(data stored in SCRATCH3701 zone)

EMBL: CP000538

ID   CP000538; SV 1; circular; genomic DNA; STD; PRO; 1616554 BP.
XX
AC   CP000538; AANY01000000-AANY01000006;
XX
PR   Project:PRJNA16135;
XX
DT   10-JAN-2007 (Rel. 90, Created)
DT   19-AUG-2018 (Rel. 137, Last updated, Version 6)
XX
DE   Campylobacter jejuni subsp. jejuni 81-176 chromosome, complete genome.
XX
KW   .
XX
OS   Campylobacter jejuni subsp. jejuni 81-176
OC   Bacteria; Proteobacteria; Epsilonproteobacteria; Campylobacterales;
OC   Campylobacteraceae; Campylobacter.
XX
RN   [1]
RP   1-1616554
RA   Fouts D., Nelson K., Sebastian Y.;
RT   ;
RL   Submitted (21-DEC-2006) to the INSDC.
RL   The Institute for Genomic Research, 9712 Medical Center Drive, Rockville,
RL   MD 20850, USA
XX
DR   MD5; ca18e8fbefba410af81ac24fc0ed0bf6.
DR   BioSample; SAMN02604044.
DR   EnsemblGenomes-Gn; CJJ81176_1704.
DR   EnsemblGenomes-Gn; CJJ81176_1705.
DR   EnsemblGenomes-Gn; CJJ81176_1706.
DR   EnsemblGenomes-Gn; CJJ81176_1707.
DR   EnsemblGenomes-Gn; CJJ81176_1708.
DR   EnsemblGenomes-Gn; CJJ81176_1710.
DR   EnsemblGenomes-Gn; CJJ81176_1711.
DR   EnsemblGenomes-Gn; CJJ81176_1712.
DR   EnsemblGenomes-Gn; CJJ81176_1713.
DR   EnsemblGenomes-Gn; CJJ81176_1714.
DR   EnsemblGenomes-Gn; CJJ81176_1715.
DR   EnsemblGenomes-Gn; CJJ81176_1716.
DR   EnsemblGenomes-Gn; CJJ81176_1717.
DR   EnsemblGenomes-Gn; CJJ81176_1718.
DR   EnsemblGenomes-Gn; CJJ81176_1719.
DR   EnsemblGenomes-Gn; CJJ81176_1720.
DR   EnsemblGenomes-Gn; CJJ81176_1721.
DR   EnsemblGenomes-Gn; CJJ81176_1722.
DR   EnsemblGenomes-Gn; CJJ81176_1723.
DR   EnsemblGenomes-Gn; CJJ81176_1724.
DR   EnsemblGenomes-Gn; CJJ81176_1725.
DR   EnsemblGenomes-Gn; CJJ81176_1726.
DR   EnsemblGenomes-Gn; CJJ81176_1727.
DR   EnsemblGenomes-Gn; CJJ81176_1728.
DR   EnsemblGenomes-Gn; CJJ81176_1729.
DR   EnsemblGenomes-Gn; CJJ81176_1730.
DR   EnsemblGenomes-Gn; CJJ81176_1733.
DR   EnsemblGenomes-Gn; CJJ81176_1734.
DR   EnsemblGenomes-Gn; CJJ81176_1735.
DR   EnsemblGenomes-Gn; CJJ81176_1736.
DR   EnsemblGenomes-Gn; CJJ81176_1737.
DR   EnsemblGenomes-Gn; CJJ81176_1738.
DR   EnsemblGenomes-Gn; CJJ81176_1739.
DR   EnsemblGenomes-Gn; CJJ81176_1740.
DR   EnsemblGenomes-Gn; CJJ81176_1745.
DR   EnsemblGenomes-Gn; CJJ81176_1748.
DR   EnsemblGenomes-Gn; CJJ81176_1749.
DR   EnsemblGenomes-Gn; CJJ81176_1750.
DR   EnsemblGenomes-Gn; CJJ81176_1751.
DR   EnsemblGenomes-Gn; CJJ81176_1753.
DR   EnsemblGenomes-Gn; CJJ81176_1755.
DR   EnsemblGenomes-Gn; CJJ81176_1756.
DR   EnsemblGenomes-Gn; CJJ81176_1757.
