agccaggctt gcggtttgat cactcaggta ggtccgcaag    168360
     ttttttctcg accaaggcga tcagtcttgc gatcggcggc ggcatgcctg cagtcaaggc    168420
     cgcatcatcg agtttggcaa gcgcctcgag atgcgccgca ggcttgcttc cgagcttgaa    168480
     ccgcgcgtgg taggcagaaa agtagctttg ctggtcagtg ctgtactgat cgggaccgag    168540
     gccgcttttg ccgagtacgg acttgacagt cgggtcgtct gccgccacca gttccgcctg    168600
     tgatacgcca taggccccag gaaaggcctg aatcattgag aagtcgagat cgagcggcga    168660
     cgagaaaaac accccttgct tctcaagcca actcagcaat ttcgcacctt gcgacgagga    168720
     cagaatctgg tcgggcccgt tccatgcagg cagcgcctcg atggcttcca gtgtcaggtt    168780
     aggagtcgac tgccagagcg ccaaaatctg cttggctgcg tagcgaatcc ggccccaccc    168840
     agcctgatgg cgtccaacat ccaggtccag cagggtcacg taaggaatct gaaggccgct    168900
     taataagcgc caaaagtggt tgacgtgacg cccgcccaac ggtgcgatta cgattgatgt    168960
     gtcgtcgtcg gcaagcccca tggctcggaa caggcgcggt agcacgatct cctcgctgtc    169020
     gccttcgcca agaatcacca gtcgcgagaa gtagagttcc ggaaatgcct gcaccgcctc    169080
     cctgacgaac ttgtgggctt cgtcggtctt tgcaggcatg acaattgtct tgaccgtcgt    169140
     gcatcgcgca gcatcgagcc gcaggtagcg gatgctttcg ggcggcaccc ttcgcagcag    169200
     ggatggcgca tgcgtggcga ccaccgcttg cgcgtcatgg tggcctgcga agtcagtgag    169260
     ggccttgatg acgcggccga ggtaatgcgg cgagaggctg ttttccggtt cttccatcgc    169320
     catcagcgtg aagacggctg gccgcaacct gtcgatgtcg aaggcatcaa gttgaccggc    169380
     gagcacgcgc cgcccgatgc cctgaatgga cagcacgagc gagacataca gcagcgactg    169440
     ctgaccatcg cttaggcggg aaaaatccac cattgatgcc tcgtgcccag gtgtgaagcc    169500
     aatcgtcaaa tgcctgagca agttgtcgat ctcattgtgt tcgaacgaaa cagaaggact    169560
     cgcgtagtag ctgcccttgt gtagcttcag ccagtgccca gccatctgct cgccgatgcc    169620
     ttggacaccc gcattggaag cgagcgcggc gctgatgccc tgtgtgaggc ctgcaactgt    169680
     ggcgcgttcc gcatgccagt tggctgcgcg caaagtgcgt ccgagcagcg agcttgccgt    169740
     gtaagagatg tggtcggtcg gatcgcgacg cgcgggtagg tagtggacct ggatcgagtt    169800
     gcgatcgtgc tttggcacca ccatgggatt gacgggctcg tcattggcat cgacatggat    169860
     cacgtaatgc atcttctcct cgatgtcacc gtcctcgtcc aagatcgctg tcaagcgaaa    169920
     acgcactctg ggtacgccat cggcggagtc aagctgcatg tgcgagaagt ggcccgggat    169980
     ggtggcatgc tggccgttcg catccagcag ttcggggaac tcaaactgcg cctctatcca    170040
     caagttcagg gtgccggcgt tgcctgcagc caaggttgct ggggagatgt gaaaatcaga    170100
     acggcgcacc cgtcgcagcg acgggtcgaa tccgaagagc ctcgccagcg cctggagcac    170160
     aacggtcttg ccggcaccgt tcggtccgag caggaaggtc atcgcctcga aatcgatggg    170220
     ggttggcacg ggcccgaaag attgaaagtt gctgatccgc agccgagtaa gtttcatcct    170280
     gagcccctgt tgtttttatt ggaaattgca ttccgttgcg cgttccttga aagacttctt    170340
     acagggatca gaagccttca ggtcaacgtt gcagactgct cgattaaaac actgcagcaa    170400
     ctgattggag ggcatgcatt aaacccgcga ccatgaataa aagttatggt gggtgtggcg    170460
     atcaggaacc gactgttgcg atgcggaaaa agttgaattc ggtttccgtt tcactgcaac    170520
     tcagaattgg taaacccccc ttgaaatctc aacgccatcg aagatgcaac ggcggcggta    170580
     gagatttcgg cgctgttatt tttttcggca tcgtcaacct tttgcatcga aataggtgca    170640
     ttgctcgggg ccgttggggc tgttcgggtg ggtatcatca actgtgtttt gatgctgcgc    170700
     gcccgaaatc cgtgcgcgtc acctaacctg caggataagg gggaaagcct catcctcagg    170760
     gaggatttat gcaacgccca gttttctaac gtctaaagtc caaactgtct ttttcgaata    170820
     atctgaagca gcaatgtggc aggcaggcac tccgagaact tgatcggctt ggcaagctcc    170880
     ttcacttcct cgggcgaaaa cgcaagcgcc gtggacaaca gttcggcgct cagatcgctt    170940
     aggtcaacgg gcgttttcag gtcaatgccc atcgcatcaa tgcgcctgct ttcggccagc    171000
     gattgaatct gcctggcgag ggtgcggttc gcgcgcgtgc cagcaaaagt ccacagacgg    171060
     gccgcacccg cttcattcct ggtgactgac agggcgccgt cattgccagt ttcgggcagg    171120
     tcttgagtga cctgctcgat ttcaagccgg gcgcgtttgg aaatcacggt gtgttcgcct    171180
     gcaccctggc gcaatgcgcg caggatgccc tgggcgatct cacggctcag ggtccgtccg    171240
     ctgccgttcc agcgcgccgt gccgccttcc ttggcgggct cgagccacac cgtttgccgc    171300
     ttccagtcga tctccgtgat gcgccagctt tttccggcca gcaggatcaa gcgaaccggt    171360
     ttgtcgccgg ccagcatcgt ggggtcgatg tagcccactt cggcgctgcc gcaacgcccc    171420
     agcagcaact gcgtcccgga aaacgaggcc agaaggtcct tgtaatgcgc ccgcccgaac    171480
     tgcttttcag tcgcggggcc aatttgcagc acgccgtgcg tgtccatcag gtagcttgag    171540
     gccaccatat ggtcgatcac gtccgtgatg cctggcctgc ttgactccgg aaacgctccg    171600
     cacagcagcg cgatcaattc tcgccgtggc cattgcgcgc gctccaaggt agccaccatg    171660
     gcctgctggg ccaccagcgc ccagggttcc gggggcgggt aagcggcttc cacccaggcc    171720
     tcaccccaca gccggcagat accaatggcc agcatgagcg aatcgtcatt ggtgcacagg    171780
     aacaggcagc tgcgcctggc gccctcccgc cgtccggtgc ggcccatgcg ctgcaaaaaa    171840
     gacgacaccg tcgctggcgc atcgatctgg atcacgtgat caaggtcccc gacgtcgatg    171900
     cccagctcca gcgtggaagt cgccacgatc acgcaatcct tttcctcggc aaaagcggtt    171960
     tccgccagct ttcgctccga gtggctcagg gacgcatggc ttaaaaaggt gcgcacctcc    172020
     tgcgcgcgta gcatgctggt gagctgctcg gcactgctgc gcgagtcgct aaaaaccagg    172080
     cgcttgctgc cccgatgcag acgagcaatg acggtggcgg cattggccag agagccgaca    172140
     aaatccacgg tgacatcggc atcggtgctc acgctggcgc ttccgacgac ctgcttgatg    172200
     ccagtgggcg caaaccaatc gagcagttcg gccgggttgc tcacggtcgc cgacaggccc    172260
     agccgctgca tctcctgggg cacgtactgc tgcaggcggt gcagcacggc ccgcatgtgc    172320
     cagccgcggt catcggcggc aaacgcatgc agctcatcgg caatcaccac gcgcaagttt    172380
     ccaaaccaga ctttgcggtc aatgcgcgtg gagaccagca tgccttcgag cgactcgggc    172440
     gtggtcagga ggatgtcggg ggcatccttt aacgcatgcc cttttttcga ctgcgaaacg    172500
     tcgccgtgcc aaaccgccac gcgccggccc accagcctgg cgtaatgcga gagccgctgc    172560
     tccaggttgt tgagcagtgc cttgatcggg cagacataga tcacgctcac gccgggccag    172620
     gcatgggtca gcatgcgcga gagcaccgga atgatggccg cttcggtctt gccgccggcc    172680
     gtgggcgcca gcagcaggca atgcacgccc gagagaatcg gctcgatcgc ctgcaactgg    172740
     gtgggccgca ggctgctcca gcccagcgaa ttgacgacgt ggtactgcag cgccgggtgc    172800
     agcttgtcga actcgctcac aactcgatgt cgtccacgct ggccgcgccc gctgcagcgc    172860
     gttcgttgac cgtcatttcg ttgtcggcca gcgtcagctt gtaatgcagg cgcggctcaa    172920
     agctcgcatg caaatccacc cggtccagca catcggccac cagttttttc aggaacagcc    172980
     tgggcgccac gccgaccttg ccgcccagcc cgcccgccac ggcgcgggcc agcacttcga    173040
     tatacgcgtc atcgaccacg ctgcgcaaac gaggttcgtt agcctgcagt tgcgcataaa    173100
     tatcgcgcac ccgctggccc accgccacga gcgagccttg atcaaacggc gccaggcgaa    173160
     tctgcaccgc gcgcggattg tcaaaggtgc gctcggtgcc aaagtccaca tgcaggcgct    173220
     gcgccaaagg cgccaggcgc tgcacaccct gggcgccatc gaagaacgcc ggtgtgccgg    173280
     tgatgaccag gtacagcccg ggaaagcgtc ccgcgtcgat ctcgtcgatc aactggcgca    173340
     aggcgttcag gccgcgctct cgcgtgtcgg cgcgcatgcg ctggagcgtc tcgacttcgt    173400
     cgagcaccag gagcaggccg gcaaaaccac tgtcgcgcag gatggtcagc agtccgatca    173460
     ggaagttggc cgcaccgaaa tggtccagtt cgcccttgat gcctgctgcg cgcttgacgc    173520
     tggcagcgac gttgggctgg ccggccagcc agctgatcaa gccttcggcc agctggtggt    173580
     cgccgcctgc cagggcccgg cggtaggtcc tcagcacggc ggaaaaagcc ggcgcggttt    173640
     tgctgatacc cgccagctgc gcttccatga gcgtgtcggt ccgcgccagc agggcctggg    173700
     cgtcatccgc atcgaccgag ccgtcggcca gcacatcctg ctccagggca aaaaaccagc    173760
     cgtcgatcac gctgcgaaag gcacccgtgc tgctgtcggc cgtacccagc cgctcgacca    173820
     gccggcggta aatcgtctcc aggcgatgca ggggtgtttc ggtttcgttg atctgcactt    173880
     cgctggtggc aaagcctttg gcgcgcgcgc gttcctgcag ccagcggccg aagaaagtct    173940
     tgcccgtgcc gtactcgccg cgcaccgcct tgaagccgcc gcgccctgtg gcaaccgtgg    174000
     ccagttcggc ctccagcgtg ggcgcgaacg actcgatgcc aacggccagc gcgtccagcc    174060
     cggcgctggg caccgtgccg cggcgcaagg cgccaatgat gtcatcccga cgtgccgcgc    174120
     tgatcatcgg ccgtctccca ccgaggtgat gcgaaactgc agcagcagca gcgtgcggtt    174180
     gagttccacc gtgcccgcca cctcatcgac ccccagcacc acggcctgat cgacattgag    174240
     gatccggcgc acggcgctga gcatcccgct gaggcgaacc tcgggcaccg acagccgctg    174300
     ggcgagcgcg gcgcgcgaga gttttccgcc ccgctcgctc agtgccgaca gcagcttgcg    174360
     catctgctca tcggggggcg ccacccgcgc ggccagggat cgctgcgatg catacacctg    174420
     gctttgaagc agcgtgtcga tccagtcgga ggccggtgcc agtcccaagc tgggtgctgc    174480
     cgagggcgcc gccactggcg tcacggaggc gtcaaacaag ggggtctgcg ctgacgcggg    174540
     tgccgccggc tggcgcgccg ttggcttgcg cgcactgggt gagcgcactg tcgtttgcag    174600
     catggccggc tgattgggca ggtcccacca ttctggctgg gcgggcaagg cgggctgcca    174660
     tccggacagc gtcagtcccg tgggcagcag cacgctcaac ggcacggtca cttcctgcag    174720
     ggaaacgccg ccgtggtaac cattcttgcg gcctgcgtag cgcacgctct cactccacaa    174780
     acatgccacc gacgtggcgc cgctggcggt gcgaacgcgt cctccggaca aaacaatctc    174840
     gccgctgtga gcggcctcgg tgccatatcg ccatcgatcg ctttcgccgc cgttgatgtg    174900
     cgcgctgcct tcttcgagca tgtggccatg gtcggccgtg atgaccacga cgcggcgggc    174960
     agcccgggct tcgcgcagga tgggcagcag cagccgcaag tcttccaggc tccagcgttg    175020
     cagcagctga tcgggtccgc tcaagtgatc gtccaccgcg ttgtagacca ggccgacgac    175080
     tttttgcttc gggtcggcaa tggccgcgcg aacgctgctc gacaggttgg tcgcgtcact    175140
     gaggtcgccc ttgtgaaaaa gcttgggcgg cagattcgca ttcgagtggg ccaacagcgc    175200
     ggcgtggctg gaaaaccccg tcttttcgag ggacgactgg cccgtggtga gcttgccgca    175260
     cagcaaggtg gcgcggctga cctcggtcac ggtcgggaac gcggccacgc ctgccagggg    175320
     ccgtgccagg ccagcgggca cccattcgct ccagcccagg cgctcaggcc gggcaaacag    175380
     ctcctggaaa atgctggtgc tcaggccatc gaccaccagc agcagcacgg gatgcaaggc    175440
     ggccagtggc gtcacgaccc ggtcaagcac cgattcgagc ggaacgatgc gcgcctcaac    175500
     gctgggcgct tgcgcattcc agcgctgcag agccagcgca aactgctgcc ccagggcatt    175560
     gcggcgcgcc atgacggccg cgcgcagcgc ttcgaaagcg tgggacacct ccaccagctc    175620
     atcgccgccc agcaagcgaa agcgcgccca atcgacaaaa gcgccttcgt cggcctgcca    175680
     gcacaccatg tctgccaccg tggcggcgcc agtggcgggg cgcaccagcc agcgcgccag    175740
     gcgcctggcc atttccacgc ggtcggcccg atggggttgg gtggtcgcca gctcgtgggc    175800
     cagcgcgcga ttggccgcgt cctcgaccgc gatcaaggtc gcatcggtgg gggcctgcac    175860
     atgctggctc agcagcatgg caaatgcgcg caggcgctgc tccaaaccca agggcagcac    175920
     ctcgctcagg tgcgcgaatt cggccacccg cagctcggcg agcaacgcat cggcccgctc    175980
     cagggccggg cgataaacct cggcgccgcc gggctcacaa accagttgtt gggccgcctg    176040
     cgcccaggcg cggccttcga gcacacccac atgggtgtcg cccacaaacc gctccagccg    176100
     gatggccgcg tggcccagcg ccgcctggcc ttcgccggcc gcagcgtaca gcgccccgca    176160
     caccaggccc agcgccatgg cgtcgccggt tcgccccgct tcgatgcagg ccagcaccat    176220
     ccggcccgcc gtgccggccg actcggccag ccagcgcagg gcgtctgccc gggcgttggc    176280
     cggcagcagc ttgagcgaag catcgctcag cggctgctgc gtccactgca gcaggccggc    176340
     agcatcggga cgcggcacat tcaattgaag aaagcgctgc agcacctcct tccaggccgt    176400
     ttccaggtcc agaaaaccat tggccactgg ggcataagcc ccctgcgcgg caccatcgac    176460
     cagcgcctgg ggcatccagc caaagcgccc caggcgggca tcgatctcct tggcgccaaa    176520
     cagctggcga accatctccc agcctttggg ctgcaagacc tggcggagcg ccaagcgggc    176580
     cgcaatgtct tcggtgatct cgtgggaacc caagggggtc agcaccacca ggcccgcatc    176640
     agcggcatcc gcttgctcga cctcgcacag cgcttcgcgt atcgccagca tcgagtcgca    176700
     ccagcgcaag gtaaagcggc ggccgcgctg attcaccgag tcgggccaca cctgccggga    176760
     ggcggcgcga atcgccacgg ccagggcgcc gggctcgcgc gccaacaccg catcgagctg    176820
     ggcggtgatc tggggcacgg agacgctcat ggctgcgcgc tccggcgctc aagccgccag    176880
     ctcagactca gctcgagtcc agggtcgcct tgaagccgtt cctgcaagtc tttcaagagc    176940
     gatgcggctt cgtcggtacc gaggcccatt ttttcatcgc catccacgaa ttcggctgct    177000
     gaaggcgggg ttccattgcg ggtaaacggc gccgggtcgg gaatgaccgg caagggcacg    177060
     ggcgagatga tcggcggctg cggtggcagt ggcggcaccg gcggtgtggg cgccgccatg    177120
     gtcagcaaat gcaccgcatc gcgttcaatc tcttccagcc ggggcttgag cgcaatcaca    177180
     tgctcatcgc tgccaagcac ctccgtcagg cggctcagga tcgacgctgc tgcggcttga    177240
     cgatggtctt gcaggttgcg catcgaatcg aaaatgctcc acttggcatt gctcaaggcc    177300
     tgcgccacct gcggggcctg ccccatgctg cgcccgacgg ccgcttccga ggtctcgacg    177360
     ctcgcgctgg ccagggcctg caccagttcg gcgtcgctgg ccgcctgcag tgtcgccagc    177420
     agcgcctggg ctgattcgct ggtgcgcacc cgtcctgcca tcgaggcacc gtagcgcgtg    177480
     gcgcggtccc gcacagatgc caccagggtg ccgaccgctt cgcgtttggt gccggcctcg    177540
     cggcgcacct cgtccaccag gcggcctacg ttgccggcgt tgagcgtttg cgacactatc    177600
     aagccaaaca gcgaggcggc gcgtttgacg gccgtcgccc agtgggccgg atcgggcagg    177660
     gcttgctcgc gcaactccag ctcatcggcc aggctgtcaa gggtgggctc gaccgggccg    177720
     ccgcgcaaaa tgaagcggcg gttcgtcatc gcggcaaaac tcaggatgat caggttttgc    177780
     agctccagcg gcagtcccat cggcgtgggc atgtcgatcc agcgccgcaa ttgcgctacc    177840
     gtcatcgcgc cgccgccatc gcgcgcatgg ctttgcgcaa agcgggcgcg ccagtggtct    177900
     tgcaccagca aatgcgtctc gcccatttgt cccagctgac acggaaacac caccgagcgc    177960
     accaaacggc gagtggctga atcgggcacc agcccgcggc ggtcaggcgc ttcaatcgcg    178020
     cgctgcatct caggccagat ttttcgaatg acgcctggct tgatctcggt gtcaaattct    178080
     ggatggccag ggtactggtg cgaaaacagc tgaccgagca gggcttcgaa cgcttccttg    178140
     aagctggcgc ccaccggcgg gcgcggggac aaggtggggt cgagcgagca gaactgctga    178200
     tccgcgctga gcacctgggt caccgcatcg cgcggctcgg tgctgatgcc aaaggccact    178260
     tccagctggc tgcgcagctt gctgcgcaag gagtccagct ggttcttggc cagggccttg    178320
     gcctgcaccc ggtccacaaa gctcaggtgg gtggcgtaac tctcgaagcg ctcgccggac    178380
     aaaatgtggt ccagcaccac caggcggccc aggtcggcca gcgccttgtg gctgaaaaac    178440
     gaaggcagcc acaccagcgt cttggtgtcg ccgccgcagt agtcccccag gcgggcaatg    178500
     tcgtcgttgg aggtgaagtt gggctcgtca aatggaaaat cgagcaccac ggtccacgcg    178560
     cccgagcggc cgcgcaggcg gtcgtcggtc atctcgcgca cgttttcgta aagcagctcg    178620
     acctcgcggt gcgtgccgcg ccaggtgaaa ccgtaggtcg tgaacaaggc tccgtcgtcg    178680
     ggaattcgca gctcggcaaa cagcgactcg cgaatcttct tgcgccggtt gccggcattg    178740
     tctatggctt cggcggcgcg caggatgggc tcaatatcga cccccgtgac ctggatcgac    178800
     accaccgggt tctggtcgtc ggtgaccttg atctcgccaa tctgcgacga ccagtcccgg    178860
     catttgcgca gcacgtcctg cgcttcacgc ccgggaatcg gcgacttgaa ggtgccgtgg    178920
     ttcagggccg ccagccgggc gccggtcaag cccttgagcg actcgacctc gggcaccagg    178980
     gccgccagca gcagcgtctt caggagccgc gcatcgttgc gcagatttct ggccgccgtc    179040
     gagtccgcct ggccgagctt catggcttcg agcgttacct ggtgctggga ctccagcatc    179100
     ggcagcagcc gctggttgta cagccgcttg gcattgtcaa aatgcagtcg catgccttcg    179160
     gaaaaaggct cgtcgccttc gctgatggcg tcgtacaggt cgcccaccgg gatcagctgg    179220
     cccagctgca aatcttcgcg ccgatcgacc agcagctgca tcatcagttt caatgccgtg    179280
     cgttcgcgct gcaaagcggc cgagacggca atgagcgttt gcaccaaggc cggggtgaag    179340
     ggatagacct tctggaacat gtcccggtca gccgatgtgg tgagcagcgt gtcgagcacg    179400
     tcgcggcgca ccgccaggat cttctcgaac tcggctttta gaatctggcg cgccgcttcg    179460
     ttgagggggc gcagcacccg cttttcggca atcgccggca ggttgcggtc ttcgagcgtg    179520
     atgcggtgaa agcgcgcttc ccagtggcgg agcacatcgc tgaactgcga ctgcaccgcg    179580
     ccggccaggt tctcgcccac gaggtcgcgc aggtcgcgct gacgggccac aaagctgacc    179640
     agcggaatcg gccggtcggc attggtcgcc tccaccagct tgaccagctt ggtgccttcg    179700
     cggctcacaa agccgacatc ggcggcatgg ctggccagcc acagcaccag ctcgtcgaga    179760
     aacaggatca cggcgtcgta gcccaaggct tgggcatgcc gggtcatgat gctcaggcca    179820
     tcgtcgagcg agacaaacga ctcgcccccg ccggccaggc tgcggtacgc tgaaaagaac    179880
     tgggtgatca ggtcgcccac caggcgcgag cgctcttctc cattgggcgc ttcgagtgtg    179940
     gccgcctcaa agcgggtggc atcccagccg ctgtcgatgt cgccccagcc cgcgttgtca    180000
     ccgccactgt tgcctccagc gccgccaccg gcttcattga gtttggcaaa aaaggctgca    180060
     tcccccatct gctcgcgcat gcgctgggca tcgccaaaca gcccttcggc caggtaaaaa    180120
     cccggcaccg gcgcgctcgg gtgcagcttg cgcacaaact ccgcgtattg ccccaggatg    180180
     gcgctttcca tgtcgcgcgc gccgatcatg tggtagggca ccaggaggaa tttcttgccg    180240
     tttgtccagc cgtgcttggc caccacgccg gccagttcgg ggatggagcg cgcctgcgtg    180300
     ttgcccgcca gcagcaggtt cagcacggcc atgaagtggc tcttgcccga gccgaaactg    180360
     ccgtgcaggt aagcggcctt gctgccgctg gactcgaccg actgcttgat gaagcccagc    180420
     gcgttttcaa aggcatcgac cagctgcggc gtcaccacgt agtcacgaag cgtggcgtcc    180480
     gcgtgggtca cgccttcgga cagcttgagc acaaagtcgc cttggtgcac gcgctcggga    180540
     atgttgatca ggtctttcag cagggtcatg gtggtttatc tctgagggtc gtcgcacatc    180600
     aatcgcttcg ggcgcgacat gttcgttgtt tgtacatgtt ggagcgacgt gttaaaaaat    180660
     gtcgtgaaaa ttaacatgtc gtggcttgac gcctaaacct gcaaccggat aaaggcgctg    180720
     aacctggggt ctgccaccag gcgcgcgtaa tcgatcaaca ccacgttgcg cacatcggcc    180780
     agcgccatgc ggccgcgcag gcgcgcattg aggctgtccc gcaggccttg caggtgaatg    180840
     gccagcttgg ccggcaggtc caccgcaatg accagcttca ggggcaagcg gatttttgcg    180900
     ccctcgggca aaccttcgcg cagggcttga ccgccggcag agcctgccca ggccgccagc    180960
     agcatcagca acgagtcggt caccttgtca atcagcgcct cgtagcgaaa tggcgccggc    181020
     tggcccttgg cggggacgaa atgggcaccc gtcagggtct cggtcacctg ggcgtagctg    181080
     cgcacttcca gcaggaacag cttgccgcca tccagccagg caaagtccat ttctttgagc    181140
     cgatagctgc tgagcgcctg gtaggctggc aggtcggcaa aacgaaagtg ctgtccgtcg    181200
     ggcaggtcta ggcgcagtcc ggattcaagg taagtcgcca tcgatcaagc ggccaggtca    181260
     agctgaacat cgaggtcaaa aagccgcagc gactcctcga caatcgggtt ttgcggcagg    181320
     ccatcggcca gatgcgtaac tgtgcccacc acgcccgcgc cgctttgctt gcgcaggtcc    181380
     agcagcgaat agtcggtgtt tttctggcgg gccagctgct ccaggcgctt gagcaaaaag    181440
     tagctgtgcg tggtcaggta cacctgaatg cccgactggg cgaactcgtg cagcatctcg    181500
     gcaaacagca caatcgcctt ggggtgcagg ttcacctcgg gctcatcgac gaacagcatg    181560
     ctgccgcccg caggggtcag gcgccggttg cgcatcaggc gcgacaaaat cccgattttc    181620
     ttgatgccct cggccgtctg gtgcatgttg aacacctcct tgccgcggcg aaagacgatg    181680
     ctgccgtctt tttccatctc cacttcgccg cccccagtga cctcctccag gtgcttgaac    181740
     acctttttga tgttgtcctg cagcttgccc gccgtggtgg gctggcgata gtcctgcacc    181800
     aggtcgtagt aggtgtcgtc aaaggaggcg atttccacgg tctcgcgggt ggcgacgatg    181860
     gcgtcgaaaa tcgacaaaat ctctttgggc ggcagaaaag tcgccttatg cccctccagt    181920
     tcgggcaggc cgttggcttg cagttcaacg atcttgctca ccgtgtcctt gccaaagccg    181980
     aatttgagat ggccgtccgt gttccagccc agctcgacgc tcaggcggtt gccggtgccc    182040
     cgcgacacca ggcgccccag ctccagcttg ggcggcaaaa aagtccagcg cagcttttgc    182100
     gccagcaact cggtcaaatc cttgggctcc gggcccgcct tctttttgga atagtcctcg    182160
     atggcgcggc ccatggcgta gagcagcttg agcaagtgcg tcttgccggt gtcgttctct    182220
     ccgatgatca cgttcagcga ggcgtgctgc cacaccagct tttgctggaa ggcgacgaaa    182280
     ttttcgacaa cgagtgactt gaaggcggtc atctgggcgc tcctgggaaa tagctggcta    182340
     ttgtcattcg ctggcggccg tggctttgcg ccgtccacgc gctttgaccg tggcggcagg    182400
     cgtccaggcc cgcaagtcat cgagcgtgaa gccctgggca cgggcttctt cggccacaaa    182460
     accctggtaa tagtcgccca tgcgctcgcc atagaccgga tcgacttcgt tgtgccactg    182520
     cgccagccag ggcaccagct ccagcaggcc ggccagcagg ggttgcaggc gctcgggggg    182580
     ccagccttcg ctgtctttca tgtctaggta aaaaccggcc agggcggtgg cttgctgcag    182640
     gtggtcccag ccggcccagg caatgatcag gctgccgtcg gcgccgcgtt cgcagccggg    182700
     gtagctgacc cagcgctcct tgggcacgtc caggccgccg cgcaggcgcc agacatcggt    182760
     tttcagaaaa tcagtgcttt tgaacttggg cggaaccgga atggcgccga cgctcgccgt    182820
     caagtcttcc cccgcatcct cgcgccgctg caaggcccag gtggcttccc actgggcgcg    182880
     cttgcgcagg cctgcttcgg tgtagcgctg cacgggcagg aaaggcgcgg cttcgctggc    182940
     gaccagctgg gcgacgagct ggccgatgtc gaaatcggcg tggcctgcgt agagcgtggc    183000
     catctgcatg aagtcggcgt ccatccgggc agcgtcggcc aggcggctgg tcgaggtgag    183060
     ctggggcggc tgatcggcgc tggcgggcca gtaacggggc agttcgagcc gggccagcag    183120
     ccagtcgcgc agggcggctt gctccagatc gttccacttg ggcgagttcc agcggcgctt    183180
     gtactcgggg cgctcgatca gggcgatgtt gcggtcgctg gcaatgaggt cgatgcggcg    183240
     ctgcaccacc tggcggtaat cctcaggcca gtggccggga atgtcggtga cgggtgtcga    183300
     gccgtgacgc tcgaaccaag tggtggtttc cgtgccggca gccacgcggc gggccagcac    183360
     gatttcaaaa gcgcgctcgc ccagcgcgac ttcgggcggc gcggcgtgct cgacatcggc    183420
     ggcttggctg ctggctggca gcaggccgta aaggcggtag cagcgccagt ccagttcttc    183480
     ctgaccggca atcatctggc ggcgcagttc agtggcatgg acgcgggcgg cgtccaggct    183540
     ggcgcgggtg gggagcgctt cggtgcccgc gtgggcggcg gccagcagcg cggcgggttg    183600
     tgaggcggca agctggttgg ccagatggtc gaggtgggtg gcgaggtcga gggggcgatt    183660
     ttctacgact ggaaaatcaa caagctgtga cgcgttgtac tcgtaacgca actcccaatg    183720
     ctcgtccgat attcctccac caatcccacc attacccttg ttgaaacaca cctgcttcaa    183780
     gaagaaacct gcggttgacg aattgagcaa cccgagcaag cccaaatgcg agtcctcgct    183840
     tgccccggcg ggcagcttga tgaccggcgc cgtgcggttg aacaccttgc cgcctcggtc    183900
     aaggacgaaa tggttgtagg tggcgacgaa ggcgaaagta atcgcagtcc tgatcttgaa    183960
     acgctctgca ggtatctgtc cgtatgaata ccaagccttt cccgtttcgc gataggtttc    184020
     accaccaaaa atctttcggt cgagaaggga tgttcggcat cgccaaataa agcgcaatgc    184080
     attcgcaaga tcgctcgcag gtcgaagttc agccttatcg ctgtagggaa acagacaaat    184140
     gttttcgctg ttaactgtcc agtcgcgaac atcttcacct actgcaaaag ctttcagtac    184200
     cgcaggctcg caccctttcc gaattgccgc ctccagtgga agcacaaaaa catcgtcagc    184260
     tttcgtgatg cagacaaatc cgagatcagt cgtgattgat gacaatggga cggtgtttgc    184320
     ttcaatctgc tcttttacat cagccacacc gccaccgcca atgctccacg gatgtttggc    184380
     caagcccttg cgctccatat cggccacgct aacaaactcg ctttctgacc cggcgcggtc    184440
     aatctgcgac aagatagccg accacaccag cccgtgcgcc gggtcgttcg gcgcgctggg    184500
     ttcgcccttg atgcccatga cggtgcgaat cgggttgtcg ggtttcggcg tctgatggcg    184560
     gccaaacagg atcaccgtcg gcgtgccgtg gccgggaatg taggcgcccg aggtgtccac    184620
     cacatgcgtc aggtccagcc gaggcagcac ctgctctatc agcttgctgc cgaactcacg    184680
     cttcatgaag gagttggcgg tgatcaggcc gacaaagccg gccgaaccgg ggccgccctc    184740
     accccggtcc tctccctgag ggagagggag taaggcagga cgcccggtca cggccagctc    184800
     aaaaaaacgt tcggtgaacg gcacgcccag cgaatattgc cgatggcaac tggcgtactg    184860
     gctgcggtaa gcggcgttca gcgccgcgtc cctgacaacg atgtaaggcg ggttgcccac    184920
     caccgcgtgg tactggcggc ccaggatgcg ctgcaccagt tttaaatctt cgctggcgta    184980
     ggcgtgggcc aggccgctgt cggcgtggct ttcggccacg tcgaacaggt cgtcggactg    185040
     gatgcccgat tgccccgaca ggccaaaacg ctgcccgtgc agcaggctgt cgccaatggc    185100
     gacatggatc gtgaaatccg gcgcgtcgct caaacgatgc acgtcgctgg cctgcagcgc    185160
     ggccagcagc agccgaaagc gagaaatcgc caccgcaaac ggattcaaat ccacgccggc    185220
     cacggcgtcg agcgcctttt gcgccacgtc gcgccggttg tgggcgggcg cggcgcggga    185280
     ccattcaccc accatgcgct gaaagccgcc cagcaagaag tggcccgagc cgcaggtcgg    185340
     atcgatcatg cgcacctcgc ggtagccaaa ctcgcggatg gccggggtca aggtgcggtc    185400
     caggatgaat tcctcgacga actcgggcgt ttgcagcagg gcgtagcgct tgcgggtggc    185460
     ttcggacaaa tcctggtaca ggtcgcccag aaagcgggtg ttccagctgg cgtcggtgaa    185520
     gtcgtgcagc agcgcgccgg tgttggggtc ttgctgctgc cagaactggc gcaggctcat    185580
     ggccgcgtcg ccgctgatgc cgaggcgaaa caccgggttg tgcgcggcgt caaaaaaggt    185640
     gtgcaggccg ggcagcgtgc cggcctccgt gaagcaggcc agcaggtaat cgcggtcgct    185700
     ctccagcggg ctggcgcgaa agtaggtttc atgccggtca cgcgccagga ccaggcgtcc    185760
     gctgcccggc gtgccgccga tccaggggcg ctcgaccagg gtgttgtctt caatgaagcg    185820
     caggaacacg cagctcagca gccaatgcac gccggcctgg gtgatgacct ggtcgctcca    185880
     gctctccagc gtttcggccg tgcggttggc atcgcgggcg acttgccatt cggcttgcag    185940
     gctggccttg aggtcgggca gcgtgtggat gcgctcgcgc aggtcgcttt cgagcagcgc    186000
     gaggcggcgc ttgaggtcgg tcagaagctg gggggcgttg atcattttgc agggcttctt    186060
     tgatttttac tattgtttta atagctgctt gcgcacgtct gtcatgcgca ggcggctatt    186120
     ttgatgctta attttggcct gtagcgccgc cagcgccggg cagcaggccc tcctgcgcca    186180
     tcagctcctg caggctggct tcttccagcg catagacgcc gcgcgaggcg cgccagacca    186240
     gggccttttc ctgcagggcg gccagggctt gctggacgtt gggcacatcg gccttgacgg    186300
     tgctgtgcgg cgccagggtg tcgagcagcc gctggtaggc caggatggtt tcggtctcaa    186360
     agggtgcgta ctgcgcgccc ttgctggcca gcacccgcag caccgccgac tgcaagggcg    186420
     tcaggctgtg gatgacgcgc agctgctcgg catagctggc ctcgatctgc tcttggaccg    186480
     cctgcgcaaa gcgggccggc acgtcttcgg gctgcagctc aaaatcaaaa cgcagcgcgt    186540
     cggcggcggc tccgagcatt tcggggcgga acgaagcgcg cacaaacagc gcatgcacca    186600
     cctcgacgct cagggcggcg ggcagtcgga cctgctggca aaaccacgcg atgtagtctt    186660
     ttccgagcgc cgggaatttc accagcggag cgccgaaaaa agcctgctcc ttgccgttgc    186720
     gcagcatggc cagcttgtcc tggttggagc cggtggcgac cacgcgcagt ccgtggtggc    186780
     ggctgctgtt gagttcgtcg cgcgccgcct tcagggcaaa cagcgcgtct gcgccgcttt    186840
     cggtggtgat ggcgtgctgg gcttcgtcaa ttaccagcac gagcgtctgg ccggtttcat    186900
     cggacagcgc ggccagcgcg ctggacaggg acacgccgct ggccaggccg atgcggtcga    186960
     gcgaaaacga caggccgccg acgctgacct tgtccatgcc cgaggcgcgc gctaggcggg    187020
     ccaccacgcc ttcgtgctgc gccagcgccg cgcgcacggc agcaatgatc acggcgccgg    187080
     ggtcggcctt gcggttttcc cacaagtcgg catacagcac cagcgcgccc tgggcttcaa    187140
     gctgggggcg caggtcttcg cgcaggaagg tggatttgcc ggtgcgccgg ggcgcggcca    187200
     gaaacagccc ggagctggaa gccgatccgg gcgcggtctg caaaatcttg tcggccatgt    187260
     cggcggcgag ccgctggcgg tggaaaaagt ttttcatcgt ggagccgcgc ggaagttcgg    187320
     tttgcaggcg ggaatacctg ctttatgctg aattatagtt ttctatagac gtttatagaa    187380
     aggcttgatg tatccatcct tggtttgata aaaaagcgtt attgctctgt ttttaatagc    187440
     tgcttgcgca agctggacgt gcacagcagg ctgttttttc tgtaaattca ggctagggcc    187500
     gatgcgcggt gcttgttttc aatccaggcg ggcggcaggg caaaagcctg cgtgctgttg    187560
     accagcggca cgggcacgcc atcaatgacg ggcaggccct gcttgtgcga aggcagcagc    187620
     agccacaccg ccggggtgtg gccggggcgg ccggcgctgg cttccatctc ggtgacgagt    187680
     gccatgaggt cgtagcgcgc cagcaggccc acgttggtta gcagggcagg cgccggactg    187740
     tcgagcagca ggggtttgag gctggccagg gtgcgctgca ccaggcgctg caggttggcc    187800
     cagtcgcggc tgccgggctc ggcggtgtcg gcgcgcagca ccatggacca gtccacacgg    187860
     gcacggtctg cttcggtgcg cagggccttg agcagcagcg cgtcaaagct catgcgttgc    187920
     agtgccggtt gtgtttgcga gtctggcccg aagcggcgca gcagttcggc ttcagcatgg    187980
     cgcgcctgac gcggttcgac cgtcagcacc aaaaggcctc cggacttgag ggcgcgctgc    188040
     agccgaatct cggccgcctg ggcgtcggcc agggctgcct cgctggcttc accggctggc    188100
     gttccagctg catgggcgcc cggaaaggtc gattgacggg aaaacacggt cgtcgtgccc    188160
     accgtggggt ggttgttcag cgcggggcac aggtaggcgc ctgcgccatc ggccgcagca    188220
     gggctccatt gcagcggggc gccggcttct tcgagcaagc ggtccagcgc aggccgacca    188280
     gggagcaggg tggcttccgg gtaacggccg cgcacgcggt cctgcagttc gcggatgcgc    188340
     aatgtgggca cacccacaag tgcgcccagg gactggcgca gcgcctgcaa ggcgggcatg    188400
     ccccggcgat agatttcctg ccggctcgac agggcggcgg tgcgcgaggc cgatgtggcc    188460
     aggcgaagca gccgggtgcc gggcatgggg gcttcgccgg cctcttgcgc cgggccgctg    188520
     cccatgagga cgcccaccgg ctggacggca acgagcgctt cgatcacgcg cgaagggggc    188580
     agcaagggat cgaccagcgc gcaggtgtcg gccacgctgc cgagctggcg ggcgtaatcg    188640
     gcccaggctg aactggtcgc gatcaggggc gaaggcggat ggtcatagag ctgaatgcgg    188700
     gggttctcca gatgggcttc ggcctccagg acggcgcgca ggacggcgct ggcgagttgc    188760
     aggcgctgcg catcctcctg catggcgcag ccgcgcaggg cgagcaaggc cagggccgct    188820
     tcatgggcgg tcatcacctg gccctgggtg agcaccagtt tgtcgagctg caggcgcact    188880
     tcggtgaacg ccgggttttt tagccatcgc tcgcgggcct tgaccagggt ggcggtgagc    188940
     gtgctgcgct ccacgccggt ggcctgggcc gattcgccca gggtaggcca tgcagcctgg    189000
     ctggatgcgc tttccggctg ggccgcgtcg tcgaggccaa ggtcgagccc aaggtaatgc    189060
     gccagcgctg cttcttcggg acggtcatcg ccggcgggcc tgcggggcat gagcagggcg    189120
     gccagttcgt tgacgctgac agcgccgtca tgggtgccat cgtcatcgga atcgtgcagt    189180
     gtggcgcgac cttgcgcgag gtcaggccgc aggtgcgcca gctctttggc cgtgagcctg    189240
     atttccttgc gaatcctgtc gcccacgccc ttgaggtagc gaaaacgaat gcgatcgacg    189300
     gcgagcagtt cgcgagcgtt gtggacaccc atgcgctcca gaacgtcctg cgcctccagc    189360
     gtgtagccca actcggccat ggtggtggtg gacaaggccg tgagcgcgat ggccgaaaaa    189420
     ccttcagcct ggggtgggtg tacggtctgc cgggcggcga agatggcccg ccaggcgcgc    189480
     agcatgtctt cggcgttatc aaagcgctcc ttgaagtccc ggcgcatggc tttggagaaa    189540
     aacgcggtga agccttcgcg cgtgacaggg tcgaacacat cgctggcaac cgtagcttcc    189600
     acatccagca tggccgggga ggtctggcca tcgccccaga caggcagctt gccaatggcc    189660
     atttcgtaca aggtaacggc cagcgcaaac cgctcggcat acaaatccca gcgtggcggc    189720
     ttgcgcaggc tcagaaacgg gtccaggtag gaatgggttc cggcggatat gttctcggtc    189780
     ggggtgcggc acagcgagaa atcaaagagg accagttgca gcttgccgga gctggtggtg    189840
     gcaatgccga tgttttcagg cttgaggtcg cggtgggcca cgccgtggtc ttcgaggtgg    189900
     ttgacgacct cgatgagttc ctcgccaaag cgctggagca ggtccagcga caggcggccg    189960
     tcttccttga tcttttgcgc cagcgtcttg gggccggcgc tgcgcatcag caaggcggtg    190020
     cggccggcaa ccgacagggt gcggcggtac tcgacaatat tttggtggtg caggccggcc    190080
     agtacatcgc cttcggccac caggcgatcg ttatgcgcca gatcacacgc gaccttgagg    190140
     atcaactctt ctggcgaatc gtcttcgcgc accagcagca catcgctgga ggagccacgc    190200
     cccatccgct tgaccaccgt gaagccgcct tcgagccggt cgccgtgccc ggcgatgctg    190260
     gggtcgacgg ttgcttccgg gtcgggcgcg gtgagctcgt cttccacttt gaccaggtcg    190320
     tccaggaaac cctgcaccac gtcgtaacgc gccatcacgt ccgggcaggt ggcgtactga    190380
     atcaactctt gcagccgcat gccgcagccg tcagagacat cggacaggcg caggccctgg    190440
     cccagacgca gcttttctgc cagttcaagg accgacccgg ccggggcctg gccggagaac    190500
     acatggtagg caatggcgcc gagcgaaaac acgtccaggc tggggccatg ggtggcatcg    190560
     gcgcgcgtgg tttcaggcgc caggtacacc aggccggggt cttcgacgta gtcctccaca    190620
     tggcgcgtgc cggtggtgcg gtggaccgtg tcgggattgc ccgcctcgcg cgaggcggtt    190680
     tgccagttca tcagccgggg cgtcagcgcg ccgccgtccg ccgtgtgaac catgatgctt    190740
     tgcggcccca gggcgcggtg gtacaggcgc ctggagtggg caaatttcaa ggtttcggca    190800
     atgtcgcgca ccaattgcag gcgctgggtg acggtgagtt gcgtaccgcg atcgcgcaac    190860
     aagtgatcta accgctgggc cttggggtcg tggtcaaaca ccagcgccgg gcccatttcg    190920
     gtctctttgt agtcgttgac cttcaggatg ttggggtggc tgatgccttc gagcacttca    190980
     aactcacgcc tggcctggcg aacccgggtg gcgcgcgctt cgggactgga cgcatgggcc    191040
     acggtgtaga tgcgaacccg tctctgaatg ctcgccatgc tcacgtgctg gctttgccag    191100
     tcctggaagc cttcgccctc ggcgatcagt ttgatgagtt ggtagtcccc gacctgccgg    191160
     tgtttgttgg agggccggat gccggcttct gccagcccgc gggcgatggc cctggctttc    191220
     tggccatcga cagcttgagc cgcgttgctg tggatgccgt tgaccagggc gtgaacgatg    191280
     ccgtcgtcgg tgagcgagcc gggctggccg cgctgaaagg tggcggtttt ggcgatgcct    191340
     tgcagcttgc ttttaaggct ggtggacgag agaaagatcg ctggctggat gaacggcagg    191400
     cggatcttgg ccttgacgat ggccgcctgg cggcgcagca ggctggccag gcgtttggat    191460