DR   EnsemblGenomes-Gn; CJJ81176_1758.
DR   EnsemblGenomes-Gn; CJJ81176_1759.
DR   EnsemblGenomes-Gn; CJJ81176_1760.
DR   EnsemblGenomes-Gn; CJJ81176_1761.
DR   EnsemblGenomes-Gn; CJJ81176_1762.
DR   EnsemblGenomes-Gn; CJJ81176_1763.
DR   EnsemblGenomes-Gn; CJJ81176_1764.
DR   EnsemblGenomes-Gn; CJJ81176_1765.
DR   EnsemblGenomes-Gn; CJJ81176_1766.
DR   EnsemblGenomes-Gn; CJJ81176_1767.
DR   EnsemblGenomes-Gn; EBG00001201806.
DR   EnsemblGenomes-Gn; EBG00001201807.
DR   EnsemblGenomes-Gn; EBG00001201808.
DR   EnsemblGenomes-Gn; EBG00001201809.
DR   EnsemblGenomes-Gn; EBG00001201810.
DR   EnsemblGenomes-Gn; EBG00001201811.
DR   EnsemblGenomes-Gn; EBG00001201812.
DR   EnsemblGenomes-Gn; EBG00001201813.
DR   EnsemblGenomes-Gn; EBG00001201814.
DR   EnsemblGenomes-Gn; EBG00001201815.
DR   EnsemblGenomes-Gn; EBG00001201816.
DR   EnsemblGenomes-Gn; EBG00001201817.
DR   EnsemblGenomes-Gn; EBG00001201818.
DR   EnsemblGenomes-Gn; EBG00001201819.
DR   EnsemblGenomes-Gn; EBG00001201820.
DR   EnsemblGenomes-Gn; EBG00001201821.
DR   EnsemblGenomes-Gn; EBG00001201822.
DR   EnsemblGenomes-Gn; EBG00001201823.
DR   EnsemblGenomes-Gn; EBG00001201824.
DR   EnsemblGenomes-Gn; EBG00001201825.
DR   EnsemblGenomes-Gn; EBG00001201826.
DR   EnsemblGenomes-Gn; EBG00001201827.
DR   EnsemblGenomes-Gn; EBG00001201828.
DR   EnsemblGenomes-Gn; EBG00001201829.
DR   EnsemblGenomes-Gn; EBG00001201830.
DR   EnsemblGenomes-Gn; EBG00001201831.
DR   EnsemblGenomes-Gn; EBG00001201832.
DR   EnsemblGenomes-Gn; EBG00001201833.
DR   EnsemblGenomes-Gn; EBG00001201834.
DR   EnsemblGenomes-Gn; EBG00001201835.
DR   EnsemblGenomes-Gn; EBG00001201836.
DR   EnsemblGenomes-Gn; EBG00001201837.
DR   EnsemblGenomes-Gn; EBG00001201838.
DR   EnsemblGenomes-Gn; EBG00001201839.
DR   EnsemblGenomes-Gn; EBG00001201840.
DR   EnsemblGenomes-Gn; EBG00001201841.
DR   EnsemblGenomes-Gn; EBG00001201842.
DR   EnsemblGenomes-Gn; EBG00001201843.
DR   EnsemblGenomes-Gn; EBG00001201844.
DR   EnsemblGenomes-Gn; EBG00001201845.
DR   EnsemblGenomes-Gn; EBG00001201846.
DR   EnsemblGenomes-Gn; EBG00001201847.
DR   EnsemblGenomes-Gn; EBG00001201848.
DR   EnsemblGenomes-Gn; EBG00001201849.
DR   EnsemblGenomes-Gn; EBG00001201850.
DR   EnsemblGenomes-Gn; EBG00001201851.
DR   EnsemblGenomes-Gn; EBG00001201852.
DR   EnsemblGenomes-Gn; EBG00001201853.
DR   EnsemblGenomes-Gn; EBG00001201854.
DR   EnsemblGenomes-Gn; EBG00001201855.
DR   EnsemblGenomes-Gn; EBG00001201856.
DR   EnsemblGenomes-Gn; EBG00001201857.
DR   EnsemblGenomes-Gn; EBG00001201858.