     ttgcggtccg ccagcagcaa agggttgtcg tagctgtact cccggccatc ggtgttccag    191520
     gtccaggtgt gcgcgtcgcc atcgaccgta ccaggccggc ttttgatctc gatcagaaac    191580
     agcccggcgg gcgacagcac caagacatcg acctcgttga cttttccttg gtcatcgatg    191640
     aattcgaaat tcgtccagac actccagggc tcacggtcgg gcaattgggc gcgcagccat    191700
     tcgagcgcat cgcgctccca gggaaagctg gattcggcaa tgaccttcca gcggttggcg    191760
     ctcatgctca tggagagacc tcgggcttgg ggggaacgat ttcaaacaac tcgcccactt    191820
     ggcactggaa aagcgtgcac aggctttcga tggcgggtaa gtcaactcga gtcgccgttt    191880
     cgttgtaaag cgccgtgacc gtgctgcgat tgaggcctgt tcgtttcgcg acatcggaga    191940
     tgcggagttt gtcgcgcccc atgaaaaggg acaggtggca gcggatcatt ttcgtatttt    192000
     tatcgaaggc tgatgcgcag aataacaaaa aaccaagcta cgcgcaacta cgagtatgat    192060
     ttgtatctaa ttgtctattt gaaagaagcg agttgaacca agcgcctgtt ttattaaaag    192120
     acactcgatt cacatcatga aggcattgaa aaaagtttgc gaagttacag gcttaaaagc    192180
     caagggtacg tgtacagccc gtacttcgtt cgcaggcacc aagggcaatt gcagttaccc    192240
     gattttcaac gttcatgggt gtgggacgag gatcgcatca tttccttgat agcgtcggtg    192300
     tcgcgcggtt tcccgatcgg tgcactgatg actttgaaaa cccaaacggt tggaacaaat    192360
     aaatttgcgc atcggttggt tcaaggggca agtgatcgcg ctgtcggtaa ctgaccagcc    192420
     tgcgctgcgt ttaccgtgag ttttgctgca ccaccataag cgacctaatt aggtcgcatc    192480
     atccaacacc ggatgatggg tgccaggtca gtgcaatggg caaagcttga atattgcccc    192540
     aaaaaaaaca tcattcacac ctcccaaagc cagcaatttc aagcaaaatc aaggtgctgt    192600
     ctagtacagc atgaaaaaac aaggtagagc tactgcgtag ttcacctgaa ctgaaaattt    192660
     gactgttgct tgttcgacgg ccattgcatg aatgcaacct gatccgcgct tttgtgtgga    192720
     aaagtcgctt tttttgcaca tcaaaatgtc ttcccgggca agcatctgct atgcagaagc    192780
     ccatgcgtca atgccaatgc aagcaatgac atgcatgagt acgtcccacg caacccgcca    192840
     atctcaagcc acgcttggat agattcgcca ggttcgccaa tccaaaaaac tgaatttgta    192900
     gtcatcctgt cggtcgtttc ctggagacgt ttgcattaat accagtgtgt taattcagcc    192960
     gtttcggtgg tgggttttac aactcttttt gaggaagaat catgcccaga aaattgaatt    193020
     caagccctgt cgcacttgtc gaacgggcgg tactggctgc agtagctaac gcgcgagaca    193080
     aaggttggcg acagtcgcaa atggaaatgt ttgcccaacg actcggtgac taccggatag    193140
     cgggctacgg gattgacttg gagcgcgaat gcattcggat cgtgcgaacc ctgggatgtc    193200
     gctacgcaag aaagcttctg aactggttca gagcagtcaa ggtgttaccg gcgtttcagc    193260
     ccgctgctat taattttcca attggtattc ccaaagcatc acgttttggc gagatgaagg    193320
     ttcaagttgc ttcgcatgtg cgtatttcag cgatcgtgga cgcctgtttc aaactgatcg    193380
     tggacgatgt ttcagcgcca tcgtggacgc gcagggatgc gcgcaagcga ggaattaatg    193440
     tatctcaaac atcgcaatgc cagcgcgcca tgggcaggcg cgaagcgatg gcttttgatt    193500
     cctgaagtct gccttctggt ttcctgtgtc tggaatttct aatttcttag gcccctgcca    193560
     gggccgccgg caggcccccc ggttgtgcat gtacccatgc attaccaagt tgacgcccga    193620
     cggtgttgag tgggcaaggc aatcaatttg tattcggatc tcgcagcgtg gcgcccttga    193680
     gatcaatccg gtggctgctg tgcacgacac gatcgagaat ggcatcggcc agcgttggat    193740
     cgtccagata ggtatgccag gcttttaccg gcaattgact ggtgatcaac gtcgagcgcg    193800
     tgcccacccg atcatcgagc acctccagca aatcgtttct ctcgggcgcg cccattggag    193860
     aaatggcaaa gtcatcaatc accagtaaat caagcttggc cagttgactc attcgccgat    193920
     taaggctgcc atcaccatgg gcgacatgca gttcatcaaa gagccgcccg gcgcgcacgt    193980
     acagcaccga gaagcctaag cgagcggctt gatgcgccaa ggcacacgcc agccaggtct    194040
     tgccacaacc ggtggcaccg gtgatcagca gattctgcgc attgcgaagc caatcacccc    194100
     cggccaaggc agtcaccagg gcgcgatcaa gtgcgcgact ggcgcgccaa ttgatatctt    194160
     cgacacaggc tgagctcact ttgagtttgg cggctttaag cagacgctcg acccggcgct    194220
     catcgcgcca tgccacctcg cgctgcacca gcagggagaa tctttcatca aaacccaggg    194280
     cgctgaccgc gatgctggtg gcttgctctt caatggcgcg caccatgcca tccaggcgca    194340
     ggctgcgtaa ttgggtaagg gtctgttcgt tcatggtctg tcctgtcgtg tttggtttgt    194400
     tgggtaggcg tgtgttcagt ggaaataatc tgcgccacgg atgttgtcgt gcgccgggag    194460
     cgcgcccggt gtcatggtgg gcaggttttg ctgacgatcc aagcctgttt tgagaatgga    194520
     ggccacgctg cggtaggtaa gggagcgaat ggccagtgct cgggtgcagg ccgcctccag    194580
     cctggccggc gtgaattcgc gtgccaagcg ctgcaagccc aaacaagccc ggtagccctg    194640
     ttcaggatgg gcgcggtgtt caagctgcca ggtcaccacc gctgcggtgc tcacgccaat    194700
     gcgcaggccc cagtcgatga gcttttgcgg ggtccactcc agatgcgccc ggtgcgacgc    194760
     aggcatatgc tcaggcgtgg tggtgtgggc accgcgcttg gggctgacag cgtggcaagc    194820
     cacgcgctgg ttggaggaat aacattccag caaggtgtca ctggcgcgca gttccacggt    194880
     ggtgcgcacc agggtgtggg gcacgctgta gtaatggccg tcaaattcca cgtggtagtc    194940
     gacattgacc ttggccgatt tccagcggaa taactcaaag cgtttggccg gcagtggacg    195000
     cagggctgga gcatcaagct gctcaaaggc actgcgcctg ttgccgggca gctttttgaa    195060
     ggcgcgctgg ttcaaatcgt tcaggagcag cgcaatggcg tggttgagct ccatgagact    195120
     gaagaacttg cgattacgca ggcgtgccag tatccagcgt tcaacgacca ggacggcgtt    195180
     ctcgactttg ggcttgtctc tggggtgagc cggccttgct gccagcaggg cacaaccgta    195240
     gtgggcggcg aattcttcat acagacggtt gttctgcggg tcgtagctgc acgggttttt    195300
     gatcagggag cgggtttggt ctggcacgat caggcgtggc acaccaccga aatactccaa    195360
     tgccagcacc tgggcgccaa tccagtcggc tgtggtctgg cgcgccgtgg cacaggcgaa    195420
     ggtgtagttg gaggcgccaa gggtggccac aaatatctgt gccttggtga tttcgccggt    195480
     gccggcatca atcagcggga cggtttgacc ggcgtagtca acaaagagtt tctcaccggc    195540
     aatatgggtc tggcgcatgg agcgcttcag ccccatggcc cactcccggt atttgacgca    195600
     aaagctggtg tacttgaagg ccaggtcgtt gcccttggcg tattcctccc acagcagttg    195660
     cagggtgaca ccggcgcgtt tgagctcagt gtgtatctgg gcaaagtcag gcagtgcttg    195720
     tttgctgttg cgcggtaacg ctgccttgta cagcttggcc tccagctctt ggtcgctcaa    195780
     ggtttgtgca acggaccagt caacaccggc cacacgcgcc agtgacatgt atttgccgac    195840
     tacgcttttg gatatcttga ggttacggcc tacctcgttg tagctcaggt tggcctgcag    195900
     gtgcaggcgc agggattctc ggatttggcg catggtgatt ctgttggttg gcatggactc    195960
     tttcgcgaaa aagcgtcgag cctatgccgg gtttaagaaa tcacttgccc gtatcccccc    196020
     aaaatatcgt ccacgatcag tttgaaacag cgtccacgat caatttgaaa tgccgtccac    196080
     gatcacgctg aaatcgcgtc cacgatcagc ctgaaacacc gtccacgatg gactgaaata    196140
     tgcacgcatg gaagtgcaag ccaattccaa aatcggcctg tatcacaatt tgcatttgca    196200
     gcacagcctt tgacgatcta gtcaatatca ccaccaggag tgatgaattg acctcatctc    196260
     aagtgagcta cacccccaca ccagacggcc tatacgctga attggataca aaaacaggca    196320
     gcattcgagc aacgattcac ccccttcaac ggaatcatcg aatttgtttt gcaacctgta    196380
     gagggcttgc agcccacttg cagggcaagg taattgacct gccagacctt caggcgtgcc    196440
     agcaggcaat cactgcatgc gaaacagaac tcaaccgagg gcagcttgtc acccaaagtt    196500
     acttctgaaa agcatttgaa aagcagaaaa ctcacccttc aggtgtgttt tcttgtggcc    196560
     ttggcgcaag gccacaagaa agcaatcgct gtgctgtttt ttaacatcct ccaatgagga    196620
     aagaaagcat ctgtatgcca gcaacaaaca aagcaatcga tatccgaact tgcggaaagt    196680
     cagaccatca ggaaatcaag gaagcccccg accaactgaa ccccggccaa actattaaag    196740
     tcaaaaccag tgaactcatt ggtgcagcct tcaattgggc ggtagcgaag tgcgaaggtt    196800
     atgaggtgga gctgtcacct gactggtatg ccccaactaa ctgcgcaatc aaagcctctt    196860
     acgctaacgg catctgccta aggtgggtgc atagtggcga gtggtcaccc gccaccaact    196920
     ggaaccaagg tgggccgatc atggggcggg aaggaattac tacgcgctgt attggtcgaa    196980
     gtatttttgg cttcttgtgg gatgcaagca catacggcaa tgatgaagag atagtgggtt    197040
     acacccagct cacagccggc atgcggtgct atgtcgcgtc caagcttggt gacgaaattg    197100
     caatccccta cgaactcatg ccgtagacga tagatatgga aagacaggtc acaacaatgt    197160
     gaatgcgaaa aaaatcaagc cgcatgaaca tggcatttga aaatcattgc caaaaatcct    197220
     gcatagcagg gtttttgtat gaattgctac tctctggtgt tcatgtcaaa ttggaaagct    197280
     gcatgcaaat ctatttgtag caagcaatcc gacaaatcac tacacgcagt gtaatccctt    197340
     cacaagaggg cttgccgata tgcccaatgg acataacggc aagccttgag cttgatccct    197400
     ttttaactac tccattttgg agaatgaaag ggaaagcaat gcaaaccaat aacgtctcta    197460
     aaccgtcgtg gaacatcact aacggcgcta ttgagcccaa cagaaccctc gctgcacttc    197520
     tggtgcagca gcgttttctg aatgaaaatt tgcttccggt caagacaggt cttgtcggtg    197580
     caatcctggc acgcgagttt gtctctaatc ctgaactttc attgttcaag gttgaaattt    197640
     atctgaagtt cggaactacc tacaggctga cggtagaaaa atccctgaat ctgatgggcc    197700
     aggaggctcc ttttgatttt caattggaaa tgaccgacga cgatgagatc gaagttttgt    197760
     tcaaggcatt cgagaaaaat cacttcggag tcgtggaaat cgaatgcagg cgcgatgaca    197820
     ttgcgagctt gctgggttcc ggcgaatgga tcagcggaaa tgaagctttc gaaaagttct    197880
     ttcccggcct tgcaggtgca agcgcacaac cacactgaat gaccacggct taaccgcctg    197940
     ggcattcggc aatggctgaa gctgtcgaac cgcacaactt aaaacttgtg cgggttgtca    198000
     atcagaaatt tggctagcta aataaatcac agtattaaaa agcaaccctc tcacgagggg    198060
     gtttgccgtt atgccttccg gacgtaacgg caagcccatg cgcttgcgcc tttttcaacc    198120
     ttcccttact tgggaaattt aaaaggagtt tcttatggaa aaagctgaat ccgtgacttc    198180
     gggcacgcca gcaagaatcg cggtcaattt gattgatcgg ggaaacaatc cgcgtactcg    198240
     gttcgatgag actgcaatgg atgaaatggt cgcgtctttt cgtgcccatg gcatcctcca    198300
     gcccatcctt cttcgcccca gtggtgaaag tcgctttcag atcattgccg gtgagcgtcg    198360
     ctttcgcgcg ttcacaacgg tctacggcat gggcgtggac atttccattc cagcattggt    198420
     cgtggaaatg gacgatgcac aggcagacat gagtgcgttg attgaaaacg tcattcggga    198480
     aaaaatgacg ccggtggaag aagccgaagc ggccgcacgc gtcctggggt actcacaggg    198540
     tgatcgggac gaagcagcgc gcaaactggg ctgggaacgc aagtttctcg accggaggat    198600
     tgccctgatg tatgcgattg acgaagtacg tcaggcgctg caggatgaaa aaatccttct    198660
     ggggcatgcc gaactgctgg caggcctgcg caaggaaaca caaaaacagg tgctcactgc    198720
     cttgctttcc tcggctgaaa agccaacggt cgcgcaactc aaggatcggc tggaaaaggc    198780
     ggcgctttcg ctggtaaagg caattttcga gaaatcgcaa tgcaccgact gccagcacaa    198840
     cagcggaaat cagcaagcac tgtttgcaga ggccatcagc gacggtaact gtacgcacaa    198900
     accatgtttt gaacgcaaaa ccgaacgcga acttggaatt cgtgccagag cgctggaggc    198960
     tgactaccag gtcgttcgta ttgtttatcc aggtgacaac ttcacggttg ttcaactggc    199020
     tgccgatggc gtgcggggcg ttggtcaaga gcaagccgcg gcctgccgta gctgcaaaga    199080
     ctacggcgcc gtggtgagcg ctttgcctga caagctcggc gcatccttca agggcatgtg    199140
     catgaacacg gtttgcaaca acacaaaggt tgcagaccgg atcatgggag agaaggcggc    199200
     tgcgtcggcc ttggctgacc agaccattgc caaggcccag gatgacacga aagctaaggc    199260
     caaaagccca agccaagccg caaccagtgc cagtgaggtc aaggccggga catccaaagt    199320
     tcaaaccggt gccgtcaagg cgccggtgag ttcggagccc agcaatgcac tcaaggaata    199380
     ccgagaaaag gtatggcgtt cggtgctcag tcgggtaatt gcccggttgg atcctgaaac    199440
     caatcagtgc gtcatgcttg ccctggcagc attcagtcct cgcgtgatcg attcaactgc    199500
     attgcttgag gcaattacca aatcgtcgat cctgctgcaa aacaatgcaa cggatatcgg    199560
     cgtggtactc gacagcgcca tggcgctgga caacgatgct ctgaaaaagg cgctcagcct    199620
     gattccggca agcatctcca aggatctgga aatccgccag gttgtgagcc ttctcaaagg    199680
     gcttgacgtg aagctcgaag agcactggaa agtcaacgat gaaatgtttg gcctcctgac    199740
     caaaaatgag attgacgcca cttgcggcga aatcggcatc aaggcagcta tcggcacggg    199800
     ttatcccaag ctgatcggcg gcaaaaagga cgatctggtg aacgccattt tgaccatcac    199860
     cggctttgaa tacaaaggcc gtatcccaaa acaaatgcgc tggtaacagc aattttttga    199920
     ctccctgacg tgtccggtgc ccacaaggca ctggacgcgc tcattcaatg cgccggtccc    199980
     ccggtgccct gcaaattccc atgtctagtg cccaacagca ccaggcatgt tctttatttt    200040
     tcttttaaag gaatacgaaa atgtttttca aagcaatcgc gcctacgtgc gccagaggta    200100
     tcagcttcac catcctggtt gaggctgctg atgacggaaa actcgcggtc agcgttactc    200160
     ccgtttcgaa aacgggcaag agtggttttg gcctcacgcc aaagcaattc gtcgccacac    200220
     ctgaggagtt cgacaacgaa ttcagcagtg tgatggcaag ctttgctgga atccagcaaa    200280
     cgctggccca acaactcaac gccgccgaac tggtggccga ggaagtgggc aaagcggccg    200340
     ttgcagcagc tgcggaacaa cccaaagcga cttcgccggc atccaaaagc ctttcgcggc    200400
     caaagaacag caatcaggct ccggccggac tgctcgacga ggatggtact catgatgaag    200460
     gtgagggcga agaagagcca ggcactaccg tgcctgttgc tgtgccagcg cccgctgtca    200520
     ccagcggttt tgattttgaa atgtaaggag acgcacacca tggcactcat tgcaaagact    200580
     atcagccgca ccttcaagtt caacggcatg actctcgccg acccaagccc ggaaatggat    200640
     atggaaactg tgaagcgttt ctacgccaat cagtatccgg aacttctcaa ttccgtggtg    200700
     gaagggccgg tgaccaaagg cactgtctcg acttacacct ttatccgcgc tgtcggtgca    200760
     aagggatagg ttcctggcat ggccgtctcg atgatcgaag cgatcaaaaa aatggccctt    200820
     ggctccagcg atgctaaatc gctgttccat gggatgactg aaactgaaat caaggagaac    200880
     atcgcatgct cgaccgttat gaacacggtc gtgaattcga atgtgacccg gaatccgctt    200940
     cccttgtcac aacaagcgtt cggaatctgg gggtagtagc acagggcaat caggggggaa    201000
     tgtgggtttt acccactttc tctcctgaaa tacctcttga aatcagtcgg gctgacgctg    201060
     aagcgtcaaa cctggctgat ttcatactgc tcgcacacaa aaagggaatt cgcattcccg    201120
     actcgatata cacgaccaca agcgaactca tgacccagca atttgcaaac tatgcaagaa    201180
     gccaagtcaa aaatgtgaga gttgagctac ccctggatgt gtcgatcgtg gcaatcgata    201240
     aaaaaatcga atttgccgcg aatgccaccg acagatttca aggtatctat caattgaagg    201300
     attctgttga gcggctcaat gccgcttcac ctggcctggg ttggtttatt accgacacga    201360
     ttcgcaaggg gcatggcgta ggactgacaa cttacgatcc atgccgcatt gccaattgcg    201420
     tgcaactcat ttggtttgat tcagaaacag accaagaagc agctgctgaa gtgcttgaca    201480
     tagatgaaaa gaatgtcact gaagcgcata tagaacaggc acgcgatgag cggactttca    201540
     tgccttcaga ctttttggct tccgtcggtg gacataaaca tctgctgtcc tggagccaaa    201600
     cgaaaaaaga gaaagcggca tgccgctcaa tgagtgcttc acgtgtacgt gcctgtattc    201660
     acaaactcaa acttgtggag gcagaccgtg cgttggtgat ggccgctctg gagtttcacg    201720
     actctatcaa ggtgcgaaaa gctaacgctg ctatcgctcc gaatggctgg tttgagcatg    201780
     agaatcttca tgaattcgaa tgtttggacg cgctgggttc tctggcgttc atcgtctggg    201840
     acgattcaga atttgctcgt gaagcgatca ctcattatga agaatacgcg atgaacggcg    201900
     agggcagtca ttcgcaacta gtcggtcttt tcgtcgaact agatgaaccc gcaagctggg    201960
     gtccatttat cgatgcctac aagctgtata tcaaacgata tgcggcattt tcaaacttca    202020
     taggggcttt gcccgaggaa gaataaatat gttgatggtt caagcatccg cgaactcgac    202080
     aaccatggcc ttgcaaaagg ccattcttgt ttatggcgtg gcaaaaagaa atctgtacga    202140
     tcctgatcag tcattggcca taacccatgc cacgatcaat gatgtcgaaa tgaagtccgg    202200
     tgctcccgta ctgaaggctg gacgtctgat gacgcagtct gatctgaatg aactcgttac    202260
     aggcttatcg caatcgcagt cgctttcggt tccttcgtgg atcgatacca cgatgctggc    202320
     actgggcgcg ggtcgcatga tctggtacac gccggcatgc cagcgggcca tgttcttcaa    202380
     gacttcttcg tttacgaagg atacttttga agcgcaaggt cagctgccaa cgccggggct    202440
     ggtctggctg gtgatgcagg gagccttgta tgtttacgca tacaagggct caggcaggcc    202500
     tgacaaggaa accaagctgt atcaggctcc attcttcaac gtgtggagcc aaggtaaggt    202560
     ctgtaccggc aatgctgcca tgcccgtggg ggataacgca gcgatccccc acatgtgggt    202620
     ggatgccttc ttcggaagca atttcacgca tccgaacttc aaggaaaagg accgccttgt    202680
     gaaaggcgtg tgccccatcg atttctggaa agccatgacg gaaaaacctc tcccggtatt    202740
     tcctgaaggc cgcctggtgg atctgcccct cacggtggcc gacctgctgg cgccggactt    202800
     gaaccaaaag cttgggaaca tcgaccgcgc cgctggagaa ttctgatgaa tctcgatcag    202860
     atcacgatgg gggtttttcc acttctggcc gcttcgcaaa cgggtgtcct tcaagacccc    202920
     gaaaagcacg gcgttcggta tgtggcggca agtgacggta tgtggcgtgc cattgacaca    202980
     gcgtggctta aagcgctgac gccggtggcg ctttcctcca aaaaggctgt gattccctat    203040
     gggcgcttga cgcagtctgt tgagtttctc tgcagcatgc cgccggcaag cttgtggcgt    203100
     gaatttgctg tactggccaa gtcaacgctt cccaatgagg ttgcagctgc catggtctgg    203160
     aatgcagagc aagacacttg gcgcctcgct gccaggcaaa gcatcgaggc caatccaggc    203220
     tttgtgcgtt accgcgaagt cgagctgcaa gagggcgagc attttgtcgt ggacattcac    203280
     agtcacggca accactcagc ctttttttca gagacggacg actgtgacga ttttggaagt    203340
     accaaagtca gtgcggtgct tggatgcgtg ggtcagggag caacgcaagt tcgtatccga    203400
     ctcatgctga ttgataaaca catcgacctc aaactcactt gttccggcgg gtgggaagta    203460
     caggaagaaa aacaggaaat cattctatga aacataaagt tcatccagag cttatccggc    203520
     gtgcgattaa cgtggtcgtg ataggcgccg gtggaacggg cagccgcgtg atagaagggc    203580
     tggcttgtct gcaccgcgcc atcaaagcca agggtcaccc ctttggcctg aaggtgtcgg    203640
     tcatcgatcc ggacaccgtc tcggaggcaa atgtcgggcg tcaagctttc tatccctgcg    203700
     atgtggggca ttcgaaggcg catacgctgg tcaaccgggt gaacatggca ttgaacggtg    203760
     aagcggtatg gaccgcatac tgtgagatgg tcacacttca aacagatttg tccagtgccg    203820
     atattgtcat tggcgctgta gacaaccgca aggctcgtct ggcgatcctg aggtcgcttg    203880
     agaatgtcag ttcgggcaac cggtactggc tggacctggg gaaccggata tcggatggcc    203940
     aggtgatttt gggtgaggtt acttcgcgca agcgaaaaac tgacgaccca gagcgcctgc    204000
     cccatgccgg cgaactgtat ccagagctga ttgatccggc aatggagcct agcgatgatg    204060
     taccgtcatg ctcgctggcc gaagcgctgg aaaagcaggc tttgttcatc aatcctgcgg    204120
     tttgcgttca agctatgaat ttactgtggc tcttgctgac caagggtgag cttgagattc    204180
     acggtgcgtt catcaacctg gagtttggaa ccgtgttacc gcttcgagtc gatccccaac    204240
     aatgggcgag attcggtgtg gtacgtaacg gaaaaagaca aaaggttgtt cggccttctg    204300
     cgcagaaaat aaaggcggct gctactgcgt gagcagtttt gcaccgctgt agttctttgc    204360
     tcatagtaaa aacgtgtgga atcttcttcg gaggaatttc agtgcaatcc ttctgaaaag    204420
     gaggtttgcc gttaggcccc ctggacctaa cggcaagccg tgcagcgatt tttttacact    204480
     ccataatgga gagcgaaagg aaattcatgt catcaactga gcaaattgaa aaaccatctt    204540
     gggtggttgg ttcgagcggt aaattcaaat caaatgccgc gcttgaaaac gttttcgaga    204600
     atgaaaagtt agttcaacgt caattggcct tggcaaactt gtctatggtt ggggccatat    204660
     tggcttatca attcgtcgca aacccaaaac tgcatgtctt caggatcgaa gtcgagaaag    204720
     tggcccgttc cttttgtgag gttacgctgg ttgaagcatt cgacgcaagt ggaaagccag    204780
     ccagagcccc atcgatagaa aagttagaaa gcgatgaggc tctgagtctt ttcacagcat    204840
     tcaaagttaa cgccaatgga gttgctgaaa ttcagtgtgg gcgtgaatct attgcagacc    204900
     tgctcaagat cgagactgca gtcaatggtg cagaagcatt tcacaagttc ttccccgact    204960
     acgcataatg cgtaatcggg gaagatattg atggagcatc acgttcaaaa caaattgaaa    205020
     tgccgttccg tattttttaa aatatcagcc ctcttgagag ggcttttttg atggtccaga    205080
     gatgaatgat cgaaaaagtc ctttaagact tattcttttt cccctttcgg ggtgtttgat    205140
     gttcaacctt tcatgtacag tgttcaggtt gaagttggct ttccaatgtg gcttgtagtg    205200
     aatattggaa aactttttta accgcttttt ataaagcatg attttttaac cccagggcga    205260
     caaaccctgg ggtctgtcgt tccttctatg gagaaacgac atgaatgctc aaactgatgc    205320
     acgtcatagc gccacggcaa aaaaaggcgc tgatggcact tttgatatgg caatgagcta    205380
     tggctgggca agcagtgaag ctgcctggga gccaatcgtc tcccgcgcaa gttggaacgt    205440
     tatggatgcc cgtgcagttt tgcgaatgat cagcttaatg gaggatgccg gcattgccga    205500
     tcttcctcgg gcggcgggcc tcatgcgcaa tgctgcacgc atcgcgaaca gcacgctgcg    205560
     tgatgcagcc ttcagcgatc ccgtccggcc acaaattagt cggcggtaac tcggaaatat    205620
     aggcggagag aaaggttgca taaagcagcc tttctccccc ttcttcctgg tgggcttgga    205680
     tcacgccttc aagccaggct acgaattgat gcagctcggc gggcgcatcg gtatgcgggg    205740
     cacacagctc catgaacgat tgccggtcct cttcgcaaga ccagcgcaca aatccgtcaa    205800
     cgatttccat tttttaacat tcctttgatt cagtcgagtc tacgactcct ttggcgccgg    205860
     tcaacagacc tgcagccgcg ctgaaatccc ttcattcatc catccactac gtgctcttac    205920
     ttctgcaaac cactgcagta gtaaggccgc ttggtcgcgt cctttttcct tgtctttcct    205980
     cttttgagga agttttaaac ctgctgctaa cgcagcgatt tatctgggaa tcaacgtgaa    206040
     aaaacctaaa gtaatttccg tcaaccaaat gtccttattt ggcgacgtta ttgaaattga    206100
     ggagccgcca gcgtctgtag cggtcctcaa accggttgca aaagccgtag aaacgctgac    206160
     taagcgccgg gagatgtttg ttctggaaag caaatacttc gctcagctga ccgggcctgc    206220
     agccaaggtg aaagccaacc tggcagccgt caaaatggcc atgcaaggtg gcaaaaaatc    206280
     gcttgaagaa aaagcggtca tcgtagccta cagcggctgg ggtggcattt ctgccatgtt    206340
     tgccgataac ggcgatttcg aggcccagcg gcttgagttt ctggaaatgg tcggtgaaaa    206400
     atcgtatgca caggcccgcg acagcgtgct gacggcttac tacaccgagc cagaagtaat    206460
     ccaggccatg tggggacttg tccaaaagat gggtttcaag ggcggaaaag tcttggagcc    206520
     ctcggcggga acaggaaact tcattggtgc catgcctgtt gccctgcggg aagcttcgac    206580
     catcaccatg gtcgagcctg acagcgttag cgcaacgatc tgcaaggcgc tctatgcgga    206640
     ctctgatacg ttggttcaca cctgcggaat ggagatcgca ccgctgcgca gcgaaagctt    206700
     tgatgtggtc atcggcaatg tgccttttgg gaactaccgg gttcatgact cgaagtttga    206760
     ttgcatgaag ctggtaatcc acgactacgc gattgcaaag tcactggacc tcgtgcgtgc    206820
     cggcggcatt gtggccgtga tcacctcaac gggaacgatg gacaagccga aaagcaattt    206880
     tcgcgagtac atcgctgaac gcgctgatct ggtgaccgct attcgtttgc catcgggtgc    206940
     attcacgcgc ctgggtgaga cggatgtggc gactgacatt cttgtgcttc gtaaaaaacc    207000
     aaaagttgct gactctcatg tgggtcacga cttcaaggtg gctgaagtga tcaagttgca    207060
     cgagttcggc aacatgaatg agcgcagtta tgacacgatc aatgcgttct attcacagaa    207120
     ccagcgccag ctcctcggaa tgcccaaggc cagcacaaac cagtttggtg cttgcctcaa    207180
     gttcgtgccg gagttggcct ggggtgaaca actgaaaacc atgtgcagcg atgcgacgtt    207240
     ggacggttgg tacacgcacg aggaacgcaa agaaattcgt gagaatttcg tggccgacat    207300
     gagcggcttg aaaaccatgg tggccagcgg ctttttcttt gacgatcagg gtcagctgta    207360
     ttacatgacc aaccaaaacg ctgaaagcca ggcccatttg cctgagccga agcgtcggcg    207420
     gattgaagga atgacgcata ttcgaaattg cgtcgtggaa ctgctggagt tggattcggt    207480
     gggtgcgaac agcacctatg aacgcgccaa actcaaccgc ttgtatgacg cattcgttgt    207540
     gaagtacgac tacctgatga agccgtataa ccggcgcctg ttcagcctgg acagccatgc    207600
     gccgcttttg tggtcgcttg agcgctacga tgacgaaaat gaaaaggccg tgaaaacgga    207660
     tattttcagc aagtcaaccg taagcgctgc ggtgctgtct gatacggctg aatcgctgtc    207720
     cgatgcgatt gccctgtctt acaaccgctt cgcgcggctg gacctggcat tcatggccaa    207780
     ggccttgtcg ctcggtgagg acgaggtggt gcaaaagctg cttgacgcta accgggtctt    207840
     ttttgatcca gaaagcagag agtatgtgga ctccgaggtc tatctgagcg gcaaggtgct    207900
     cgaaaagcta cttgtcgccc gtgcggctgc agaaggcgac gaacgttaca tgctcaatgt    207960
     tgctgccctt gaagcggtgg tgccggcaac ggtgccgctg agcaaggtca gcatccagtt    208020
     gggtgtgcca tggatcgggc aagaggatgt gcaggccttt gtcgatgaaa tcgtgaccct    208080
     ggatgccgaa aaggtccaag actacaacga cattaaagct gtgacagtta cgcaagtgat    208140
     tggcatggca gtatggtcgg tgacgatggg gaatcgattt caaaaggaaa ccaggtatag    208200
     cggtgattgg ggaacagcgc ataggccatt tgatgacctg ctgagcgact tgctcaatca    208260
     gcgcagcacc acggtttaca tggaaattga agtcgagccg ggcaagacaa agcgcatcgt    208320
     taacaaggac gagacgctgg cggcacgcga caaagccgag aagatccagg cagcatttac    208380
     ctcatgggtc tatgcagacc cggagcgtgt ccaacggctg gagttcacct acaacagcaa    208440
     attcaacggg acactcaacc gtgaattcga tggcgcgcac ttggtggtgc cggggctgag    208500
     ttcggctgtc aagctgcgct cggaccaact ggacggcatt tgggccggtt tgatcggcgg    208560
     caacaagctt tacgcttatg ccgtgggtgg cggcaagacg ctgattacca tttgccttgc    208620
     gcagatgatg aagcgtctgg gttttgccaa gaagccgacc atcgtggtgc ccaaccacat    208680
     gcttgaagag tttgcgggac agtatgcgag ggctttccct cgtgcacgaa tcctggcggc    208740
     cagtaaagaa gacctggagg gcgacaagcg ccgggtactg atgatgagat tggcaatgga    208800
     ggattgggat tgcatcatca tcacgcacgg ttcgttcgga aaaattgcac tctctaaaca    208860
     agttgtacag gatttcgcag acgaggccgg tgaaaaaatc gatgccatga tctcaggctc    208920
     ggatgatcgg aacgtggtgc gcgaggccgt tcggcaaaag aagactgtca ttgcgaaagt    208980
     gatggcgctg gctgaaaagg gcaagaaaga cgatggggtt ttgacttttg accaactggg    209040
     cattgatcag ttgctggtcg atgaagccga ccttttcaag aatttgtggt ttcaaacaaa    209100
     gaaaacacgg gttcccggac tgagcagcgc ttgtagtggt cgcgctttgg atttatttct    209160
     gaagtcgcgc atcattttcg agcgccgcaa ggacggattt ggtctagttt ttgccacagc    209220
     aacgccgatc gccaacacga ttggcgaaat gttcatcatg cagacctact tgcagcctga    209280
     ccgcctcaaa gagttgggaa tcgatgggtt cgatgcatgg gcggctaact ttgcccgtga    209340
     agtgacttcc atcgaggtga cgcccgatgg aggtggctac cggatgcaca cacgtttttc    209400
     ccaattcgtg aacgtgccag agttgatgct gattttcaaa gaagtcgcat tgattcgaac    209460
     caaggctatg ctggcgcttc cagagccaaa agtcgctggt gggcgtcatt gcattgttgc    209520
     cgcgcgtgca tctgaagctc aaaaggccta tgtgcaaaaa ctcgtggaca gggctgcggc    209580
     tatccgtgaa ggaaaagtca agccgcatga agacaacatg ctgtgcgtga caggtgacgg    209640
     ccgcagggcc gccctggata tgcgctgtgt ggatggcttg gaaatggacc acgcaggcag    209700
     taagttgaat gcctgtattg aaaatgtcta tcgacattgg gctgaaggcc gcgagaaaaa    209760
     gcttacccag cttgtatttt gcgacttgag cactccgaag gcacatggct tttcggtcta    209820
     taccgacatg cgtgaaaagt tagttttaat gggcgtgccg gttgaagaaa tcgcgttcgc    209880
     tcaggactac aagacgacag cgcaaaaggg tgagcttcac cgcaaggttc gctcaggccg    209940
     tatccgtatc ctgcagggct ctacagagct gatggggttc ggtaccaatg tgcaggatcg    210000
     actggtggca gagcaccatc tggacgcgcc atggcgtccg cgtgacgttg agcagcggga    210060
     cggccgcatc atcagacagg gcaacctgaa tgaagaggtg ttcatctacc gctacgtcac    210120
     ggaatcgacg tttgatgcct acatgtggca aacgctcgaa cgcaaggccg gcttcatcgc    210180
     ccaagtgatg gagggaaaaa cagaaatgcg tagtgttgaa gatgtgacca gccaggcgtt    210240
     gagctttgct gaagtcaagg caattgcctc gggtaacccc ttggtgatcg agaaggcggg    210300
     tgtcgatgcg gaagtgtcga aaatcctctc actcaaagct gcttggcgct cggaccgcga    210360
     aatcgtgctc tcacgactcg cgaactgtgt gcaaagcatc gactacagca aaaagcggat    210420
     tcaggcgttt gaaggcgacc ttggatcgat tgggaacgca agcgaagtta cgctgggtgg    210480
     aatggtgcat agtgcgtcag ataagactgg gaagtctgtg atggcgcacc tggcatcgat    210540
     aaaggctagc gtaacgacca aggagcatca gtggaggtcg tttgacgccc tgctggccgt    210600
     tggcaacatg agcatcgggt tggaactgca tggaaaaatt ggcagcgcaa gttacaagtt    210660
     ctttgcaaag ggatcctctg gcgtgagctt tgagttcacg cttccctacg gtgcgaaaga    210720
     catcgaaatc tttttgaggt ctaaacacct tgaaacggat ttgatggaca agctaagttg    210780
     gttcagaacc cggctcattg cggacgaggc tgagttgatc aacctgaaac gtggcgctga    210840
     aaaaccattc gagtacgctg aaaggctcga agcagcgctg aacaagcaag aagagatcga    210900
     caagtcgttg gacctgaggg ctgacgatgt ttcgacgctg ttcatggaag aagaaaagca    210960
     agaagaggcc gaaatggctt cataaaggcg aaagccctac aacaccctca caaggggtgt    211020
     tgtagtcgct gctctgcaag agagcagcga ctacagcatc cactgattcg agaactggag    211080
     tggaaaagcg gtgaaataaa ctctttattc agttcgaatt tcgctgtcac gacattgatg    211140
     atggcgtcat gcaaagaaga gctttcctcc aaaccgtagc tgccggcctt gttgccccaa    211200
     ttctgcagcc gcatgtcatg ggtcaaacac aagatttctg gtcaatgccc cgaacgcttc    211260
     acctgtaccg ccccgcaacc agggaaaccg tccatgcgac ttatttcgcc aatggcgagg    211320
     tcattctttg cgagtatgaa aaactgtgca tccttcttcg agacgttcag gcagggcagg    211380
     cggtgcagat gtcattggtg acgcttgaca tactggcggg catccaaggc tggcttcgcg    211440
     ccaacggcat caattcacca ctgcacacaa actccggtta cagaagcccg ctcacaaata    211500
     atcataccga aggggctgca aagaacagcc ggcacatgta cggcatggct tgggatggca    211560
     gggtgccgca ggtgtccacc gagtcactgg cgcgttttgc cgtgtacctc aaaggcggtg    211620
     gcgtagggtt ttatcaagag aagaatttcc tgcacatcga ctctggcagt ttgagaacct    211680
     ggcggggcta acaggcggcc taattaggcc gcctataaaa aagacgcgaa atttattttt    211740
     tttgtcgagt tccaaaaatg tcaatcaaag tggcatagta gcgactgcat cccagatgcc    211800
     gctgcttttg cagcatgaaa caaatttcag atatattctg aacgactata actagcgcgc    211860
     atgcgcgaac gtcgattcac catcctctgg tgcattcaac gtgaatcaaa aaaagcgcat    211920
     tcgagcgcca cgggcagagc ttttctcatc aagccctgct acaaatctgc gctgcttagg    211980
     cattcgcgca cagttgtagg aacctctcac acttttgatc cagttgtttt tcctgttttg    212040
     tttaacagga aaacccattg gttttgcctt tcttaactcg ctaagttatt tagcacgaaa    212100
     ggtagtgtca tgttcactct caacaaagaa ggtgtaattt ggtttgcaat tagcgtgaca    212160
     agcgttgttg caacgctaat tcagctcaac ttcgcgtagt gtgatgcgca gcgaagagct    212220
     ggtggtaggc gtcagcctgt cattcaaaga aatcccagac gatgagaatc ttgtcttttg    212280
     ttttaacagg cttgaactcg cgcaaatcat tgcatctgtc gggcttcctt ttatcgagtg    212340
     ctccggcgct ttggtcaagg gtttcggcgg gtatctcgaa acaatctgga tttgccggga    212400
     tcggcgtgct tttgacctgg acgccacgta tgaattggtg aagtacaagg ggcagtgcat    212460
     tcatgccagt gaattgaaat tctaaaaaat ttgaattttc cttcgggagt ttttttttgt    212520
     taagtttgaa caaaaaaagc ttctggctta tttcttttaa actacgtcgc tatgacgaat    212580
     gaaggaagat ttaattaacc ccatctatgt tttgctcggt gcgatcttca ttgcattact    212640
     ggctattgtg attggagctc tgttgcaaaa tggctatgaa aagtacaaga ctttgcgtct    212700
     tgcgagccga aagagaaagt catatgaaat ggtcatactc aaaagtctgt cacctgtagt    212760
     tgacattacc aatcaactct ggaaattatg attcggtaat taaataccat taaaaaatga    212820
     atgctccttc tggggctttc ttttgccacc aagtaaaaga aagccccatc agggcaacac    212880
     cttttttaac tcggcccaag ttggctaaag aaaggtattt tttatggctc accaactttc    212940
     gtttaccggt ggtttggcag atatggctta cgcaggacag gtgccttggc acggcctggg    213000
     tcagaaagtc gaagcagacg catccattga agagtggatg gcacaagcca acatggaatg    213060
     ggaaattaag aattcacccg tcatgtacca gaatggagag atgcacgagg ctccggaata    213120
     tcgggttctc taccgcagcg ataccaatgc gcatttgtcg gtggtctccg accgctacaa    213180
     ggtggtgcaa ccaaagcaga tgatggaatt tttccgttcc ctagtggatg cggaaggttt    213240
     taccattgag acgctgggtt cgctcaaagg cggtcgccgc atctgggcat tggccaagac    213300
     caacatcgag gacacgattc gcggtggtga ccttatcaaa ggctacctgc tgcttatcac    213360
     gtcgtgcgac ggaagcttgg caacgactgc caagttcatc tcgaccaggg ttgtttgctg    213420
     gaatacgcaa gctattgccc ttggcgaagc cggccaggaa gtaagggtgc gtcacaacac    213480
     caccttcgat gccaacgctg tcaaaggcca gatggggttg atcggccgtg tcgcctttaa    213540
     cgggttcatt gaccgcatgc gcaatctggc atcggtcaat ctcagcacgc acgatgcgaa    213600
     atcagccttg ggcttgattt tgccggcgcc aacaggtgca aaggaacttg aagagacgaa    213660
     gggctttcgc aagattctgg acttgttcca gggtggggcg atgggctcga acctgcctgg    213720
     ggtggccggt actgcctggg gatttcttaa cgcagtcacc gagtacaccg accaccacat    213780
     ccgtgcacgc acgacggaaa accgcctcga ctcggcctgg ttcggcgccg gggcgaatct    213840
     gaaagcgacg gcagaagaag ttcttctgac actgtaaatc cggaacgcaa tccaccggtt    213900
     ttgtcggggg aaagaaacct tttatcaacc acaagaagcc acattcaatt ttgagtgtgg    213960
     ctttttttat taacttcagg aaaaaataat gaacatcagt accactattg gcgctctcaa    214020
     acatgccctc caaaatgttt tgaaagccat ccataccaag caaatcactg ctgagttttg    214080
     caatggccag ctccatattc atgcttgcgc aaatggagca catgcaaaag cactcgttcc    214140
     atcaacaggt actctgccaa atttggtgtt tcagctgact gccaagctgg tgttgaacat    214200
     catcaacaat tgcgcgactg aaaccaaatg cagcatcagc caggacaagg aggacttgcg    214260
     gctttccttc ggcggcgccc gcatcaagtt gacacgctac acagagaagg aggtggattt    214320
     tttcaagtgg aattcaaaag atgaacacaa tgaagcgatt gggcacttcg aatcgcaaaa    214380
     tctccgcaag gcgatcatgt ctgtgtcacg cttttacagc gatgacgatc agcggtatca    214440
     actacgtggt gtgtacttcc aaagtatcca gggccgactg gtcctcgctg ccacgaacgg    214500
     cacgcgcctg gcagaaaaaa taaccaactt ggtggttcgt gatttcaggc ccatgatcat    214560
     cggcggagag tacgttgaag cgttggtgag catcatcaag aatgatgaag aagacgtcga    214620
     gatttcgatt cgtggtggaa atgacgcaac tgcggttatt ttctctacgc gcaatttcag    214680
     catcaaatgc ccattgatcg gtggtgccta tccctcgtac cgttccatca ttccggcttc    214740
     agaccatcat gttcaggtta acgcagcagc attgatcgct gcactggaca gaatggaagc    214800
     ggtatctgga aatttcgtac atctcaattt ctcaaatgaa attgtgactg tcgagactcc    214860
     agacaacgat agcagtgagc agattcaagc tgagggcgat gacttcactc tcagtctggc    214920
     tatccagcca aagctcttgg ctatttcact tgcagccgtc accacggaaa aggttttgat    214980
     tgctgtgtgt ttggccaatg gcaatacttc ttttttgact atcaaaaata cggagataca    215040
     agatggctgg ctcgcgctgg tctctcctat caagaggtcc aaaaattgaa ttaaccggaa    215100
     tcaatcgtca aggcccctca aggggctttg ctatgccatc ccaaggcata gcaaagcctg    215160
     aagtttttaa gcgctgtgta ttcagcaaaa cttcaaaggg aaatatggct tccgacatta    215220
     aaaaatcttc agaatacttt cttccatcaa acttatattt ggagtggcaa ggttgcgagc    215280
     ttgaggactt tgtacctgca gcccggcaac gattggtaat gcaggcgcat gaagctgcag    215340
     tagttgcagg ccacttttac actaacgacg tgaaaggctt tgctgccgat tttctcgccg    215400
     tcagccaaga cctcagactt ctcaataaac acaaggttca tgggggcgat gtgggctacg    215460
     atatttacta tgcaggcaag gctgtcaatg cagcaaagca ctggaaagca atttcggaag    215520
     taaaccaggc actccagcct aaggtcggga tgccattggg gacacttcgc atcagtttca    215580
     agcgaacgac aaacggcgtg attaccaaaa tcaacggcca tgcgcttgtc atcattggca    215640
     agcgaggaca cgaggtatgc acatttgcct gcgatgtgct gcagttgcaa aacgcctctg    215700
     tcaacgcatt tgacaaaggt tggcgccaaa gcccgttggt caaaaccgcc tagcagtttg    215760
     cgtgactgat aaccccctcg ggggtttatt tttcaagctt gcttgaatca aaacgctgtt    215820
     gtgttgtcgc cgaccgaaat ttgaccatct ggtcaatatt caatcggcgc caacacgctg    215880
     ttgttcagac gttgtttccg cgtgcggcaa caaggtgtga gcgtcgctca tgtcaccttc    215940
     tatcgctgca cctgtagcac gaaggtcgcc gccgatttcc ggtgcgacaa ccttttacgg    216000
     aaaatttccg tagttggagt tttgacatgc caagtatcat cagtgacaaa gtaaaggccc    216060
     gcagcaacag cagccgcagt ctcccggttt ccggacacat ccgttcagga acccaggcac    216120
     ttatcaaaag tgcagcagaa gccgtgggcg caaaagagct ttacaaaaag gcagcttcgg    216180
     gtgcgatgtc attcaaagac gccgaaaaag cgattctgga gaaaaaccca gcgttgagaa    216240
     aagcattcac gccgaaaaac acgcagtatt tcagcttgta cgcgcatgaa acggaagggg    216300
     gacaagcctc ggtggacaac atcatgcagc ggtattgcga ggtggttgaa ggtgatcctg    216360
     tgcctcgcct gtaccaaatt ccagtggtgt ttcctccaac gccggctggt gtggaaggtt    216420
     tcttcaagtc ggaatacagc atggctgtcg gggccatcaa gtaccgcagt gagtatggcg    216480
     atgacggcat tcggcgctgc gtctatctca agccgataga cctcaaggaa caagcccaac    216540
     gcaagaaatt cctgcgtcgg gagcccacaa tccgcaagga ctgtgatcca agttcctgcg    216600
     atgagttcgg ctcaggcgcc tgcaagtttc ggggccgcat tcacttctac attcctggcg    216660
     tgatcggttc aggcactttt gtgtttgaaa ccggtagtgc caatgcgtgt gaagacattt    216720
     ttctgcggct tgaagacctg cagcgaagcg tgcgtggggg gcttccaagc tttgatccca    216780
     atggaaatcc tgtgttcttt ttaacgaagg agcgcaagaa agtctcctat gtggaagcag    216840
     gggttgaaaa aagcggcatg caatgggttc cagtgctcca aacgacgctg atcaaaagca    216900
     gcatcttgct gcttgaggaa aaagagcgtt tacagctcgc gccaccggca gctgttccaa    216960
     agtcgccttc ggcgcctgcg ggatggctgg gtgcttcatt tgggcagtct gtgcaagagg    217020
     atgttgtcga tggctctggc tcggacgaca aactggcgcc aaaatcaaaa accgatgcag    217080
     aaaaagcact ttgggaattg aatgccctta atgaagtaca caaattgccc attgctgaat    217140
     acggcgaagc aaagtatggg gaaaattggc attgcggcga tgacgtcctg gcgcttcaca    217200
     aagatgtgac cgacatgatt caatcattcg gcggaaacct cgatgtggtg cgtatatttt    217260
     tacccctgat gacattgctg ctggccaaca tgattcctgt gaaggaattg gctttcccat    217320
     acttcaagat tttcttcggt gaattcaaga agcgtcatgt gccggaggca atggctcaca    217380
     tatctgaatt gctcaaaagc ggctcggagt tggcaattgc gcacatgaag gccaggttgc    217440
     aaatagctgc ctgaccttat cagtgggcct gttcacaaga caggctcact gaggttctac    217500
     aaaactatgg atcaatgatc caacttctaa aaaaagcgcc ctgggcgctt tttttctgcc    217560
     cgctcgaatg ctttgctgtg ccgccaggta gatctaagcg ctcaggtgct tgaagttttt    217620
     ttaacaccct gtattgggaa agaaaggttc aaaaaatgaa ataaatttgc ccgtattagt    217680
     gcatccagcc gaacgggtga aattcttgac ttctatagta attaatgcta cactttggac    217740
     aattaatgca ttctaagaaa gtatttaaaa cgaagtcatt tgccagatgg gctaggaagt    217800
     tgataagtga ttcagaactt tgcgttgctg ctcttgaaat tgaaaagaat ctttacgaag    217860
     cagacttggg cggtggtgtt tgcaagaagc gcatcgcagt tccagggcat ggcaaaagtg    217920
     gttccactcg tacacttgtt gccaagcgtc atgaaaatgc aatatttttt attgttggga    217980
     ggtccaaaag tgaccctgga gctgattttt cacctacgga agaaactgta gctaaagcat    218040
     atgcgggcct gctacaaaaa gcgagcttat caaaattgaa tcaaatgaag gtgaatggag    218100
     ccttagtgga gatatgcgat gacaaagaaa actgcaagcg atagtcgagt tcttcgagaa    218160
     ctaatggaat caaccatcga gttaagcgcg tatggtcttg tatcaaaaac ggatatggcc    218220
     cgaatgaagg cgctgtgcga agtgccgcct gagtatccac cggagcgcgt cgtgtctatt    218280
     cgaactgaaa tagcaaaaat gagtcaagcc gtttttgcct cgttactcaa tttgagtgtt    218340
     tctacagttc aaaagtggga gtctcctgtg gcgaatcagc gcccaagtgg aagctctgca    218400
     aaattacttc atgtgctaga aaagaaggga atcgagggac tactcattta gtcgctctgt    218460
     tgaagttaac tctttatttc ggattaaaag cctcacatcc tgcagcggga tgcgaggctt    218520
     tttttgtgac cttgatcgtt ttgctgtgct tccaagcaga ccaaagcgct caatcttgaa    218580
     tggcttgccc tttttatcta cccccgttta gggaaagaaa gggaattcga aatgcttgtt    218640
     ttcaaaccaa atcaaggggc accaacagca atgcccatga acgaagcgga ccatgccgca    218700
     cttgaactcg ctgcccaact actaggacag ccgagtgtcg cgtttcatca tccgcagtca    218760
     tttttcgatg cattggatgc agagctgcta aggcaaaagc ggcgcatcat gcgactgcga    218820
     aatgatgcca aaaaggccgc gacgctaata gaaaaactcg atatattgaa gcaagtctcg    218880
     ccagcagaga atgcgcttca tcgcatgcgg ctgtcaattt ttgatgcgca ggatgcaatt    218940
     tgcgagtgcc ttaaatctgg ctcgaacgtt gcatttgatt ctcatgccgg cttgtttcca    219000
     aaagtggctg ctcttttgaa agctactttt accaactcaa gtcaacaata acagtcatgg    219060
     gctgatttgc tgcttttcaa atttacatat tcaggacaga aagaaaacga tgtacgaatg    219120
     gaatttgatc acactatggg ccatccgaaa aattacgtgg agaactgttg tgttcgcttt    219180
     gcgatcacgg cctcctgcag tgtgtggccg ggggggctct tacgttgttg atccagaact    219240
     tgactattga tccggccctc ggaagtttga acactcttgg cgcgttgccg gaggaggcct    219300
     gttgtgacaa tttaaacttc caagggccgg atcaataagt gcgcgacaag ctccgtcctc    219360
     ccaggcgtgg cggggtcact agcgccactc aaaccccttt cgagaggttt tctgatgtgt    219420
     ctctatggac gcattagaaa gcctctggtt tggccctttt ttaacaacct gtaatgggta    219480
     attaaaaaag ctgcccccat ttcgaatgcg ggcagctttc taaagcttgc aagcgtgaat    219540
     tttagaaagc ctgtgcagct tgccccgtcg gcaactctgg cctgattgcc gcagtttccc    219600
     gcacaatttc gatgatgtcc tgaactgtcg cgcaaagcgc atcgatacca ttggcgccgt    219660
     tatcaagctc aagcagccgt aggctgtcga tgcgcttgcg cactgcgtca ataacggagg    219720
     gcaagtcgct atcgcgcatg ctggttaatc ccggagtcca cagccgtttt gcctcagccg    219780
     cccggtggtt taaccgtgct tcacgcactt cctcggggca gttgacatga accaccaacg    219840
     agtctggtgg cagcatggca acatgctctg gcttggccgg aaaaccgtca atcacaacgg    219900
     gagtgatttg gcggtgcttg ccgatctcga acagtattgc gtctatcagc ctctgactca    219960
     tgagttcgcc agtgcgatac atagccaatt cgacaaaaag ccgcaatgac atgttgttcg    220020
     gccgtttccc ggctcttgcc agtctgccag cgtcacccat gctcaagtga gtccagccgt    220080
     gcttgcgtct caagtggtga cccagggtgg attttccgct accgtgcaga cctgccagaa    220140
     aagtaacggg atgcagaatt aacattgcaa gctatgcgtg gtgaatgctg agattaaaaa    220200
     tggagtttga atttccgaag ccgccgcact ccgtcacatg ggcctgggac ttgacgattt    220260
     gaagttcttg ttgcgattgt ttgatcttgc gaatgaaacg cgccaggaac tcctgatttt    220320
     caggattgct aatcgtttca aggacttcga cgcattctct aaggcaatca accgcatcgc    220380
     caaatttctc gtgcgcgagc gtttgggaaa gtttgtgcgg aaggttgcgg cttttgtttt    220440
     ctgaagggaa agaaagtagt gtcatcgcga gtgctccttt agatgaacat atgtgcttga    220500
     tgcacgggat tggacaagac cgttatttgg gtttcgacag tgaatgaact ctatctacat    220560
     catcgaaaaa cttgctcttt aactgggtag gctggctctg gaattcgatc caactcaaaa    220620
     aagccagacc agcaagcaaa cagactttga ctgtctgctt gacaagagtg gctgtacgct    220680
     tcatggatgg cgcttgtgtc attactgcca agcttgcgaa ctattcaatt tgctttgttg    220740
     agaatctgtc tagcgtgacc gtgtcgtctt ggatattttt catggacact tttttgttca    220800
     cgcgcgcaac cagatcgacg ctgatgggct cctcgtcggc gccttgattc aatgcatcat    220860
     tgattgggcc tttcaaggcc aaagcattca catctgcgtt tatttcggga ccgtacccaa    220920
     gcggaagcgg agtcggataa gtcaccgatt cacgggcagc catggcctgg ctcgaagcgg    220980
     gttcttgcga ggcaaccgga gctaatgttg cattcggtcg agctgactgt agcgatggtt    221040
     ttgtcggttc aagagcttgt ccatccaagg ctgctatcag tgcaggccag tgaatctggc    221100
     tagaacgaaa cccgacatac atgctgctcg caactaccga gcaaaacatg aaagcccaaa    221160
     atgttttttg cacatacgtt ggcttttcaa cataagccat aggcccatta gggggtatgt    221220
     cgtagtcacg ccaaaacacg tcctcgacgg tgcctgcagg catcgaaggc ttgatttttt    221280
     tgagtttgac gacccgtgct cgacctatgc cgaaacgggg aaaaatagga ttgatacgtt    221340
     ttgcggccac tcacatattg ggcgctacta ttttttacat ttctttctga aaactatcaa    221400
     aaaaagagcg taatttcaaa tttatggctc tttgctagct tttttttggg gtttttttta    221460
     ggtcgtccca gacttggagg cggcctaatt aggccgcctc gcctggtttg cagctgccta    221520
     tatccaagtc ttaagttgtg gcgagtttcg aaaaaactct cttgatttcg aatgtaggga    221580
     caaacagcta tttattcggc atgaatttga gccagatagt tttcaaaatc agagcaccac    221640
     aacttaatgc gaaagaattt ttatgagtga actcagtaac agccatgatc tgggtacatc    221700
     cagccccagt ggcgcaccgc tgaccgaaac cgaggtggca ctgcttgaga tcgatgaagc    221760
     ggcgcgcata gccttcaaaa gtgtggagga tgaacaaaac gaggctttgg gtgcggcgcc    221820
     ggcccaggct gcacttgcag acagttatgt tgcacgcccg cgcgttgatt tttcgacact    221880
     gaccgacgaa cagaagaaag accggatcaa ggtttttaca aagcgcgctg cctctcagcg    221940
     tgataggggc cgggctgaac ttgagcgtgt ctatgccggc gcgatgtcgg tgaagatgaa    222000
     tgtgtcctgg aacgatttga cggtggcttc gtcgtgcgaa cgctttttgg gtatgtgcga    222060
     tctatccccc tacacaattg gccggcgtgg cccgtcagtt ctgggcagca aggcaaccac    222120
     aacggttctt gaacaatttt cagccttggt cgaaaagtat tacgaagcgg gcatgcttgc    222180
     taaacgcggc gcccaagctt tgttcgatgc agaacgcgac catgtttttg gtgatgacga    222240
     atgggttacg ccggaataca ccacagcggc gtttgcgatg gtcattcatg ccaaaaaccg    222300
     cagtaccgca cgcattgttg ccggcatggc ggcatgggac gaggcgattc gcctggccag    222360
     cgtcctggaa tggaatggaa aaatcgaaac ctcgaaaatt tcagacctgc gcgagcagga    222420
     gcgaaaaggg atgtactcga ttttttcctt tgcacgtcgc tcgctgattg gtctctacaa    222480
     gggcacgctc aaggtggaag ctaccaagcc tgcgaaagag ttgggtgcgc cagctgaagc    222540
     agtaccggcc gctgctgata ccgaactgac gactgcgtaa tcctttttcg gattgcgctc    222600
     aacgaaaaag cgtagccctc ggctgcgctt tttttatttc gatttggctt tacaagtaac    222660
     ttttaggcgc atccatgccc gactatttca gcgatctgaa tgaaggtcaa ttccaggcgg    222720
     caagctgcga aacgcactgc ttgactattg cagcgcctgg ctctggcaag accaaaatgc    222780
     tgtctgcaaa ggcgtcatac ctcttgtcac aaaacaagac ggttacggct gtcaccttta    222840
     cccgcgattc ggcccttgag ctgcgtgacc ggatcgtcaa acaggccggc atcgatgtga    222900
     tgtcgcggtt gctggtgggc acctttcaca gcattgatct gctgatggcc ttccccggca    222960
     aggcgaaatc ggccatgggt tccaaaatac tcaggcactc ccgctcgtcg ctgtcgcaaa    223020
     gctgggtcat cgtcaaggaa ggcaatcggc gcagtgccgt ggcgcgtgcc tttgacgctg    223080
     ccgccgtgcc ggggctcgaa ctcgatgatg ccaccgcgct gattgaaggc atcaagtcgg    223140
     gccaggtagc gcccaagtgc tatgaagaag agctgctggt taaaacgtac accgatgtgc    223200
     ttgaacgcca tggcgtgatc gacttccagg atattttgct caagaccaat gaagggatca    223260
     aggatggaag gatctcgacg ctcaggacgg actacctcct gctcgacgag taccaggata    223320
     ccgacttgcc tcagcttacc tggaccatgc accatgccaa aaccggctcc atcatcaccg    223380
     cagtagggga cgatgaccaa agtatttacg gtttccgaag ggcgctcgga ttcggcggca    223440
     tgctcagctt cgagaatgat ttgcgcgcta cccgtgtcgt cctggggctg aactaccgtt    223500
     cacacagcga agtgctggag ccgtcagcca agctgattgc ggtcaacttg aaccgcatgg    223560
     acaaggcttt ggtgtccaac aaggggccgg gcggcgccac ggcatgggag cggtttgcct    223620
     cgcgcaagct tgaggccatc gcgtgcgccc aaaccatcaa aacgtccctt gaggaaaagc    223680
     aaagcgtcgg cgtgctggca cgaaccaata aacgccttga tgagatcgaa acgcaatgca    223740
     tcgccttgga gataccctac agccgctcag ccggtggttc agtgctgaag acgcgggaaa    223800
     tgtcagtgtt catgtccgca ctgagctgca tgacccgaag cagtgcaaag gacaccgatg    223860
     aactgctggc ctggtgtggt gtcgatgaac aagatctgac agcgctctac cagacattcg    223920
     gtgatggctt gtttgacgtg gcgcgaaaac gcactgacat tggcaaggct ccaatcaagg    223980
     acgcaactaa actcctggtc gcaaaacttg ccaagtcatt ttctgactgg aaagcgttca    224040
     tcagaaccgg tggctcgtcg atggtggtgg acggcgttgt gcaattgctc ggcagctata    224100
     cggaagacaa atattccaaa aaaatgcttg agatcgttgc aggcgttctt accccgccga    224160
     tcaatgagaa tgttccgctg aacaaagccc aggaacattt tgaatgcaga ttgaacacca    224220
     ttcgggctgc aatggagcgt ccaaaaacaa aagaggatga ggctggcaag ccagtggtct    224280
     tgatgactgc gcacggctca aaggggctgg agttcgatat ggtgtggatc gtcggcgcag    224340
     aggaggacac ctttcctgac aaggccagct ctgtgcaaga agagcgcagg ctcttttatg    224400
     tggccatgac acgcgcacgc aagcatctgt ggatttcggc cagcggcaaa cttgatgtgt    224460
     cccggttcgt ctttgaatcg ggcgtgccac gtgtgcctga cggcaccttc cagacctacg    224520
     atggggacca ctagcaaggc acgatcacaa gcgggcgttc tccgcaaaag cgtttcacta    224580
     gcggcctaat taggccgcta aatctggcag ggatggggac aacatcaagc tgccttcctc    224640
     aaccagttcg cgggcatttt gggctttacc acgcatggcc gtgtttttga atccgatata    224700
     ggcctttgtt acgggataca ggatgtgctt gcgctgcttg cgatcaatga tacccaggcg    224760
     ttcggcagtc agaagtcgag caacgcatgc atcccaggtt ttcatggcac gcagccaaga    224820
     agagctgttc gcgctgatga tcttgacctc gacccgcagc atgttgagcc atgacgtgtc    224880
     cacgtcgctg aacagcccca tgctggcaac cttgtagagt tcgtcaatct ggtgatgcag    224940
     ttcagccaaa tcttcctgaa tcaagacccg gtagtctcgc ttgagcccaa agacgtacat    225000
     cttggcagat acgatgttcc aatcccggcg aattgtcctg gaaacaggat gcgtcaggaa    225060
     aagcacttct tttttcacta cagccatgtt gcatgcaatt tcttcgattc tgtcggcatt    225120
     tttcatgaac tcaagcggcc tctcatcgct gctgaagtag ctttgttcgg attttacttc    225180
     agtaggtagt ccttgggacg atagcaggta tgaactcatg gcgtgaattc ttcactatgt    225240
     ttgggccata ttcctgggaa agcgtgccaa aaaagctggt tttttgcgct attcaaatgc    225300
     cttggcttca ggcatagttg agcaatcgtt tttctatgtt ctgacttatt cagaaagaaa    225360
     aaatgcagcg atcactccct gcctttacga atgactcccg tatcgaaata ccttttaggt    225420
     atctactgaa gacttgtcac ttcacgggtg agcctgcctg ttgtgcgcgt catgctcctt    225480
     cgcgctacag caaatggttc catagggact gagacgacta ctcctgctcg caggatggct    225540
     tgtgctggtt ccatttggaa tcatggtagt tttaccccca accacccgcc ctgtgcaggt    225600
     ggaaggattc tgcgcaagcg ttgcatgcca agccaaacgg ctgttatgca acgcttggct    225660
     tggcctcccg ccaaaaacct acttcttaaa aagtcgtgtg gccgccgaat gcccagaaca    225720
     caagccgatg cgtgtcattg ctctgtgttc tcggtagtgg tcttgcaccc aatcagcttt    225780
     gctgcagata ctgccccggc aagtttcttt gcgtcgaaaa ctaagttttg aagaatgcct    225840
     gctagctggc tccttttgaa ccacgcgctt tgacctgtgc agggttgtgg tgccatgggc    225900
     gctcacaagg ctcaaagctt gtttgtttgg ctccctccaa gcaatcgcag agtcagctgt    225960
     cacgaacgcg ctgaaaaatt cgacttcttt tgaaaattaa aaggcgcctg ttgaggtacc    226020
     gtgtatgcac tagtgggtca gttggcaacg gcatcggcat tcttgtcgca actatggtct    226080
     cggtcacagg gggagtagca cttactttcc gcagggaatg ctggtttgat tgccaactga    226140
     cccactagcg cgccactgaa gccagcacgg cgaaaattcg gcacggcaag acatgttttt    226200
     tccaatgaac gcaaaccgct gtcattggaa agcccgtggg cttaaccctt ttttaacctg    226260
     gcgaaattta gccaacgaaa ggacatttat gaacgatcaa tctggaaatc tctctcttct    226320
     cattattgat gacgatgcga gagaagtgtt cgagaaaaag tccaactttc agttggatct    226380
     tctctccggc tccgttaaaa aagctatgaa tggcgccaag tcttcggact tgtggatgtg    226440
     cccgattgat gacattgtca tcatggaggg cttcaatgtc cgctcggaaa cggcgcagta    226500
     tagggaaaag gtcgagaaat tggccaattc aatcattgaa aatggatttt ataaatccaa    226560
     gccgctagcg atattcgtag gcgtggatgc cgaaggcaaa aacgtcaatt acctttacga    226620
     cggtcaccgt cgatacgcgg ccgccaagct tgcgatttcc aggaacttcg aacttccgaa    226680
     cctaccctgc gtaacttcgc cagccggcac atcgctggaa gatctaacca ttgccatggt    226740
     tacgatgaac gatggcgatc cagttgaccc gtttggagtt gccatagtct gcaaccgaat    226800
     gataaaaggt ggtacgccga ttgaagaaat cgccaggcga ctgatgcttt caccgactta    226860
     tgtgaaagac ctgctcacta tgatggctgc accccgggcc cttcgcaacc tggttagtga    226920
     agggcacgtg tccgctacgc tggccatttc caccatcaag aagcacggta cttcggcacc    226980
     ggcggtcttg caggagggag ttgaaaaagc caaagcgcag ggtaaaaccc gcgtgaccgg    227040
     caagacgctc gctccagaaa aagtcaaaac catcaagccg gaaaaacgcg atctgcttca    227100
     ggtcgcaacc gactggctag cacgaaatgc ggacctcgca gacaaggaca agcgcgtttt    227160
     cgaactcgcc gccttgctgt gtgaagttag ccccaatgaa gttgaaggac ggtatgcgtt    227220
     caagctgaaa gacggcgcgc aacctgacgc tacaaactca ccggcaaagt cttctggtaa    227280
     agaacaactg gcgctcgcac cggaaattct cacttgaaaa gatcgagttc gaccgatttt    227340
     acccccccaa ttcgggggct ttttattgtg aaacctgcgc aataaaaagc ttctgagctt    227400
     tccttttttt atcaatccat catggagaaa aaggaaattt atgacacaag gaaaatacgc    227460
     agggaacacc gtgcgggtgg ctcagatgac agacttgcac tactgtgcaa ccaaccttga    227520
     agaatcggat cgatgcttca ctgcggcggt cacagatgcg atcgagaaac aagtcgattg    227580
     cgccctgatt accggcgaca gcaccgatca tgcgatggac gcccacagcc cggctttcgt    227640
     ggcgctggcc aagcaagtcc aacggcttgc caaccattgc ccggtactca tgctgcaagg    227700
     caccttcagc catgagccag ttgggcttct caaggtactt tctatggtcg gggcaaaatt    227760
     tccgatcatg attgcagaga agatcagctc gttcggattg accaagtcga aagggtttga    227820
     actgatcatc cccaacaacg actatcgcct ggtatgcacg gctataccga cgctcaacaa    227880
     agccgatatt gcggccatga ccgaggacag tgtgggcgct gcggcagaag aagcagggcg    227940
     gatcatttcg gacctcctgg ccagcctggc gcctatgaac agggccctgc gcctacaggg    228000
     aattgcgtcg atggtgatca gccacggcac ggtgatgaac tgcctgacag agcacggcgt    228060
     gcccatggcg ggttttgacc acgagttcac ggccggctcg ctattttcag cgggcgcgga    228120
     cgccgtagcg ctgggtcaca ttcacaagca tcaatcctgg gagagtgata cgcagggatt    228180
     tcgccagacc attgcctacg ggggctcaat cgggagattt cactacggcg aagaagatgc    228240
     gaaggtttgg ctggaatggc acatgacaag cggtcaggct tcgtttgtgg cttatgaaac    228300
     gccggctcgt cgaacaatcg atattttctt tgacggcccg ccggacatgg aaaaaatccg    228360
     tgcagctgct gctcaatgcg aaggcgcctt tgttcgcgtt cgctatgagg tggacgcaga    228420
     gcacaagcaa agcgttgacc gcaatgccat caaagccatc ctcgggtcag ccttgcacat    228480
     ccaaattgaa gggacaacgc tggctatcga gcgggtgcgg gccaaaggca tcagtacaga    228540
     accatcgctg gtcgggaaac ttgaaaagtg gtgcgaggca actggtacca aagtcggcat    228600
     cctgccagag atgctgacca tgattcagaa ccaggacgct caagcgctgg tggacagtac    228660
     gatgaaacgg atcatgcagc aggtgatgcc agtggctgaa aagcccattg aaaccgctgc    228720
     agctgaacca gccaagcttg ccacggcgcc agttccaatt ccaaaagttg atgtcaaaaa    228780
     agaaacgatg agtcgcggtt tctttgaaga tgacttggcg attgaggatc gcacgctatt    228840
     ttgatgccgt aatcagccgg aaggcttctt gcgcaaaccc caaaaccctt tgcttcgcag    228900
     cagggggttt ttctttgtct cgcaggcaaa gaaaagcctc aagtccattc ctttttaact    228960
     acgtcgctat gacgaatgaa ggaaatcttt gaatatgcca cccactcaaa acgcaacaac    229020
     actcggccaa tttctctcga ccgacaccac tgcagcgctc gaaaagcgtc gcagccggtt    229080
     gcagcatttg ctgctcacct cggcagcaac tttcgaggcg cgtgaacgca tcgaaagcta    229140
     tacggttcaa atcgatttcg aactcatgga gcgggttgca gtgcaggaac ctgaaacagg    229200
     ccgatggcat tgatgcgttc gagtttggtt agcagcactt cgcattcctc gctgtcctca    229260
     aggatcgcaa ggatgctcct gttaaccagg ctgttggcat ctggacgcga ctttaaacgt    229320
     tcaatgaaca gggcgttgaa cgtctcaaaa tcaatgcgct tgcccaacaa ggccagcgcc    229380
     tctttgaatt catcttcaga aaaactgcat gggacagaca gaagcctttg aaaaagcttt    229440
     tctctgtccc ctgtggacct cgatggggct gccaggttcg ccgtattatc aatcagcagt    229500
     ttgatgtgtt gtgccataaa accagcttat caccggcctt ttgaagtgca actattcaaa    229560
     ttgaaaccgg ttgcgttcac tgagcccaca ttgaagtgtg gaattcaata cttaacgtgt    229620
     tcgcatttac catgtcattg ctgggcctaa agcctcaaaa tacaaccctc tacacctgta    229680
     gtacaaattt ctcatccacg ctgtggactg gttgcactga agttgatctt tctgcgaaaa    229740
     gacgaatgcc tgttgaggca tccgccttct cgtcgcgagg agctttccga atttaattca    229800
     ttaatttgga aggaatttta tgcaagtcaa taaactcatg cttgagcatt tcgagggaat    229860
     cgaaagaggt cgcggcaagg atcgcattga ggtggacttc acgaaagtca atcccaatgc    229920
     aaaactggtg gcgctgttcg gtcccaacgg aagctgtaaa actactctga tggacaacat    229980
     gcacccctac cgggtcatgc catcgagagc gacttcacca acccccacgg cgttcagcta    230040
     ctaccttcac gtcataccag gcaaaaatgc gctgaaagat attttctggt cccacaaggg    230100
     ccgtgaattt cgcagcgtca ttcgaattcg gacaacggga aagacgaata agcaagagtg    230160
     ctacctgacc gaaagggtgg gtgaagactt cttgccctat gaggacacca ccgggctggt    230220
     tagtgatggc aaaaccgata cctatgaccg cgcagtagaa gccattctcg ggaaaccgga    230280
     agtgtttttt gccacgcagt tcagtgccca gggaaaaaag ccgatcagca ccatgactgc    230340
     tggtgaagtc aaagccctca tggccgcgat gctgattatg ggcagcttca aaacgctttc    230400
     tgaaaaagcc aatgaagtgg tcaagggtct gaagccgcac ctcagcgcat ttcagtcgca    230460
     attgcttcct cttgagacga aaattctcaa ggaacagtcg ctgattgaac tgcgcggtaa    230520
     cctgcagcgc gagatgcaag tcaatgctga aaaagttttg cggcaaaagt cgctcatcaa    230580
     ggaaggcagt gcaacgctgt cggccttgga gctcaagctg tcccagcaag aaagcgtgct    230640
     ggcccagcgg tcgtcgctgc aaatgcagct cggatcagtc gtgtctcaaa atgcggctga    230700
     actggctgcc ttcgaagcga agcaggttgc cgaaagaaaa tcagtggagg cggccgatca    230760
     aaatagccgc aatgctgtac gggtcgcgca gtctgcatat gacgatgctt cgcttcgggt    230820
     caccgagacg atggcagtca tcgctaccga gaaagagatt gagcaagcgc gggtttttca    230880
     ccaaaccaac gtgccggttc ttaacaggct tcggggccag cagactgatt tgtatgtgga    230940
     catcaacaag ttcaatgagc tcacccaatt ggtagccaaa atgcgtgaaa gctttgcagc    231000
     tgacaggcaa acgggcattg ccatgagtga ggcggttgaa acggccagac agatagcggc    231060
     cttgatcggt gaggtgccat gtgcgggtca ccgtttttcg ggttcgtgca agcttctagc    231120
     cgaagcgaac ggagctgctg ttggcttggc gggcaggcaa gccaaggtcg tcgagttgag    231180
     aacccgcctt cagggggatc aggtcaggat caaaaacaac aatgcagagc tgcagcgcct    231240
     gattcaggtc aatgctgaga gggaggtact gttgggcaag atcgcagccc ttgagcttgc    231300
     cttgagtaat gcaaaagccg tcctgaaagg ggctcctgcg cttgaaaaag caaagcagca    231360
     actcgatagc taccggcagt ctgcgttaca agcaaagtct gaccttgcca atgcaaagac    231420
     cattcacaca gcagctctgg gagcggtgaa caacatcctg gccaagcagc aaggtgataa    231480
     gtcgatattc atgtctgttc tctacaagga aaaggacagg attcaatcgg ccatcagcga    231540
     gttgccggtc ctcatccagg actatgaagt caacgaggca aggaaggctt ggcaatatgc    231600
     cgagctgatg ctggagaacg aagagaaatt gcgcgacggg ctggtcagtc gtttcaataa    231660
     tgtggtttta tccatcagtg atatagctgc ttcaaatgca aaaatatcgc aagtcacctc    231720
     tgtgtgcgat gcaatttcca atgagatttc tcagtggagt ttgttgtcgc gtgcgatggg    231780
     aaacgatggg attattgcca tgtcaatcga tgacgcggga cccgagatca gcgctttgtg    231840
     caattcattg ctcaaggact gcgcgggcgg tcgattcaat atcagcttga gcacgcaggc    231900
     cgctacggct ggcggaacgc tgaaggaagc ctttctcatc aacgtcgagg acgtggtgcg    231960
     cggtggcgag ccgacagagc tgaactttat gtccggtggc gaaaaagttt ggatcaacga    232020
     atgccttgta agagcgatgg cgctgtacat gtcgcaaacg acggcatcaa gcttcaagac    232080
     cctcttcagc gatgaggcgg acggtcccct ggaccctgag cgcaaacggc aatacatggc    232140
     gatgaaacgc actgtacttg aacgtggcgg ttatgaccgt gaattcatca ttacccagac    232200
     acccgagctt ttgcttatgt gtgaccaggt gatcgatgtg acaaaacttt aaggaaatac    232260
     ggacaggctg tgaagccttt ccactgccgt tccgagtgac ggcagtggaa agggtgtacg    232320
     ccctttgcct tttttttggt tcaaaccaat tttgaatgaa aggcatagga aattatggaa    232380
     acagcagccg tacaggtcag tgattttttt gcagggactc tggcgtatgt gccaacccac    232440
     aaacaaaacg aattaaaaaa atgcgctcca tttggtatcg aggaagtcga gctaatgctg    232500
     ccgtcattcc cggaagtgat ggtcgctgat atggagcttt gctttcagcg ctatcgacgc    232560
     gtgaaagtaa ataaggatga agttgacgaa gacggggaat tcatggataa ggcgaaatat    232620
     tatgccgaga acggggaaat gcctaagtcg caaagaaaat ctgcggctag cgccaatcta    232680
     tttggagctt caaaagggaa agctacagca ctccaaaagc agttttatga gtgcattgca    232740
     tggcttttcg atatttacga atccgaatgc aggattccgt ttgaacaggc ttgcctgaat    232800
     ctcgcaatgg agcctgaact aatccgcaac accgtatcag ctgcattcag tgacgacatc    232860
     cgtgagttca tcttgatgta ttcctacgca aatccaatgg atgcaaaacg tgtgcagcga    232920
     tgcatgcgtg gttacatcaa cttctacaac tgatgactca tgaaatcacc tggtattttg    232980
     gataagaaat ttacgatcaa ctgggcaaag cttggcttgc tgttgatatt ttttccgttc    233040
     ttttttgcag gctacatcct gtatttcatt tggaagcgag tgaaataaat ttatatgagg    233100
     gcttgccctc aaaagaactc atccgagttt ttttgaggtg gtcattccat cttcgatcct    233160
     attttcttta actaaaggat tcgaatttca tgtcatcaca acctaaacaa ccagccatcg    233220
     agaaaatctt ccagatcatc gctcagatga ccggattcgt cattgccacc ctggtgaact    233280
     tcgtcaaaac agttttcaag gaaatcgtta catcagagga aaaactgatt gatgaagctg    233340
     ccctgaaggc cagccccatg caaactgctc aggcagtgtc agaggggggg cattcaagca    233400
     cagttccaga agccattgca atcgaagttg cggtatccca cttgcaaatg cacagcggtg    233460
     tgatcagaga cgcatcaacc aaggtcataa agctaagttt atttgcgggc tcaaaccctc    233520
     gcattgaacg cctgctgagt gtgccttgcg aaaagttgca ttttcaacgc atcaactggc    233580
     gctttgatcg gattcggctt tctcatttca cacctgagaa agcagcgaaa agcgatttgc    233640
     ctttcaacta cgaaggtgcc aagaaatatt cgcttgcgga tttcgatgca aaagccccac    233700
     acggtcacct gtccaagcaa gttcaaaatt ttgctgagat acctttctta tccaaggggg    233760
     ggtctcctga aaaagttagt tctcaagagg aacagacgga caactcagtt acatcgccaa    233820
     caggctgtgt gactgaagca gaagggacag ttctcagtgc cagctcggtg gtagttgctc    233880
     ctgaaggaaa agcggaatac aggagttttg cggtcgtttt atctaccgca acaggtgatg    233940
     tgacgtttca aggtgtcgat ctggaagtgc aattcaaaaa atatcactat tccattggcg    234000
     atctggtcag tatcaaaaaa tcttcctcga aattcgagtt cacgaaaccc aacaagaaaa    234060
     gtgaaacaag aacaaaaaac gttttcatca ttactgttct taaaaaagcg tagccataac    234120
     tgcgcattca aaccatccgg ctctagtagc cggtttttaa ttcactagga gaaaaaacaa    234180
     tggcatcagt caacaaagta atcatcgtgg gtaatctggg caagaaccct gaaatgcgga    234240
     gtttcccaag tggcgaccaa atcgccactg tcactattgc caccaccgac aaatggaagg    234300
     acaagcagtc cggccagatg aaggaagcca ccgaatggca ccgtgtggta ttcaacggcc    234360
     gtctggcaga agttgtcggc cagtacctgc gcaagggctc gcaggtctat gtcgaaggca    234420
     gcctgcgcac ccgtaaatgg accgaccaga gcggcgttga aaaatacacc actgaaatcc    234480
     gcgccgacca gatgcaaatg ctgggaagtc gccagggtaa tgacaacgcc ggccatggac    234540
     aagatgacgg tgggggatat ggtcaggatg acggtggcgg gtatgggcag catcatggtg    234600
     gagggtatga agaacctcgc caggctcgcg caccagctca acgcccggca tcagcacctg    234660
     caccgaggcc acaagcaccg gcgccacggc aatcagcacc ggtaccgtct catgcttcca    234720
     gcggctttga cgatatggat gacgatattc cttttgtctg tgggtccatg ttttacgaca    234780
     tgaccaccag caaatcaaga aagatggccc gttacgacta ctgatccgta agcgtcaagt    234840
     tccaatcgcc tgcgattggc cttgatgtga acgctgaaaa gaaactgcta tgcagtgcaa    234900
     acctctcggg gtttgcttat ccgcttcgtc gagcggataa gcaaaaaacc gagcaaggca    234960
     cgggtggttt tcaaacaaac ccctttttgg gaaaggaaac caaatggcaa gattagacct    235020
     aagcaaagta gattggtacg caacgctccc tcgactgggg atcgatccca gcaccattga    235080
     aaacccgaga aggctgggtc catgtccgat agaaaatgat gggaggaccc gttttcgttt    235140
     cgtcaacaaa gatggtcgtg gcaactggtt ttgtaacttc tgcggagcag gcgatgcggt    235200
     caaactggtg gcgctcgtca attcgaaaac tgatgccgag gcaattctca tgattcgcga    235260
     tctggacaat gggccaggca tcaagggacc gcctcaacgg ctaaaaccca tcgtggaaca    235320
     gccaagggac gtcacctgga tacgaaagct gctgcaacag gtttgggatg aaaccaagcc    235380
     aattcagggg tcggctgtcg cactgtacat cgagcgccgt gtacctggtt tcgatctgaa    235440
     ctggctttca agttcactgg cttaccatcc tgatctgtac cacgtagatg aggtgaccaa    235500
     gaagaagaat gtttttcccg cgcttgtcgg acgtgtgaca ggattggatg gaacgcctgt    235560
     cacgctgcac agaacgtatt tatccaagga tggctttaaa gcagctgtct caccagggca    235620
     agtcaaaaag caaatgaccg gtgtggcaac gctcaagggc gaatccatac ggctcaatgt    235680
     gcctcgcata aaaacacgcg ttgcaatcgt gtgtgaaggc attgaaactg gacttgcgct    235740
     ggtggccgcc actaaaaatc gccatgcggt tttttccgcg ctcaatgcag gcaacttggc    235800
     caagttcatg ctgtccagag ctgaatttga tttgtgcatc atctgcgcag acaaagatgt    235860
     tatgaatatc aagcacggct ggcgacctgg tgagcacttc gcggagattc ttagcgaaaa    235920
     actcataagt gaaggctatg ctgtcaagtt ccggattccg caagttgagc aaactgattt    235980
     tgcggattta tggatggatc gctgcaaatg gctcaagctt gtggcttgaa aggaaaaaaa    236040
     tcagcccggt gcctcgttaa gaggggccgg gcttttttac gcctgtactt ttaaaacctg    236100
     gcgatggatt ttaggtgttt tcttctaatc gatgacgttt tttaggtggc cataaattta    236160
     caggcggcct aattaggccg cctgtggaga tctgtgatca aaacaatgtg cctttgactt    236220
     tgagcttgtt tcggtgagaa aaacggtttg gcaggtttga cactttttgg cttctacctt    236280
     gccaccatgc tgggccatgg ccaattccct ggcttgcacc acactgaacg catttttgcc    236340
     gaacaaggat tgctgttgtc taaagctgct ttgcagtgca gtaggaacgt cgctgcggtt    236400
     gactgcgtag ctcataaaag cacaaaacag tccggctcga atgtttttat cagcatcggt    236460
     caagcactct tcgacgaagg gcgtgagggt aggttgctca aaaaccttga gcggatcaag    236520
     cttcatcatt gcctcaagtt gtggcatatt ttgttccctg ttagaacgat ttaatttgca    236580
     accgcaattg ctgctacaaa ctttaatgta gttcctttgg cgcggcttgc gatttatttt    236640
     gtctttttag gaaagaattc agggagtttt ttaggcctta aaacaaaaaa acccgccatg    236700
     acggcggtta aaaatcggat aaattgggtg tttagaggca caaagggcac tttgaaccac    236760
     cttcatcaaa acgggctaga tatttcccta ggcacccctt gcagcatttg acaaccagat    236820
     gagtgtgtcg gctttgagga ttttgctcat tgtgatagcc ggcgatcagg ttgaaggctc    236880
     gggagtaggg gagggcgtag tcactttcaa tattgcgaaa agccccgtca acatcttgac    236940
     ccttcgggcc tttccactca cctgcagtga tgtttgaaaa atgatagtaa gtatggggaa    237000
     gagcaagttc ccgtggcatc gctgtcaatg ccttttgata catcaaaata aacaatgccc    237060
     cctgaaaacg cctgtctgtc gtctcaaggt accagtcgtg gttgctcggg aattgaccac    237120
     ttggggaaga acgattgttt gtctttttcc atatcgtttc cccttctctc ttcgtcaatc    237180
     caagcgcatg tacgatgatt ggatttcgag cgagcatcct ggccatgtaa acagcccagg    237240
     gataaaccgc ctcgcttttt tttagccgac tcatgttttt gagcggggct tgtatggttc    237300
     aagggtaatg tgcttggaca gatttctcag catctgagct gaactaaatc cagagcttgc    237360
     caaaagcgtg acctcttcga cagtattgac tctgagaatc accaacggca agcccaggcg    237420
     gcataggtcc agtagatcct ctttttcggc tttttcatat gcatcgagga cttcatcggt    237480
     tgtcccaagg agcatggcaa tgagtggctc ttgcttgcga agtcttagag caacttctat    237540
     caactccatg acaactttgt taactttatt gatctgtgca tgaaacgctg gcgatgtgac    237600
     gtgactagga agcagttcag cgtcgtttcc atggttatct ggcattttct cggtgctcct    237660
     tttataaata ttttctttta ctcaacatca agggctacag ctagtgaccg caggtcggct    237720