DR   EnsemblGenomes-Gn; EBG00001201859.
DR   EnsemblGenomes-Gn; EBG00001201860.
DR   EnsemblGenomes-Gn; EBG00001201861.
DR   EnsemblGenomes-Gn; EBG00001201862.
DR   EnsemblGenomes-Gn; EBG00001201863.
DR   EnsemblGenomes-Gn; EBG00001201864.
DR   EnsemblGenomes-Gn; EBG00001201865.
DR   EnsemblGenomes-Gn; EBG00001201866.
DR   EnsemblGenomes-Gn; EBG00001201867.
DR   EnsemblGenomes-Gn; EBG00001201868.
DR   EnsemblGenomes-Gn; EBG00001201869.
DR   EnsemblGenomes-Gn; EBG00001201870.
DR   EnsemblGenomes-Tr; CJJ81176_1704-1.
DR   EnsemblGenomes-Tr; CJJ81176_1705-1.
DR   EnsemblGenomes-Tr; CJJ81176_1706-1.
DR   EnsemblGenomes-Tr; CJJ81176_1707-1.
DR   EnsemblGenomes-Tr; CJJ81176_1708-1.
DR   EnsemblGenomes-Tr; CJJ81176_1710-1.
DR   EnsemblGenomes-Tr; CJJ81176_1711-1.
DR   EnsemblGenomes-Tr; CJJ81176_1712-1.
DR   EnsemblGenomes-Tr; CJJ81176_1713-1.
DR   EnsemblGenomes-Tr; CJJ81176_1714-1.
DR   EnsemblGenomes-Tr; CJJ81176_1715-1.
DR   EnsemblGenomes-Tr; CJJ81176_1716-1.
DR   EnsemblGenomes-Tr; CJJ81176_1717-1.
DR   EnsemblGenomes-Tr; CJJ81176_1718-1.
DR   EnsemblGenomes-Tr; CJJ81176_1719-1.
DR   EnsemblGenomes-Tr; CJJ81176_1720-1.
DR   EnsemblGenomes-Tr; CJJ81176_1721-1.
DR   EnsemblGenomes-Tr; CJJ81176_1722-1.
DR   EnsemblGenomes-Tr; CJJ81176_1723-1.
DR   EnsemblGenomes-Tr; CJJ81176_1724-1.
DR   EnsemblGenomes-Tr; CJJ81176_1725-1.
DR   EnsemblGenomes-Tr; CJJ81176_1726-1.
DR   EnsemblGenomes-Tr; CJJ81176_1727-1.
DR   EnsemblGenomes-Tr; CJJ81176_1728-1.
DR   EnsemblGenomes-Tr; CJJ81176_1729-1.
DR   EnsemblGenomes-Tr; CJJ81176_1730-1.
DR   EnsemblGenomes-Tr; CJJ81176_1733-1.
DR   EnsemblGenomes-Tr; CJJ81176_1734-1.
DR   EnsemblGenomes-Tr; CJJ81176_1735-1.
DR   EnsemblGenomes-Tr; CJJ81176_1736-1.
DR   EnsemblGenomes-Tr; CJJ81176_1737-1.
DR   EnsemblGenomes-Tr; CJJ81176_1738-1.
DR   EnsemblGenomes-Tr; CJJ81176_1739-1.
DR   EnsemblGenomes-Tr; CJJ81176_1740-1.
DR   EnsemblGenomes-Tr; CJJ81176_1745-1.
DR   EnsemblGenomes-Tr; CJJ81176_1748-1.
DR   EnsemblGenomes-Tr; CJJ81176_1749-1.
DR   EnsemblGenomes-Tr; CJJ81176_1750-1.
DR   EnsemblGenomes-Tr; CJJ81176_1751-1.
DR   EnsemblGenomes-Tr; CJJ81176_1753-1.
DR   EnsemblGenomes-Tr; CJJ81176_1755-1.
DR   EnsemblGenomes-Tr; CJJ81176_1756-1.
DR   EnsemblGenomes-Tr; CJJ81176_1757-1.
DR   EnsemblGenomes-Tr; CJJ81176_1758-1.
DR   EnsemblGenomes-Tr; CJJ81176_1759-1.