     gcaatggctt tgaactgttc tttgatggcg ggggcgaccg aagccattcg ttccgctaac    237780
     gctttggggt atttggcgag catcatggat acgtctgctt gtagatcatc aagcgccacc    237840
     ttggattgtt ctgtcagcga aagggttcgc tgtagtgatt gaagcttttc gccttcttgt    237900
     tttagccgcg acgagattcg ttcattttca tccttcagct cactattttc cttagtcaga    237960
     gtttctttca gctcaacttc actagcgacg cctttgggaa gtgcatattt aatcgcctca    238020
     acgggcgttt tcgcgtcaat ttgtgcttgt tctgcgatcc ctttccatcg catggcttgc    238080
     gttttacgct cttccagtct ttcgcaaagc tcgacattgg tttgctcaac agcggaaagt    238140
     tttttctcag cttccaatct ggcaatggtt tcactgctta actccgccgc tattctgcga    238200
     acatcttcag cagtgatttt gccggcagga tctgcttgca aaacctcttg aacggcaatc    238260
     aaagtttgct catttccacc gatcgcaaac aatgctgccc gagacatctg gtcgaaaaac    238320
     tcgatgcctt ctggatattg tttttcatga tttaccaggg ctgaaccagt tctaacagcg    238380
     gctcgaatgt ttccatcgct catgcgaaga cgggcgaaat tacgagcgca aaaatcttgc    238440
     cagccattac agtttgtacc tgtagacgcg gcgatatagg cctcgtggca gtgatacata    238500
     gccacacata acagtcgcgc actggtgcga atggcaagct caaattgatg gacctgcagg    238560
     gcatggtgaa ttacggaaga ggcgcttgct tcatcgaaat gatcaccctc cagcgagatt    238620
     gtcggcgcga tttgtcctat gtacccaacg gcgggtgaat gtgaattgat caactctagc    238680
     gcttgcattg ggttactaag tccgtgggtc ataggggtaa agttttaact gtcaaaatta    238740
     attactcagg ctctcacaac tatgaaccag tcgtatttca aataccgaac gaaaacacaa    238800
     tcatttcaac tgactttcga gagaagcggt agtttaaggt tccatagacc ggatataacg    238860
     aatgtcaaag attacagcta gactcccatg aaattttctg ctaaacatcc aaaatacctt    238920
     ttttctgaga tggggcatga ctactttgct caattgctta ctgcctgcgt cggtggcgag    238980
     ccagcatttc gtagccagta tttgccggtt gccgagcgcc tggcttgcac cgttcaagat    239040
     ttgcctctcg aaaactccag ctttgcctat gctggtggtg cgcttcaatt cggcctgtta    239100
     gccggattaa ccgctctgcg gctttgcgat ggggtgatat ttgagccgtc agcatctgct    239160
     caaaagcgca tgctggtgga gcctcaatac agatacgcag cctggtgtgc gacgttggca    239220
     ggagtgccgc tgatcgttga tcactatgcg ttgctgaccg tcaatgacaa gccgtggagt    239280
     ttcgctttta gcccgtcttc actctgggaa gcctgtggca ctactggttc ttacggtatt    239340
     gaatggaagc cagcgtcaaa aaatccacca accccatcgc tcggattgat attgctttcg    239400
     agtttttttt atgccgggca attcactgat tttgactcct cggtcttggc aagcatgtgc    239460
     caatcagtca atcctggact tactcagtca tcaggcgaat catccttgtc aaaattggtt    239520
     cgtgttgcac aagagaaagt caaggctacc gaaaagcttc gcatcagcag agtatttgtt    239580
     cctggtgagg cacaggtcaa tacagtggct tctgtgatgc aggcgcttca aaccgtaccc    239640
     gcttcaacca cgacagaatc agcgattgtt aatactccta aagcaaaatc aatttcatca    239700
     aattgtgaaa atcaaaaaat attacaagta gtaacattaa atgttgcttc agagcaacgt    239760
     acaaatcaaa taaacataaa ttctttgact gattcgaagt tgaaactgga aaacgaccaa    239820
     aaactggaga acaaatccgt gcctggcata cctccgaaag taacattttg gttaagagcc    239880
     ttgattagtg acgaagcaat gcgcctggca ttcaagtttt tgcctgacca ggaaatggtt    239940
     gacattaccg gtgctcaact caggtttgga gtagtggcca aggaaatgtt tgagctgctt    240000
     cattcttcag gctttgtgca ttccaaagtg ggaaatttga cagtaagact caataaagag    240060
     ttaaccgccg tggtccaaaa cgaattcaaa aaccttggag tcacgcatgc gtaaatacga    240120
     agatatgttt cggccagcac atgagggtta tgccgttgcc ggttgggcag ccggtgcact    240180
     gctgctcgtt ttgttcagac caccattttg gtgggcagcg ttcccagtca ttcttgtcat    240240
     gctgatgttt cgaggtggcc agctcgaaac actttggaaa tttcgcttgt cgctcgctgt    240300
     catgctagcg cctaccattc caattctcac gctcctggcc aagtcgcgcc agatgcgaaa    240360
     gcaaaaaaag agcttgtatc tagggcgtgg tttccagtgg ggtcagcgcc atgcggagat    240420
     tgcgcagcag gtgatgaatc gcaatatcac cgaaatacct gaccttcctg atttcctgaa    240480
     gaaacacatc gagaagattc tcgaaacgcc accccatgat cgcacagcga ttcaaaaagc    240540
     agcctctgtc ttcgtcaacc ggttgatgcc aaagcacaca aaggtcatga atgaagccgc    240600
     tcttggcctg ccctggattc acggcattgg cgcggtggag gatgaagaca tttcccttcc    240660
     gctcagtgta ctgaccggcc atacgttgat tcttggcacg actcgcgctg gcaagacgcg    240720
     actgtttgaa ttgctcacca cccaagtaat cgatatggga tcggctttga ttgtgatcga    240780
     cccgaagaaa gacagagatt gggtcaatcg cctgcgcatg gagtgcaagc gcaaagggcg    240840
     gaagtttctc tattttgatg ccgccaagcc atccgaatct atccggatca atccactggc    240900
     caactggaac aacatcagtg agccagctac ccggattggg caattagtgg atgcagatgg    240960
     gagctttgcc gccttcgcct ggaaaacgct ggtccgtgtg cagcgcggcc tggtggccgc    241020
     tggcgagagg cccagcatca agaacaccaa gcattacgtt caaatgggcg tcgattccct    241080
     ggctgaacgt gtgctaacgg ttcacttcat gaaaaagtat ggtcctgaat gggacaggga    241140
     catcaagaat tccggtgtta aggatggtcc cgcaggtcaa aaggggccgc ctagccggct    241200
     cgacttgatg attgccaagt tcatcaagga caacgaacca gacgatgcaa tcgcaggatt    241260
     gatttccatg atcacccatt ccaaggaaca tttcagcaaa atgatccagg tgcttgaacc    241320
     tatcctggag atgctcggtt ctgacgaaat tggtgacctg ctttcgcctg atccgacaaa    241380
     cctggaggac aagcggccga tctatgacat gcgcaaagtc atcgacgaga aagctgttct    241440
     ctatgtgggc cttgactccc tgtccaacaa aaccatcgcg caagccatcg gttcgatctt    241500
     attggccgac attgcttcga cgttgggctc catctataac ttttcctcca acccagccga    241560
     ctgctacttg tttgttgatg aaaccgctga agttgccaat gaccagctga cccagattct    241620
     gaacaagggg ggcggggcag ggatgaaggt gttcctggcc atgcagtcca tcgctgactt    241680
     gagcgtgtgt tttcagagca agaaggataa ggcggagcag atgcttggta acttgaacaa    241740
     tctgatctcc cttcgcgttc aatcggtgga aacggcgcag tatgtgtcgg acaagttttc    241800
     ggaggtcggc acccgtgcca tggacgttgc tttttcctca ggctcgggtt cttctgaagc    241860
     gttcactgag ttccgctcca acgtttcgcg cagccttaaa accaccaaca ctgcgcttgt    241920
     gtccccggcg ctgctgacaa agcttccgcc gcttcactat ttcgccttca ttgccgggcg    241980
     aagctatatc aaagggtgct tgcccttcat tggcgaatag acaagtcaac caccccggcc    242040
     taaaggccgg agcttgaagt cgaaagacaa cgagccaggt tgaaacaggg aaagcggtat    242100
     ccagtccgct acgttagtca caggtcgttc agacgcacca gcgaatgctt cctcagttcg    242160
     ctgctctgca aggcttggat catgcagacc aaaggtaaag ggtcgaaggt tttagtcgct    242220
     gctcgcaaga gcaggagccg gttattgaca ttcccgaggg gagatttgcc gaaaggctta    242280
     cgtcacaagg cccgtaaggg cagaaggatt tgaaatggca gtgtttgttt tagacaggag    242340
     cgccaggcca ctgatgccgt gtaccgagaa gcgggccaga ttgctgctgg aacgcgggcg    242400
     ggcgcgagta cacaaggtca tgccgttcac gattcgtgtc gttgacctcg aagccgaaga    242460
     ttgcgagttt caggcgctgc gcgtcaaact tgatccgggc agtaaaacca ccggcattgc    242520
     tttggtgcgg gaaacagcag agaagaacgg tgtggccgtc atcaacctgt ttgaactgat    242580
     gcaccgtggc aaacagatca gcgaagcact cacggcacgg cgtgggcatc gcagaatgcg    242640
     gcgcagtcac ttgcgctacc gtgcgccccg gttcctgaac cggggcaaca aaaagtcagg    242700
     ctggctggca ccaagcctgc aacaccgggt tgatacgacg ctggcatggg tcaatcgtct    242760
     ggagcgcctc gcgccggtat ccgccatcag taccgaactg gttcgctttg acatgcaggc    242820
     tttggaaaat cctgatattg aaggtgcgca gtaccaacaa ggaacgcttg cgggctacga    242880
     ggtgcgtgag tacctgcttg agaaatgggg ccggacttgc gcctactgtg gcgccaggaa    242940
     cgtgccactg caaattgagc acatccaccc caagtcgaaa agtggctcag accgcattgg    243000
     caacctcacg ctggcttgcc agtgttgcaa ccagaaaaaa gcagcgttgc ccgttgaggt    243060
     gtatctagcc aggaagccag agctgttcaa acgtattttg gggcaggcca aacggcccct    243120
     caaggatgcc gcagcggtga attcgacccg ttgggccttg gtaaatgccc tcaaaacgac    243180
     gggtttggtg gttgaaaccg catccggcgg tagaacaaag ttcaatcgaa ttcagttggg    243240
     aatccctaaa acccatgcgc tcgatgctgc ctgtgtcggc tatgtgaact caattaccgg    243300
     ctggcgcaag ccgaccctgt gcctcaaggc catggggcgt ggaagttacc agcgcacccg    243360
     gctggacaaa tatggctgtg cgcgcggtta tctgacccgt tcaaaaagca tccaaggctt    243420
     tcagactggc gacatggtga aagccgaagt cacccaaggc aagaagaccg gtatctacac    243480
     cggacgggtt gctgtcaggg catcgggcag cttcaacatt caaacccgtc atggtttggt    243540
     ccaaggtgta tcccaccgct attgcaccgt agtgcagcgc ggcgatggat acggttattc    243600
     actggtggca aaaacggacg cgacaggtac gtcaccaaag cagggggatg ctttgcatcc    243660
     cgcgctctac ctccccggcc tgaaggccgg ggtttcacgc gcaaactgat gatcgagata    243720
     aaaaatcaat ttgcaaacca cctgattttc tggtcgtttg cgctgccgct tgttggcgtc    243780
     ctgggcttgc ctgcgttgct tccttctggg gacttcgtga tttccgatgc agaagtaact    243840
     ttcttcaaaa atgttcttgc caaggatacg ggcgctatta ccgcatcgtg cgatgccttg    243900
     ttcaacagcc ttttcgtcaa aacgcatatt gcgccggcct tcaaagagtt ttttgctccc    243960
     gcattgagcg ctggcgagaa tcccctgggc tcgatggcaa acaaattttc aagcgactac    244020
     aacaacgcgc tgtggctgat ggtttaccgt ggcatctggc ggctcacggg cttgtggacc    244080
     atcgtattgt cagtgctaat gtctttggga atcccattcc tgatcgatgg tctggccgtt    244140
     cgtgcgcgaa agtcttataa ctttcagttc cacaaccccg tggttttttg gaccgcttct    244200
     cactcgatga ttctggtggt cggcctcggc atttttctgc ccttccttcc ctatgccctg    244260
     aatcctgggc tgctgctggg tttttgtgtc atgttttgcg cttcactatg gattactgcg    244320
     gccaacttcc aaaccggcaa ttaaaagctc gatgctcgca ggaggcggcc taattaggcc    244380
     gccttttttt taactatttt gaatcatcgc taaagaagtg cttttttcga ctgaggttaa    244440
     gcgaaatatt tcgggaacat agcgtctgca tcctgtcccg ttcctcaact gttttttaaa    244500
     aggtatttca tgaaaatttc tcctcgcgtt tcccatgctc gccctgctct gaagcaacaa    244560
     actggtttca ccctggtcga gttgctggtg gtggcagcca ttattgcgat tttgaccatc    244620
     gctgcacttc cgcaaattca ggcctatatc gtgagcggca aagtcgggcc tgcgaacaac    244680
     gaaatgcagc gcggcttgac gcgtatgaaa atcaacgccg aaggcaacgg cacgaccccg    244740
     tacagcggtg tcaccaccgc agtgttcgca aacaccatgc gtgatggttc ggtcttcacc    244800
     gtggccggtg tggctggtgc tgcaaccatc aagcatggcc tcacagcttc gggcgctggt    244860
     gttgttgctg tcgcacccgc aaagatcgtg gctactggcg atgcattttc catcacgatg    244920
     aatggcgtga accgtggcgc ttgccccgat attgccgcaa cgatgcaaaa gtctgccgcc    244980
     cagatcgaca tcaatggcac tactgtcaag cctatcggcg gcaaattcga tggcgcagcg    245040
     gccaccaatg cctgtattga taccaacaca gataccaacg tgtttgtttt cactgttcag    245100
     taatcagctt tgcttcgcat aggggaaatc gctgattgca gcgatttccc cttttttgtt    245160
     tctacctcac aaggtgcaaa agtcaatcac cccaccctga agggtggagc ttgcggagaa    245220
     atccaaaaag ctaggttgac cagggtagtg gtagccaatc cacggcgtta ataacaggtc    245280
     cttcagacac accagtgagt gcttcctcag ctcgctgctc tgtaaggtct tgatcatgct    245340
     ggacaagggt aaaggtccga aggtcttgat cgcggcgcgc aagcgctgga gccggttgtt    245400
     gacagtcccg aggggagacc gtgcgtcaaa cgcccttaaa agcgtttgac aagcggcgtt    245460
     acaaggcccg taagggctcg cagcctggaa ttagacaggc accttatttc gaaagaaggc    245520
     gagatggcgg tttttgtatt ggatcggagc gggcagccgg tgatgccctg cagcgaaaag    245580
     cgcgcccggc tgcttctgca gagcaagcgc gccagggttc accgggtcat gccgttcacg    245640
     attcgactga tcgaccgaag ccaggccgac tgcctgctcc agccgcttcg cctcaagctc    245700
     gatccgggca gccgggccac gggcctggca ctggtgcggg atattgaaac cattgagccc    245760
     gccatgggtg aggtcacgcg cggcgcggcc gtggtgagcc tgcttgagct ggagcaccgc    245820
     ggcaggcaga tatcagaagc gctcactgcg cgtcgccaga tgcgccgccg gcgccgcaac    245880
     cagctgcgct accgcgcccc gcgttttttg aaccggggca acaagcaaaa aggttggctc    245940
     gcgccttcgt tgcagcaccg ggtcgatacg acggcggcct gggtagcacg catccagcgc    246000
     tgggcaccgg tgacggcgct cagctcggaa ctggtgcgct ttgacatgca gcaattgcaa    246060
     aacaccgaga tcgaaggcgc cgagtacagc caaggcacgc tggcgggcta cgaagtgcgc    246120
     gagtacctgc tggagaagtg gaagcgcacc tgcgcctact gcgatgcgca aaacacgccg    246180
     ctgcagatcg agcacatcga gccccgggcg cggggcggca gccaccggat ctccaaccta    246240
     tgcctggcct gccagccctg caaccagaaa aaagccgcgc gcacgcttca agatttcctc    246300
     aagaaagacc ccaagcgcct ggcgcgcatc ctcgcgcaag cccagcggcc gctgcgcgat    246360
     gccgcagcgg tcaacgtcac gcgctgggcg ctggccaacg cactgaagac cactggcttc    246420
     ccgctggagc tggcctcggg tggccggacc aaattcaacc gatgcacgtt ggacgtgccc    246480
     aagacgcacg cgctggatgc ggcctgcgtg ggccaggtgg aggccatcac tggctggcag    246540
     cagcctgcgt tctacacctt gaccatcaag gccatgggcc ggggcagcta ccagcgcact    246600
     cggctggacg cctacggctt tccaagaggc tacctgatgc gtgccaagtc ggtccacggt    246660
     ttccagaccg gggaccgggt caaggccgtc gtgccccagg gcaagaaggt tggcacgcat    246720
     gtggggcgcg tggcgatccg caagacgggc agcttcaaca tcaccacgcc ggctggcgtg    246780
     gttcagggca tcagtcacaa gcactgccgc atcgttcagc ggaacgacgg gtatggctat    246840
     ttcttccacc gggccgattt aacacaggac gcgaacaggt aacggcccaa agcgtaacgg    246900
     atgcgttgca tccggcgctc tacctccccg ggctgaaccc cggggtttca cgcgcatcat    246960
     gatgataaaa agtaagcagc gcggtttcac acttgtcgaa ctactaatta cctctgctat    247020
     tgcgaccatc atcgccatcg cctccgcgcc tgccctagtt gccaaaatcg aggatgccgg    247080
     catggaaggt actggggttt atatggcgat ggtgaaaacc ggcttggaac gctataacct    247140
     cacgaaccac gactcgcttg tagccggcac tgcccaggca gtcgtgactc ctgctgtcgc    247200
     tgatgcctac gcgccgacca ttgcagagct ggtgcgcgac aagtacatca cgggcaacag    247260
     tttgaccgct attaccccgc agcgacagtc aattctcaca aggatcacaa cgccaaactg    247320
     tccgggtgct acatgcgctg ttgtcggctt ggcctacacc acgactgcac tggtttattc    247380
     tggcactaca gatcctcgct tcgacctgct cggaacctac ctggcttctc caggggtcgc    247440
     tggcggtggt ttgatcacca agcccgaggg cgacggctca atcctttcag gcaacagtgg    247500
     catggtcttt cctaatccaa tgggtgcagt gccaggcgtg ttggccattt acacctatat    247560
     tgaccaaagc ttctatgcca acttcgttcg catacaagat acgcgcgatg ctgacttgag    247620
     gggcggcttg actttatcgg gcatgtccaa ggacggcgtc aacacgctgc gggtcaacgg    247680
     ggatgcgatc acaacaggaa actcagccat taacggaagc caaacagtgg ctggcccggc    247740
     tacgtttctc aatgacgtta gcgtcaaaga cccaggcgca ggaacggtgt gtgtgaagtt    247800
     ttatgtggcc ggccagattg acgtgaattg caatggagtt ttgaacgcca aggctggcac    247860
     gttcacgggg ccgctaggta ctgtcagagt aggtaacaca ggcagcgctt atacgataga    247920
     cagttctgga aaggtaagag ggcagaatgg tttctacact gcggtgaaca gcatgtttgg    247980
     cgataaccca aatggcgtaa tgttcggcgg tacatttttc acggttacac aagatggtat    248040
     taacgcactt ttatccgttc aaagtgatgg tcaagtacag gcccgaaaat cagttgctac    248100
     gcaatttatc gcactcacca gtgctgttac tttaggtcaa gcttgcggga ctcccgccac    248160
     aatttcagtg cagggtcctg ccaccatgcc gggaaatacg gcgctcgcat cggacggaaa    248220
     cggtggggtt gctacctgca taggaggtgt atggacaggg attaccaaac tcggcgcctt    248280
     caacgccgca tgtccaaccg aaggcgccat ggccgctgac gcagctggca ttgctctgat    248340
     ctgtcagggc ggccggtacg ccagtttggc cgacagattc ggcagtcttg tcttttcgga    248400
     atcgacggtg gtgagcaatg tgggcatcaa tccccttgcg actgatcagc ccgcatatcc    248460
     tgcggtcagc aagccgcttt gcgcttccac ttcctcaccg ccccgggcct acatcatccc    248520
     caacaatgag acacagaggc cacaaaaagt aaatcgctat ctgcaggaca acggatcgag    248580
     ctggcttgtc tacatgcttg acggcaaccg caatgttgtc accgatgcat ctgctactgt    248640
     gcagacctat tgcgcctaca actagggctt gcgccaacac atcatggcgg cctaattagg    248700
     acgccattta tgtttgagaa tgccgcaagt ccagtgaaaa ttcattagga agcaggcaat    248760
     cgatgaagga tgagcatcgt tgatgcaaaa aaagacccgc accagggcgg gtcttcagtt    248820
     tgaggggatt ggctattcag ccgccagtgc ctgtagtgaa gatgaaggtg cggttgaacg    248880
     cggcgccatt gttcgttccg ttgatcacga cttggtagcg cgtgttcgcg gccatgggcg    248940
     catcagccgt gatgaaggct tgatggcctg caaagtagct ttggccgttc accttgttgg    249000
     gatcgctatc gctattgagg actggccgca cggtaactgg cacgccggtg gccaggttgg    249060
     tgaggctcgc attcgtgatg gtgagcttgt tgccgtcccg cactgcgatg tagacagaac    249120
     ttcccaaagg aagtcgagac agatcacgcc ccggcacagg attaggtgtt tcgtccgcca    249180
     actgacggtt gatgccggtc gagccttcgc atggatatgt ggcaactgaa ctaccgtcga    249240
     ttaattgcgg ttggtccacg tctttgtagg ccaagtttgc ttgtaaggtc acctgtcgca    249300
     atgcacttcc agcaatatca tcggaactta aaaccgaaaa tccaacttct ctgaagcctg    249360
     acatcagccc ggctaagtga taaggcgcat taagcagcct taccatgcca accttaccga    249420
     aaccaacttt gttgcccgaa tagatcacgg atgtactttc atcgccaacc gtcgatccct    249480
     gtccaactgt atatccagct tttgcgaatc tttcttgtgg tgttacacca gtgaaaccag    249540
     gggtgcctgc aatctgaaag tgcccaaaat atccattcaa cacattccag ttggcatggc    249600
     cctttgccgc aacatcgaga tttgcatttt gcgcaagcag gccaaaaccg catgcgttgc    249660
     gctctgcatt gagcttgtcg aaggctgccg cttcctcgct gccgactgca taggttgaag    249720
     ggctaacggc cgtcaccaat gttgaggcgg ttgaaaccgg cgtcactacc ggggcaggct    249780
     gagcgctcgg tgcggacgct gcagtggttg cgcctgagcc ttcgccgcca ccgcaagcgg    249840
     taagcgccga cagtgccaac gcaaaaccga ccaaattgaa atttttagct ttcatggatt    249900
     ttttcctttc gattattgtt tccatgcatt gagaatacca gtgccatgct tcagcgcaaa    249960
     tttgaaaaat ccagaaaaag acatagccag gaaactttag cggccaagag tttccctggc    250020
     ttatctccaa catgaaagct gctgttttga ggtgctcttt cgaccgcctc aaatggagcg    250080
     gaacgattga caatggatac tcctaaaagg agcaacatga ataagaaatt caacaaatgc    250140
     attgccgtgg ctttgctggc gtcggcggga ctcgcggcac tgcctgctgt cgcagacaac    250200
     ctctacacct cgcaaacacg tccgcgtcgg gttgatgact caagtggata tttgacgttg    250260
     actggaaatg ttgtaatccc aagtacagca cttcctcctg gctccactgg cggcggtctc    250320
     ggcaacagaa tcatcagctt ttctactgga cctggcagct cagggttcat ccgggcgaaa    250380
     acatgtgttt tgagccaaac ctcctcgaac gacaacagga ataccagcta ccttcgcatt    250440
     gctacgggtc cttattacga tggtacgttt gtctataacc tgggttccag tggtggcgtc    250500
     gaagattcga cttcagctaa ttgctactac gatggggtag cgggctttac cagctcaccc    250560
     gtattcaata attatgagaa tcaggccagc tcatcaaatc gtgaatatag tggctattac    250620
     gcacgaacac ggtatgacac aacgcaactc aactttctga ccggtgccac gaagtctctt    250680
     ggatccagct acagttctta tgaatatgtt ccttgcgagg ttgctccgca aagcacggcg    250740
     tgctatgaaa cgatagtctg cccggcaggt tatgtcagct atcaaggaac ttgctacccg    250800
     gttgacacgg gcggttcggg ttgagtcttc atagtttctg gattggccgg ctggtagcgg    250860
     ctgttggatg cagacacgca ccgctgcaaa gcaagaaacc aaagccacct tttcggtggc    250920
     ttttttcgtt gtcggcgggg tttgcgctgc tggtgcgcac aggacgcctt tgcaacgcgc    250980
     gacccgcccg cacgggtttc agtccggctt gcgaatctgc gcaaccagcg ctgggcttgc    251040
     aatgtcctcc agatcccgaa acgcggaacc gatctggtcg atgagcttgc cgttcgccgc    251100
     gaattcctca aaacacgtcc tccactgtcg cacctcgccc cagacctgcc ggatgagggc    251160
     gagcgcccgg gaccgttcgg gagtgaaggc ggcaaagtgg gtcattgcgt tgtccaggct    251220
     ggcgagcttt ccctcggtgc cgacttgcaa atgcagcatg cgctcatagg cgagactcgg    251280
     gcgcggaacg acatcgtaaa gcggactgag cacccagccg gccagatgcg gggaatgcac    251340
     gaacccgtgg tttcttaagt ggtcgtcgtc gttgctcacg aagatgttga acaccatccg    251400
     ggtgaaaagc tcttcgcagt ctttgcggat cgattgcggg tgcgcgaact ggcgaatggc    251460
     gtgcgccagg tcgtgatagc ctttggtgcg agactcgaac tcgctgcagc cgaccagcgt    251520
     gaggccgctg acaaacgcaa gcctgccttc catgagccca ccatcagggc gggtgtcatg    251580
     cagcgccgtg cctgccgcag gcgcctggcc agcggcggcc cagtaacggt cgaaccggcg    251640
     aatgagcatc acgggccgcc ccccgatgtc ctggtatttc acttcaggca cggtcaagcc    251700
     gcaccgcctg gccagctcca gggtgcaaga ttcggctcgt gctacatcga gcgtgtcgcc    251760
     cctggcaggg aacttggcca accacaaagc gccgtcatcg tcccgcaccg atgccttggg    251820
     ccgcgcgccg ccggcagaag gtccggcgcc cagatagtcc tccaggctgg caggcaccgg    251880
     caagccttga tccaccctgt ctgcggcctg cagaacgtac cccagtgagc gcatgtcgct    251940
     tgccgatggg gagtcggggc ttgtgctgtc ggctcgaata tcgagcgctc cgacacggtc    252000
     gccaccggcc tggagtaggt aatcggcctc ggccaagctg ttggcgggaa ctctgcgacg    252060
     cgcctcgatg actcgccgcc cccaggcatc gggcgctgca tcgcgaatgc cgccgaactc    252120
     ttccaggcca ttggccggaa agaactcctg gccaatggcc gccttgcggt ccgggatgga    252180
     caggctcacc gggtcaatct cgatggcttc aagccgctgg aggtagcgcg ttccgtaaga    252240
     aaaccgtgaa gccagctcgc ggctgcgcgc gccggctccg aggtcttcgg tcaacgtcag    252300
     gagtcctgcg ggaacaaacc gaggaccagc cttcttggcg atgctggcaa agacgtagag    252360
     ttcgcggact tgcctggcca tcagaaatcg agcttcttga gttcagccac gccaagcggg    252420
     cgaacgcggc gggtcgcttc cctggctgcc agggcctgca aagaggggtc gtcctcctgc    252480
     agcagggaca gcaggctcac ccctggcgca atggcttcga gatagcgcag gatttgcgct    252540
     tgcgtgcggc tcaagtcgcc cttttcgatg agcgcagccg tggagcgcgc aatccccgca    252600
     cgggcagcgg catctgcttg gcgcaggcgc cgggccatgc gaaggcgtgc cagcttttca    252660
     cccatggcgc aagcctcttc aacccgggca aggggcataa ggggcatttc gtttctcttc    252720
     atgtctgcaa acaacgacct taacaggcgt tgcgtccgtg attgcggaca atatagcaac    252780
     cttctagaga cgagtcaagt ccgtaaatca agacattatc ttgataatgg agtcgattac    252840
     ggacctgcgg gtatcggcca taggatgcag gcatgcaccg ctgcatcgca agaaatccaa    252900
     gccacctttg acgggtggct tttttcgttg tgggcggggg ttgcgctggt gcgcgcagga    252960
     cgcctttgca acgcgtgaca gcgaacggct gttgcatcat taggtttaag tagttatcat    253020
     accaatcagt aaaaacatta cttaaataga atgattgcac ctgcttcctc ccaatggcac    253080
     ttccctcgac cggcccttgc ccaagcttac ctagcatcgc tcaatcttgg gctttcaagc    253140
     gcccgaggcc tgttcgcaag gcggcgcatg ggcaagacgg aattcctggt ggaggacttc    253200
     atgccggcgg cgcgggccgg cgggtacagc tgcgcttacg tgaacctttg ggagcttaaa    253260
     agcgatcccg ccacggcgct ggttttagcc ttgcatcagg ccattgagcc caagagtttt    253320
     gccaaggtat gggagcggtt gaacacgccg atttcaaaaa tcaaggcatc cggcaaattc    253380
     gcggggatgg ccgaggcggg tgttgaagcc gagcttggca acaggcacca ggtcgcgggc    253440
     acgctgctga tgcaggcgat ggccgagttc gacaaataca aaaaatctct cgtgctcatc    253500
     attgacgaag cgcaggtgct cgctgccgcg gagaattccg tctttgctca tgcgctgcgc    253560
     gccgcactgg acatccgcaa ggatcggctg aaggtgctgt ttgcgggcag ttcggagacc    253620
     actttgcgcc ggatgtttgg ccgggcgtcg gagccgttct acaactgggc ggcactggag    253680
     ccgttcccgc ttctgggtgt ggagttcgtg gcgttcatgg tggacaaggt ggcgcagatt    253740
     tcccggtttc ccttgccctt gcctgatgcg ctgcaggcat ttgacgcgct caagcaaacc    253800
     cccttgtttt tccgcgacta cgtggagcga tacctcaccc atcccttcga aggaacccag    253860
     ggcgcactgg acttcaccag ggcgaaggct ttcaacgacg gcgaattcga aaagcagtgg    253920
     aaggacctcc tgccagctga ccaaatactg ctggctctca ttgcccgcga cacgtctgat    253980
     ctgcaggggc tcgaagtgcg cactacggtg ggcgcacgcc tggggattga aaagcccgtg    254040
     cccgctggtg cagttcaaaa ctcccttcgg cgcttggtcg acaagagcgt tattacccgg    254100
     atggaccggg gcgcttaccg tatcgaggat gaggcgtttg ccgactgggt gcgccatcag    254160
     gattagcgcc gatggtcggc ctggccagct tgggcactgg tgccccaagc tggcccaagg    254220
     ccaaggcctt gcgagaaggc cgttcaaggc gacgtttcga actggccctt gtccacgctc    254280
     acgctcttga gcgtctggcc atcgggcatc ttttcgccga ccttgatctg ccggaccgag    254340
     cggccctggc gaacgatcac ggtgccctcg atgacattga ccaccttgaa gtcaagcgcg    254400
     gctggcagcg cctgcgccgg atcagtggcc cgggcttcgg gcgcggcctt ggcgcggctg    254460
     ctcgaaagca cgaactcgcc ctcctcgggc ggcttggccg ccggcttgtc ggccgtgcgt    254520
     tctggcaagg gcgcgttcga taggcgtggc ggcggtgcgc gctgggctgg cggcgctggc    254580
     ggcgctggcg ccagcatgcg cgccggcaat ggcaggggca cggccagcgc tgctggctgg    254640
     gccgcttgaa cgggcgccgc ctcctggctt ggcgccgggg cggtgggtgg cgagggctgc    254700
     gccagatggg cggccacggc agcgcctgcg ggcggctcgg aagctggcgc cggctcgatg    254760
     cgttcgatga tgtgacgctg aacgggcgcc gggcttttgg tgccaacggc gtaacccacg    254820
     gccacgcaca ccaggcccgt ggctgcggcc acggccatca ggcgccggcg caggccggcc    254880
     ttggagttgg cgatgcgctc cttgcgaatg accgcgatgg tttggagttc gcgcttgagc    254940
     cgctcctggc tctggcgctt tgcaatggct tgcgattcgg ccatcgcccg ctccctggcc    255000
     atggcgcgcg gatcgctctg gcggtcggcg cccgaagagg gctgatcacc ggcttgcatg    255060
     gcttagaggc tttcggcttt ggcggccgaa gcggtccgcg cggcgtagcc ctccggcttg    255120
     gattcgaact tgccggcgcc cacattgggc gactcgggcg cggcgctcgc cttggccgaa    255180
     gcgcgcaaga tccgcatgtc caccgcgtcg gccaggtggc tcaccaaaag ctggccgccc    255240
     acggtgacgt tgccctggaa ctgcgcactg tcgccgagtt cgacatggcc cctggctttg    255300
     atctcgccgg aaaaggcccc ttcgatcagc agatcgttgc aatcaatcgt gcagttgacc    255360
     agcgtggcca gcgcggaaat cttgatgggc gtgtcgtcgg tgcattcgat atgcacgtcg    255420
     gtcagcctgc cgtcgatcag cgcggtcaag ctggttttga gcgtgccggc aacgagttgg    255480
     gtgtgttcgg acaccagcgt caggggctgg tcaaaggtgg tgcttggaaa aagtacatgg    255540
     cggttcatgg cgaattgctt tcagggttgg gttaataaag gcgagggaca gtgaaatcgg    255600
     aggcaagcgg ataaagcgtc gccttgcggc gcaggggaag ggaagggaat ggcgtggcta    255660
     ttttttgagc atgtcccgaa gggtggccgg ggagctgtcg ctggcgcgct tgaactgcag    255720
     agcgccgagc accatgccgg cgtacatgac ccatgcgcca acgcgcccgg tgcttgacgc    255780
     ggtcagcagt ttgctcagca agaatccgcc gacaaccatg gcgacagcga ccttgagcac    255840
     cgtcaatcgg atggcggcgc cgcgcgcctc aaggaacggc tcgacttcgc cttcgtccat    255900
     gccgcgattg accaaaaatg caacgagatg gcttctggcc cgctcgatct tgagcacgaa    255960
     gacaaaaaat tccatgaacc gaagggcgag ttggtctttg tccatggtgt cagagctttc    256020
     ggcggatcag caccatcgcc accacgccga cgaagaccat cacgctgccc atggcgtgaa    256080
     gagagccggg gagggcgccg atgttgagca gcgccaggcc caggagggca gtgccaagcc    256140
     cgcagacaaa gatttcctgc gcggtgacgc cgttcctgcg gggttcttca tacgcctcgt    256200
     cgatgatttg atcgatcttg gagggtctgg cgcggccgtt gttcggatcg ttggtcatgg    256260
     tcgggtttcc ttgcgggtga ttcgggtgga aggggagcgt tcaaattacc atgcggcatt    256320
     catggcgcaa tggcaaaacc tgcgctgccc gcgctggttt tcagcaagcg acctaattag    256380
     gtcgcttcat ggcgcccgtg cttaatctgc gaacatgtcc tgtcctgtga gaaagtagcc    256440
     ccggcagttg ctcatgacgc cttcgggcat gacgtccatg cggatgtggg gcagccgcgc    256500
     cttgagcgca tcgatgtaga agccggcgcc gcccccgcag acgaaaatgc gcgagacgcc    256560
     cgccttgtaa ggattgaagc gcatcagcca ctgcgccacc atgtcctggg cttgctggcc    256620
     ggccagcttg cggtacggcg tcatgtcgat ccgcttgagg tccagcagca gctcgccctt    256680
     ggccagcgcc gactcgatca tcgcgaagtc ggccgactcg atcccgtggt cctggctcag    256740
     ccgcttggcc acggcattga tgagctggga cacgcccccc tggaacgagc cgcacagctc    256800
     gtagtgcggc gccatcccat cggagagtaa ccagtcgaac gtgaggtaac ccgggtcgat    256860
     caccatcgag atcacgccgt cgtcggccag ctccagcgcg ctctgggccg ccaggcgcag    256920
     cccgcctagc ggctggggga gcaccaccac ttgcttggcc gagacgtcca cataagcctt    256980
     tccaaggcgg ctgcgcatag gcatgggaac gggcacgcgg cgcacgcgcg aaccgatctc    257040
     cttgagcacc ttcttgttgg ccgaaaaccc cgacacgggc aggcccagca cgagcatgtc    257100
     cacgctcggg ctgacgatgc cggtctcctt gaacatgtag tgccatgctc ccagcagcag    257160
     tgcctcgtgc gtgggcgtgt tgatgtagtc cggatgcagg gcgcgcaaac cgccttcgcg    257220
     gtcggccttc ggtccgacgt agtacgcctg cccggcaacg ctgactgcca cccggtctag    257280
     attgctcgtg gcttggccag gtgcgatgtc atcgtccagg gccagcgggc agacggattt    257340
     gaaaatgatt tccgaccagg cctcggcttt gccggcaagc gtgcggtggg accaggtggc    257400
     tttggtgttg ccaaagccga tatcgatggc gagtatgctg ggtttcatgg ttatttttga    257460
     gggtgaaggt gaggtaatgg ggagggcgat ggttttgcgt ggcgcggatg gcttactact    257520
     tctcagactc ggttacggtt ttgcgcattc tttgggcgag ggtctgcttg gctgcagggt    257580
     gcggctcgct catgctggaa gggtctggca aggaagcgat tggcacggca gggtttgcgt    257640
     caggcgccgt ttgcagtgct ggctcccgcg cggccggtac gggcagggcg cggcagggcg    257700
     cggcatcgcc gctgggttgc gccgaaaggc agtaagcatt gaagaggcgc cgcttgacgt    257760
     agtggctgcg ctgggaagca ccctcgatcc tgcaaatttc aaggaaaagc ttttccagcc    257820
     caacatcgcg ctctgaaatg cggaactcaa ttttgaagct gggcatgcgg ccagagcagg    257880
     ccgccaggct tgcgttgttt cctaagtcgc ttgcgcctgg cgcatgttgg ccacagacaa    257940
     tttggtggag cacgcgcttg acgtggcgtg ttcgatggct ggtgctgccc gctgcggcga    258000
     gctccaggta cagcgcttca agcccgatgt cgctggcctt gataagcagc tggattttca    258060
     agcttgcggc cgttttgccg gccggctttg gcgctggcgc tgccaaaccg gcttctgcag    258120
     ccgcgccgcc aatcagggac atatccttgc tactcgcaga caaactgccc tcgtctggcg    258180
     ccggtattgc cgggattaga ggcgctatcg ggcaattcgt gggcgaatcg ctggcatttg    258240
     aagccagtgc tgccggaatt ggaggcgttg tcaggggatt cagggacata acggtgctgt    258300
     ttgtgggcgc ttgttggtga tttggcggca gacggaattc tcagcgccaa aattgcgatt    258360
     tctcctccga aaaacaccca aaaaatcgcc gctttcacat ttctcaaacg cgccaaaatc    258420
     cagtacagtt ctacccattc gccttcacgg gcgagccttt ttcaattgct gcttcatgca    258480
     gaacgaaaaa aaccggaatt caaagtgcct ggccccgcgc ggtccaggct ttttttgaat    258540
     ccttacaggg cgccaagccc cagctttttt gacagagcgt gagttactga accgtacaga    258600
     gtgaggtaat ttttcgtttt tcttcaatga cggcaagcgc ttggcgcacc tcatcagtaa    258660
     cagaacgggt gcagaacggc ttactgacgc tcgattcatt gccgaaatgg cggtgaaatc    258720
     gcggcttcag gaccctgctg gacctggcct ggctactcaa tgaggatgat gaaagccact    258780
     gcctttcttc gggcaatgac gggctagcgg gcgcttgctt tgccggcctg cctgttccca    258840
     tggccatgct gcccataaga ctggctctgg agcctatcca tgccaaccca agcacagcta    258900
     gcgagttccg gctgccccta gcgctacaag actggccatc cgcgccgctt cacgttcact    258960
     gcttttgatc gctcttgact gctggcaatg gccacagggt catgcgttgc aaagggctgc    259020
     tgaaaacgag gcgagcgctt ttgccgatga attcaacctt gagcgcctgt cgcgcatgga    259080
     ctgctttgcc accacctgcc cacttggcaa cttgcccggg cggcggctgg agaacaaggc    259140
     ggcatggcag cggcaaggaa taacgtcaat gaattcaaca tatttgttga gccttgaacc    259200
     agccacctga ctacctcggc gggtagatca cgccaagaac tgctgacgca gggcaggtgt    259260
     ggtgaaggaa cggcgaccgg gctatgggcc tggaacacaa atcaacacgg gtcgttcgcg    259320
     gacccagcct cttcggtgag gaacagcgaa agtgcgggac gcttgagtgc ccaacggatg    259380
     aaggaactcc accggcatcc cacctgttag ccgcaaggcg cggggactgg caaggcgagg    259440
     acacgcgccg aactggtcaa aaaccatttt ctttatgtca acgtgtcccg gtatttcttg    259500
     aggtgaaggc gcttgcatgg ggaagcaggc agcttgaggt ggatcggttg aggtaggtcg    259560
     gttgaggttg cgcctcaaag cgagtgggtt gcgtgttgtt tgcggatgac tgcgcccgat    259620
     cgctttggcg cgtgaccgcg cgggttctca aacaatgcaa acaaaggaca cagtgatgac    259680
     agtcgtacaa agcggcgcca taggcagcct gatcaagagc gccgacgcca tcgtcgagcg    259740
     gcacggcgca gtgcgtgtca acggcaaggt cgcctccatc aggaccatcg agatttcccg    259800
     gcaggtgatg cgcgagtctt gccacagatt gcatggcctg ggcttttacc tgagcgatat    259860
     atcttcgctg aaggaaaagc acatccatgc cctggtgcgc gactggcatg ccacgggcag    259920
     ccggagcggc aagccgctgg caaacaagac gatgcagaac cagctgtcgc gcctgcgcat    259980
     ctttgccggc tggctgggca agcccgagat cgtcaagccc ggcgggctgg cggtgtacct    260040
     gcccgaggtc gaggcatcga gcctgaaggt caggacctat accgaacgca gcaagagctg    260100
     gacgggcaat ggggtggacc tggtcgagat catcggccgg gcgaggctcg aagacgagcg    260160
     tgtctgggcc atgctgctga tgggcgtggc gttcggcctg cgcaaaaagg agatgcttcg    260220
     gattcaaccc tggcgggccg acgcgctctg cgagctgcgc atcgatggca gcgtggccaa    260280
     gaacggccgc gcccgctcga ttcccttcat cggcgcggga cacccttatg ggctgtttca    260340
     gcgctggtgc ctggaccagg ccaggcgcgt gaccaagcga ggccagacgc tgggctggcc    260400
     ggacttgagc ttcaagcagt cggagaaccg cttctaccac tgcatgaaaa agctgggcgt    260460
     cacccaggtc gacagcggca tctcgccgca cggcctgcgg gcggagttcg ccgagaacat    260520
     ggccctgatc cggggcttgg tgccgccctc gctgggcggg gacattgacc agatgggcaa    260580
     ggcgcagcgc ctggagatca ccgatgccat taccagcatg ctgggccacg acgaggatcg    260640
     cacgatcaag gcctactttt ccagcttcta ccggccgctg gcccatgtgg gcggcatcgg    260700
     cggcaaggtc ggccccaccc ttgcgctaga tcgaatgcag gacatcttcg tgacggtcca    260760
     tgtcaacccg gtgccggtca gggccaagga cggcagctac cgcatccaga gcgtggccga    260820
     gcgtgctgct acggcagtga cgtgcgtgct ggaaaacccc ccgcaggagg accggcactt    260880
     tgacgtggtg agctttatcg ccgagtaccc gcagtttgcc gagcgcatca ggaagtcgct    260940
     cgtggccgtg gggctgggcg attagcgcca ggcgctatga ggctggcggg ggcggcaagg    261000
     cgtgttcgtg cgctagtagc ttggccgcca gccagccgtg aaagccgcct tgaaagcggc    261060
     cgcattcagc cgcattcgcg cctggcctgg cggcaaactg gacagctttt caacttcaag    261120
     gaaccttctc atgcccaacg gaaaaacgca acccgatcca gtggctacgg gccacggcag    261180
     tgcgcaggcc ctgcccaaaa attccggcgc ctccaaaccc aaacccggtg atgccgtgcg    261240
     caaggccacc aaaaaggcga ttgccagcct gggtgaaacc gcgcaccagc cggccgcgat    261300
     ggccgcgtcg cctgttggcg gcgacagccc ggccggcctg gagctggtgc aggtggcaca    261360
     aggagtcatc ggcgggctgg agtgcctggt cgtcgatggc agggcgcttc acgaggttct    261420
     tggtgccaag cgcgactttg cgacctggct caaaagcaag ctggacgagt acggctttat    261480
     tgagaaagtc gattttgaga tattccccca aacgggggaa aactccaaag tcggcagacc    261540
     aacacaagat tacagcttgt ccctcgacat ggccaaggag ctggcgatgg tcgagcgcac    261600
     gccgcaaggg cgggcggcca ggcgctactt catcgcgtgc gagcagcgcc tgatgcaggc    261660
     cggcatcccg gcgccagcgc tggcgcagcc gacccacggt ccggtaggcc atgaaggagg    261720
     cgacatgctc gactacttcg ggccggaaga tgtgcacgaa acggcaatga tccacaacgc    261780
     catgtacacg cgcacgtggc tgcttgccat gcgcgaggcg aacaacgtgc tccttctcgg    261840
     gcgcgacgca ggcattgccg agggctttgc ctgcgtctac cagcagcgca tgctgagcca    261900
     gctggtaaaa agcctggaaa gtatcaattt cgctgagcgg ttcaaggaca actatatcgc    261960
     ggacacgacg gcctatataa acagctggat gcctgcgcct aactgaaaag ccctttacac    262020
     ctgagcgaac agaccgcccc caccggctcc ggtgggggct ttttcgtttc gcccggtaca    262080
     caataccgcg cccgcacccg gcacgcccat tcagtgcgtt tgcaaccagc gccgcaaatg    262140
     cgggaaaaca ggcccgcttg tcgggccgtg aacgccgaag tggtggccca tctttagcgc    262200
     cagcctgagt tgcgcgcccg tgccttcaaa cgatgcgttc tcgatgatga tctggggatc    262260
     gagccccaga tgcattccag ccgcccagct ccaggcggtg gcttcgcatt cgccggactg    262320
     catcacctgg accatgagcg gatcgtctgg atccagatgc ctgcattgcg cgagcatggc    262380
     ctgcacgcca gcatccacgt cctcgcccat caggtgccga aagcgccccg gcaccacaca    262440
     caggtggccc gcctcgtgca gcacgtcgct ggccagcgcc ttgcgcggat cgatggccag    262500
     gacgccgttg aggattcgca cgccgggcac aaagccgctg gcgccatcga cccagcagac    262560
     cggcaatccg gccagggcca ggaaattgaa tacctgttgg gtgctcatcg cgatgcggcg    262620
     tgaaagctcg ggccccgatc cgggctggcg gcgcgtcagc ggcaaggcgc cagcaccgga    262680
     tcgtcgtgtg ccacgccgtt ggcaacggcc atggcccggt agctgtcgtg cagcgcggcg    262740
     tccgcgcctg ccacgtcatc cttgtatcgg cccgtgatat agccgatgcg cacggccatg    262800
     ttgtggccgg cgccgcgcag caagaagccg gcgcaggtgt gggccggctt gataccggac    262860
     tcgtggcacg aaaacacgtt gcgcgccatg tcgtaagccg tgctggcgct gtgcctgaac    262920
     gcctcggccg gaaacgctcc ggcgttctgg acaagccagg ggcagccgcc gcacggtttt    262980
     cgccggtaac cggccacctc gcccgcaaca gtgaccacct ggtggtctgg accggcgggc    263040
     cggacgttga tgatttttgc tggtttgcgc atggctgtaa ttttcgcctg aagcggtgcg    263100
     aaggcaaatc cccggattcc cgggccaagc gagcgggcag tctgcgggtg cgggctgcgg    263160
     cacgcttggg tccgccacaa aacgcccgta gctgttcacg gcgccttcgc gcacgctctg    263220
     gcccacctcg aagcgcgcgg catacaccac gctgcccgtg ccttcaatcg caacggcgct    263280
     ctggggcgcc ggcttgcgcc cgccttcgag gcattggctc agttccacat cgatcaggcg    263340
     ctggccgtcc cagatggctt gcaccgtctg cgcgtcccag ccctggagtt cggcgagttc    263400
     ggcaaggtcg ggcaggttgg gggaatgcgc ggatttagtg ttcaatcttg gatagctctt    263460
     tggctcaggc cgaccaaaag ccgaccgtag ctatgcacac aaccagcacc taagctctcg    263520
     taaacaccaa actgagcggc atacacagtg gaatgctctc cgtcgatcgg gaaagattcc    263580
     cgtggctctg gtctgcggcc atcgtcaagg acttgacgca gttccacatc aatcaaagtt    263640
     tctccgctct tgatgtttcg cactgttttg tcgtcccaac cttgatgctc agctagctca    263700
     gcaagttcct gtaggttttc tgctgcctcc agttgcagcc attgaatagt gcccttagag    263760
     ttctgagata acacgccaaa cggcgcaccg atcacaacat gctctaccca tccttgcgtt    263820
     agagatagat attccaatcg ctttgaaatc agcgggtcgg agatcagggc cagctgtctt    263880
     tcagacaaag ttggtgacca aatctgttgg tgattgtcaa ttgaggcttg aagaaactca    263940
     ccaatggtat tgattaggtg tgaagttagc ttggaggtct gcttgggaat gtacttctgg    264000
     atcaatccag agttgaaagc actcacagcg atttgttcat ctgccaaacc agtaagtaat    264060
     atccgtgaac ctttccagcc cttgatggag tgcaagaatt caaccccatt catggcaggc    264120
     atggaatagt ccaccatgca gatcttcgtt agcgaaaaac gctttgtgcc gtcatcacgc    264180
     caatatttca gaatctgcgg gatcagttga gtaccaccgt gccacctttt aacgatctcc    264240
     tgctggcacc ggaagtcagc attccatacg ttttgctctt gaatcagggt ttttgcgcac    264300
     acggcaggac gatgaaagag gcggacttgt aggccctcag gcaaggcatc gcccaaaact    264360
     tgaagatagg cctgatcatc atccaagaaa atgatgccgc caagacgacg gtaaagtgga    264420
     aatgacatgt aggttttgtg agtaattggt cgaagctgac cagggtcaag ataggtattt    264480
     cacgaccgca ccaacgcaag tctaaaagat acactattgg gagaacgaat aagcacatag    264540
     ctagcagcct gtcgggcttg aatctggcgt acaggttgca cctttggcag gtcaatcagt    264600
     cgctcaatat tcaggcgatt tttgccgttt attcgctctt tttgcgcagt tcgagccgtc    264660
     tccccagcct ttcaggcaca tgggacggat ttgtggcgta gcacggccat gcgcttgaga    264720
     ttccacgcca ggcacaccag gtgccattcc ccgttcacct tgtctttgcc cctgagcagg    264780
     aactgtcgaa agcccatcac cgacttgacg atgccaaaca ctggttcgac ggtctgtttg    264840
     cgcagcgcat acaccgcgcg gccggaggaa ctgcgcagtt tgtgcgccat gcgttcaagc    264900
     gccgtcgcat cctccggaca aggcgcgggc tctgtaaaac gctcgctcca gtgcggatgg    264960
     tggtcctgcc gcgccacggc caggtagggc tccatcccgg ccgcctcaca ggccgcaatg    265020
     ttcttgtcgc tgcaaaagcc gcagtccgcg atcaggctat gcacccgccc cagcgagccg    265080
     ggcagcagtg ccagttgctc cagcatgggc atgacttgct ccttgtcgtt gcacgcttgc    265140
     gtcacaaggg gcacgagcac cagcatgctg gcggtatcga ccgctgccta ggcgttgtag    265200
     cactgctcga agccgccgcc ggccaccttc atgatgcgcg actcctcatc ggtcaggttg    265260
     atctggtctt gcgcccgggg accggcctct gggggctttg gtggcctgcc gccggacttc    265320
     ttgccggttt gttcggcccg ggcctggcgc tgggccagtt tggcctggta ctcggcctgc    265380
     tcacaggcga aacgcgcctg cgcgcgctgc tggattttgg tcttggcctc ctgcatggcg    265440
     acaatacggt cttgcctgtg cttgagctct tcgggcagct tcatgccatc gagaatatcg    265500
     gccccgtctg cctgctcggc cagcgcgagc agctccggca cttcggcctg cagcttggtc    265560
     tggagtttgt cgatatggcc atgcgacagc gcactgtggc gcgaagcgtt ggcatgcacc    265620
     ttggtgccgt ccaggctgat ggcgcccagc ttgagcagct tcatctctcc cgccagttcc    265680
     agcacctgca tgaagatgtc cgagagttcg cccaggaagc ggcggcgaaa cgtggccaga    265740
     gtgtcatggt cggggtggct gttggcagca agaaagcgaa acgccaccga gtcatgggtg    265800
     gcgcgctcga ttctgcgact ggaaaaaacg ccggtggcgt agccgtagac caaaagactg    265860
     agcagcactt cggggtggta ggcggcgctg ccgcgtccgg cataggcact ggtgagcttg    265920
     ccaaggtcca gctgctcgat ggcttcgagg atgaagcggg ccaggtggtc ttcgggcagc    265980
     cagtcctgca gcgacggggg caggaggtag gcgctctggc ggtcaagtgg gataaagcgg    266040
     ctcatgcggt ggcaatgcgg gatggggttg cgcaattatc ccgaattgct ggggtaagcc    266100
     cgacaggctg ctagcgcgat aattggcttt tagcacagtg aataagtgat tttttcgtgg    266160
     aatccaaatt agatcttcgg ttttcgtcaa ccttccaaaa cgttctgtat ttactgacgc    266220
     ccattccatg atggttttga cacttggcca tagtggcttt tactttttta gtgcacgctg    266280
     atgggggtat ctgaagcgct cggcttttta agcctagatg gcatagtcta tgagtggcta    266340
     agcgcactac ggctgttttc cgtggaagct ctgataattc tcggccccga cccgttttct    266400
     acagaggaaa gtcggttggt gcgcgcggtg cagccagcta acctactctt ggcagcacaa    266460
     acgcttgcta aaagtggtga ctttggcgta gcgtgggatg atttcatggc gcctctcgtc    266520
     ggctgggagg acattgcaga cgccatccca gaagcaaccc aaggctggcg catgctttgt    266580
     gtggggcacg gtctccagag tgtgttgcgc atcgcatttc ccatgactgg agggagagcc    266640
     ttcgaatgct atcttttcag ttctttaaag tggcacgacc agaatgacgc tgctcaactc    266700
     gcttggtcgg catttattaa atggccagca ctcaagcaag ccttgattca agcccacagt    266760
     ccactaagcc cgcgagaaat tgagtgtttg aaattggcgt tcaaggggct gactgccagg    266820
     gaaagcagcg aaaaaatggg ttgcaccgaa cgcaccgtga cgtttcacat cgccaatgcc    266880
     agcaccaagc tgcgcgccga caacaagttg gcggcaatac agcgggcctg ctggtttggt    266940
     cttttctaac caattttcag tttcagttat ccaattccaa aattcaaccc ccaacgaaag    267000
     ctatgtcggg ggcatttcat gcgccggcac cctgcgctgt ctttatgtta gaggaacgtg    267060
     accgagggtt caaagtgctg aaccgtaaag cggaaaagtt ggaagctgat caggtgcaga    267120
     tgcgtcgata ggcaattgcc gtcttgcttt ggtaggtgca cgctacacag ttgtattgtg    267180
     tgactggccg tttaccttga tgcacgtagg ggcgggacag gtcacatgtt taacgaatcc    267240
     ggaatagaca ctgctttgcg cgctgcaggc ttcgatccag ccactttgcg actggcatga    267300
     acggccagta cgttctgtac aaaacgaatg ccagtggtcc ttgcggcaaa cgctgtgacc    267360
     aggtattgtc cgaggaacca cgctgcggac gccagcatgc gcgtcgagtc gatgccgctg    267420
     aaatgcatga ccagaggcag cgttggtacg agcagcagcg acattaccga gatgtcgcgg    267480
     aacagcaggt agttcttatg gctgtccacg accgaggggt ccgagtcgac ctgcctgtat    267540
     agaccgtacc acttcgagtt ctgatctctt tccgtagacg ggaactcacc cacgtttttc    267600
     ttcagcttcg ctatgtcgat ccgcgggtcg gctggcgcat gcacggagaa ggcccgagca    267660
     cctggcagcg gatgctggaa gcgccagaac accagaatgg ccttgtgatc ggacgagatg    267720
     agcgacgaga ggatcaaggc cggaatgggc agcaacgtgg tcagactcgc acggataacg    267780
     gcgacctttg tcagagtcag atcatcgacc gcagtgttga aagcgatcac caggagcacg    267840
     aggacatcca ggacgagtgt cgctaccagc caggcgaggt ttcggccctt cagtgttttg    267900
     ttgtaatctt tcatttcttt tatccgttgt attctgtggt gaccgtatac ctgccgtcat    267960
     ccgacacttt gaacaaaatc cagccgtctt tgcgcgtcgt taggcagcgt cgacgtcggt    268020
     tggtgttgga cactagcacg ccctgattcg aagcagcgta ctggtaatgt ggtttttggg    268080
     ttgagtggac aattgacttg tccgagatca ctaccacttg cggttcgaag tagtcaaata    268140
     tccgttggca atagccgttc gttcggccat gatgggatgc gaccagcact gtcgtaccga    268200
     ccaactcggc gcgaaacgct ggttgttcca gcatcgcgag ccatccatct tcttccaggt    268260
     cgccagggaa caggatcttg aacggcccga atttgaagaa cacggccagg ctcaggttgt    268320
     tcgtgtcgta gaagcgaggg taggggttgg agaaggcggt taccgtaatg ccgcccatgt    268380
     gctgatcgaa aggggcatcg acggcgtgta tgtagtcagt gtgaagggcc aagtacctct    268440
     cgatgtcgtc ggtcagctcg ccactcgctt ccttgatgat cctcaagacc tctggtgaca    268500
     cgctgcgatt cctctgaaac gaggagacgg tgatgccctc ggtccacaga ttgttcagat    268560
     cgctcatatg gtcgaggtct gcatttgtga tgaacaggta gtccagcaca ctgcgccgca    268620
     ggtgattctt gatataggtg cttggcttcc atcccgtcag cccgttgtcg ccggaatcga    268680
     tcattgcgag tcgaccttgc tcaccgttgt ctgcctggtg tgtgagcatg gcgcatgcgc    268740
     catgctgcac atcccatatc tgtaagatca tttgcccagg catgctgccc tccgaagcac    268800
     gatgaactgg ggattctcta caacagatcg aatgctttgc ccgcgcatca cttcaccgtg    268860
     ccttgcaaga cttgcagatc gtgttcaccg acgatgagct gaacggcggg gagaccgtca    268920
     tcggccatgc ccaaggccag atgaacgagt tgcacgagat cgtcacggct gggtgaggcg    268980
     gaatgcccag gtggatggct gtgccactcg ccgatgtagc cgacgactcc ggctgtccgt    269040
     cgagacgctt cggtgaccgt ttctgccaga ccagcgatgc cgcgctcgaa tgagccagga    269100
     ctggacttgc tgtcaggcgg agcaggaagg gccgcgacta cgatgacggc actgacgttg    269160
     aaatcgtaat acccgattaa cacgccgccg gtttcattgg gaaatccctt cgtccgcaag    269220
     tcccgaagtt gcagctctac gctggcgtcg acgaacagat cgaattcacc gagctgcatg    269280
     cgacgttcag tggccacagg cacgtcgtgc acctccacgg tgccacgaac tggatcgcgc    269340
     tgccatacgc gaatcattgc gccgtcttgc gctgccgcca atggaatctg ctcggccagt    269400
     gtactggcct ggcccatgat ccgcgaatac ggtatgacca cagaaatatc ccggcagctc    269460
     gcgccgctcc agaacgaacc agtgttgtcg gtgaggtggt ttcgtcccca gttctcttgg    269520
     atcaaggcgc ggtaatactg cgcttcaaga gtacgcaggc gaagaagccg ttgggcgtct    269580
     tcggcaagta atattcctgc attgccggtt ggtgtgacga agaccgagaa gtgtctggcg    269640
     aagccatcga ccatacttgc ggcgcgcgga tattccagag tcgtcgaggc gtcgaccact    269700
     agcttcacac ttgacagtgc atcagtgacc gccccaggct tgaagtcact ggcatcggcg    269760
     ttcagtgggg tgatctcgga ggccccatgc atggccgccg cgtgtaggtc cgccacgacg    269820
     gtggccttgg ggtatccaat gtgctgcgca taggccacat gccgagacag gttgtgcggc    269880
     ttgatatggt ccttatcgat gacggtccag cttccccagc cagcgcgtcc ccaaaaattg    269940
     agtatcgcgc tgccgaggga acctgcgcca acaagcgcgc cggccggtcc ttcctcggtg    270000
     atgcccgact gcttcctcgc tgccgctgcg tcgttttggc tcaggacggc catcggcaaa    270060
     acaggctgcg aacgccactc ggtggcaggc tgcgcaccga tcagccccgt tgcgctgaaa    270120
     tacttcttgt cgaggacgaa caatgcgccg acggcgacgc cgagttccag tccgcctgcc    270180
     agcagcagga acgcgcgatg ggtaacgccg acgggctctg cgccttcggt ccggcagatg    270240
     gggatatgga gcaggatgac cgtgcatttg tcgtcggccg atgcgacgac gcccttggcg    270300
     cccacgcgcg cctgcagggc tgctcgcaag tagggcagga gatcgatgcc acgcctggaa    270360
     agaatgtcag cgagttgtcc caatgtcgct ggatcgcgct cgacgaaccc gtgcaggatc    270420
     ggttgcagca ccaactcgat gggggcggcg gtgccggtct tgaccgcagc atctttaggg    270480
     accgcttcca ggaagcacgt gaagcccgcg tcgggacgct cggggcctcg cgcgatgacg    270540
     aagcgatgct cagcactttt gcgtaacgtt gacagattcc acggcagaac gagttcgtat    270600
     ctggtagcga agaacagatg ttcaaccggc tggtccgtcg ggtgcagttc accccgtgca    270660
     ctcttttcga gccaccactg gattcggcgc aaaaaacttt gcggtgtcca agtgcgcatc    270720
     accgccgcca cggattcgaa gtacagacaa aggctcgcag gggcatcgag gatgccctgg    270780
     ttctggtgca tcaaaacagg gaagtccttg cgcattgcca gaacctcgat gagctgcttg    270840
     ggatcgtcgg acacacatag cgccaagcgt tcccgataat tgatgccgac gccatttttt    270900
     ggaggcacac catcgcactc gacctcgacg acgatgcatt caagcttcgg agtcccgtca    270960
     tcgcagtgtt gcaggagctg gaccaccgcg tagtcgcgct gccgcgagac gacatcgaat    271020
     aacgtcttgg ctcgcgggat cgtcagtcct acttcatccg caagcgcact gacattcgtg    271080
     agttcgtggt actcctcggc catcagcccg cccgcggtgg cgtcgacaga atgacggccg    271140
     gcgcaccgat ggatgttgag cgaatccagg tcaccccgcc gtttgtgatc tcgaaggtga    271200
     tcggctccgg cttgttggcg ttgggttcct ccattgtgac aaggaattta cgaccattca    271260
     cttccttcaa gtagcgttcg taggctttgc gggcctgaat gtgtgggggt tgcttctggg    271320
     tgtacgagtc cttcacgtcc gtgatgggct tgctacagct gacgatgtac gcgtccttct    271380
     tgcccagccg caagaggtct ttgatcagtg gtttgggctc ggtttccttg tcgcctttct    271440
     cgtcgctcag tgccaggtag ctgcaatggt gggggatgtt gtacagatcc caggccagtc    271500
     tgtcctcgtt cttgtgatac cgcgtcgtct tcacaatgtc ttccatgcta tcccaggttg    271560
     catcaccgac ttcgaggtag tcatagtgag cgccgtcggc gcgaaagcgc acgttgaaaa    271620
     ccagtgacgc ctcgtttcgg atgatgtcgc cttcgtcgca gtgcttgatg aacggcgagt    271680
     ggcagaagaa ctccaccttg tccgcgtcga gcgagaagcc gggtacgatc gtgccggcat    271740
     cgatgagcag gtgatcgcgg gccgaagccg attcgccacg ctctttcagg aggggttcga    271800
     gccagtcggc cagtgcttga ggcttcgaga acaccaggat gtccttgccc tccagtaggc    271860
     ggtgccgagc ctcctgtcga agcaggacga actcttccat ctggtggtcg ttgtcggctt    271920
     gctccaacag cattgcggca ggcacccaga gttcatgaat cttgattcga ccttcgccat    271980
     gatatttcct ggcgtgctgc agctcgaaaa agtcggtact gccctggatg tgatccagat    272040
     cggcgtgcgt gaaggccacg acatcgaaat agtcgcgatc cgcctttttg aggtcggcct    272100
     tcaggcgcgc tttgagatca atttccggcg tgctcgtgtc ttcagctttt tcgcggtggc    272160
     aaaagtcgaa caggacacgg cgaccgccgg tcaggacgat ctgggtcgta tcaccgttgc    272220
     cgaccggata gaaaatgact tgatgtttgt ctgccacgat ggatcctctc taaaccggtg    272280
     gccaatttgg aagaattagc actcaaccac gaggagtgct aatggacact atatatgggg    272340
     caaaactacc agtcaataca ctacaggtag cgctttttgg tattttactg tatttaataa    272400
     cagctcttca acacttgcac ttgctgcgga tttttgggga tcaatgtacg tgatgtcccc    272460
     cacccagacc ctgtcaggct cagccacggt gaactcgcgg ttgagcaggt ttggcgaaat    272520
     cggcaacttg tgattgctgt cggtggtgac cttgaagcgc cgtttgcctt tggcacgaat    272580
     gccgtgcagc tgcatgagct tttgcacccg ctccttgccc accgggacac cgcgtgccac    272640
     cagctcgcgc cagatgcgcg gccagccgta ggcgctgcgg gtctcggcgt gcagggcctt    272700
     gatgtgtacc agcagcgcct cgtcgctcag gtggcgccgt tgcgcattgc tggcgcgccg    272760
     cgccaggtgc tcgtggtatc cggccgcact gacccgaagc acccggcatt gcaccgagac    272820
     cggccaggca tgccggtggc gctggatgaa ggcaatggaa tggacgcccc accttaaacg    272880
     gcattgatat gtcaaattgg ggtggcgtat caatcctttt tcatcgacag gagtgtccac    272940
     catgaaagtt acaaccgttg gcattgatct ggcaaaaaac gtgtttcaaa ttcacggcgt    273000
     cagtgaattc ggcaagcccc ttatcaaaaa gcaattgcgg cgcaatcaaa tggccgagtt    273060
     cttcgtgaac ttgccacctt gcctggtcgg tatggaagcg tgcggtagcg cccaccattg    273120
     ggcccgcaag ctgcaggcga tgggccacac tgtcaagctg atggcggccc aatttgtcaa    273180
     gccgtacgtc aagacaaaca agaatgatgc ggctgatgca gaggcaattt gcgaggctgt    273240
     gacccggccg aacatgcgct tcgtgccgat caagaatgtt gagcagcaaa gcgtgctgtt    273300
     gctccatcgt gcgcgccagg gattcgtgaa ggcgcgtacc gcccaggcca atcagattcg    273360
     aggcatgctg agcgagtttg gtctgatcat tcccctgggc atcaggcata tcgcaaacca    273420
     tgtgccagaa ctcatcgaag atgccagcaa cgtgctaccc ggatcatttc ggctgctcat    273480
     tgagcgtttg ttaaatcacc ttaaggagtt ggaccgccaa gtcgatgaac tggagtcgca    273540
     gatcgtagcg tggcatcgtc aaagtgaagc cagcagcaaa ttggcacgga tacccggcat    273600
     aggtcccatc actgctagtg cgctggtggc ctcactggga gatgccaaga gcttcgatag    273660
     cggcaggcag gtcgctgcct ggctgggtct ggtgcccaag cagcactcca gcggaggtag    273720
     gcagaacctg ttggggatca gcaaacgcgg cgactcgtac ctgcgaaccc ttttgattca    273780
     cggagcacgc tctgtggtgt tgcgtgcgag tctaaagagc gatccgaacc gcacgtgcag    273840
     ttggatcaat gacgtcgtca accggcgtaa caagaatgtg gcggcagtgg cgctggctaa    273900
     caaaaatgcc cggatcgcct gggcgttgct aacacatgac aggcgatatg aggccgggta    273960
     catcgcttcc aaggccagcg cctgaagaac caactatggg acagcagtaa taacgacacc    274020
     gggagaacga aaccaccgat tgcacaggca atcatgaagt tgatggcgaa ccaggtcaga    274080
     ccgtggttgg caaagcccgc tgaagtacag gcactttgag tgcatgaagg cgatggggca    274140
     ctaaccagcg aattccatca gggacggcgg cattgccgca aaagagtccg aatgtacggc    274200
     tgcaatcttt accttttagt catcacatga attgaatgct tggcataccg gggcgtccat    274260
     gtacgtactt caaatcgacc ctcttgcgaa gtacgccgtc gcttttccca agatgtcgcg    274320
     ctccattttc acgcgcgcca gctcggcccg gagccggctg atctccatct gctcggcgct    274380
     caccggtttg ctgtccacgc ctttgagctt tccctgcctg tgcgccttga cccagttgaa    274440
     cagcgtctgc tccactatcc ccagcgttcg agctgccccg gcaatggtct gcccgccctc    274500
     gaccagcctg accgcttcct gcttgaattc gagcgtgtag cgcgcccttg atgttttcgt    274560
     catttccgtt ttccttgtct gaattgaacc actcagcaag ggatacgttt ttcggggcaa    274620
     ggtcactgca tttcattcgc aggattaacg ccccacaaca gcgagacctc aaaaagcgct    274680
     gcttatcggc ctgaaaaata agagcgacta aaaataaata cagcacttat tacattattt    274740
     attgtgtaat ttacagtatt actattacac tgtaattaca caacaggagt tgaagatgga    274800
     aaatgcaaat gccggccccg tgacgatgga ggatgtgctc ggcgccctga acgggacaga    274860
     cccgttgaac accagcgcct cgaaaattcg ggccatcctg gggcgaggca gttttgcgac    274920
     ccttcaaaag cacctggacg cgctgcgcgc ggcggccaag gcagcccagg agccggtgag    274980
     cctgtccgcc gtgccgagcg cgccaccgga ggtgatcgcg gccctctgga gcgcggccta    275040
     caacgcggca gggcatcagc tggccggcaa gttggccagc tgcatgaccg agcgcgacgc    275100
     cttgcgcgcc gccgccatcg cggccgccga tgatgttgca acgctggcgg cgcaggtgga    275160
     cgcgctggaa caagagaccg cagcggccca tgcctcaagc gaggcggcgc tggccgactg    275220
     cgccgccgcg cgcaaggagc tccaagcgca tcaggcgcgg gacagcgcgg acaggatgcg    275280
     gctggccacc gccgccgagg ccgatgtgat ggccgcccgg catgcgctgg agatggaaaa    275340
     gcgcgaccgc accatcgagc gccagacgct gcagtccacg gtcaactcgc tcaccgatca    275400
     gatcggggag ttgaaggcgc tgctgtcgct acaggcgcgt cagcccatcg cccaggcggt    275460
     gcagccatga ggtcaaaacc ttgcgccgga tgccctttcc gcgaaggctc caaaacggtc    275520
     tatgaccgtg acgccatcga ggcgcttgac gaagggcaag aaccctcgtg tcactgcgtc    275580
     gtggggcacc acagcatctt tgacgccgtg ctgccggagc gaagcatcgc ctgcctgggc    275640
     tacttgagct ggcaggagtg cgagcccgga ttttgccgcc ccaagctcga cagcaacgag    275700
     cggccctaag ataacgaata gtttatcggt cgctgccgcg atgccggcca agctcaccgc    275760
     tgctgatcag cggcagataa acctgttgga ctgaaccgcc gcccttgagg gtggcaagag    275820
     gggattgggg tctgaggtgc agtggaacag taaaagcagt taagaggcca agatagatgg    275880
     tcaaattgtt ggcgccgatg ccgaattgac ccaggctgcc ggaaatcgtt gatccatcca    275940
     catgcccaga aaacccaggc tctgcgtgga atctgactgg ttttgcatgg atcagttgaa    276000
     atcggtagcc tagagcggct ccgccctgac tggcaagcaa acacaaggaa aacctcggag    276060
     gcggtggaga tacagctatt gccagtcagg gtgattccgc tctagcgcga gcaaggccat    276120
     gtggtgcggc tgctggcttc ggcctatgcc gacaaagacg tggtggtcgc agccatcaac    276180
     cagggccggg tgatgcgcat cctggaaaag ccgttcgact atgggcaggt gcgccagggg    276240
     cttcgcgaag ccctgcagat ccatcgccag cgccagcgcg agcagcaccg gctcgaaggc    276300
     tcggccgccg cgatgcgcga gacgctcgga ttcctggcgc acgagctgaa cacgcctatg    276360
     gccaccgtgc tgggctacct tgaaacgctc aagagccgcc accgggcgcc cgcgcccaat    276420
     gcgccgcccg gcctggcgca gatggctgaa cggcgtgccg gcgacacgct ggtgatgttg    276480
     gggcggccga gcagcgcgcg cagtacgcga tgtcgctgct ggacaccttt gtgcagtccg    276540
     cccgcgatgc ttaccccgat gccgcgccga cgccgctgct ggccagcggc ctggtcaatt    276600
     cgctgctgca ggactatccc ttcgaggacg gcgagcgcgc ttgggtgagc tgcgatctgg    276660
     aggccgactt cgtgctgccc tgccagcgcg acatgctcta cctggtgctc tcgacgctga    276720
     cgaaaaatgc gctgcacgcc ttgcacgcct tgcacggcag gagcgagcag caccttcgca    276780
     ttacgctcga acgcggcgta cccgacgcgg ccggccatcc ggtttgccga cactgggccg    276840
     ggcatcgggc cggccatcct ggcgcagctc acgctcgggc cggtcgcctc gcgccggggc    276900
     agcgggggca tggggctgct gttttgccgg cgcgtactcg aatcgatggg cgggtcggtc    276960
     gaggtgtgct ccgcgccggg ccagggcgcc agcatcacgc tgtatttcaa atccggcgcc    277020
     tgaactgttc gggggctttg gctggtatgc gctggccgcg cctccacggc ttgcgggcaa    277080
     ggcaaccgct caaacccgct cgaacaactc ggccacccac tcgttgaagg cagtcggcaa    277140
     tgcacccgca gcccgacccg atggtgctgc cgatggtggg cggccagccc cggctgggcg    277200
     ggctgatgaa cgccagggtg ttcctgcacc gctttggcgc tgcccgaggc gaccaaattt    277260
     ggtcgcctcg gcctggccaa gcccatgcgg ccggcgcgaa tgtccaggca catccttcgc    277320
     cattcacgcc agcgccgtgg gaatgtcgct ccagcgcgcc atgtagtcgg gcgtcttgag    277380
     cgcctggcgc atcgaccaga tgcggttttc tgcaaaatgc ccggcgctgg ccagtgccac    277440
     cgtgcccggc ccatggcgct cgttgatccg atccatcgca gccatcagcg cctctagccg    277500
     gggcgcgtca tcacccagcg cgagctcgtg ctgggcggcg ggcccgtgct gcaggccaag    277560
     cagcatgacg ccggccttgg catagttcaa gccgggccgg tagatctgct gcagcccatg    277620
     gagcgcagcc tgcacgatca gccggctgtc cgaggtgggc cagcgcagcg gcacggtgag    277680
     cgagcgcgaa tactgcgtgt cgtgctgccg gaatggattg gtgtggacag cccaagaaac    277740
     tcgggagagc caatactggc gcaccttccc gcacaaccag caccgttttc taaacgaccg    277800
     cggccaggcg cgcggcgagt tcgtcgtact gttggatgaa ccgctgcgta ttggtcttct    277860
     taagcttgga gagattcatc aacttccatc gaatcgccgg tagctcctgc aaatgcgcga    277920
     atggcatctg actccagtcg ggttcggctt ggaccagtga cagcagaaaa gtatgatggg    277980
     ctggcgttag tgctttcggc aacgattcga atagccgtgc cctcgtagct tccaattgct    278040
     ccaaggtaac tggtgtggcg gtcatgccca cgaattcact tgcgaacacc tccgccagag    278100
     gttgcgactg agcaaagagg acttcatgca ctggtcggtt gtggccggcg aggtacgcca    278160
     caaagcagtc aacgaactcc ggtggcagcc cgaatcggtc aaacatgtgc tgaacatcga    278220
     acaggtctcg gggatgctgt cggtccatcg cggccaccag cttgctcccg tatagttcag    278280
     gaatcgccag caccggcacc tcgatgtttg ccgcgaaaag ggcctgcgcc gccgccacca    278340
     gcgaggtacg aacgggtgga agcacggttc ctcggaagac gaagttgact tccaccttga    278400
     cctcggattt gtcgtccgtc acaaacatct tggcttcgtc gccggccttg ttctggcgca    278460
     cttccgcgac aaaccccatg cgctctatgc gcgtctttgc agctgccagc tcgtccttga    278520
     tggccttgag cgccacgtca cgggccatat cgtgacgcac gaagaccacg tcaatgtcta    278580
     ccgacaaccg aggaaggtct tggacgaaca ggttgagcgc cgttccgcct ttcaacgcaa    278640
     aaagcggcgt ctcgaagatt gcaggcgcga tggccagcaa gagttggacg gttgaggcgt    278700
     aggttggatt catgggtttc gtttgagatc caagcgctcc cctgtctttc ccacactcac    278760
     ccagcgcttg ccgccgccga gccgctcgct gtgttgtcgt gcgatggatt tccaaggaag    278820
     attgagctca tcggccacgg catacgctag ccgtaccact ttgatacggg tcaggtacga    278880
     aaaaagctca tcaagcagag gcagtcgaag cgaacgggcg ccctctacga gatgctttgc    278940
     ctcttccagg gtctgcctgt ttccgacgtc gctgagaagt tctagcaagg cgcgctcggg    279000
     cgtcgaaacc ggaacatcag gtctcccgcc aggcaacggc gcgatgccaa gctccggtgg    279060
     cattctcgcg tcgaagaggt gcgtcgcctg gtagtgagag gggaaccgcg tggtaaacca    279120
     ggcgggtagc ttggccggtt tgtcccccca aagtgtcagc gtttctcgaa aggcgaggtt    279180
     gtgccgcact ccgcgccagc ttagcgccgt ctttccggca acgtgcagac cagacacggc    279240
     aggaactagc caggcgatgc tcgcatcccg gtccagtgtt tcggctggta aggtataggc    279300
     gccgtgtccg agacgttcca gccaaccctc tttcgcaaga cgagcggcgt gcttggtcgt    279360
     caaaccgtgg tcactcatca atcgcctccc gatgggttgg ccgcgcggca gatccgagag    279420
     gagcgacttg aatgaaaaat ttgttgtatt tcgcatctaa ggggagttgt agctataaat    279480
     ccatgcaatc ttcaacgaag cgttcaaagc tacgccgttt ttttgttatc tattttgcat    279540
     aaaattagtg taaaaattca cctacaaggg gaattgtata atattttcta tgcatctcga    279600
     ctttggtcgt ggacggtgct cccgcctgac ctgggcatct tcaaggcaat gaaaagtcgc    279660
     ccccagaagc tgcggcgact gttacaaatt ttgggccaac agcgtagtaa aaccctttgg    279720
     gaatgagaaa aatgcgctcc agcgccgcac cggctggccg cgctcaagga gcgggagacc    279780
     agtcgacatc agcatctgcc attttttcct cgtcaagctc ggccagcagg tagtgacggc    279840
     gatttcgcgc aggctgtcgg tgggcttgcc gatggcaaat agctggcccg ccaggtcgtc    279900
     cgccgtcacg cccagcgcgg tctggatggg caggcacagc gcatgcatgg cggcccggtg    279960
     cgaatggttt gggcaattgc gtcagccgca gctgccgggt gcgctccagt ttttggtggg    280020
     caattctgat cctgatgggc aagttgtaaa gctgggtttt gcaccgcttc tcgatggcct    280080
     tgaccttctc gcgctgggtg tcgcaaaaga aaagcagcgc ctcatcggcc gcagtgagga    280140
     tcctggtcga gcgctccttg atcttgagcc tgagcgccct gagcctggct ttcgcttcga    280200
     ggcagacagc gacttcctgg gtcagcgccg catgctcggc cacgaggcag tcatgctggt    280260
     gcttcatcgc atcgagttgc ggatcgagcc tagcgtcgag caaggcgttg tagtcgccgc    280320
     actgctcgtc aaacgcaccg gccagatgcc gccagccggt ttggggctca agcacggtgg    280380
     cgccgaaggt gtaatggaac tgctttacgt gatcctcgaa gcgcgaaaac gggtggaaag    280440
     gcatgaaagc ttctcgggtg ggggaagcct gcacgatagg ccagcgcggg cggctcgcca    280500
     ggtcaaaagg cgcgactgaa aaagcagtat ttgaaagtta ctttcagtgg aacttgcgac    280560
     atacttctgc gatgtcacga ttcaacccaa ttgccttggc cttggcggcc tgcctggcgc    280620
     tgccggcctg ggccgcccct accgaatgcc ccgaacactt cgccggcggc gtcccgcccg    280680
     cgctcaccaa tgccaggctg caatcgcgca cgcaggccct ttgctttcag agctacgccg    280740
     cgctgcactc aggcatcagc cgcaccccgg tctactcagc cgagcacctg acccgcgcca    280800
     atatagaagc ggccaagaag ctctcgcggc gcgactcgtt ccatgcggaa agccagctgg    280860
     cgcaagaaga ccgggccgaa ctgagcgact atgcccgctc tggctatgac cgaggccaca    280920
     tgcaataccc ggtaaaaaat atactcatca gctagtttgc caatgaaatt gtttaagtac    280980
     atatactcaa taaacatact caaacgcaaa accgctccca ccaccatgaa ttctcaggtt    281040
     tttcgacgcc tgctcggcat agttttcaca ctgctattcc tggtcagttg tcgcccttct    281100
     gcattgcagc caccaccaac gaatcaaaca aagcaagttg agaaggcaga agttgagaag    281160
     ccagaactag tcaacagcaa aaaagagatc ggacaccgcg actttgccaa cgcaaaaaaa    281220
     atactccctg aagttttcgc aggtttggaa gaagatttct attgtggttg tacctattca    281280
     ggcaagaagg ttgacctgaa tagttgcggc tatgtgccgc gaaagaacca gacgcgcgca    281340
     gagcgcatcg agtgggagca tgtggttcca gcctgggttt tgggacatca gcgtcagtgc    281400
     tggcaacaag gcggacgaga taattgcaca gcttcagata cagaatttag taaggcagaa    281460
     ggcgatttga acaatctggt gccagccgtt ggcgaggtca atggcgatcg tagcaattat    281520
     tcctatggag cctggagcaa caacccgacg cccatttatg gaagttgtaa aaccgtcatc    281580
     gactttaaat taaagagggc tcagccacgc gaagaagtgc gcggcagggc agcgcggatc    281640
     accctctaca tgcacgaaaa atacaaatta aacatgagcc ggcaagatcg ccagttgatg    281700
     tgtgcatggg ccaaacttta tccagtagat acctgggaac aaacccgcga taaaaaaatt    281760
     attcgctggc aaggggaggg caaccctttg gtatctgacc cgcagcagct ttctagcctt    281820
     tgcccttagc caatctttcc acgcctgcaa ggggggatat tcatcatggt tgtggcagtt    281880
     ttcgaaagcc gattcacgaa gttccattct ccaggataca gaccgttccc agactaccgc    281940
     aatatcttga gttgactcgc ggttttcagt tcgatctgag gaatgccttt gtagctttcg    282000
     atttgcccaa tgatgcagac acttctccct tctaactgtc ccggccttac cattgggaag    282060
     tctggttttt gtttacccca gattaccagt accagccgct ggacattggg atagaccgcg    282120
     cctacatcaa cccatgtggg attgccgcgt gaattctcgc gatgagttac tttcatcaaa    282180
     ggaccgacta ccgctgcagt ctgaccaata tgctgcccag cctgttgcca actgataggg    282240
     ttgtcgcagg ttgcaccttc aggaacctgc acgggcacct cagtagccgg taaagcagaa    282300
     agcattacag gctggagtgg ggtggtagcg ctttgcactg ttgcctgaga ctggccggat    282360
     gaacccccgc gactctgcca gacgatcacc atcacgagca tgaggatgag ggcagtaaat    282420
     gacgcgacgg tatatttcat gacggatgtc tctttattga ggtattcgat tttgtcgttt    282480
     tggcctttgg tcagtgcgtc cagtcgctcc ttttccttgg cacttaatgt cttgcgttgg    282540
     gatttgcttt gtgaacgctt gagcagcagg ctgatatgtt ctgcacatcg gttcggttcg    282600
     tccctgacat ctctgttagc aaagcgcagc acataccagc cttgtgaggt cagtgccgct    282660
     tgtcggcgct gccagtcaac aaaatctgca tgggacatcc ccgtacccat accgcgcttg    282720
     tcatagccgt cgatctcgat tgcgattcga acatcctcat tttcatggat gacaaaatcg    282780
     cagtagcgct gtcgtctgtc cccgtcctga aatggatact gcaccgaaac tgcatcaaag    282840
     ctgagttcag ggatcagagg caataccgtc tctgcaaaca ggatttcata atcgctgcca    282900
     aagtttgact tgtttttcgt cagccactca tctagattca taaattatga tagggtcata    282960
     atatttatta tgctgagtac agcaccttgt tctgttttag ttgagcagtg atttccagtc    283020
     aataaaatct accgtgttgt caaacaactc tctatcgaga gtccaatttt tgtttttcaa    283080
     gcgattttcg caatgctcta cagcattctt catcaattgg gccaaagcca gatttgattc    283140
     tgatttcgag aacatttcat tgcaataact gttggatact tgtacgaatg ttttccgtcg    283200
     agtacgaact ttccttgttg cttctgtatc ccaatattcg cacctgattt gattttcacc    283260
     atattggtaa aactgtaaaa atccaattat ctcgttatat ttccaatcgc caccatattc    283320
     tttgcgcaga tgctcactga tcaatggatt tgaattatct gaatttattt tttctatgta    283380
     ggagcgcatt tcattgtagt aatcattctc ttttgtcctg taaacttgaa tttcaaatag    283440
     ttttttgctt ttgagcattg gctgtgatta tttttaatat ttaaatagat ggcttgctta    283500
     cgggctattc tcggctaaga atgcctccgc tgccgttaca aatgacggtg gaaataatgt    283560
     ttccccttgt gcgtcggtga tgctgccatc ctccatcacg gtcataccac gttccgcaag    283620
     tcgcgttcgg tcaacaccaa tttttagagc ccgcagcagt cgcggcggaa ccgcatggaa    283680
     ttgcgtaatg ggtccattga cttgagtttg cccatccgtc gttggagtgg cggaaatgga    283740
     cgctcccacc tgcaaggttt tgaacgctgc gtgcaggttg tcgttgacca ccttcaggcg    283800
     ttttccctcc tcgatagcca tgcgcagcgt ggcgcggatg ctcgggtccg tgatgagttc    283860
     gagtgctgcc tcgacttgtg acttcgactt ggaaaggtat tttgtcgaac cgctgcctcc    283920
     ctcagcgtac gcgctaatga tttcgcggaa atgcgtccct tgcgcgttgc gcagactctg    283980