DR   EnsemblGenomes-Tr; CJJ81176_1760-1.
DR   EnsemblGenomes-Tr; CJJ81176_1761-1.
DR   EnsemblGenomes-Tr; CJJ81176_1762-1.
DR   EnsemblGenomes-Tr; CJJ81176_1763-1.
DR   EnsemblGenomes-Tr; CJJ81176_1764-1.
DR   EnsemblGenomes-Tr; CJJ81176_1765-1.
DR   EnsemblGenomes-Tr; CJJ81176_1766-1.
DR   EnsemblGenomes-Tr; CJJ81176_1767-1.
DR   EnsemblGenomes-Tr; EBT00001573028.
DR   EnsemblGenomes-Tr; EBT00001573029.
DR   EnsemblGenomes-Tr; EBT00001573030.
DR   EnsemblGenomes-Tr; EBT00001573031.
DR   EnsemblGenomes-Tr; EBT00001573032.
DR   EnsemblGenomes-Tr; EBT00001573033.
DR   EnsemblGenomes-Tr; EBT00001573034.
DR   EnsemblGenomes-Tr; EBT00001573035.
DR   EnsemblGenomes-Tr; EBT00001573036.
DR   EnsemblGenomes-Tr; EBT00001573037.
DR   EnsemblGenomes-Tr; EBT00001573038.
DR   EnsemblGenomes-Tr; EBT00001573039.
DR   EnsemblGenomes-Tr; EBT00001573040.
DR   EnsemblGenomes-Tr; EBT00001573041.
DR   EnsemblGenomes-Tr; EBT00001573042.
DR   EnsemblGenomes-Tr; EBT00001573043.
DR   EnsemblGenomes-Tr; EBT00001573044.
DR   EnsemblGenomes-Tr; EBT00001573045.
DR   EnsemblGenomes-Tr; EBT00001573046.
DR   EnsemblGenomes-Tr; EBT00001573047.
DR   EnsemblGenomes-Tr; EBT00001573048.
DR   EnsemblGenomes-Tr; EBT00001573049.
DR   EnsemblGenomes-Tr; EBT00001573050.
DR   EnsemblGenomes-Tr; EBT00001573051.
DR   EnsemblGenomes-Tr; EBT00001573052.
DR   EnsemblGenomes-Tr; EBT00001573053.
DR   EnsemblGenomes-Tr; EBT00001573054.
DR   EnsemblGenomes-Tr; EBT00001573055.
DR   EnsemblGenomes-Tr; EBT00001573056.
DR   EnsemblGenomes-Tr; EBT00001573057.
DR   EnsemblGenomes-Tr; EBT00001573058.
DR   EnsemblGenomes-Tr; EBT00001573059.
DR   EnsemblGenomes-Tr; EBT00001573060.
DR   EnsemblGenomes-Tr; EBT00001573061.
DR   EnsemblGenomes-Tr; EBT00001573062.
DR   EnsemblGenomes-Tr; EBT00001573063.
DR   EnsemblGenomes-Tr; EBT00001573064.
DR   EnsemblGenomes-Tr; EBT00001573065.
DR   EnsemblGenomes-Tr; EBT00001573066.
DR   EnsemblGenomes-Tr; EBT00001573067.
DR   EnsemblGenomes-Tr; EBT00001573068.
DR   EnsemblGenomes-Tr; EBT00001573069.
DR   EnsemblGenomes-Tr; EBT00001573070.
DR   EnsemblGenomes-Tr; EBT00001573071.
DR   EnsemblGenomes-Tr; EBT00001573072.
DR   EnsemblGenomes-Tr; EBT00001573073.
DR   EnsemblGenomes-Tr; EBT00001573074.
DR   EnsemblGenomes-Tr; EBT00001573075.
DR   EnsemblGenomes-Tr; EBT00001573076.
DR   EnsemblGenomes-Tr; EBT00001573077.
DR   EnsemblGenomes-Tr; EBT00001573078.
DR   EnsemblGenomes-Tr; EBT00001573079.
DR   EnsemblGenomes-Tr; EBT00001573080.
DR   EnsemblGenomes-Tr; EBT00001573081.
DR   EnsemblGenomes-Tr; EBT00001573082.
DR   EnsemblGenomes-Tr; EBT00001573083.
DR   EnsemblGenomes-Tr; EBT00001573084.
DR   EnsemblGenomes-Tr; EBT00001573085.
DR   EnsemblGenomes-Tr; EBT00001573086.
DR   EnsemblGenomes-Tr; EBT00001573087.
DR   EnsemblGenomes-Tr; EBT00001573088.
DR   EnsemblGenomes-Tr; EBT00001573089.
DR   EnsemblGenomes-Tr; EBT00001573090.
DR   EnsemblGenomes-Tr; EBT00001573091.
DR   EnsemblGenomes-Tr; EBT00001573092.
DR   EuropePMC; PMC2412886; 18492293.
DR   EuropePMC; PMC2704436; 19304960.
DR   EuropePMC; PMC2928727; 20865039.
DR   EuropePMC; PMC2950462; 20709846.
DR   EuropePMC; PMC3111999; 21677848.
DR   EuropePMC; PMC3145565; 21745410.
DR   EuropePMC; PMC3289066; 22208406.
DR   EuropePMC; PMC3295178; 22170908.
DR   EuropePMC; PMC3526280; 23034806.
DR   EuropePMC; PMC3886934; 24084637.
DR   EuropePMC; PMC3928116; 24558375.
DR   EuropePMC; PMC4153488; 25146148.
DR   EuropePMC; PMC4510157; 26025899.
DR   EuropePMC; PMC4611032; 26419875.
DR   EuropePMC; PMC4928009; 27413761.
DR   EuropePMC; PMC5270690; 28126931.
DR   EuropePMC; PMC5691412; 28939610.
DR   EuropePMC; PMC6097035; 29856309.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01069; purD.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP000538.
DR   SILVA-SSU; CP000538.
DR   StrainInfo; 844882; 0.
XX
CC   On or before Jan 9, 2007 this sequence version replaced
CC   AANY01000001.1, AANY01000002.1, AANY01000003.1, AANY01000004.1,
CC   AANY01000005.1, AANY01000006.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1616554
FT                   /organism="Campylobacter jejuni subsp. jejuni 81-176"
FT                   /sub_species="jejuni"
FT                   /strain="81-176"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:354242"
FT   gene            1..1323
FT                   /gene="dnaA"
FT                   /locus_tag="CJJ81176_0027"
FT   CDS_pept        1..1323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CJJ81176_0027"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="identified by match to protein family HMM PF00308;
FT                   match to protein family HMM TIGR00362"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0027"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71949"
FT                   /db_xref="GOA:A1VX79"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VX79"
FT                   /protein_id="EAQ71949.1"
FT                   /translation="MNPSQILENLKKELNENEYENYLSNLKFNEKQSKADLLVFNAPNE
FT                   LMAKFIQTKYGKKIAHFYEVQSGNKAIINIQAQSAKQSNKSTKIDIAHIKAQSTILNPS
FT                   FTFDSFVVGDSNKYAYGACKAITHKDKLGKLYNPIFVYGPTGLGKTHLLQAVGNASLEM
FT                   GKKVIYATSENFINDFTSNLKNGSLDKFHEKYRNCDVLLIDDVQFLGKTDKIQEEFFFI
FT                   FNEIKNNDGQIIMTSDNPPNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEF
FT                   NDINLSNDIINYIATSLGDNIREIEGIIISLNAYATILGQEITLELAKSVMKDHIKEKK
FT                   ENITIDDILSLVCKEFNIKPSDVKSNKKTQNIVTARRIVIYLARALTALTMPQLANYFE
FT                   MKDHTAISHNVKKITEMIENDASLKAKIEELKNKILVKSQS"
FT   gene            1483..2550
FT                   /gene="dnaN"
FT                   /locus_tag="CJJ81176_0028"
FT   CDS_pept        1483..2550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CJJ81176_0028"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0028"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72015"
FT                   /db_xref="GOA:A0A0H3PA99"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA99"
FT                   /protein_id="EAQ72015.1"
FT                   /translation="MKLSINKNTLESAVILCNAYVEKKDSSTITSHLFFHADEDKLLIK
FT                   ASDYEIGINYKIKKIRVESSGFATANAKSIADVIKSLNNEEVVLETIDNFLFVRQKNTK
FT                   YKLPMFNHEDFPNFPNTEGKNQFDIDSSDLSRSLKKILPSIDTNNPKYSLNGAFLDIKT
FT                   DKINFVGTDTKRLAIYTLEKANNQEFSFSIPKKAIMEMQKLFYEKIEIFYDQNMLIAKN
FT                   ENFEFFTKLINDKFPDYEKVIPKTFKQELSFSTEDFIDSLKKISVVTEKMRLHFNKDKI