     cgttttcagg cccccagcga cctctaggcg gcgtccaact tcagccaacg agtagtctcg    284040
     ccccccgtcg cttcgaatgc cttccagggc ctcccaaagg atgtcgagat ttttgacctt    284100
     ggactctcgg cttgctgctt cacgatgcgt cttgtacaac tgccgggcat cgcgcactgg    284160
     gtcaggcgca acggtcgagg tggacgtttt catgaggagt tgccttcaat aaaaattgtg    284220
     cggctcaagg caagggactt gggcgtcatg gcctgaagct ggtctgcaaa agccttttcc    284280
     ataccgagtg cccgcagcgt ggtgcggccg tccatgagat catggactgt ttttggcccc    284340
     agcctggcgt acaagaactt tcccatcgca ttagccgcac cgagcgcatc ctcatcgtct    284400
     agaagcgaga agtgcggctc gcagccggat gcgcgcagca ttctgtcaaa cagacgggcg    284460
     cgttccagat tggggtgttg ccagtcgatt ttcagcccgt caaacagcat tgcgctctca    284520
     caaatacgat gcaactgctc gaactcgtgc gtttcagtga gaaccgcttc caactcgcct    284580
     gtgccgccca ctgccaccag tgacagtccg ctgccaccgg gcttgttgac gccaaggttg    284640
     ttgatgtgaa tgctttgctc cgtgagggcg taagcacact gaaggctgag cgcaatcgca    284700
     tcaacctcgg cggtcactga ctccagcgcg gtttcggcaa tttccaggtc tctttgctgc    284760
     gagaacgggg tcacgttttc aagagcgtcg gcaaattggt tcgaaagggc atcgaatcgc    284820
     agttgggact tctcaaatga caccgatgcc ttgcgcagtc tgtacgacag gtcaatgacg    284880
     tgggcctcaa gcccaagcag gaacgcggga ccactgacga agaatcggca acggacgcaa    284940
     ttgcttgctc cacccgggac agccagatac cggatgaaac cagagcttgg gtccatcgag    285000
     gcgagacctt catggcaacg ccttgctgca accggacaca cgccgtggtc catgacgacc    285060
     aaacctgtgc cagttccgct ggtgatggca tcgagcgccg acgggtgcgt tctggcgacg    285120
     gcgcgctcca gctccattct gctggcgcgc tggatgaacc ctgccatctc ggactgttcc    285180
     ttgcgttgac gctcctgcac tgcagcatcc aactgcaccg aaatggtttc ggcgttgagc    285240
     ttgacgtagt agagcgtcat gatgatcgag gcatgcccga caattttcat gaggatttcc    285300
     ggcggaatgc cctcttcgta catagcggta atcattgtga cccgcagcgt gtgaaggtcg    285360
     aacagtgccg ccgatggcgc gcttcttttc gttgagctga taacaagttt tatcggctcg    285420
     ccgtttgcga gggtttcacc agccagcgcc agccttttct ccagttcttc catgagcctc    285480
     aaccagaggt tgcgcagtcg aacatcagac acaggaaggt ctggtcgatg ttgatggcag    285540
     gggtcacgga agaggaataa gttggtgccg agcttgcgaa ggtcctcaac gtgctttgcc    285600
     gccttcagtt cgttgatgtc ggtccaattg gttgggccat ctaactggtt gtacttttcc    285660
     tgccagttgc gcatccgtgc aaacagttga agtgcgtcca gcttctccca cggcatgacg    285720
     aaaccggtct tgtccttgtc tttatcgatg tccccagtct tattggtgtt gaagtacagc    285780
     acagcgccga gactaccgtc cttgcgcttg tattgccgga acacaccacg ctcgacgccc    285840
     gcattagatg gcgcgtgttt tcccgtattt ggtccccatg ttccgttctc ttcatacctg    285900
     agcgaatcgc cttcactgct gtcgagatgc cgaatttgat aggtacgagc tgggaggata    285960
     agcttggcca taagagcgta tgtacgcaca gggctccaga cgctctcaaa ttctcgggtt    286020
     tctggatttt tccaacggaa gttgtctgag agctttccga cctctcgcgc ccaagcgaaa    286080
     tcgttctcgg tcagtatgct catcgcttgg cgaatgagac gcgttggcat ggactcgcgg    286140
     tgtgtctctc ccttgttgac accgataaac gtctgtttga ccagcgggtt ggcaaagccc    286200
     ggcatcaaaa taggaaatgc attgtcgtca gcctggatac agactttgtg cagaacctcg    286260
     ttgaggaact ggtacaccac caccatcgtc tgacgccctt tattgccatc gatgtgaaag    286320
     agaggatcag gacgacgctt aatgtcacag tagcctgcag gacttcggtt gacagtcgag    286380
     tttttggcga tgtgctcgat aaagacattc accgcactcc ggcgtttcct atagttcgtc    286440
     ggattttcgg caagatgctg ctttgccaat tccacccatt cgatcattgt tgggtcaatc    286500
     tcaagagccc attcgaaatt ttccttgcgg cgcagatgac cagacctggc ctgataaaag    286560
     ccgaagtctt ccagtaccca cggaacctgt ttgatggagt attcatccct tagcgcctgc    286620
     agcagacctg taaacgccat gggtcgctgt ttcctctttc gcgtcggcgc tggctggacc    286680
     tgcatggtgg tgggagttat gtcgccaagt tctacgactc cagccctgga gagcaccatg    286740
     tccacgaaga accgaaacgt cacagcgtcg gtaagggtgt cgcgggcgag gtactttcgc    286800
     acatagttca gaacgactac gaactcggcg ctccatcccg cattattgag ggtcaagata    286860
     gccgacggaa acggctcttg aacggtcagt ggccacgcca ccagcccttt gcaccacatc    286920
     gctagcatca actgcgtcaa aaactgctgg ccggagaagt ggaagccttc attgtcgagc    286980
     tttgctttga actcttggag caaaagtacg ttcaggcctt ctccgaaggc ttgtggcgaa    287040
     acacaatctg acagcgccgc aaccgcagcc cgctggcccg ctggcggtcg gttgcttcct    287100
     ggaagtgcgt agatacgagc attccactcg gcaacgacca cctggacggc cgcttgattc    287160
     caagcgggag aaataaggta ttggtcgtgt gactggtttt catacacggt acggccggtc    287220
     agttcgcttg tgcgcgcgac aaactgctct ttctgccaaa tacacttttg cagcgccgtt    287280
     cgtggtgtcg gcggctgccc tgccttgcgg ccacggttgt ttttcggtcg agcagcaacc    287340
     tcgtctgttt tatcaacagg cgtctgtgta gccttgagcc gagtcatgtc agtccttcga    287400
     aactgggtaa tgaaagtgcc tgtccatcgc ccatggcagc ggccaccttt gccacgccga    287460
     gctgccgata gacctcctgg ctcttgacgt tgcggtgatg catggcgact tggccttcct    287520
     tctcgcctat gccaagttcg ttgagccact gcccatagcg gtgacgcatt gcctgggttg    287580
     atgttccgct ccactttgat ggggtaagcc caatccgacg aacagcagcc acaaacgaat    287640
     cgctataggc ctcggcgccc agcggttggg cgtctcgggt caagaacgcc cacggggttt    287700
     gaagggcgag tggccgaacg tattcgaggt acaaacgcca cagccttaga aacacgcgtc    287760
     cagcattgcg atcaatccaa aatacttgaa acgcattgcg gtcgcggtga gtcatcaggt    287820
     tgcccttcca gcctgaatgt cggcgacctg tttccatggt caaggggcgc ttgccgccac    287880
     agaagcgctg caggtagtcg gtgcggttgg tcttgcgctt ggtgcccgtc agcggatcaa    287940
     cgtaataaat catgccgtcg tgaggctcgt gtacaagcac gagggccagc tctgggtcat    288000
     cggggtccac aaacacgtcg tcaacccaca ggtgcattgg ctcgctctcg cgacagccac    288060
     cgtagaggca aagcagggtg atgagaatgt cacgcagatt gaacttcacc cacagttcgg    288120
     cagcgttctg ctttcccgga ttgatgaatc cggtccagag cagtgcatct atgtgctcga    288180
     ctggaaacgc tttggtttcc tgcaggaggg tgttccgtcg gccagggagc gacgatcggc    288240
     gcgaaatctc ggacctaggt accttctggc tgcgactctt gacgtgggcc aagagcgctc    288300
     tggacttctg cttgttccat tggcgccaga atatgagctg gtcggaatag gtcacgcctt    288360
     cctgcattgg gttcaaggcg ggcctgccgt ggcgcagagt aagccagtcg ctgaactcca    288420
     ccaggcatcg tgtgagtcgg gcaacgttct tctggctggt tgcggtccag ttgagcccga    288480
     gggcgtcctc gccatcgcag tagctgccga acagcagatc gtgagcgaag gcggtgtaaa    288540
     tcaggccgcg attctcctgc ggccagaact cttcagtacg cactgagagc cattcgataa    288600
     agcgtccgat agcttgggca tatgcccgct cggccgaaag cgataaacct cgctctcgga    288660
     agaatgccag gagttgcaag aacggctgct cgccgacgat gaccattgcg gtcagagtcc    288720
     cgctgcgcat cttgtctcga actacgacgg tttcggtcct taccaccctc ggaccttcca    288780
     gaacaacccc ttcatgtgta ctccttgata atatcgagcg tctgccagcg aacaaccccg    288840
     gcaccggctc gccggtgccg gggttgttcg ctgcggggtt gttcacgggc tagttacggt    288900
     ctctgcactt caagcctgac gcgctctgtt gaaatgagaa acggaaagaa ggtttacgag    288960
     acaccgcagt cactcagcct tgttcactat agataaatga gtatggtttg tcaccgggta    289020
     ttacacctag cgccaaataa ggacatgccc agccgctcag cgcaagccga gagcttcagc    289080
     ctggccaaca tggtgcccca ggtccatgcc agcaatgccg gcgtctggga aggcatggaa    289140
     ggggccgcgc ggcaaatggc gctcgatgaa ggcgaggtct atgtggtgtc gggcccggcg    289200
     ttcatcggca acaacgtgca gcgcgtgggc aacgtgctgg tgccgacgca tttgtggaaa    289260
     gtgctctaca gcccggcgca gcagcgcgcc ggcgcctacg tgacggccaa tgacgccacg    289320
     ggcacgtatt ccatggggag cgtctcggag ctggaaaaga tgacgggcgt gagcgtcctg    289380
     cccgggctgc cccggagcat tcgggacagc gccatggcgc tgcccaagcc ggccgcgcag    289440
     catggcggca agaaaagcag gacaaagggc caaagccaga gcccgagcaa agaagcagac    289500
     gatttcacgc tgcgcgactt cgcgaccagc atcctggacg ccatcaagcg cgccggccaa    289560
     cactgaagga acccatccat gacccaggca ttcaagccct acgccaacga agccgatgtg    289620
     ctgcgcatcg gcgagctgga gatcgaaaac cgccttgacc gcgtcacgct cacgggcgat    289680
     gtggtgctca cacgcgacaa ggcgggcttg gggctggcta ggcagctgca ggcgctggcc    289740
     gccggcatcg tcaaggcgct cgaagcggac aaggcgctgc ccgatgcggt ggagctcaag    289800
     gccgccgtga cggtcaagaa tccattttcc tgagggcttt tggggccaag ccgcttgcgg    289860
     ggtgattctc aaaagccctg tgcgcacgac cactgggcga accttgccca atgttggcaa    289920
     tgcagcggga gggggtattg accaacggct gctttctgaa agttcaattc ctacgttttg    289980
     ccgacccgtc agctgtcatt catgacggcc cgcttcgggc ccaaagccga ctctggtaga    290040
     cgcgcaaagt gaccacttgt ctctgacgag tttgggttca agagagccgt tggcagtgtt    290100
     cctcggcagt cagcctaagg gtgcagcaac caaggtgcca agcgattctt atcatcaaac    290160
     ccaaccccgg gataacggct ccctcgcgtg cggtcaaagt aaggcatcat cctgtcgcat    290220
     gaatacttgt gagcacctgc ggcagcttct gcgtcctgtg gtgggagata tgaaggacgc    290280
     ttgcaccaat agcacgatgc cggagctatg cattgcgatg ggcttacccg tgccgcctga    290340
     gggcggcgac aagcgtggcc ggctgcatgc cgcgttcgat gctcttcctg accctgacat    290400
     accagctttt gcccagagat tagtcgacca acgcagcgtc cgcggcgagt tgcgcgacca    290460
     tgtgcaagat gctctttggg ctcatctgcc agtcatagat atcccaaagc gaagccgtcg    290520
     agacattgca cgtgcgctga accaaataga gttgttcgcg cactgggacc attttgcgca    290580
     agccctgaaa gatgtattca tccttcagga atacagcttt gctggtctga gtgatggtgt    290640
     tttggagttt gcacatcgac actttgtgcg aaatccggaa gacgcagacg tcgaactttt    290700
     gttcgagaag ctgcgggcat tcgacctacc gaacaggaga ttcgtcctgc tgctagaaaa    290760
     gttcgcatca gcggacgtgc aggttgacgc agacgctcaa gaacgcctcg ttaagcttgt    290820
     gaatcctatg ttgcaggctg ctggagccga gctccggcaa acctcgaccg acggtgggta    290880
     cccgatattt accgttgtgt ccatcaggtc accgcgaggg cggccgaaga acctcatctt    290940
     tgcgtcatcg acaaagcctg atatccgact cagtgacgcc atcaacaatg acatcgagat    291000
     tgcgtcgaac ccaggcgcgg tcttggtcta tgaccgtcct ctaggcgcag acggtttgcg    291060
     gtggagcgag cttcagcgct ggtggagtga aaccactggc gaaccggatg tccagaaggc    291120
     tcggcaaacc ttgcttcggc gactacaaca gtgccttccc gactcgtcgc cgccacaacg    291180
     gctgctcttc agaacgtttt tcatgacctt tggcgagtcc gtccctcgac tgccggcact    291240
     gctgccagag gtttggcttc attgggaccc gaagacggtg gctagtcgag gagctgctgc    291300
     gctgctgacc caccgcatgg actttctcat gctcttgcct gggggcgcaa gggtggtgct    291360
     cgaagtagat ggcgcgcagc attacgcaga cgaatcgggt cgtgcggccc ctcaaacata    291420
     cgcgcgaatg gctaagggag accgagagct aaggcttgca ggatacgaag tatatcggtt    291480
     cggtggagca gaactgcaag gacccgaacc ttctctgctc gctgctgaat ttttccgggc    291540
     gctgtttcag cgacacggaa ttcccctcac ctgagttcca aaaaaaagta aaggcacaac    291600
     ttggcgaggg ccagctgagg gtcagcccca cgcggcgctt agaaatgaca tgattttcag    291660
     accaatgtaa gaggccgact taaatcggaa gggctgcata tcccatacct tattaatcgc    291720
     taggcgatac tagggaaaag aggaggcccc gtatgactcg attcgtcgag tggtgcgctc    291780
     atacagatat acctgttgcg caccacaagt tgcagatttt gacggctgac ccagcgaagc    291840
     tggcggcagc ggtggacatc gttgcggagg tcgtgccgga ccactatgtt atgcctgggc    291900
     gcctggctca gcttcttacg cgcttggggc gcaaagaagt cgctgtatat gtagcagaga    291960
     agctcccgac caccaagcaa attaagtcgg gtgacttggg tgaaatcctt tgtacgacct    292020
     tcatccatga gagcacaccc tttaagcttg gaatcaagcg ccttcgttgg aaggaccatc    292080
     gtaatatgtc gatgcgcggg gatgatgtgt tggcgttcca cattggtgca ggcgcggccg    292140
     gacttcaggt tcttaaggct gaggccaaaa gcgggggcaa aatgcaagcc ggcacggtca    292200
     gcacggctcg tgatgcgcta tcggcgtatg gcgagcttcc ctcaccccat gctatgagtt    292260
     ttgtggcaga caggctggaa gcggcggtgg acaaacctct ccgagatatg ttggatgatg    292320
     cacagttgaa gcggaacctc aaacccgcac atgtcacgca tatgctcttc acgttctcag    292380
     gcaacgatac aaccgcgatg ctgagcaaaa accttgcaag ttacgtgggc gggtcggcac    292440
     agcactatgt gggcattcgt gtcgaagacc atcaggcttt catcaagtcc gtgttcgcgg    292500
     cggcggaggt ctaatggcaa ccacactcga agaactgcag gcgaacattg aagccgccgt    292560
     cacgccagga tatcggcaaa aattgctggc acgaggccag gcccggggaa tgatttggcg    292620
     agctgggcta ctgcctatcg acgctcccca cttcagcccg gaactatccg aggacctgct    292680
     gtcttttggg tactcgctgc tgttgcatgg gctgagatat gtagacctag gaggcaattt    292740
     ttctctcgca agagtggcgt ttgaagtagc cgctgagtca attgaggcgg tggtagcacg    292800
     cggtgaggtg aacgaaaatc gtgactttca ccgactgata gcgggcgcgg cctatcacct    292860
     tggccattac tcggcacgcg cctactcgat gctttttgaa gggctgggtc agtcgaacct    292920
     gtccgttgtc gagcgctgct tggcccaact tatgttgcga gaccttgaag gagtcaatgt    292980
     tgcggtgtcg aactgggtcg aatctggtgt gggttcggac agcaatctca tcgaggcatt    293040
     tgatacgggt atcgacgcag aagtcgagga tgaggacgcg ggggagagcg gagtaatcga    293100
     ggcaatgacg ctggcattgg aaggtaattt cctatcagca atgtcccaga cattgctcgc    293160
     cttggagcga ggggagcact ctctgatttt acaagcccag gcacggttgg aagagggcct    293220
     gtccgttgca ggagaattga acctggtcac tcaatggtgg gctcaccggc ttgcgattca    293280
     tatcgttggc gggctttggg ctaatagctt ccattcgctc ctaccgagtc aagggccagc    293340
     tggcgcagac gtgggcgatt gggtccacct acgcaagctg cttattgcgt cgctaatgcg    293400
     ccgtcgtcgg gcagagattg aactctggcc atcccagatt gatgcggcga agcgtgtgct    293460
     cgaatttgaa gccaatctgg tgctttccct gccaactagc gcgggaaaga cgcgcattgc    293520
     ggagttgtgc atcttggcct gccttgcacg tggaaaacgg gtggtctttg tgactccgct    293580
     tcgggcgctg tcggcgcaga ccgaggtgtc gctacggcgg actttcggac cgttgggtaa    293640
     gacggtgtcg agtctctatg gcagcattgg cacgagctcg agtgatgtgg atgcactcaa    293700
     gtccctggac atagtggttt ccacccccga aaagctggac ttcgcacttc gaagcgaccc    293760
     tcaactcctg gatgacatcg gacttgttgt cttagacgag ggccatatga ttggtctggg    293820
     tgaacgtgag gtccgatatg aggcacagat tcaacgcctt ctgcggcgtg ctgatgctgc    293880
     cagcaggcgg attatttgtc tctcggctat tttgccggat ggcgaccagc taatagattt    293940
     cacagcgtgg ctcacgtccg accgtgaaaa tggactcatt aagaacgact ggcgtcctac    294000
     tcgtttgcga tttggggagg ttgactggaa tccagtcagt aagctggcgc aactcaaaat    294060
     cgtggtcggg gatgagcatc ctttcgtttc gaaatttgtt gtcggtaaaa ccttgaatgc    294120
     taataagaat gcaaaagtct acccggcgtc acagaccgat ttgtgtattc ttagtgcttg    294180
     gagattgatt gaggagggcc agtcggtctt ggtcttctgt cccctcaggg tgtcggtcgt    294240
     gcccttcgcg aaacggatta tcgagatgat tcagcaaggg ctaatcgtac cgatgctgac    294300
     cccgcctgca gaagtcctgg cctcagccct ggcagtcggt gtcgagtggt tcggaccgga    294360
     ccacgaaatt ctcaagtgcc tgcgcatggg ggttgctgta catcacgggg aactgccggc    294420
     ctcattcaga aaagaggtag agcgtctact gcgagacgga gtgctgaagc ttacggtttc    294480
     ctcgccgacc cttgcacaag gattgaacct tgctgcaacg agtttggtgt ttcacggtca    294540
     cgctcgaaaa ggcgccccca ttgacgtctc tgagtttcgg aatgtcgtgg gtcgtgctgg    294600
     gcgcgcatac atcgacattg aggggctggt gctgtatccc atgttcgata aacatgaaaa    294660
     acgtcgaact gcatgggcaa atctaatagc gagtacgaag ggccgagaga tggaaagcgg    294720
     cattttgcaa ctactctact cacttctcgt tcgaatagcg agaaaactgg atgctcctga    294780
     cgtgagtact gtgcttgact acgttgcagg ccaggggggc tgggattttc cgtttctgcg    294840
     gtccgaaacc ggctggcgag cagccaatgc ggctgaggag tggccgcgcc acctgacgag    294900
     tctcgataca gctatcttta gcttgctcgg tgacgcgcaa gtcccggacg aagaaattga    294960
     ggcgacgctg gacgaagtgc tgacatcctc gcttttcatg cgacgaatgg cgcgtcgaga    295020
     cggcctaata caaaatctct tgattggtgg cttgaaagca cgcgtgaatt tcatctggtc    295080
     caattcctcc gccttgcaac gtcgcggtta cttccttgca ggcttaggcc tagcctccgg    295140
     ccaagcactc gatagcaagg cgaaagaact tgagtctcta ctactgcaag cgaacgtggc    295200
     cgtgggcgaa ggagaggtcg aaatggcaat tcaggccatc atcggctttg cacacatcgc    295260
     tttcgaaatt ccgccctttg ccccgaatgg actacctggg aactggaaat acatattgga    295320
     gctgtggctt cgaggggtgc cagtgccgca catcggcagc aatgacccgg atggtacggt    295380
     ctccttgatt gaaggcgcct ttgtctataa ccttccgtgg gccatggagg ccgtgcgggt    295440
     gagggcagag gcgcatctgg accttttctc aaacgatgtt agcgtcgcca actacggccg    295500
     tgcacatgca gtggcagcga tagaaactgg aactctatcg gtagctgcat ccacactcat    295560
     caaagctggt tttgcatcca gactaggcgc catccatgca gtcactgtca cggctgctga    295620
     tttcgattca tcggctggga tgagggcttg gcttttgtcc gcagaagtaa aagcgcgacg    295680
     agataaccct agttggccca cggtggaatc acatgagcta tgggtcgact tcaccgcacc    295740
     tcatggtagc ggatacacga agccttggtt agcgaccgca tacacgggtc ctgttacttg    295800
     gcacggtttg cccatgccgc caggcacccc gctgagactg ggcggcggac caggcaagga    295860
     gaatgcgatt tacaccgcgg acttcaagga ggtcggcaag ataggctatg cgtttaatca    295920
     ggccgctgtt ggcctgtcca ttgcgacagc cacgggagct gcaaatgaga ttgcctttga    295980
     gtacatcggt ccgaacgact tggttgttct gtagaaggtt gcttagctgc gacacccggc    296040
     ctaactttct cctcagcgga aaagtgtcac gcttgggtca tggcgcgcca tcccttgcag    296100
     cgataacgtc caggagatag taacccggcg gtagctaagc ctgagggcga gttttcgaag    296160
     ccacggccac ttcctggcga tggacgcgcc aatgaatctg gtgatgtctc cggccgtatg    296220
     aactgtgccg tagcttgacc agctccggcc gactgttgca aaaagagcca tcgtatcagc    296280
     cgggtgtagc caattctgcc gaggcttcga gcggccgctt ctggctgggt gcgggtgcag    296340
     caatgatcga aatcggcgcc acattgccga cactcaaccg gccaatgtca acgtcgggta    296400
     tggagcgacc aattcagaat ctgctacagc cgccttcagt ctaaaaccga cttccgctat    296460
     gcagcgtgag ttgacggtca caagtacccg cttcctggaa gtccagtttc cccccatctc    296520
     gaatggacgt tcccactgcc tagaagcagc ataggtggaa atgcgagtgg gttcaacaga    296580
     ccctcgtcag gatgccagtc cgagcccaag gacgtgcact ctctcccgaa atttgcccac    296640
     gtgttcattg cgaaccacca gagttttagg tccggcgcgc aagcatagcg agctcgtttc    296700
     cttgtgcgtg gccacgttgt cagcggtttc gcagtcgcgg cattcgatca gcactgcgct    296760
     ggcgccggtc ttgagtgcct ggccgtctcg tgcgcagcga agcaaaaacg attcgaccaa    296820
     ctccggcaac ggcagatcgt cgttattttc caaaaattgc ctgagcagcg cgatgtcgtg    296880
     gcctttctcg atggcggcca cggctttttg gcggtccaga tgccaaatat cctcctgtat    296940
     cggttctgcc cagagttcaa gcaacagcga gtcttgtgcg ctgagaattc cgcgcacccg    297000
     tttgacctgc aggcttggca tcaccgaaat ggccacatgg ctgggttggg ccacaggttg    297060
     gtaggtggcc tcccgcccca gtatgtaagc ccccagcgca gtgattctga aactgttcaa    297120
     cccatcgtaa cggctcaaaa aacgcagttc gtcggcgccc cacatatccc gaaagtcatc    297180
     atgcccctca gtggggtcaa agtaggccac atcgacgatg ccgagcgtgg ctgcatattc    297240
     aaacaatacg gcagccatgt agcggtcttg caaaatgttc catccatggg agccgtcata    297300
     ccccaggcta ccgtattgac gttcgcacaa gtacagcttc caggggtcat gggcgactgc    297360
     aaagacatga tcggctgccc gcatgaaccg tgaaaaatca tccagtcgca cccatcgtcc    297420
     ggtcgggcac gcctgcaatg cctcttcgat cgcagcgcgc cgtgggggca cggcactcat    297480
     cacgcgtgcg gtgctgcttt ggcccttgat ggcatcgacc cggctgaatt catcgagcag    297540
     cgtggttttg agccacttgc gccacagcgt gcgcagcacg tctgcaggag acgcgctcag    297600
     ggctttgacg ccgctcgggc tcagagccag gcgcgtgccg gtgcgcagcg ccaagccaga    297660
     ggcttggagc agcataggcc aggcaaaggc tttgatcggg ccaatcgtct gatcccactt    297720
     gtctgttttc tccaccacag ggtagaagtc gccgccgaca agtctttcgg ccagtagctt    297780
     gagtgtgctg ctgccgggca gcgccgtctt ctcgctgacg gttatgcggg cctgttcaag    297840
     ggtgcgcagc atgaccacca cttcgtgcaa ggcttcacgc tcggtcaggc gctctgtcag    297900
     ccctgcaccc gttggcggag tttcggagct atctaaccgc acattgggcg gttttggcac    297960
     aaacgcaagc aagctcgccc gcagatcagc aggtacgaaa tacagtcgct ccttgaatgc    298020
     atagtggatg aacaatgcca gggccgattt tttttggctg gaatagcggg acgactttgc    298080
     cccagccact tcaaacgagg ggtcaccttg gtacttggct cgaaagcgct gcggcgaaaa    298140
     ctctccctgc ggatggtgaa cggcctcggc tacggcggca gcctgcaggg tgtctagctt    298200
     caaccaaatg gactgcaact ttgcgccctt catcgcgtcg gctattcgct cgatcaactc    298260
     gtctttgcgg ccggcggcct cggcttgcgg cacgtagcgg attaaatcct tcaagtcggc    298320
     aacgaccaaa ctttgcagcg cttctttgag catgatgggc atagctacgt ccttgggaca    298380
     ataggtgatg gacaggttgg gagactggct tggcgcccca gtgacactgg caagccggta    298440
     gctcattggc ggtcagagcg gtaccctatt ttgtcaggtg cctggctaac ttccgcaagg    298500
     aaaccgttgc ccaaaggaaa ttccatgcac gtgaaagttg aaggtcagca atggagaaag    298560
     ttgtagaccg ggaacgcagc gggagcgggt attcgcagaa atttggtgag cgtcaggttt    298620
     cggccaagag cggactgtcg agcaaccgcc agtggcggtc cactcagact gcaagctgac    298680
     atttgaaaag tgctatcgac atcagccgac cgctaagcga cggttgtggc tggctgaccg    298740
     attcgccccc tcaagcctcc tttttgatgc ggcgacggaa ctcttgctgc gccgcctcgg    298800
     gcatttcccg ataaatcgtc aggagtgcct caactaggct aaatgcgccc ttgaactcct    298860
     cgtcagcgcc gctgaggccc tccctgcaaa tcgaaaaacg tgcaagcgag cttggctgct    298920
     tgccaaatga agccagaaaa tcgtgcagtt tgtcattgag ctcatcgtaa agagggccag    298980
     aactgacctc aacgaaccag ggctttagag cgtcttccgt tttgcgacca tccaactgga    299040
     cgatgttggt ggcgtacgcc ttagccgtca agccgacata cccgacaaat ttgctgggtc    299100
     cgaaaatcca cttgccgttg gcctttacgg cataccacgc cctaaagtgg gaaagggtgt    299160
     tgaccaggtc attgtttttg ccggtggttt cgagctcctt ttggaaggtg cggatgttct    299220
     gcagaacctg ctcctgcttg gtgacgacgc gaatgtgggg catgacgttt ccattaaatg    299280
     gttagatttc agtttgactc agttcgacca attcaccgat tcgatgagtc aatgtattca    299340
     ttgtatcggt taatacaaag tatacatgaa taaaattgac tgatgacatt tggaaaaaag    299400
     acgcatgagg ctgaacactt ctggtgtatc caagagtcgg tctgctgacg ggggagaccg    299460
     ctcacggcca caactggcct ctggtgaatg ccgggtatgc ggcgctccaa gttagccttt    299520
     ggctcgttgg gatgcgagcc tggcagctaa gcggtaggtc taggctggtc tctgtcatcc    299580
     gcgcccgacc gacggaatgg ctattgctgc tattgcagtc gttccacggc ggcagccttg    299640
     attgggaatt atcgtgacca gactgccaga acgttgggct acctcgccgc ggactgccgc    299700
     tctggaattg ggttatttga gtgtcccaga caagaaggag tgggcctggc tttcttgcgt    299760
     ccgcaggtca aggtgacgcc tgctggtacc atcagttcaa catcccagaa tagggttctt    299820
     tcgataaacg aggagtgcga ttttgcgtat ctgtgacgtg gcaacggcat tggcacccct    299880
     gaagcttggg ccgcctgact tggagatgtt gaggcccacc gaagcacgtt acacctgtct    299940
     actattgcag ccgagcggcc ccatattcgc cgggagacag cgcatcggcc agcacgaacc    300000
     ggtcgctgga gccctgaagg cacgtcagtt cctgcaactc gcgctaggaa aacatgcgca    300060
     cttagccgtc actcccgaat acttcttccc ctgggatgcg ctcaaagttg agctactggc    300120
     cggcacacaa ccttcccccg gcaatctctg ggtattgggc tgcgaaagca tcgatgctcc    300180
     agccttggcc aagttccagg cagacgttgg ggatgtctgt gacgtcgttc acgagcccat    300240
     tgcggggctt cctgctgacc gcgccctgtt cgacccggtg gttcacattt tccaggcatc    300300
     ccgcgaagac gggacgttcc ggctggtcgc cctggtgcag ttcaagacgt gcccctcccg    300360
     cgacgacacg ttcttcgagg aaggcctgct caggcgaggc accacggtct acaagttcaa    300420
     gggacaggat ggcacgcttt ccgtctcgac catcatctgc tcagacgcat ttgctctgac    300480
     ggatgcggtg atgccagagc ttgttgaccg gtccacgctc attcatatcc aactcaatcc    300540
     cgacccgcga aacagcgcct accgccaata tcggaagacc acgttcgaga cagacccgag    300600
     tacatcggaa tgccacatcg tctgcctcaa ctgggccggt gctgtcgtcc agcacggcga    300660
     gactgggccc ctagagacct ggccgaaggt tgctggctcg gcttggtatt gccctgactc    300720
     acgttgtaag tccgacgacg aaatcgtgct gcccaatcac gaccttgggc tgtactacgc    300780
     ctacatgcag gagcggcggc atgcgctcct gtttgactat ggcgaagccg ccttcgagct    300840
     tcagattccg aaggtggtaa cccgaggcaa agctgtcctg gcaaacaaga acggaccagg    300900
     tgcggtagag cgctactgct ggaaccctgg ggcgtctgcc tgggctcctg ggactcggcc    300960
     tgttaatgcc gggtttgagg cactgcttcg cggcaacccg gaagcgctgg cggcgctatc    301020
     gcacgcgacc caaaacggct cgcccctgga tacggaacgt cttcttgcgc tcacggttgg    301080
     gagcgccaac ggcatggaga gctggttttc tgcgaaggaa gtcgactcct gccggattgg    301140
     tgcggacgag gtcgtgaagc gcgtgaccgt ggctcaagac aatcatgccg acgccgtcag    301200
     ctttcggtac gctcgcattg agtcggccgc agaacttcgg catctcctcg acacgaaaac    301260
     cgattggcca cctcaactgg ccggagtggc caaggattcg ctgattcatt ggtcggcgaa    301320
     cgacccgcat ttcaacgtca ggacgagcga cgggcgccca agcctcatcg tcaatctggg    301380
     caatgcaccg gagcctcgcc ggctggagaa caccgcgtcg aagtttgtcg aactgctgcg    301440
     aaaagctggc ggccaccaca aagaccggct ctgcatcgtg taccgccgcc tcggtgagct    301500
     gaagttcgct cagttgcctt ccacacggtt tgacgatgcc ctcggtgacg aaaccgacct    301560
     cctagcggtt cagccgcttg aatgagtcag gtaaacacaa tgaccaatat tgagacagta    301620
     cgcacggcct tcggccgcca tttccagcac gttgtcgaga tgggcaacgg agtggtccgg    301680
     ggagaacgcc agcacaacgg caagccctac gcggtcgcct acgtcgacct gtccgatgag    301740
     gtcgtggagc gggcgcacgg ccttcagagc tatcaggaac gcctcatcgg tgctgacttc    301800
     ttctcgtcgg acaacgacct gcggtggaat agctatttgt tcttctgggc agggcccaaa    301860
     tcggcagcga gcgaggagtt tcaacaagcg aagaagctaa ttgagtcaga cagacatttc    301920
     gctcggaaat tcgttctcaa cgaagatgac ttggagcgcc gcttggggca gaagccccag    301980
     gctgttgcaa cgcctgcgac gcaacaaggt gatgctggta ttgcgtgggc cgagctactc    302040
     cgcgcagatt ctctggcaat gctcctggag cagaggccga gaacagcgac tctggagttg    302100
     atagaagctg gcgaagcatt caaggctgac gtaggcgcgc cggccccggc aaaggcttca    302160
     gcaacggacg cgctcgctac tgggatgctg cgcaagcttt cgattcagca attccggcgc    302220
     attcatcaga gcacggagtt tgagtttggc gatgtgaacc tcatcacggc gccgaacggg    302280
     atggggaaga cttccttgct ggaagcaatc gaagccttct attgcggccg agtgcgtcgt    302340
     gaccccgagg ccgtgtttga gggtatttcg ggcgagctag aggcacctga cggccgccgg    302400
     catgccgtca agctcactaa ggttcctgcg acgctgaagg cgcgcaatat ggcttggtac    302460
     ggacggaccg acgtgcatgc ccaggccatc tcgcaaggat tcactcgctt caacttcctt    302520
     gatacggatg cggccttccg cctgtcgtcg gaacaagacc ccgagcagat tcagcttgac    302580
     ctcggccggc tgattgtcgg cccggatacg acgcgtcttt ggacctttct gtccaagctg    302640
     aaggatgacg tcgatacgcg actgaaagca ctggaggggc agcagcctag cgatgagctc    302700
     aatgtcgact tgctggagaa agaggtaagt cgactggaga caaccccgtc tgaatccacc    302760
     agtctgcgcg ttgcgttccg ggaaggcgtt gttcgacttc ggccaaggtg ggtaatccca    302820
     gatgccaata ctcagctgaa cgaacaggaa aagagctcgg ttgccgaact caagagcgcc    302880
     ataaaccgtg ctcttgctgc cgcaccagtc acgccaggca acaaaagcgt ccttcaagag    302940
     caactcgcca agatgaaggc gtccctggcc gaagcgagga ggattcaatc ctcgtatgaa    303000
     gccgctgtac gtgaagcgaa tgccgccgct gagaaccaga aggcgagcaa agaaaatcaa    303060
     cgcttggcgg agttgtggga aaagattctg cttgcaggag tgccggagct ggaaaagcga    303120
     attggtatag cagaacagca ggtacaggcg ttgaggaccg ccttgcctag ctaccgggag    303180
     gatgcgattg ctagctttcc cgagaagtat ttccctctcg cgctgaagga tgccctgtcg    303240
     gacgcgaagc gggaatccga cctggcgcaa gagtcttctc aaactgcatc gcgggcgctg    303300
     tcgcaagcgc aagagctcgg acaaacgttg gtcgctttgc ggcgcgattt gcacgacgcc    303360
     tccgtcgcgg tcatggggca gactggaaat ctgaccgaat gccccgtgtg caagacagtc    303420
     catgccgagc aagaccttgc cgaaaagctg cacgcgctca ttggctctgg cgactcgcaa    303480
     atgtcggcag ggctcaggca acgtgcacaa acggccaagc agaacacaga caccgctcag    303540
     cgtgccctgg aagccctgct gaccctggca aagtggcaac aggccgctgg cctggcagac    303600
     gacttggcat gcaaggactt attcacgcag ctacagcatc agcacgagaa gctgagggcc    303660
     gcgctccttg agttgcaaga ggctcgacaa gctgagaaga cgcttggtgc tacaggaatt    303720
     cgattggatg gctggcagct ggcccgtgca aatgctcaac gaggcttgtc agaaggggtc    303780
     aacgtgaacg acaggacgcg gttgcgccag gcaattgagt ttatggcggt acaaatcggg    303840
     tttaacgtcc tggcgcacgt tctcacagca aaaaagccgc agacgctagc caatgaagcg    303900
     acgatgcttg caatagcaac tggcgcatcc agaggagttc cgatgctgcc gtctcagacg    303960
     gtagtggctg tggaacgctt agtacagcag gccgaagctc gtgttgcggc tgcagcagaa    304020
     gttgaaagag ctattgactg gccggttgat gccgcctatg aaacgctgct gtcggaagtt    304080
     caatcctgcc ttttggcata tgacaaggcc gaccacgcag caacccagga gacagaagcg    304140
     gattcagtcc tcaagcaaaa gctaaaggac ctggccgagg ctagagcccg acaagcgaag    304200
     catgaagcgt ctcgcaagaa cctggcgcgc gctgcagcga cgctatcgaa agtcgtagac    304260
     gagcactctc tcgaaaccgt gacgtccgag gcattgcgcg cgattcgaag caaagtgagc    304320
     gacgtttttt ctcagattca ctcgccgcca gagtacgcct tgggcaactt cgaagatggg    304380
     cagctcatcg tgcgccgcga agacggcgcg acccacgccg tcaatcaggt cagcaccggt    304440
     cagcgtgcgg ccctagcgct ttccatcttc ctggcgctga acgagagcgc cggcactgcc    304500
     ccgcccgtca tactcattga cgacccggtg gcgcatatcg acgacctcaa cgccttgtcg    304560
     ttcctcgact acctgaggga actcgtggtg agtagcagga agcaagtctt cttcgcgact    304620
     gcagacgcga ggttggcggc cttgttccaa cgaaaattcg attttctggg gccaaacaga    304680
     taccggcgaa tcaacctcga cgcccctcag gcaactgcac agtaggccaa cttaagattg    304740
     cctcggaggg acaaaacggc cagttccata cgctgcgcca tctcatcaag cggatggtgg    304800
     agctgaccaa gcccacgtca atcagttggc atcgcatggc gcatgctggc tggctggctg    304860
     gctggctggc tggctggctg gccattccat tgtgggccgt ccgatttgag tggcagcttt    304920
     cggaccattt tcttcgctag ccggattgct gctttgggcc cataacggtc agccagggtt    304980
     tgaggaagca gccgttcaaa ctggcgcatg aaaatctgta agctgacatt cgtagacgct    305040
     gagtaatccc cttcgcctgt acggctcttg tgcagcacga tcacttgccc tgactccccc    305100
     aactcacggt ctctgcacga attcggccac cgagtggact ggtctgccgc agctcgactg    305160
     gccggtatcg tgggaactgc ggacgtagtc ggcagtccct tagcacgtcg ctatctttag    305220
     cgcctctatg accgctgctg gtgcatgacg gcatcggcgt gtgactgaca gcccatcgcc    305280
     tcaacacgtt acggtacatc atcaggatgt cgccatggac caaaaccatg cacctgcagg    305340
     tcaagctgaa actgctctgg atccacgaag cgcaggagtc gaagctgatc gggctgcggc    305400
     agcttcgcat aagcatccat gccaggaagg tttgatggat tccacccgaa gaccgcactt    305460
     cggtagtaca ggtggtccct aagcacttgg tagggcttga tggatgtgcc aacaatagct    305520
     ggtcgcttcc tttccaactc cttcagcttg gcgcaagcct cacgggattt ggcgatcagg    305580
     ttctccagac ttgtatcaaa gcgctgcaga ggattgcaga tcgtggacac acctagtgcg    305640
     caagtaacgt cgtggaagaa ggccacgcac cccatcaagt gcgagtcata gaagcttggc    305700
     ttggggcggt gggaccaatc cgagaatggg gtcggaatgg catcgatgca taactcaatc    305760
     aactgcggca tgttttcaat gcgcacgcgc atcaggggat tcagcgcctc gaacgtgaac    305820
     ggcccaggcc cagcgagtcg cagcgctatc aggatgcttg cagcgtccgc agcgattttg    305880
     ccaagttgtc ggctgtcggc tctcgcgaca accttctgta agcactgctc ggccaattca    305940
     ttgcggccat ggcgaaggtg ccagcgcccc tccgcgtagt caatgacgaa cattaacaag    306000
     cccgaggggg cgaccgcgcg cgaatccgca cgcaacttgt cgaaattcgc ttcatccaga    306060
     tcgttcacct gagcgccaag ttggtcgtac tcctttgata gagccaaata agggtcgagg    306120
     tagccccagt acatgcggat gcggctgtgt tgtgcctcat ccgggaagtc gccgttcctg    306180
     tccaggcctg caagcagctt accgacaacc agcgcgagaa tatcttgctc tggaatgatc    306240
     tcagcagcca tggcgcacag ccgcatcgtt gccatgccgg cgaggtacaa cccgcgcacc    306300
     gcgtcaaccg cagcatcaag ctcttgcgga gaggagaaac cgctctgcat ttcaacgcgc    306360
     aggttggcga ggtcctgctc gatggacgaa tgtttgcgct gagaacgctg atctagtctg    306420
     gcaagcgtcg agcgaaactc acgcgcgttg atgcccttcg gaattgctcg cctgaccgca    306480
     gccttccagg tggccagata acttgtggtc tcaccagtga gcgaagctgc atgcacttca    306540
     agcagtagcc gagcgctctc cagcaccgat ccagtctgtt ggcgggcatc agaaagcatc    306600
     tgagcaatcc acggggccac ccagacttcg ataaagcgct gcagcccttc tgtttccgtc    306660
     gcctcggtga ccagtgggag agccctggca ttggtcaact ccgtttcggc gtcgagcagc    306720
     catacttgga caaggctccg gagcgcttcg tccgagcctg cgagcagatc caagagcagg    306780
     tcttgcaggc cagcgcggtg aagcgagccg ctataggcat cgatccggcc gccaaacgag    306840
     ccgaggtcgg cgagtgcatc ctctttgttc cgtgcgatcc caaggccaga ggccaggccg    306900
     tcaatgacgg cggagaaggt aggcaagcgt gcgtagactg atggcgggtg ggtgagcatc    306960
     ggtttccgtg atttccggtg gagcaggatg gtgccagcgg cgatgatcgc gttgccgacg    307020
     ccaagattgt cggcgattaa cttaaaggaa cctcacatga aagaacggac gcttcgcccc    307080
     atgcttgcga tgagcctcga ctggcaccta acccgggccc tcgaacaaaa cgatttctca    307140
     gcggtcagcg acaagctgcg cgatcagctg atcgaacgcg ggatgccacc caggaaggcg    307200
     gcgatcaatg cgccagtcat gctggatggc atggacaggg cgctccaggg cgagtttgac    307260
     tttaagcgca tccgcaacga gctgtgcgct gagcggcgca gccgcgacgc ggccagcccg    307320
     ctcacgccgg ccgctggcta acgcaggtcg ctatacggcg tacagggttc gcatagggcg    307380
     ctgcggccca tccggaaacg tagagctggc gagcccttca aggagggctt gctggatgct    307440
     ttccctgact ggtcggtcgt gctcggatcg tagtcaaagc acgtcgagaa actgttctct    307500
     gctaacacag cagtcataca tgccgctgta tgtcgaatgt cctgtgatgg acttcagttc    307560
     gactactttg tctttgtcga aattgccttg ccttgccttg ccttgccttg ataatttacg    307620
     tcttgaaaca cgttgcgaca acctgtttat gatcccttgg ggcgcatgac agaaccatct    307680
     tgaaaaacca atttatttat gaaccagcaa caaggcaaag aagcctttga tcaaagcttt    307740
     tctcagatcg ttggcgcatg gaatcagatg cagggcgacg cgctaaactc agcgctggac    307800
     gcctacagtc agggcatcaa agattccatc tccaatggct cgggcggttt cactaaccag    307860
     tccatagatg tgcagcaggg cttcgtagcc gaagcgcacc tcgttggctc cttcaacgta    307920
     gaggcatcag taaaggggtt aaacaatcac cgcgccacgc gcaacagtgg ggtgcacaac    307980
     gatcccgtgg ctgatgcagt tgtaaccacc cccgatgggg cgaccaccac gcaccagatg    308040
     aagttttaca aggacggcca aaagacttct gcggctttat cgccggagcg gtacgacacg    308100
     gtcgacagca agatcgtgcc gtccgaccaa gtccttgacg tgaaggcttc ggcctccaag    308160
     caagctgcgc gtaaccaaga cattcgtccg ggcgtctcta aaagcaacca gcacacagtc    308220
     gacacggcca cagacaagct cgcatccaag gatggcaagg tttccagtac aggcctcaag    308280
     cgcaaaggcg atggcagtgc agaggaactt accaagagga ccaaggaaaa caacgaaggg    308340
     gcagagtacg gcgagaaggc ccgcgtgcgc cgcgagttca actcgatgca gtaccgcaac    308400
     gcggccaagg gtggagccat tgctggcgct gccagtgagg gcgtgagcat cctgattgac    308460
     atcctgcgca gtgacaagcc aatgacgttg gatgactgca tggatgcagc cacgcgtctt    308520
     gtggccagcg ccgcaaaggg tgcaggcaac gcgctgctca tcaccggcat tcagcatgcc    308580
     ggccaggcca tggtcgacgc ggctaaaaac caaggcacta aggctgtgga ccaggcaatg    308640
     ggcaagcatt tggttaaggg caacgtggca gcagctgtga cacagatcac agttcagcta    308700
     gcgcaaaacc tatatcgttt ctcccaaggg gagatcgaca acctgcagct cgcttcggcc    308760
     acggttggca gcacgatgca aatcgtgggc ggctccttgt catacacagc aggcgctgct    308820
     gtgggtacat ggctgggggc aagcgttccc gcagcgatct ctggctatgc gattgcaggc    308880
     accacttttg gcgctgtggg cgtgatggcc agcggcatgg tgtttggtat cgggtttgcg    308940
     ctcgctgccg gcgcgtatgt caatcacttc tccaccgagg gcagaacgct tgcaaccaat    309000
     cagctgaact ccgcactgga acagctcaac ggcggcaaga tcgacatgag ctcctacgtg    309060
     ggcaaggttg ccacgatgtc ggagatgacg ttccagtgga gcgacttgct gccattcagc    309120
     ggcgcaatct ctgtgctcgc tgagtacggt caacgcaaga accagctgca ggctacacgt    309180
     agccacatcg agtccatgat cgatgcactt ccagcgcaag agcaggcaat catgcaagag    309240
     ctgaccgacc agtaccgcaa ggccatccag cacgtggatc agcagtacat ggaagcccgc    309300
     gccagcatta ccaagcaggc tttagaccag tttgacacct tgagcgaaca gctcaacgag    309360
     cacctagagc aaaagttctt gctctttgag ccaattcgta agtcatacat cgagcagtcc    309420
     aagctgatgg acttggaagt gcgcaaagca caagaggacg acgagcgagc caaggtctac    309480
     aggagcgagc ttttggacct gcaaaccaag ctcaacacat tcaccacctc cgacaaagct    309540
     gaccgagccc tcaaggaaaa cctccgggag accatcgtgg tccgcctgga gatgctcatc    309600
     ccgcacaaga cgggctggga tgaggcttgc gaattccttg aactgcagta agagatacag    309660
     atcatgttgt tgaaatggat tgcccataca tgggctagct cgaacctgcg caaagaagaa    309720
     gcacgcactc agcgtctttt gagccagtac gacagtgaga aagctgcgtc cgatcgccgc    309780
     attgccgccc gcaagagcga ctaccagcgc aagatcaaag agcgtcaaga gatgcgcaac    309840
     agtgagctgg aggaatacat ccaattcatg aacagccgtc tgcaagccgc ttcgaattac    309900
     atgccgaagc tcgatcagtt ccagactttc acgttcacct gtgtggattc gtggatgaaa    309960
     gtggacttga tccagcagga aatcgacatc tacaagaaga agattgaagc gatcttcacc    310020
     accataggtt tgatcgacgc gtacatcagc gagctgacca aactgtccca gcgccagggc    310080
     cgtcacgtct ggcgtgaaat gacctcgaca cgcccgttga ccgtctccaa cacctacgtg    310140
     gacaagacca agcgcaacgt cgaccgaggc tcaaagctca gtaatgacga gttccgcaat    310200
     gaactcaagc gcctgcaaag ccaccgcgaa gccttgtaca aagaggccaa ggagctgatc    310260
     gaccagcgca agggcttgca cttcagcaag gacgaagtgg agctggtgca caacgccaac    310320
     aagcaaacct tggaaaccat gtacaacgaa tacagtgacc aatggaaaga aatcctcaag    310380
     ggtttcgagt cgtactacgc caacaccaag acggagcacg actacgtcaa ccagtggatg    310440
     agccccctca aggatggcgg cacgctcaag gaaatcaccg tagtgatcaa cacctcgcac    310500
     gagatcatca agtgcgcaca agagaagtac gacttgatca aggatgactt tgagtcatat    310560
     cgggagatta tcaagaacgc ccgtaactcc aacgactatc catccaacta ctcgacgatc    310620
     aaggccaact acgacaagtt gctgccaatt gccaaggacc ggggtgccct gatggcttca    310680
     cgaggcttct tgtacggacg acgcgacgag ctgcgaggct acatcgacaa actcaagcgc    310740
     ctgcacccag acgaagtgct ggacaccctc tacgcgttac tgagcgaaga gcgtgaggtc    310800
     aacacatggc aggcctttgg catcaacaca tacaagcagc gcgtcgcgta ccgcgacaaa    310860
     caaaagggag ttcaacgtgc agcaaattga gatgcagttt cagtggaagc gacacgaaat    310920
     gaaggaagtc atcgttgctg tgaccaaggc agtcatcctt ggctacaaca ccaaggacaa    310980
     gctcttggca gcgctgccca tgttctctac ctaccggatc gccctggcca tcgatgcgtt    311040
     gatcaccgcc gatatggcgg agaacaacct tggcgtgctt tgcatccacc cagacatgca    311100
     gatcgtgctc gagctgctca agcgcaagtt tgtgctgccc atgtctgaag aacaggccaa    311160
     gtcgcctgca gttcgccgct acgtgatcaa ccaactggga gccacaaacc ctgcgggcgt    311220
     tgaaacactc ctacgcgtca acccagtttc agtggaggcc taaatgggtg cacgtcattc    311280
     ctacatgcac aacggaaccg aagttgcatt cgacttcgtg gatcacatcg accactggct    311340
     ggagtacctg acagaacttt taagcactgc cgacagcaaa tccaagccca aggtcgagcg    311400
     ccagatccgc tatctgctgg agttccgcgc cggcacgaac tgcaacatca accacaaccg    311460
     cctgctgctg tactactaca gccaccgcgc caagaaggcg ggcaacgaca tctctttgcc    311520
     tggagaagat ctgtccggtg acaatatcag catgacgaaa ggcaatggcg atgcccaggc    311580
     caagatcgac gctttcattg ctgagtttcg gactcgcgaa ggttcgacct ccatgtcgat    311640
     ccacccaagc aagcccatcc aaagcgagta cgagcccacc gatccagcct tcaagctgat    311700
     cctcaaggct ttggccagcg aagatatgtt cttcatacag ggcccaccgg gcaccggcaa    311760
     gacaacggct atcgtcgaga ttatcctgca ggtgctcaag tccaagccca atgcccgcat    311820
     tctggtgtgc tctgaaacgc acgtggccgt ggacaacgcg ctagaccgac tggccaagca    311880
     gtcgcgcccc gagctgatgg actcgatcct gcgctaccct ggcttcgcca tcacggagtt    311940
     tgagtgcgac agaacgcccg aggcagacgc tatatcgcga gcagaggcta tctggcaaaa    312000
     ggcctatggc gcggcaccag agctgaccaa ggatctatgg gaaacattgg aggcatccaa    312060
     gacccatgac gacgacatca aggtatcgcg ctggcaaggc cgcaacctgg cagacatgca    312120
     ccaggtggta ggggtgacct gcaaccagat cgaccatttg atcgacagcg acacccagat    312180
     gtacgacctg gcgatcgtgg acgaatgctc caaggccact atgcccgaat ggctcatggc    312240
     catgtgcgta gccaagaaat gcgtgctggt cggtgaccac aagcagctgc cacctacgtt    312300
     ctgttcggaa gaagccgaag tgctggaaca gatggacgag cgcaaggaac gcctgatccg    312360
     taatggtgtg atcgagcgcc tgttcgagaa cctgcctacc gagctgaaag gcacgctggg    312420
     caagcagttc cgcatgctgc cgcacattgg gcacttcatc tccacccact tttacaacgg    312480
     gcaactggag caccaccgca cgacgacaac ccacgaattt caggactttg gctggtttac    312540
     gtacaagtcc ggcggcatgc gcgtgcctga gcagcagggc caagaaaaga agatattaat    312600
     caacaatctg gagctcaaga tcatcatggc tcgactggcc gagatccgcg tccgtctcaa    312660
     gcaagccaaa accaagcgca aggtcagcgt tgcggtgatc accccgtacc gcgcccagtg    312720
     caaggcattg aaaactgcgc tcgcaaagta cgacttcagc gaccaactgg ccgtggaagt    312780
     cgacaccgtg gacgcgttcc aaggacgcca agccgacatc gtttttttct cgttcgtgag    312840
     aaataccggg cccgcaacgt tctacgctga cgaccgccgt ataaacgtgg ccatttcccg    312900
     tgcacgtgat gccgtctact tagtgggcga catcgactac atacgcagta agcgtctgcc    312960
     agtgctcgat gcactggcca agcttgacgt gctgatcttg catcgcaagg aagatgtctg    313020
     atttgctcag gagccgacca aggccgtatt ccacttttca aatctgagtg accggtattg    313080
     agaattcggt tttcccaatg accggtatca ggcacataac tccaatgcct gctcctggtc    313140
     ggttgcgggt gccgcagtca tcgaaatcgt cgccacattg ctgacagtca agttgctggt    313200
     tccaatgtcg ggtctgaagc aagcagtttc gattcgtcta cagccgcaat cagtcttttg    313260
     aagatattcc ggatagatac tcaaagaccg ctaccagttt ggcttttctc aaaaagcact    313320
     ttcgttcgaa ctgccgcacc gccctgaagc tccttgccag gcgcggccgc accgccacgg    313380
     cgctgcatca cacctgctca atgccggcga gctgccacac ggctgggctg ctgcggggca    313440
     gcacgaaatg ccagacctcg tcgatgggct cgggcggatt gacgccttcg gtgacctcgc    313500
     ccgtgtagcg aacgctggcc accgtttggt gcggctcctc ggtgacgtcc tgcacactcg    313560
     cattgagcac caggatgcgc aagggcggcg agcccatgct gccctccagt tcggcgaaca    313620
     tgcctggcgt cgtgacccgg cgcaacgcct ccttgttgcc cgtgctgttg aagtcctgca    313680
     atgaccggaa ggcttcgagc ggcgccaggc cggcgggcgc gggcaggttg attgaaccgt    313740
     tggctgaatc aatcagcgat ggcgccggag gaaacgcagg ggcattgcca aagccttgcc    313800
     cgccatagcc gccctgggtg gagtgcatat ttcagtccat cgtggacggt gtttcaggct    313860
     gatcgtggac gcgatttcag cgtgatcgtg gacggcattt caaattgatc gtggacgctg    313920
     tttcaaactg atcgtggacg atattttggg gggatacggg caagtgattt cttaaacccg    313980
     gcataggctc gacgcttttt cgcgaaagag tccatgccaa ccaacagaat caccatgcgc    314040
     caaatccgag aatccctgcg cctgcacctg caggccaacc tgagctacaa cgaggtaggc    314100
     cgtaacctca agatatccaa aagcgtagtc ggcaaataca tgtcactggc gcgtgtggcc    314160
     ggtgttgact ggtccgttgc acaaaccttg agcgaccaag agctggaggc caagctgtac    314220
     aaggcagcgt taccgcgcaa cagcaaacaa gcactgcctg actttgccca gatacacact    314280
     gagctcaaac gcgccggtgt caccctgcaa ctgctgtggg aggaatacgc caagggcaac    314340
     gacctggcct tcaagtacac cagcttttgc gtcaaatacc gggagtgggc catggggctg    314400
     aagcgctcca tgcgccagac ccatattgcc ggtgagaaac tctttgttga ctacgccggt    314460
     caaaccgtcc cgctgattga tgccggcacc ggcgaaatca ccaaggcaca gatatttgtg    314520
     gccacccttg gcgcctccaa ctacaccttc gcctgtgcca cggcgcgcca gaccacagcc    314580
     gactggattg gcgcccaggt gctggcattg gagtatttcg gtggtgtgcc acgcctgatc    314640
     gtgccagacc aaacccgctc cctgatcaaa aacccgtgca gctacgaccc gcagaacaac    314700
     cgtctgtatg aagaattcgc cgcccactac ggttgtgccc tgctggcagc aaggccggct    314760
     caccccagag acaagcccaa agtcgagaac gccgtcctgg tcgttgaacg ctggatactg    314820
     gcacgcctgc gtaatcgcaa gttcttcagt ctcatggagc tcaaccacgc cattgcgctg    314880
     ctcctgaacg atttgaacca gcgcgccttc aaaaagctgc ccggcaacag gcgcagtgcc    314940
     tttgagcagc ttgatgctcc agccctgcgt ccactgccgg ccaaacgctt tgagttattc    315000
     cgctggaaat cggccaaggt caatgtcgac taccacgtgg aatttgacgg ccattactac    315060
     agcgtgcccc acaccctggt gcgcaccacc gtggaactgc gcgccagtga caccttgctg    315120
     gaatgttatt cctccaacca gcgcgtggct tgccacgctg tcagccccaa gcgcggtgcc    315180
     cacaccacca cgcctgagca tatgcctgcg tcgcaccggg cgcatctgga gtggaccccg    315240
     caaaagctca tcgactgggg cctgcgcatt ggcgtgagca ccgcagcggt ggtgacctgg    315300
     cagcttgaac accgcgccca tcctgaacag ggctaccggg cttgtttggg cttgcagcgc    315360
     ttggcacgcg aattcacgcc ggccaggctg gaggcggcct gcacccgagc actggccatt    315420
     cgctccctta cctaccgcag cgtggcctcc attctcaaaa caggcttgga tcgtcagcaa    315480
     aacctgccca ccatgacacc gggcgcgctc ccggcgcacg acaacatccg tggcgcagat    315540
     tatttccact gaacacacgc ctacccaaca aaccaaacac gacaggacag accatgaacg    315600
     aacagaccct tacccaatta cgcagcctgc gcctggatgg catggtgcgc gccattgaag    315660
     agcaagccac cagcatcgcg gtcagcgccc tgggttttga tgaaagattc tccctgctgg    315720
     tgcagcgcga ggtggcatgg cgcgatgagc gccgggtcga gcgtctgctt aaagccgcca    315780
     aactcaaagt gagctcagcc tgtgtcgaag atatcaattg gcgcgccagt cgcgcacttg    315840
     atcgcgccct ggtgactgcc ttggccgggg gtgattggct tcgcaatgcg cagaatctgc    315900
     tgatcaccgg tgccaccggt tgtggcaaga cctggctggc gtgtgccttg gcgcatcaag    315960
     ccgctcgctt aggcttctcg gtgctgtacg tgcgcgccgg gcggctcttt gatgaactgc    316020
     atgtcgccca tggtgatggc agccttaatc ggcgaatgag tcaactggcc aagcttgatt    316080
     tactggtgat tgatgacttt gccatttctc caatgggcgc gcccgagaga aacgatttgc    316140
     tggaggtgct cgatgatcgg gtgggcacgc gctcgacgtt gatcaccagt caattgccgg    316200
     taaaagcctg gcatacctat ctggacgatc caacgctggc cgatgccatt ctcgatcgtg    316260
     tcgtgcacag cagccaccgg attgatctca agggcgccac gctgcgagat ccgaatacaa    316320
     attgattgcc ttgcccactc aacaccgtcg ggcgtcaact tggtaatgca tgggtacatg    316380
     cacaaccggg gggcctgccg gcggccctgg caggggccta agaaattaga aattccagac    316440
     acaggaaacc agaaggcaga cttcaggaat caaaagccat cgcttcgcgc ctgcccatgg    316500
     cgcgctggca ttgcgatgtt tgagatacat taattcctcg cttgcgcgca tccctgcgcg    316560
     tccacgatgg cgctgaaaca tcgtccacga tcagtttgaa acaggcgtcc acgatcgctg    316620
     aaatacgcag gtggagcgca ccaaggtgcc cgaacggtat ttcctccaga cgaaaaatgc    316680
     cgcgctggcc aaaagcagca ccagcaagag gccggtcaag ccgcccagac ccgacgagcc    316740
     aggggctgcg gcaagcgcgc cgcccgctgc gtttgaattg aatccggcat tgccgtcgct    316800
     gccattgccg ttgttgttgg cagcgctgtt gcccgcgccg tggttgctca gggcgtagcc    316860
     ggccagtgcg ccgacagcgg cgccggccag ggcgggcttg acccagccgg gcgttccggg    316920
     cgcgggcgcc acgggcgcga caggcgccgg ggcggcttgc tgcacgggcg cgatgggccg    316980
     cacaggcgcg gcgggcggcg gggtgcgggt cgcctgcatg acctggggcc gctgcatgcc    317040
     caccgactgg cccgacccca ggcggccggg actttggtac tgcgcgcccg agggggcagg    317100
     gcgggcgccg gcgggcgcgg ggcgggggct ccccaggcgg gcgttggcca gcggcatttg    317160
     ccccatcagg agcgcaaagc aggtgagcga ggcagtcagt tttcgggtgg cggttttcat    317220
     caaggtttcc tttgggcaat tgcagccgtg ttcaatgcgt gtagatgcgg cttgaaaagc    317280
     cggctgcaag actgagggta acgcaaccaa tgccgcgagc aaggaagctg caagccgggc    317340
     aggactctct ggcaatgcat gcgcggcgac cgcttgatag cctgtttttt taaggggcgg    317400
     cacacttgcg caacgcaatt gcaacgaacg gactggctat tgccagcggg gccagatacg    317460
     tcgagacaac gcctcggccg ataagcgtgg cttccagcag ccaggcaatg gtgattccaa    317520
     ggccaaggcc cagcacaaag ccagaggcga tggtattttt catgcgtcaa tcaatcaggc    317580
     gattgctgca actcaggcca actgcagccg cctgttgagc acggctcgct tgacatgaac    317640
     catgtcgtcc aatatggcat atgaaaccag cagccccacc gaaatcagtg tttcgagtga    317700
     cttgcgcagg cgcgcgcgaa agttgctgag gtctttttcc tccgacaggc actgctcgcg    317760
     cagtttggag acggagtagg ggatgggctc gcggtggctc gaataaaaca tgtgcagcca    317820
     cagcgtcaag gccgccttgc tgccgatctg ccggcgttgc gcccactcga cgagcgtggt    317880
     gttctcgtgc aggaacaagc tggcaatggg gggctcaaga cgcacgacaa agctgctttt    317940
     gcccgcttcg tcgaggccat cgaaaaggaa gtcccggatc aacgagcccg cgtagcccga    318000
     ccgctcgttc ctcagcgtga ttttgatgct ggtgaccttg agccggtcga tcgagttgcg    318060
     cagcctcgcg tagctgtccg aatgcatgcg ccagttcatg tccttgatga tggcataggc    318120
     cgtgaaatag atcggctcgc caagcacgcg gttgcggccc agatgaacga tggccagcca    318180
     gacggaaagg tcatcctggc gcaactcctc gcccgtgtac aggatgtccg cattcgacag    318240
     cgatgcgatt tttgcggact tgaacgacag ccgcgccttg gaggttcggg tgctgaaaag    318300
     accgccccga atcaaggggt tgggcacccc gcgcctgtct tcgtcccact tgctgaacgc    318360
     gagctgcagc acgggttgca cggggttggc gggcgcggct ggcggctcgg gctggccaag    318420
     tgtttgcagc gcggcctggg ttttttgcct taagaattcc gcgcttttcg ggctcagcgg    318480
     tttgatctcc cgaacgcttc tggcgccgag gctgccctgg gcctggccat tggcagccgt    318540
     ttgcgggtct gccgggaata gatcgctgat gtgttgcatg gtgatttgat ttgggtgcaa    318600
     gtttcatggc gcaaccctgc gcatgtcaag acgcgctatt agcgtttcag gtgtgcgttt    318660
     catgccacag ctggcgttcg ccgcctcctg atcgaccggt tcccgatccc gcttgcgcgt    318720
     ccgttttgct ggttcggcct ggattagaaa gaagagatta agaaagaaag attaatacgg    318780
     ggattagcaa agggcgcaaa gcctttgccg gcgcggcctg cagcccgatc atggcatgtg    318840
     aaacgctaat agcgaagcct gcgtgccgct aatagcgttc cgcatggaga gctattagcg    318900
     tttcacagtc tgcgctagca gtgccctata tgcgccgcta ttagcgtttc acatggaccg    318960
     ctaatagcgt ttcgcatggg ttgatgtaaa gcttaaagcc tggaatttcc gccggagcgg    319020
     ggctttcgcg ccaacaggcc gggaaagcac catcaaaatg gtccaaacac ggcaagactt    319080
     cagctagatg cccgaggcat gcgatgtttt tgcgttgccg ggtcctggtc ggggtgcgtt    319140
     tgactttacc gggggcatcg caaggcacat acatgccgaa ataacgcccc ttcaatcgaa    319200
     aaacacgctt tttccgttcg cattcgggct gtgcgaagga gcgagcaggc gtattagcgt    319260
     ttcacatggg ttgaggcagg cggcaatcat ttgcgcgcat agccaagcca aggataagca    319320
     tgggactgga ggaaagcgca tggcaaccca tggcacggtg gaggatcagg accggcttgt    319380
     catcaaaaat ggctgcgttg tcttcccgga tggcaaggat gccgatctat gcgcgtattt    319440
     cctgcagtgg cgcaatcgcc aggctgatgc tttcgggctg cttcatgcgc cgaaggatcg    319500
     cctggagacg gtcaaggccg ccattgttgc cgcaggcggt gtggtgatgg ggctgaccac    319560
     cggtcggtgt ttgccttcgc ctgtaagtcc gcaccctgat gccacgtcac aggcacagcc    319620
     ggccggtgag gtttcttccg gcctcggtcg cttcccggca cagatcctcg ccttgcgtga    319680
     catagccggc cttgtgcagc gcctgcatgg tggccagggt gcaaaccttt tgcccattga    319740
     ccagcacgga tgagccagcc cccagttcac atgcttcctt gatcaacttg gtcatggtct    319800
     attgcttgcc agacatacag caagggcacc acagcccttt acttggactg cacagcgcag    319860
     gcttgccaca atgtgggcat ggcgttcctg ttgatccgat atgcatgttt tcctatgaga    319920
     ttgagggtat gcggtcaatt gaaatatggt gttggtggca tctgataccc caccccttgg    319980
     ggcggggttc ttcatgcggt accacacgcc atccagactc gtagcaacag cgcgctcgcc    320040
     agcatgcgcc gtacttcagc aaccagtttt cgtgaactgc tgtgcatcac tgcgatgcgt    320100
     tcccaccagc tgcggcctgc ctcaacgcat cctcctctgc catggcgctt tgaatccagg    320160
     caacgtgctg ggtgtcttcg atgaaccaga gcccacggcc agcgttccac accaagccgt    320220
     ccttgcgcag tcgctccaac gcggcctgaa ccgcagactg ggaaggtgca ggctgttcag    320280
     ccgggccgta atcttgaaga aggcgcttgt aatgctctaa tgccttggta tcaaaagggg    320340
     tgaaggcttt tccggtttgt gccatgcgcc gcatgactgc tgcatccaaa ggctcaagtc    320400
     catgcaaacc ctgaatgaaa ttgtttcgca gaccctgcag ggcatcaatc atgagaagtt    320460
     ctaggcgagc gtcgagctcg gctacgtcca taccgccttt tttgtaaaga tcgcgcatca    320520
     ctttcttcaa cggttccggt cgccggctgc acatctcaaa aacacgtttg agagcagcca    320580
     gcgatggctt ggctgctttc tgcgagttgt cgagcaacca ttgcaaataa tcatcaccca    320640
     gttgatcgag ttcctccatg ggcgccatga aaaacgcctg atccttggcg ctgaccagta    320700
     cggccagcct gtcactgttc gagcccgtgg caatcaagcg aaaacccggc cctgcgcccc    320760
     tgagcgcatc gcgagctgct ttgagggcaa agagcgtttg gcgaccctcc tccgtggtct    320820
     gtgcatgctg ggcctcgtca atcaccatga tgatcggctt ttgcgttgct gcactgagcc    320880
     tttgcaatgt agtggagatg ctctcgcctt ccttcgagcc gatcttggcc agatccattt    320940
     caaagccagc aagtttgaac cggctgagtc ctgcggactt ggcagctttc aggacagccc    321000
     catcgcatgc caggatcgac tcacggatgg cattgatgat cacgatcgat ggattgatag    321060
     acctgtcttc ccagaggtcg gcatagatga cggtagcgcc ttccaaacgt atgcgcggta    321120
     ccaggtcttc cttgatgaag gtggttttgc cggttcgtcg gggagctgcc aagaacacac    321180
     ctgacgatga ctcgggtgat ttcaaatact ccaggtaata ctctgtgagt tcttttcgat    321240
     gaaatatcgg atcgtcgagc agctgcattt agggatatcc atatctgagt tctgcgatca    321300
     attatgacaa attattttaa ttatgcaaat tatgcggatt acccatgaat ggtcatggcc    321360
     tagccagtcg atgttgtgct gaccatggct tgatcgagta cgccaatgcg tcgggcttgc    321420
     cgcttgttca ttgggcagtt ggcgcgtggc gactcgattc aaggccctgg ccgaagtcgc    321480
     ggttcagcct ggcaaggggg atgggccgca cgccggcgca ggccagccgg gccgcgctgc    321540
     cggcgtcgcc gcgaagcgct gagccgatga agagcgtcgc cacgcgcgca tcgagcgctg    321600
     ccgcttgcgc ggtgccgtgg tcagccgaat ggctggcgcc cgagcggctg atgaccggca    321660
     tcacggtgcg ccgcgcgagc cgggcgcatt ggccggcatc ggcgccgggc agcgttgccc    321720
     gccaggggtg cttgccgttg tgccgctcgt cggtgaacca gacgcaaaag gtggcgcgtc    321780
     cccatttgtc cttttcggca aagagcacat gggcatcggc gaaatcgggc gggccggcgt    321840
     ctgcgttgcg ctcggcgggg ctgagcgaga gcctggccac gaatgcggcc ggggtgatgg    321900
     ccttcacggc aatgggcgtg ccgggcagca catcgcacac atcgagcggc gagatcagcg    321960
     ccccgtagcc gccgggcgag cgcacttcga gctgctggcc gaccaggcgc tggaaataga    322020
     accatggcag ctcgaacggc tggtccgcga acttagaaaa ggcccgcgcc tcgccgatct    322080
     catggcggga gttgatcagc acccggtcca gcgggcgaag cccgagaatg gaggcaaggc    322140
     agcagttcag gtttgtaggg tccatggcgg tgcaagatga gctaaaaagc cagcttagat    322200
     acaaaagggc agggtgcaag cgccgttgcc ggccctgcgc ttggggaaac taactttccg    322260
     actgcacggg cggcacctgg gaatttcacg gtccttgcgt gccagacgct ttgtctttcg    322320
     gtgcgccgta ttcctctcgg tgcacctgat gctccggccc atcggcgaca aggcccatcg    322380
     cgtccagcac cgagcgcctg tacgtgttcg gacaccgcga gccctcggca atctcccgaa    322440
     acacgatgag cacgaggtct tcgaccgtct cgatggtccg gggcgctccg cgcttttggt    322500
     gcagcgcaag gatgtactga aattcttcga ggtattccgg atcgatggtg atttgcatgg    322560
     ctggcaatct ctttcaaagg gtcaggcgct cagcagggcg ccagtgggtc ggcgtgccgc    322620
     ccgagggcag gatgcggccg ccgcaaaacc gacgggactc gatccaggcg ttgcagccaa    322680
     agccgtcgtg aaacggattg gtgatttctt cgagttgata aagcacctcg accgacacgt    322740
     catcagcggg cttgccttcg ctcaagggcg tccaggatgc atcggccgca ggcgcctcgc    322800
     ccgcagcctg gcccacgccc atgagcgcca tgcgccggcg gcgcaggctg gccagcatca    322860
     ccggcgccac ggcccttgcg cacccgatca gctcgctttg ctggtcgttg tggctctcca    322920
     gggcgaagcg gtaaaggaac agatacctgt acgcgccaat ggccgcgtcg atgcgttcga    322980
     gcagcgcctg gcggtccgtg atccggccgc gtgtgcgcag ggccaaagcc gcatacgcgg    323040
     caaacgattc atcgctcagc gcttgcgggg ccgtctgcgc catgaaagcg tgcgcccggt    323100
     cctgggtgtg gtcgcagtgc gcgcaagccc agccccgggc cgtcgccact agcacgccga    323160
     gctggccgcc ttgggcgccg tgcgtgacct gtgcgccggc aggagcgtcc tcatcaagat    323220
     gcgcgtgaaa ccccggggtt cagcccgggg aggtagagcg ccggatgcaa cgcatccgtt    323280
     gccccgggcc ctgcctgctc acatcctgtg tgttgggccc ggttgaaaaa atagccatac    323340
     ccgtcgtttc gctgaacgac gcggcaattt ttgtggccaa taccttgcac cacgccgcgt    323400
     gcggtggtga tattgaagct gcccgtcttg cggatcgcaa cacgccccac atgcgtgccc    323460
     gctttcttgc ccttgggcac taccgccttg accaggtcgc ccgtctgaaa gccgtggacc    323520
     gacttctcgc gcatcaggta accgcgggga aagccaaagc cgtccaggcg cgtgcgctgg    323580
     tagcttcccc ggcccatggc cttgatcgtc agggtagctg aggcgtggtt ttgccatccg    323640
     gctatggcat cgacccggcc gacgcaggcc gcgtccagcg catgggtctt cggcatgccc    323700
     agcgtgcagc ggttgaattt ggtctggccg cccgaggcca gctccagcgg caggcttgtc    323760
     gccttgagcg cctcggccag cgcccagcgg gtcgcgttga ccgcagcggc atcgcgcagg    323820
     ggttttttgg cttgcgccag gatgcgcgcc aggcgcgccg ggtctttctt caaaaagtcc    323880
     tgcagcgtgc gggcggcttt cttctggttg cacggcccgc aggccaggca caggttggat    323940
     atccggtggc tgccgccccg ggctcggggc tcgatgtgct ctatttgcag cggcgtgttt    324000
     tgtgcgtcgc agtaggcgca ggtccggctc cacttctcca gcaaatactc gcgcacctcg    324060
     tagcccgcca gggtgccctg ctggtactcg gcgccctcga tctgcgggtt tgctagctgc    324120
     tgcatgtcaa agcgcacgag ttcggagctc agcgccgtga tgggcgccag gcgccgcaag    324180
     cgcgccaccc aggccagcgt cgtgtcgacg cggtgctgca ggctcggggc gagccagcct    324240
     ttttgcttgt tgccccggtt gaggcccctg ggtgcgcggt agcgcaagtt gcctctgcgc    324300
     cggcggcgca tctgccggcg cgcggtcaag gcttcgctga tctgccggcc ccggtgcacc    324360
     agctcaaaca ggttgatcac ggcgatttca aaggcaggtg catttttagc gcctggcgtg    324420
     ttgggcttct cccgcaccac tgccaggccc gtgacccggc tgcccgggtc gagcttgagg    324480
     cgcagcggct ggagcaggca gtccgtctgg cttcggtcga tcagtcgaat cgtgaacggc    324540
     atgacccggt gaaccctggc gcgcttgctc tgcagaagca gccgggcgcg cttttcgctg    324600
     cagggcatca ccggctgccc gccccgatcc aatacaaaaa ccgccatctc gccttctttc    324660
     gaaatatggt gcctgtctaa ttccaggctg ccagccctta cgggccttgt aacgccgctt    324720
     gtcaaacgct tttaagggct tttgacgcac ggtctcccct cgggactgtc aacaaccggc    324780
     tccagcgctt gcgcgccgcg atcaagacct tcggaccttt acccttgtcc agcatgatca    324840
     agaccttaca gagcagcgag ctgaggaagc actcgctggt gtgtctgaac gacctgttat    324900
     taacgtcgtg gattggctac cactaccctg gtcaacctag ctttttggat ttctccgcaa    324960
     gctccaccct tcagggtggg gtgattgaca actcgctccg gtacttaaga gcctgctcct    325020
     gggagggcag cacatagaaa aacagcagcg caatgaagcc aggcccccac gccagaaggc    325080
     agagcaacaa cgcgctcagt gtctggcaga gcaggcctat tgccaaggcg gctgcgatgg    325140
     ccagcgccat cgtgatgcaa aaacgtttga gcatggagaa acttcccttt tttgttcttg    325200
     ttgcttgcac ttggccttgg gatgtcatga ctccggcgtc cacctgtttt tgttgagtcc    325260
     gggcgatgca ttggggaggc gcctcgatgg cgtgtcccag ctgcgcccct tgaccttgtg    325320
     ctcgattgtc caaccagcgg ccttgaggct cacgcccgat tcggattcga gcgtgtaggt    325380
     gattattcgc tgaaatccgc gcttgcgcgc ctcacgcgcc gcccagccgt aaagctggct    325440
     gcacgcattc cagggcagtt ccggcgcaat gtcggttcga acgcacaggc ggttcacctc    325500
     gacgacgcgg gcagggtcca aggcacgcgc cacgggccgc ccgaccatca cgcagccgat    325560
     cagctcgtcg ccgttgaaga ttccagtcca gaaacgccag ccggccggcg ccgggcaatg    325620
     gcggtgatgc ggggcaacga agttcttcgc agttgaaaac gagaccggcg cgatggtgag    325680
     cctccagtcg agcacgagtt gcccggagcc gtcatcgatc acgcgccgca cgcgcctgcc    325740
     tgtcagcccc tccaggcctt tggcgcgcag ccactgcgcg gctgccctgg ggttttcgct    325800
     caggaactgc accgccgcct cgtggacgcc gtggcagcag gtgtcgagct ggaagtcacg    325860
     cggcggccag acctctaaaa tctcgatcag ctcggcctcg ccgcaatagg ggcaggcttc    325920
     ctggggcaac gccatcgttc gccttgcctc gcttacgacc agtagtagcc gcttggggcg    325980
     ctgcagttgc cggtgatgaa cttcaggccg ggcagccttc ggcgcaagaa gcgcccgagg    326040
     aactggcttt tctcgcacgt atagaacctc aaggtggaag tgacttcgaa ggcgccgcgt    326100
     tcatcgcgga cgatccggat tcgtgcgttg ctgagttttg tcaggtcaac gtcgcttgaa    326160
     atgaccaggc tgagtttgga tttgcgcatg ttcggctttc cttggctggc agtgggcagt    326220
     ttcaagcaag gcggcagtcg gcccgcagat cacggccatc gatggccgca tcgagcatat    326280
     cgagtgctgc ttggcccgtg atccagttgt gcccgcctgt gcgcatgacg cgctcgattt    326340
     cggtcctggc cgcaccgagc gattcgatgg gctcatcgtt cagggaggcg gaatttttcg    326400
     ccagggcaac cgcctcgcca agcgagtatt taactgatgt tacgcagcgc cctcctgata    326460
     ggcttcacgg atgaaaaaag ctgaccttga tttgtacacg gactatttgc tgagcacttt    326520
     tggtgcggca acggcgacgg gcttatcggc aatggttgaa ggcgatgtga gtcatgacca    326580
     gatcacgcgg tttttatcgg ctcaagagta cacatccaag gatctgtggc agcaggtcaa    326640
     acggaccgtc agatcggtag aacgtgacga tggggtgctg atttttgacg acacgattca    326700
     agagaaagca tggacggacg aaagcgagct gatgtgctgg cattttgacc attgcagcgg    326760
     tcgttccgtg cgaggaatca atcttctcaa cgcgctgtac tactgcaacg caacatccat    326820
     tccggtagcc tttgagttgg taaagaagcc ggttcaatac tgcgacgttg cgaccaagcg    326880
     gcacaagcgt aaaagcgaag tgacgaaaaa cgagctgatg cgcgagatga tcgagacgtg    326940
     catccgcaac gccttgaaat tccgcttcgt gctgatggac agttggtttt cttcagagga    327000
     aaacttcgat tacatcaccg gcaagggacg gcatttcatt gccgcactca agggcaaccg    327060
     gctgctggcc ttgagcgaag aggacagaaa gaagaagcgt tttactcgtg tagatgaact    327120
     gattttttca gagcaaactc ccgtgcgcgg ctggctcaag ggatatgcaa aggaagtcct    327180
     tgtggtccgc caagtcttta aaaacaaaga cgacagcacg ggaatcatgc atctggtctg    327240
     cagtgacttg acttgcgact atgacgccat caccacgacc tacaaaaaac ggtggcaagt    327300
     ggaggtgttt cacaaatcct tgaagtccaa tgccaacctg gccaagtccc ccacgcgaac    327360
     gctgcgaacc caaagcaacc acgtcttcat ggccatttac gccgccttca agctcgaatg    327420
     cctgagcatc tctaacaagc tcaatccttt cgcgctttgt cgcaagctac tcatcaacgc    327480
     atctcgctcc gcctatgccc agcttcagct gttccaggct gctgcgtaac atcagtattt    327540
     aatataggga tgcgtgaggt tggggctgcc gaaagtctca actggatgcg cggtggtttc    327600
     tggcatgacg ggctttcttg gtgatgaaat ggttgtgaat tcatcttctc actcaaggag    327660
     gcgctgtcaa atgccacaaa tgccacaacg gctgcagcag tagcggtgcg ttttgcttcc    327720
     agcctcacgc cattttcctg atcacgcagg ccggcacaag tccagatgag ctttaattca    327780
     ccggaccata aacggcctcg acggcaaagc cgtgaatccg tgccggcaaa ttcgccaacg    327840
     gatgcgccga tttcacgaaa aggcgatccg ccccgatcat cacgcggtac ggcggggctg    327900
     cttgcgcgcc gggggctttg tttgcgatgc tcaactcggc atcgagcgcc tgggccgcag    327960
     ccaccagttc gggcttgttg gacatgcgcc cttgcccttt ggcgtcggcc acttcagcgc    328020
     gcaggccctc gatctgcacc agtgcggcat aggccctgtc gcatgtttcc ggacagccat    328080
     aggcgatcat gaaagagttc atgagactga gcagcaggcc tgccgtgtcg tggttctttt    328140
     gcaccgagag gactgcaaac tggtccatcc gctccacggg cgtttgcgcg aatcggtcaa    328200
     tgcccatgcc ccttgcaatt tccctaaagg ccctggtgag gaacgcatgg cgctcttcgg    328260
     gcgtcaattc cttgcccgtt gcggggctgg ccagggcgac tctgaattgg tgttgcagcg    328320
     caaggtcggc acgctcttga atcagttgtt cgatcatttt ttctttaagt ggacgttatt    328380
     gacttgcgtt cccggcgcgc tcaatcccgg ccggccataa aggcagcgcg tgcttcgcac    328440
     gcttggctga tcgcttgtcc atggtatcgc ttgtcgcggc attttcaagc gactcccagc    328500
     cgttggctat tgcctcatca acaagccgga tcacgcgatt gaggtcattg gttcatgctc    328560
     gttcgggggc aggattgcgc agaaagctac tttgatcttc ttgggccgtc ccggcccttg    328620
     agcaaggcgt actcgttaat ggcgggcttg agcggctcga ttcgatacca ggagccagcg    328680
     tccggtgggg gcgtgtcaac caggctggcg ccatcacgct tcaatgactg catccagcct    328740
     cgctcatacg cattgaaatg cgcgggtggc cctgccttgt agggattggc gtaaacccca    328800
     cggtgcgaaa aatagtcggc tttgccttgc gcaatgattt ctgattcgtc gggtatctgg    328860
     gttttttcag acatttggca gagccttgaa aggggttagg tcgctcgttc aattcgcggc    328920
     aaccccccat tcgggggata gccacgctgg agatagtcgc ttaaattggc tcatcaattc    328980
     atcgtacctt ttcatccaaa aatccatgcg tctgaacctg ccaatcctgt tctctgattc    329040
     acgcggcaac gacttcagtg gctgaaaaac cgcctttgtg gccctcgccg tgctgggcgc    329100
     cgtcaccttc gctgcaggtg tcattgccgg catgtacccc ttggtctatg ccggtgtgct    329160
     ggcgagcctc tttgcctcgg ccaagctcaa accctgatct gcgccactgc ggttcatgcg    329220
     ggcgtgagca gcccaaaatg caatggcact cgcaatgtct tcctggcggc ccgggaacac    329280
     ctccagcagt ttgagtttca gtgtcgcaag ccgttgaacc tgttcggcgc gggccatgcc    329340
     aacggccgct cgcagaactt caaagactga atcgctcatg ccgatttcct gaaatgcagt    329400
     cacagtttcc ctctgatcaa gcctggggct ttttgacgaa gccgattttg gcctcttcat    329460
     cctgcgcgtc atcgagatag ccctgcatgc cggcaagcgc ttcgggggtt ccgtccagaa    329520
     cccaggtcgt gtgcgcgcag ccggcgcaca cggcgccgcc tgccaggcgc atgcccggta    329580
     tgccccggat gtccagcggc tcgatctcgg tgagccaggc ctggcagttg ttgcattgga    329640
     tggaatcggg aaattgcgcc ctcgcatttg ttttggcgtt ggccgcacgc tgttcaaacg    329700
     tgccgcgaag tttggcctgt cccatgactg gatttccctg atgttgttgt gcaatggggc    329760
     agtgtgccac caagcggccc atcgagcgca gcgctgccca tgcaggactc ggccagccac    329820
     tcaggggctt gaggcgcctg gcgctcccaa gctagcttgg cttgcctgaa tttgcgtgaa    329880
     ggggcggcca ttttcccgat gcaggctttt tccatggcgt atccaccgta actcgaaaac    329940
     gtccttgccg gctcgaagca ttcgaaaaac cggtccgtcg cgcagccgcc caagtgcgct    330000
     gtttcgtagc aggtgacttc gccaatgaag caaatgggct tgtcgcccca aatgcaggcg    330060
     gcaacgaacg cctgctcggt gacggtgggc cagctcatga gcagcacgtc gtgcccggcg    330120
     ccgaaccgat ccacggcgct gatggcatcg cactcgacca ccgggtggta caggccttcg    330180
     cagtgcgcgt ccatgcttga aagaacgctc gtggccagca cctcgatgcc gcggctggcc    330240
     agaacgctgg ccaagtagcc gttgccggca aacacctcaa gcactctttg gccttcgagc    330300
     gctccagcca gctcggcgac aaaagcctca ttgggccgcc agtacaggcc ccggacctga    330360
     tctggcgact cgggcgcggg cagcagcggt tgcattttca acagggcgcc tcacgcttcg    330420
     tcaagcactg cgcgcgcaac ctgcggcagc atttcgagcc attgggcgcc ggtgcgctca    330480
     atcgcctcgg ccagcgtgta gccgatgctg gccagccagt cggcgcggtt aagcgccagc    330540
     gcaacggcca ccttttcccc ggtggacatc acactccagg catcgcgccc gccgcgctgg    330600
     gcgtcgcggg ccttgcccaa aaaatgcctg tactcggtgt tatcgacggt catgagtttt    330660
     ttccttcaag ccgccaggtt tttcttggca actgcttggt ggcgatcgag catgcgcttt    330720
     gtgatggtga cttctttatg gccgctctcg ctcgtcacaa gaatcaccaa atcgtgcgag    330780
     ttgaacgtct tgcgacgaag actctcaatc ttcgcgctat gcccaaggtt tgcgtgtttg    330840
     agtgcaattt gctctacgtc cgtgcaggcc tgagtatttg tgagcatgag gagtttcctt    330900
     ttttaaccag cgcctgactg cgctgaggtg agggttactt gacgcaaacg ccaagagagc    330960
     cgttttcgat gtccctgccc ggcatgcgcg cttgccgcga tctcgattgc gcgttcaagc    331020
     gtggccatga gaggttttct tggtcagaat ttatccggca gtgtccagcc ggtgcgcagg    331080
     tagatgattt ttttagccct gcgtagcgcc tgcagcctgc gatcgaccgc acgccctggc    331140
     gagtggattc tggagccctt gcagaactgg gcggcaagcg tttgcagctg ctgtgtcaat    331200
     tgaggcagcc ccgagatgcc gccaccaatc aagacaatca gctgtgcgtc aaattcggtg    331260
     tagtcgtgca tgttgccagg gcgctagcgg cgggctttgt cgatggccag atccgctgcc    331320
     atatcggcga cttcggatac aaaatggcgc tgcccgtctg cggtatgggc caatgagccg    331380
     ccctggcctg aggcgacgtg cgcggcgacg actgccagct cggtttgggc cacatgcagc    331440
     gacaccgaca atccctgcgg cagcgaggtg gacgagagca tgcaatgcaa gccgatggcc    331500
     tggagttgcg ccctggcctg ctcaaggatt tcagtggctt tggcgagatt ttcaggcgtg    331560
     aatgaatcca ttttttgttt cctgtcattc ggttgcaagg taaaaggccg gcccgccatc    331620
     aacatggccg ccgcggttca ggtgttcggc caggacgccg gcatccctga aacagggagc    331680
     atgcaccaag ccgtcccgtg ggaatttgtc cagccgaagg tctttggcgc tcaagccagg    331740
     ccccatccca acgaccactt gcacatggcc gttggaaaat acggcgcccg cctgaatctg    331800
     ttgagccgtg acgaaagtta ctttgctttc tggctccagg cttgaagcgc ctggcttgag    331860
     ggcaatggtg ttcatggtgt gctcgtcgtc atttcaactc gttccatacg cgcaccgcct    331920
     ccttgcggct gtgcatcgta tggcctgctt tgctgcatcc tctcagagcc ctttggttct    331980
     ttgagcacaa gaccttccag tgcgatgcgg catgatcgat tttcgccgga gcgccgcagc    332040
     cggggcaggg ttgcgcaagt tttgcgtcaa aagtgatttg cgacgcgccg ggctcttgcg    332100
     ctctagtccg tgttggcgcg tctgcctggg ccagcaccgc cagcaccttg tcgttgcgcg    332160
     ctgccgctgt gagcgcggtc atgccgggct gacccgacag aagtcttgga tcagcgcctg    332220
     caggcagtcc tggcacaggt cgcacctgac cctggcgcca tccccgaaca ccgaggcgta    332280
     gccgccgaca aaatcgatgt ggtgggcctc ctggtgctcc agctcagctg cattcacttc    332340
     gatagcgcat cggtcgcagg taaagccggt gacggcaggc tgagtttttt cttctatgtg    332400
     cagcatggct tctttttatg cgttgacttc atttagtttt tgattcaaag cgcagaacgc    332460
     tttcggatca gtttgaggca atgcgcgtgt aatgacattg gctccgtgcg taatcgtcca    332520
     ggaaccatca atgtgctcga tttcaacccg attgatgccc agcactatta cgagcctgtc    332580
     tcccttgtct ggcgcaatcg ccgcttggcg ttcttctgtg tcgatagacg ttgaattttg    332640
     actgtcgcca ataacgaatt gcatgatgat ttccttgaag gttaagggcg ctggccagca    332700
     ggccatggca gttgtctgat tccaagatat acccacaatg cgctaccgca agcgtcattt    332760
     cagggtagtt tgcgcgcgga agttttgagc tgattagact tctcgtgcgc caccatttcg    332820
     cgcaccagcg tccacaccgc gccatccata tcgcggtggt ccttggagtc gttgggcagc    332880
     agccagttgt ccagcgtacg gccggcgcag cccaggcggg cgcagaacgc atcacggctc    332940
     atgccgagtt cgctcatggc cgagcataga aattcttgtt gtgtactcat ctggacttta    333000
     tagcgcgtgc tttgttggcg gcgtccgcat gcacccgcca tcaatttttt ctttcctgcc    333060
     gctgccgggc aaagcctggg acggtttctt cggcaaaagc attgattggc ttgtctatga    333120
     gggattgctg atgcgctatc tctgcaggat tttgatacag cactttgccg gacgtgtggt    333180
     gctcgaccca aacgcgccag ccgttcctgg taatggttgc ggcgccttcg agcgcggact    333240
     tgcggccctg gggattcgcg gcatcgccga caacccgcca ggttgtgccc aaccggtaca    333300
     tcaggctcca gactttggtg ctcacgatgc cttccttttt ccattcttcg ccggtactgg    333360
     ccaacttgca aggcgggcca tcaggcggga atgttagagg ccttgaggcg gccatcgaag    333420
     atgcagtcga gcttctcgtt gagatacgcg acttcaaagc cttccatcgg caatgggttg    333480
     cctgtgtgct ggctgcactc ggtgaagtcg atgcccgcgt catgggcacg ctggcagctt    333540
     ttcaggtagg ccgtcatcac gccggcaaac tcgatgaagg ggtggttgcc gatctgcacg    333600
     gctgcgctgt agaagcggtt gatcgcctca tccatgcgct gcagggctac gtcgcgttct    333660
     gctggggtca tcacaattcg ttttccttca aggtagggtg gcagggtcgg gcagttcccc    333720
     gccttttttc tcacgcacat aagccagcat aggcgcttgc gtcgatgacg caatacaagc    333780
     gcggcttggg tttttgcgct actttttttg cttcacttcg ctgccgccac ctggcgcgca    333840
     tattcctcat cgtcgcgcag ctcaaggctg atgccacggc acaagatgtc aagaagttcc    333900
     tcactcgaaa aacagccagg aatgtcgagg ttgtcagact tgagcgtcag cttcttctgg    333960
     aaaagctcgg cactcaggca ggggcctccc acccgataga gggcgccgtt cagtttcgtg    334020
     cgatctcgca aggcgcgctc agccgcatcc ttcacgcgcg caatgccggg gtctgccagg    334080
     tgggcgtcga tttttcggca aagctggcgc gttatcggca cggcgggtag gcgcatcagg    334140
     tagtcgcgca cctcggccag caaggccagc gcgctggcat gatcttccat tttcaatcct    334200
     gattcatcag ccatggtgtg ttcctttcat gccaagggcg gggtgggcgc tacgctctgg    334260
     accatttttc taagtgccaa cgccagtgcc ggccaaagcg ccttcatggc tcggtgttcg    334320
     tggtggccgc ttccggatac aggtctggca gcaagatggg cagggcatcc agcgcaaagt    334380
     tgaaggtcac tggccctttg gggttgtcgc ttaccaagag cttgtccttg agcagctggg    334440
     ccagcgtgcg gcgtgcgctg cgctcggcca tgcccgtcat ctggcaaaag tccccgcgcg    334500
     agaccgggcc gcccaaaagc acatggtgca aggcgagcgt agcgtgcttg gtgtagtgct    334560
     cgaactgcga gctttctgag cgcaccagca tcaaggtggc aatgcgttcg cgcaagccgt    334620
     caagtctgag catttgcgtc atgaacgtga cctggtcatc ggccagctcg atgaagaagc    334680
     cgcaccactc gcgcagcatc ttttcactca gattgccacg gccatcaagg tcgccctggc    334740
     gcgcgctgtc cgcgttggcc agcacggcgt aatacctgtc gcgttgccgc gccagccccc    334800
     tgttgacgga ccacagcccg gcacttgtcg caaggagcgc gcaatgcgtc tgcagccggc    334860
     atgcccgccc gttgccatcc ccgaaagggt gaacccatgc ggcgcggtga tgggcagcgg    334920
     caatgccgaa taaaaggcca tcgagcccct tgatgcgggg atacacctcg tccatccggg    334980
     acaggaacgc gggcacggat gccgctgtcg gcggctggtg cctgccgacg ctgacgtcct    335040
     cccggcgcag ctggccgggc tcgatcacgc gcccatcctc ggtcgtgcgg tcaggcgcct    335100
     gcagccggca gtacaaggcg gcatgggcct ggaccagaaa actcgattgc aaggcctcgc    335160
     gctcacttcc cgcgcccggc gccagcaagc cttcgagctc ctgctcggcc tgcatgtggg    335220
     ccagggccag gcgctggcgc tgggccacat cgggaacttt ggagaagtcc gcgctcagcg    335280
     cacgctcgat gttcagcggg tgcgtgccct ggccttcgat gcggttggaa tagtacgagt    335340
     tcattccccg caccaggcgc tgcagcgact ggcgcgtgct gggcgcgacg caatgctgca    335400
     ggcggtaggc cttctccagg acagtgcgcg tgcgctcgat gaggcctgcg agttcgcgct    335460
     ggggcagcag gggctcgaac tggtggggct gatcgtacac tgcgacgact tttgaaggca    335520
     tgctcattgg ccgattatct tgaaagttaa attcatcgtc aagccattgt attaattgaa    335580
     ttaagttaga tttatagata gaaaaatcct attttttgcc gatcttttag ccgatctcct    335640
     ggccgaaatt taaagtgcag ccagcgcctg tcatgcgcag ggctgcgctt tgggcatcac    335700
     tcgggcagcg cattgaccgg gcagggggcg cccaagcctg agccggccgt gggcttcaca    335760
     cgcgcatcga taatgcccgc ttgcctcgcg catccccggc gatgcgccga ttcttttccc    335820
     ccagcacaaa gcgattccat gcccgctatc cgccttgccg agcccgcgcc gcttgcccct    335880
     gactgcccgg ctttgctgga agaggcgtgg caggaactgc aaaaagtccg cgctttgttc    335940
     agcatggcgt cccggatcgg ccggcaagtg gcctggcagg tggacttggc tacccttgcg    336000
     ctgacctggt ccgaggatgt gcgcgccctg tacgagctgc ccgctggcgg gccgccgacg    336060
     gtggaggaaa ccatcgggtt tttcgcgccg gagtacccag gccccatccg ccagcgcttt    336120
     gagggctgta tcgccaccgg cgcgggcttt gacatggcgc tgcagatcat caccggccag    336180
     ggccggcggg tctggattcg cattcttggc gaagccgccc gcgcccccgg cggccagatc    336240
     ggctgggttc agggcgtgat gcagaacatc gatgagcaca agcgggccga agccggcatc    336300
     ctgacgctca acgccgagct cgaagtgcgc gtgcaggagc gcaccgtcca gctcgaagcg    336360
     ctgaaccggg aaatgcaggc gttttcgtac tcggtcgcgc acgacctgcg ctcgccgctc    336420
     aacaccgtga gcggtttcgg gcagatgctg ctcaaatcgc acgggaaaaa cctcgacgac    336480
     aagggccggc actgcctggc ccgcatccag gagggcgccc ggtagatgga ccagatcatc    336540
     gacagcctga tggcgctggc cagggtttcg cgcagcgaag tcgcgcccgt ggcggtgaac    336600
     ctgtccgcct tggcgcggca ggccgaacgc gagtgccgtg agcgcgaagc ggcgcggcaa    336660
     gtgcaggtga gcgtggaaga tggcttgatg gcgcagggcg acgcgggctt gctgcggatc    336720
     gtgctgcaaa acctggtggg caacgcctgg aagtacagtg ccaaaaggca gcttgccctc    336780
     atcgaggtgg gcagccaaac tgaagcgggc ggccagaccg tttacttcgt caaggacaac    336840
     ggcgccgggt tcgacatggc ctatgcccac aagctgttcg cgccgttcga gcgcctgcac    336900
     ccggccagcg aattcgccgg caccggcatc ggactggcca cggcgcaaaa gatcatctct    336960
     cgccatggcg ggcgcatctg ggccggatca atgccggggc agggtgcggc gttttacttc    337020
     acgctgggtg ccaaagcgcc gcatgggctg acagcgtgaa gccggccgcg aatccgcaat    337080
     tgccgggcgt ctgcaccgtg cgcctcgatg tgcccgtgcg cgatgctcgc ctggcgttcg    337140
     agcgggcgta ttttagtttc cacttggccc gtgaaggctt ctcgatggcc cgcgtggttc    337200
     gaaaaagcgg catggaccgc accaatgtgt accgcaagct caggcagctg gggttcgagc    337260
     ccgatgcggg ccagtggcgc cttgtgcccg agatgctgca ggccggtcaa tgcagccttg    337320
     atgccgacta atagagattg ccccacgaag ccggcgatgg ccgcacagca caacaagacg    337380
     agactgacgc acaagatgcc gccggaagtg ctgctggcga gccatgcgct gtgctttgca    337440
     ctatgttttt tcaagctgta cggcccagcc caaataaacg gcttcctgga gactggattt    337500
     tgtcgggttc acttcatgcg aaaccgcgtc attgaagata aaccattcgc ctggcctgtg    337560
     aattgtcttt tcacgccctt gcttgaaata catgccatca ttaaagagaa ctaaaaccag    337620
     cgttggcccc catacgcgat caatgtgggc atctacaccc gtggtcatga cccaatggtg    337680
     gttctttgag actgcccgat agccccgttc gaaaagctca tttgttggaa gccaatcaag    337740
     cctgaatccc cgtggcaccc aggtgtcaac accttcatta aacccgctgg cgacctgggt    337800
     attccaaaat gccttcgcca attgcgctgc cttcttggct gctgctggac acactgccaa    337860
     cttgcctaga acttcgccag ctttagtttt gaccaatgac actgcaggtt cccatcaaga    337920
     ttttggtaca gactggtttt tcaactccaa agtcacgccg tcacgcaacc gagccatcag    337980
     tgtgtccttc tggccaggcg ccaatgatat ttttggaatt cgacaagtca catcgttggc    338040
     tgtcaccaca atatcaagcc gtacctggtc aacagcatca gaacactgtg ccactcgcgt    338100
     tgaggcctct cgtttggcat ccatggcagc aagctttgca gccgcgacac tgggatcaat    338160
     cggaaaatga tcaaagctgc cccaagcgtg cgacatttgg gttttgcggc cgacgctagc    338220
     gctccttggc agtgcctgca gatgctcgac gggccgatgt catatcttgg caagcctcgt    338280
     agactgcagc tgccaagccc atgagctgcc tggccatcgc ttcgggttca ttggccaacc    338340
     gggtaacggc tgtggtgcct gaattgacgc cgtcatagcg aacctcgaca aatcggcaaa    338400
     aatcggccgg tatgccctcg ccatagtgtt tcaaggctgc agagatggag ccgtgaaggg    338460
     tggtgggtgg tgtctgacat tcgcaatgcg cctcgtacag gccaggggct agttgttcga    338520
     tgtccagctg caagatcatt tatcaactct cgggttacag gccagcacag gcgtatgcct    338580
     cacttcacgt tggaccaaac cggcctcgac caggcgatgc tcggttttca acgcgtgcga    338640
     cttggagtag attttcttta aagcctcaat gccgcccgag gcatagatgg cagcgcattc    338700
     ttcgagcgat cttcgaggca ccagataagg ctcgccagaa tttttaacct cgcgcaacca    338760
     gcgctgatag cgcttgtctc gaagttcttt ggccagcttt gttgacctga cctgccaaag    338820
     cgcatggtgc tgaggcttgc catactttgc gatagcctgg tgcgccgatt caagggacag    338880
     gaaaaggtgt tcatccagct cagggaaggc agccaggtag ccggctggtg tcatgaacag    338940
     cgggtttgaa aacttgcgcg aacgggcaaa cattccatga ggcgctacgc tgtcagcact    339000
     gcattcagca ataaaccttt cttcagtcag cgcgcggtag gcggcctcgt ccccttgctt    339060
     ggacagctca taggccgcat tgtgctcagc cctgcgttct ttgaggctca ttttttcagt    339120
     gttcattcgt gcttgcacaa ttttcattgg ttatctgccg gggattttaa aagccgtgcg    339180
     cggccttgac cagcgccaga atctccgaga cgctgcgcac gggcttgtca ccctccatgg    339240
     ccatggcgcg gcagaacagg tccagcacgt agtagagggt agcggtgggc acgggcaccg    339300
     aatagatggc cgcatgctcg cccgtgacga gcaccagtcc gccctcctgg cggcgcagct    339360
     cgatgaactt ggcttgggtc gcgccgtggt ggccaaagcg gaccgagggc gtgatgccga    339420
     tcagcgtggc gacgaccgcc ggcatttcct cgggcgtgag ctgcagcacg agcttgcgct    339480
     cccaagcgta gcccccgccg gcgctcagcg catgggccga atcgatgctg accacgtgca    339540
     cgcccataaa atcgccgccc cggcggtgcg cggtgacctc cagcgtgtgg gcggccgcct    339600
     tgccgaacag gcgaagctgc agtcggctct tgtcccgctc ggccggggcc gcgctcgatg    339660
     caggggacgc ctggcgctcg aagcgggtgg gcagcagggg cagtgcctgg gttctgcctg    339720
     aggcgggcgc tgccggcatt gtgtccattg cattcatgtg ctccctatcc cagccgggcg    339780
     cgtcgtcatc gagcgggccg tcatcgggcc agaagtaaaa cgcctcgggc gctgtttctt    339840
     gctggcctgc aggcgcggcc agcgcctgca ggggcagatc cacaagctcc acaggctcct    339900
     cctggggcac ggcgggcagc caggcgcgca gcgtgtccac atcctcaggg tgattgtgca    339960
     actgcgcgat gcgctgctgc atgtcccagc cgtcctgccg cagcttcagg ccgcaggcaa    340020
     acagctcggc gccggtgaag gccaggccgt ggctttgcag ttgcttgagc agggcagggc    340080
     gcgtgcaggc cgcggcccag ctcaaaagcc ccaggtcgcc cggcttttcc cggccccgcg    340140
     cggccagcgt caggacgctt tcgagcgtgc tgcgcgcctc gggttcgagg tcgtgcaaga    340200
     actgcccacg ttggcccgga tcgggcgcgg gcgtgccgcg cgaggcgcac acctgcagcc    340260
     acagccgctc caggcccgcg ccatcgctct tttgggttcc cgttggctgc atgccggcgc    340320
     ctcagagcgg aaaagggttg agcaggtgcg cgcccaggcg gctcatgacg ctggcgtcct    340380
     tgaagccgca gcgccgctgg atctcggcga gcggcacgcc gctgttgaac cacagcgcaa    340440
     tgcaggtgtt gcgcagcgtg ttggggccca tgtgctggat gccgcccgga tcgacgatgg    340500
     tgttgggcat tggtgcggcc atgaagcctt gctgcaccag gcagtgcgcc aggtgcgcct    340560
     ggcagatgtt gtacaggccg ttgggcgcga tggcctggcc gatcttgtcg cccacgatca    340620
     gccggctctc cgggtcgatc agtcccaggc cgatgtggcg cacctcgagc cagtcgtgca    340680
     gggcccggct ggtgcgcgca tcgaggagca acacgcgttc gtggccggtg cgcgccttgc    340740
     gcacgcgcag ggtgtaaagg ggggaaggct cggcttgctg ccagtgcgaa ctctcgggct    340800
     gcagcagcgg caagccggcg tgttcgaact gtgcggcctg gtcctcgggc gagcccgcat    340860
     acggctcggc gctggccagg gtcaagtcga tgatctcgcg cacggtgagc gccgcgcgca    340920
     tcatgagcag caggaccaat cggttgcgcc gctccttgaa cgtgtggccg ctgctcaagc    340980
     cttcgcgcag ggcgatccac atattcatgg gcagcgccag cgacggcacg cgctcggtgg    341040
     ccgccggctt ggcatcctcg gccgggttga ccgccacggc cccggtggcc agcgcgtgcg    341100
     cgtacaggtc gtgcagcacg cgccagtagc gccgaagcgt cacgggcgag gttttcttgg    341160
     atttggagcg cgggccgatg gcttgggtga accgggtgat gtcggtgctt tgcgccgcat    341220
     cccaggcaac ggcgttagcc gcgcagaacg ccagccattt gcgccagatc agctcggcct    341280
     gctgcagtcc ggccgcgccc atgggcttga ggtcttgatt gtcaagcctg gccgcctgcc    341340
     aggacttgaa gaacgcggcg gggtccaggg cggtcacgtc agccattgga gggctcccga    341400
     ggagttggaa aagcgttgag cgcgttttgt catgatgtca accttagcgc aaagggcagg    341460
     gcgagcaagc ggcaaaaggt gctcggccag ccgctgcaat cgaggacggg ccagcgccaa    341520
     gagaaggaat aatcgcacag cagtggaaac aagctaattg aatttacaac aaacccaccc    341580
     caaaatcata acccctccag gcccgtaccc cccttgcgat gacggcgaag cctgaattat    341640
     ggttttcctc ttctcccctt cgttccccct caaggcaggg gcgggttcgg ggcaggtctt    341700
     ccaggagggg aggaggtttt tgtgggaatc gcgggttgct ttgttgtaaa tgcaatttcg    341760
     tggggtgggg ctggctggga aggtggcgcg gtctagcgcc gatgttgtca tcgtgttctc    341820
     gaaaaccgtt ctcggttcaa gtggcggaga aaggcgagga gtttcggaat gaatctgccc    341880
     cgcgccaccc gcaggttcgt cgggtagcgt ttgctggcaa atgagtctgg atatttgtca    341940
     gccagttctt tagatgttca tttgacgagc ctgataacag caggtaaatc atcaggcttg    342000
     ctgacattga cggcaatggg cggtagccag cgcagctcaa atggccgctg tgccgcagga    342060
     atgtccgaac cgtcatcccg cttcatggcg ccggaacgga acccgtgcca gtgggcgcgc    342120
     cggatatgcg ggcgtggccc aacgtggccg gctacttggc cggtctgctc ggcagcgtaa    342180
     gcttgccgca gggccgcgcc caggcgaacc cccacgtccc aggtagtcgg gcgctcggct    342240
     acaaacaggc gcagaccgcc tttgactctt ttaggttctg gattcgccgg ccggcgctgg    342300
     ccgtcgccga cctcggccgc ctggctgcac agatagagca ataggctgag cagcggctcc    342360
     agcaccggcc ggagtacgcc gctcataccc ttggcgaaat cattgggcaa ttgctcgccc    342420
     gcactcacag cgttgccggc ggccagattg agcgagcgtg tcaacgcatc ggccagcgtc    342480
     caccgcccca ggtgcagtac agcgggcata agcgcaggcc ctgctgcctc atcaatgtcg    342540
     agcaaaaagc gcagctcagg ctggccggtg ttgacatcat gctccaggtg cgcaaatgcg    342600
     ccatgcatct gcacgtcacc aagcagcatg ttcggtgtct cgatatagac gcaccattcg    342660
     ggcagccggt acaacacatc tgagggaatg tcgccggcaa ctagcgtatc gcgtacagcc    342720
     tcataaaccg ctggatcaaa gcgataaatg ccctgcgtca tgcgccaacc cgccagcccg    342780
     gccaggcggg ccgcgtcagg tatgcgctca gggtgagaca catggagcca ttgggcgtct    342840
     accccggccc cggtcgccac gatggcctgt gtggccgcga tgggcaaaaa acaccaggca    342900
     ggccaatcgg gaaagccctg gccgcgcccg gagcgcatgg tttcggactg cttccaggct    342960
     gacggataga ggcgcccggc tgccgtgacg tgatcgcgcg gccggcaagg agttatattc    343020
     atcatggtgc gcgtgaaacc ccggggttca gcccggggag gtagaacgcc ggcggctgtg    343080
     ccgccgagtt cttggttttc ttgactttct tgttttcttt ttccgcctga acccggatgt    343140
     cccgtacctg ccttccgagg atcagttccg ccacggtgtg gctttcgatc tgcgtcgtct    343200
     tccgagcggc caggcggatg caattgatgg ccttcgcact ggcatgaatc actgtgccat    343260
     ccaggtcggc aatggcgaaa tatcccgtgc tgcgcttgcc cttgacaaag ccaacgccat    343320
     ggggtgtggc aaccttgtcg cccttgcgca agccaaagag cttgcccgtc ggcaagcgct    343380
     gctgactgtg ccggcccgcg gtctgctggt agtcgccgct ggccatgtgg ttcttgatca    343440
     ggatgcgcgc catcggcagc accacttcgc cgtcttccag acaggcggcc accgcgtcgt    343500
     tggcgtgcgt cttgggccat ttgaggcact gctcgcgctt gaatttggtc tcgtagccga    343560
     aagtctcgcg gtgcggcacg tggcgttgtt gcataaatcc tctgtgagga tgaggcttgc    343620
     cccttacccc gcgttttagg caatccggac ggatttcggg cgtgcaagca ccagcatgcg    343680
     attgatgatg cccacccgaa cagcgacttc agcgtcttgc acatccacat cgcgcgccca    343740
     cagcctgtcg cccgtcagca ccttgaagcg gtacatcagg ttctccacca gggaacggcg    343800
     atggtagcca cttttgtctt tccagtcctg cttgctgctt tgggcaatat ggtcaatggc    343860
     ctcgttgcgc tctggcgccc cagcctggct ggcaggccag tgcacggcgc cctccacggg    343920
     gggaatgacc gccaacgcgc cgcacccggc aatggccgca cgggcggcct ttgtatcgta    343980
     ggcaccatcg ccgataacca cttcaatctt cgtttcttgg gggatttgcg ccagtaactc    344040
     cggcagcaca ctggcatcaa tcacatcctt gtgcgtcatc aacacggcgc acacctgccc    344100
     cgtctcgtca tccatgccca gatgcacttt gcgccagctg cggcgcttgg cgtagccgtg    344160
     tttacgcacc ttccattcgc cctcgccaaa cagcttcaac cccgtgctgt ccaccagcag    344220
     atgcacagcc tcgcctgcgt tgcgcagcac cggcaaggtt acccgcagcg ccttggccct    344280
     tcggctcagc gtgctgtagt tgggcactgg caaggccggc agcgccaggc ggcgcaggct    344340
     catggcaaac ccctgcaatg cccgcagcgg caggcggtac accgacttga gggccagcag    344400
     catctgaatc actgcatcgc agtaagcctg cgggcgcccg cgctgaactg acgccccagc    344460
     cattggtgcg aacatctctt cgtccatcca gatgctcaca ttgccccgct caatcaggcc    344520
     cgcgttgtac tcgggccagt tcttgacccg gtagaccccc ttgggctggc tgggcaggtg    344580
     cttgtctttt cgcatgttcg gaacaaaggt cggtagccta tcagtaaggc agcccgttca    344640
     ttggcgcggg cgatttatgc aacaacgccg cgcaagcgcg cggcgtgcgc ttcgggcgcc    344700
     agcccgggca gcgcgtgaaa gccgatcgcc atcaaaagcg tgcgctggaa ctggtggctg    344760
     ccgggcagtc gtaccgggag gtcgcactgc gcctgagcat cagcaagaac acggtgctgg    344820
     ccatcgtcaa gcgcgaccgc gcaaaacaag cagcgattcc aggctgaggt ttagtgaata    344880
     gtcccaccaa aacgcatttg tcaaatcact gacatccaag cttggcgcgg gtttgcgggc    344940
     gatcttactc atttacgaac gaatccttac gcctacccgg ctagactcgc atggcgccag    345000
     cgcttgccag ttcggcttca attcgcgtgc ctgtcgcacg ttcttcgttg gagaagccat    345060
     cgtagtcagc cagcccatgg aaatccaggc cggtgatctc ctcgacgtaa gcaacactac    345120
     gttgataggt cttgaaggcg ccgaatgcca cctcgagggc ggacaactcg cctttctggc    345180
     taatcagata ggcagtggcg gaaggattgc cttcgtcgtc gatgaaggcg ataaccttcc    345240
     agaacgctaa cggaatcagg acgtcgcgat actccagatc tcgtgtgccg aagacaggtc    345300
     cggaaaacac cgtgatccgc tcttccgaat ttcgtgcgtt cttcagtacg tagttctcta    345360
     ggcttagcca agtcttctga ttgaacgctc ccatctgagg tgaacaattg gtgaaatgga    345420
     acgtgtcttc gttagccgtc tgggcatcag cgccccagtt ggggtcttcc cgccgcacca    345480
     agtgaccgcg gtcgagcagg ttccctgcgt atagatcctc gccgatttgc gcttcatccg    345540
     gtatgcggcc atcgaagtac caagcgtctt tgtcacgcgg gatctggacc gaatccttgc    345600
     cgctaatgtt gacacctacg cacatcgcga tgcggcgtga cgcagacatc atcactgaga    345660
     agtttgtgta ggtgagcaag ttgtctcgtg ttccaggcac cggaagcaca tccccctggt    345720
     tgtcacccgc tgagggccac tttactttcc aaccaggcag gaagccttcg ttgtacccat    345780
     tgcgctcagc cagggtgcgt gcatcggttc gctggggccc cttgcggggc gcttcggccg    345840
     ctgcctccgc cgcttcagca ggagcgattg gttgaagtga cgagagccgc gggcggtgtg    345900
     ccagattgac ttgcattgaa tcctcctagg gtgaccttca gcctgggttg aaaaagtctt    345960
     taagccgcga gtcgtagtct cgaacgacct gcatcagagg gcgcgtcccg cgtcctcgct    346020
     cgatcaggtg attaaccaag tttaggagtt cgccgtgccg gtcgacaact tcaataaagg    346080
     cgctggtcca ccgctcgcgc tcttccctca agttttttct cagttcgacc cggcccagtt    346140
     cagaaggcca ataccgatgg gccgccatac tttccgagaa ctcaaccagt acctttaagg    346200
     cgcacttacg cgcggccgca cggaccaacg gatagatttc aggtgtcagg cctcgaagct    346260
     ttctatggtc ctctgaccgc aaggatgctt cgtcctcgat gtacatgcac ccttgttctg    346320
     ggcgaagccg gtttagctcg tgcagggaat aggtgagtcc cgctacgtga gcgcggcttc    346380
     ttattgcaag ttccttgttg cccgcgcggt cgagagatag tggttccaag cgagcagcat    346440
     tggaaggctc gaagccgtcg gccagatcac acaagagcct cagtcgcacc tcaaacccgc    346500
     ttcgcgctgg catcaccccc ccaagttgcc agcacctgag ggctgcgaca ttctcgatag    346560
     tagatccgtg ctgtggaaca ctcacccgct ggtctggtgg gttcttgcca tgaaggcgat    346620
     agagcatgaa atatgcgctt ccgagagtca gcggatccct cgatgaaaag ctcaacggct    346680
     ggtataccga tttggggtcg attcgcgtga acgatcgatc tagcgaactg gtgaagcgat    346740
     tagattgccg aagggaacag atagcaactc gccaaacagt tgaatcagtg aagtcgcggc    346800
     tgtcaggttc ccggttcggg ctaccgaact cttgaattgc aatttgtgcg ctggataaga    346860
     cggatgccag ttcgccgctt tcaaaggcgt tctgagcccg attgagcact gcacgagggt    346920
     cctgcgcctg catatcgccg tcgctcgctg actgtttgct cgacgtggcg tagccagtct    346980
     cgagaactgt tcgtctttcg acatcgccgg catagcgcac agattccggc tgttgcaagg    347040
     tgtcggcttc tgcagtcatt agcttttgct gggagccgac cttcagagaa gcccgccacg    347100
     ccggcggcag ggtctcgatg tcgtcgccaa gtgcccgcac gaaagcagga atcagttccg    347160
     gcggtggaag ttcaactgcg gaagtcaaca tgcagtgata gtggtactcg atgcgttgct    347220
     gctctctcgt aagtacggga tcgaggtagt ccgcgtagta cgccatcgca ctcaagtgca    347280
     cggcggctgc cctttcaaca tcagttgcgg tcatcgcctg gagcatgagg cggcgtaggt    347340
     ccttccggtg cagcacggcg ttctccccag acggctgtac aagccaaacc tgctgggaga    347400
     gtttgtcgaa caagtcccgc gcgcgcgcat tgcttacttc accgagcccg caaggcacgg    347460
     ccaaaacttg ctgaattagg tcgggcgtga cgcgacgaag gatcaaaccg ggatgagcga    347520
     ccttgaccag gtcaggatca tcagttcgta tccgccctaa cagtcgcttg tacaagaagg    347580
     tttgggcgaa ctggcggtcg aaattggagc gatccgctag aagctcatga gcagcagttc    347640
     gccctccgtc ccgtaggtgc acggccagaa tcttcagcat caacggattg ccgcccaaca    347700
     tatcgatcag cgaccggagc aaacctacgt cgatggatat ctggtcgccc accatcgcct    347760
     ggagcagttt gaccgccgcc gcggccgtca gatcgcccag gtcgagttga gagtggatgg    347820
     gcaggccacg cgaaaattca gggtagaagg cgcgtccgct gaagatcgat cgcaggtggg    347880
     gaaacccggc agctctcagt cgatgcagcc aggaggcgag ttcgttgagg ctcaggttgc    347940
     cagaagagga gacctcctcg agagtgtcga agacgaccac tacttcccca attaaaggaa    348000
     ggtgatcgcg tacacactct ttccatgcgg acagaagcgc aatgccactg gtcgcccgat    348060
     cgtgaaaccg cgtgttgtct tttttggcct cattgcgacg aaccgtttcg cggaagtccg    348120
     acaaggcttc tgacatctga ggacgaaaca actccaactg ccgagacatc tcaaggaaaa    348180
     tggaagaaag ccttccctgg taaaacgccg gacggtcaaa atcaatcgtc aaaactggca    348240
     caccacccca ttcatcaccg cgtagctcgc gcacgaactg tgcgaggagg gcggactttc    348300
     caaccccgcc tacaccagtt agccatagga tgaagtcgtc ggcaagtcct gtgttctggt    348360
     agacaaactc tctcagtcgc ctcaactgac gctctcggcc gatcagtttc ttgggaagta    348420
     gcgtttgcac agccgcttca gcgtcacgct tggcaaccag atcttctacc cactttgaga    348480
     catcgccgcg ctctgcaacc ggtacagtca gttgtaaagc cgttctgaga taaactagat    348540
     catccgtgct caggcgggag cgcgtaatgt catctccaag gatgatcttc ttgaggaagt    348600
     gaccaagtcg atctgacttg gcaggttgtg catcacgcgc atgctgcgcc agcgttccgt    348660
     agtgcttgag ttgcagaagc gtccgcgatc ttgcatcggt cgataactgc cagagtgctt    348720
     ggtggtcgtg cagtacctca gcgcattcag ttgctagttg ctgcaatgcg gccaactgga    348780
     ttggatcatt cgcgtcaagt aactcaagtg ggctgaacat gcccagcatg gcggccttgg    348840
     ccaaagaggc ctgcagcgcc tcttcaattt tggcatcgtt accagaactc atgcggacct    348900
     cgcagccttc gccagtgcct tggctagttg ggcctggcgt gtcaggggat cgtcgggcac    348960
     tgctgcgagc aaaccgcgca ccaggtcttg cgccctggct gcatcaagat ggggcttctc    349020
     cacactccaa aagcgctgaa cgtaatgctc catctcgagt cggtcaaact ctcgcgtccg    349080
     atcctgatca acttgctctg ggtctgcacc gggaacttcc ccatccaagc cgattagaac    349140
     aacacgcagt tctggcaaac ttgccatccc tgcatacagt gtttctagga atgtgcgggt    349200
     cgacgtatta gcgatcttgt accggtctac atcgtcgacg accagccaca ggactcgttg    349260
     atcggaatgc tccctaatgc ggcgaacgaa ttccgcaaac aactcgtcgc gaatccaggc    349320
     gcctacggct gactctgctt cgtctgaaac gggcagggca ggcacagtcg ccgcaccaca    349380
     ggctcgcaag atttccatgg cggtgccgtg ggccgtgacg tccaactgcg atgcagacat    349440
     ctcgacgaca ttgtgctgcg cggtacccag catggtgcgg agaatttttg cggtgaaact    349500
     tcggcctgtc ttggccgcgc cagccactgc gattatgcga actttgccac cgattgcccg    349560
     aaggacggca ttctgaaatc cctcacgtcc gatcaatggt tcgtcggtcg aatccagccg    349620
     ccacattgca tccaggccga ccacgctggt gagcgcggtc ccgcgtctcg cgatacaggc    349680
     cgtcggtatt gcaccgttaa atagcggctt gttggctgcg tcaaagtaac catattggtg    349740
     caaacctacg ggcttgaact cttggtccac taggagacca cctgaggatc catccgatga    349800
     gttggcgtca tggtgcagtc ggctcttatg caccgtgggc cacagccttg agcctactcc    349860
     gcgggaggtt gccaatggtt ggttgttctg aaactgccaa agtgtaagtt gggcgccaac    349920
     gtttgcgatg gtgggcattc gtcccgggtc gagcgtgtag aacccacgtt ctcgacccac    349980
     cgtacggctt agacgaatga ccgcgaaatc cagatggctg tcgaaacctt cggggtcggc    350040
     cccggtccag tcaatctctt gttggttgtc agggtcctca aggggatgga accggctgtg    350100
     ctcgaccagc caagcctcct gaggctggat gacggtgccg gtgctcatcc cgttaacagc    350160
     atcgaaagtg attttgaggc gatctctact gtcttgcagc ggcatatctt gtgcgtccag    350220
     cagcgggcgc acaacatggt agctagtgat tacggtctga gggcctacta gaaatccggt    350280
     gccgcttttc acaggcatgc cgttgccatc tatgacaaca atgctgcaca gcctgcgcat    350340
     tgcaagcagt gagctttttg attcggcctc ggtgttgacg atgccggcct ttggctgcgt    350400
     caatgcctgt aacttcaccg tcgccgatgc cgcagccggt gcggctgcca caacctccat    350460
     gttcaactga ttggcgtgca gcagtcgctc cacgagcgca tcgagaaaac ctctttcagc    350520
     cgcgtgactc aatgccttgg cgatcggcgc ctggggcgtc attagtgcca ggagtttgaa    350580
     aacgtagggt gtgcacggtt tggcgacatc gtcaaagatc gccgcgaaac gctcgcggtt    350640
     ggagactgcg gcggccaact gttcaaaatc agtttgagag tgctcaccag gcatcagggc    350700
     acccagttga tggcgagtcc atcaaaaaag ccgagcgatt ttagctcagg aagagtgtgg    350760
     gcgtagttgc cacttctgaa ggcgccgccg aagtgtagcg ctgccgcatt catcggcttt    350820
     gcgaaagacg caactagcga gccggagcag ccgcctagcg tcgtggcgtc gtgcacccgt    350880
     gtgattcctg gaatcacccc aggaaacggc gccactatca ccttgcctgg cgagaaatac    350940
     ttgcttccgt agtcggcacc gaagattgct tgcagccggt ccatgacctc gtagtccacc    351000
     ttattagttg tgccaatgcg aatcaaattt ggttgtgccg ggtacccaat gatggctatc    351060
     tgctcggtgg ggttcgtcaa ggagggggag agcgaaacgt ctaagggggg gggcgctgcc    351120
     atgtcacccg cggtgctctt ctcggcgata cgcaggaccg cagcatcgac tttacgcaaa    351180
     tctatggcat tcatatcaat gaaatcgtca ccagcgcgca agacttcgag aatcttgaat    351240
     cggctcggtg cggagccgta gctcgggtct tccgcgaagt caatgacgca gtctccatca    351300
     ttcaaaatcc aagcgtccgg cttgttcctg cgaggtatcg gaaatgcaat ttgctgcaga    351360
     acgtgccgat tggtcaggat cagtccttgc cccactacaa aaccggtgcc ttggtgttcc    351420
     ccgtcaaggt caattcggcc cactgcgtcc aggcgcaact tgaagctggc gcccgccttt    351480
     atgttgtaga tcgcgccgcc ccagctctcg gcgcgaggat cctcgtggtc gacgtcgccg    351540
     ttgatgacgc gcaaagcagg ccgtccagtc atggccacca aagcctcaag tcccaacttg    351600
     ccgagcgcgg acctcggtgc gttagatttg acttcgtcca ggagcgcaga aatggattgc    351660
     gcgatttcgt ttgcttgatc gtgcgtcgca cgagtaccag aaagaatttt gcgagctcgg    351720
     tcgatgagga ttttttcgcc gcccgcggct aggaaatcac gggtggcttc caggcttgcg    351780
     ctgctggtcg tcccctcaac caaagttccc gaaggcagcg ccagtcttac acgcgaaaaa    351840
     tcttctggga ctctaggagg tgcagtgggc agagaaaccg agctgctgcg cgtctgaccg    351900
     aaacgccgaa ctctgagatc acttgatatg tttgccgcat tgcgcaagtg aaccgagggc    351960
     ttggtcgcga tagacttggc agcttcagtc aaggcgatca acggctgatc gaagctcgcg    352020
     tggctcagtg caatcgcaga tatttcggtt tcgtagcgct cagcgtcaaa tgcggggtcg    352080
     gcttggccga gccctatctc ctcatccagg aagtccccaa gggaactctc tggagttgca    352140
     gtagtttccg ccgatgcggc tggaattgca tccagcggca gttgcagcag cgccagtgca    352200
     tccagcactc cagcgcccaa gtctccgtcc cagccctgcg ggcggcgtgc cgtagcgcgc    352260
     aaagctgcgc cgaaaaggct gcaaactgtg atccctcgct ggcgagcgac ggctacaacc    352320
     ttctcgcgac catgtgcgga gagccagcaa gcggcagcac cggccaccag tgccgtagca    352380
     taggaggttc cttgccccgc gctgatcaag tgcttgtccg cggccagtga tgtgcgctca    352440
     gcgcgccaga caaattcagc aggcgctgaa acggtcacac ggctgccttt cgaacttccc    352500
     ttccaggcct tatccaggat gttggtgccc ccaacggcga tcacctcagc atagcgggca    352560
     ggccaaacca cgatgccgac gcagtttccg gccgctgcca cgacgatcac gtccttgtgc    352620
     accgcctgtt ttactgctgc atgcagcgcc ctgccggcga taccgcccag gctcatcgaa    352680
     atgacgtgac agccagcggc ggtggcatag gagattgctt tcgcgacagg cgccgtgttg    352740
     aaaaccttga cgtcctcgat gcagcgtatc ggaacaacct tggctcccgg cgccgccccg    352800
     acaatttcgc cggttgtcct gctggccagc acgctgactg tagaggttcc atggcccggg    352860
     tttgccattc ctttggacaa ggggtctgtt gggtcttgat cgccatctag gatgtcagca    352920
     gccaagtcca aggcgaataa gtcggcatcc aattcagcgt ggtcagtcag gccggtatcc    352980
     agatggccta ctaggctgcc tcggccatct ccgagttcac gcgctgaatc cagtcgcgta    353040
     gttttcagcg cccactgctt gtctgctggc ggttcgccct ccgcgcggca cagacctgtg    353100
     acgaaggcgg tttcggctcg caactcgggc tgcagagcgt cggggtcgcg atatacgtct    353160
     attcccaggt ctggttcggc gctagtgatg cccaagtgat ccgccagcgc gtagccgatc    353220
     gcaaataagt cgccctgtgg aaacacccgc tcaagcgccg gaaagcgcag cgcgacaaag    353280
     cgaacgggcg g                                                         353291
//

If you have problems or comments...

PBIL Back to PBIL home page