FT                   IFEGISLDNMEAKTELEIQTGVSEEFNLTIKIKHLLDFLTSIEEEKFTLSVNEPNSAFI
FT                   VKSQGLSMIIMPMIL"
FT   gene            2579..4888
FT                   /gene="gyrB"
FT                   /locus_tag="CJJ81176_0029"
FT   CDS_pept        2579..4888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CJJ81176_0029"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="identified by match to protein family HMM PF00204;
FT                   match to protein family HMM PF00986; match to protein
FT                   family HMM PF01751; match to protein family HMM PF02518;
FT                   match to protein family HMM TIGR01059"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0029"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71991"
FT                   /db_xref="GOA:A0A0H3PA85"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA85"
FT                   /protein_id="EAQ71991.1"
FT                   /translation="MQENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDN
FT                   SIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFD
FT                   KDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIGKSKKTG
FT                   TTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVGKHESFHFEGGISQ
FT                   FVIDLNKKEALTKAIFFSVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGF
FT                   RMGLTRVISNYIEANASAREKDNKITGEDVREGLIAVVSVKVPEPQFEGQTKGKLGSTY
FT                   VRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTL
FT                   PGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKIL
FT                   KSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELV
FT                   ANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGIEGLNYEGIGMNDLKDYLKIV
FT                   AAYRAILKDLEKRFNVISVIRYMIENSNLVKGNNEELFSVIKQFLETQGHNILNHYINE
FT                   NEIRAFVQTQNGLEELVINEELFTHPLYEEANYIFDKIKDRGLEFDKDILEVLEDVETN
FT                   AKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVEPR
FT                   RDYIQAHAKDVKHLDV"
FT   gene            complement(4914..5255)
FT                   /locus_tag="CJJ81176_0030"
FT   CDS_pept        complement(4914..5255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0030"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71901"
FT                   /db_xref="GOA:A0A0H3PGL6"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGL6"
FT                   /protein_id="EAQ71901.1"
FT                   /translation="MKKIILILALFLSASWAQNLEINPDTGLIIDPDSPLVEANCLACH
FT                   GSNLITNMHASKKAWLAAIRWMQDSEGLWEIEPEDEEKILNYLEKYYGEKYDTRRRIPL
FT                   AIFLQNKTH"
FT   gene            complement(5258..6496)
FT                   /locus_tag="CJJ81176_0031"
FT   CDS_pept        complement(5258..6496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0031"
FT                   /product="molybdopterin oxidoreductase family protein"
FT                   /note="identified by match to protein family HMM PF00174;
FT                   match to protein family HMM PF03404"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0031"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72032"
FT                   /db_xref="GOA:A0A0H3PGV5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGV5"
FT                   /protein_id="EAQ72032.1"
FT                   /translation="MKQNDQKENRRDFLKNIGLGLFGISVLSNFSFENFLGSKALAKEL
FT                   PDFKIEGKKDLIYHGEKPLTAETEIYALDSDFTKPENFFVRNNGLPPSLETIKERLHKG
FT                   WTLEIDGESIINKKSYTIEDLKKKFKTYTYALTVECGGNGRSEVIPSTKGTQWGYGAVA
FT                   CGRWTGVRLKDILKDCGIKNDAVYIGYYGIDTKLNGEETSPISRGVPISKALQDETLIA
FT                   WAYEGKDIPLVNGYPLRLVCGGYPASTSGKWLYKISVRNKIHDGEKMEGSYKVPVNPVK
FT                   PGDFNYKGEMKIIESMPIRSVITNIKNGSEIKANKKFEVRGKAWAGELEVSEVYVSNDY
FT                   GVTWTKAKVEKPLNRLAWQKWSAQISIPTKGYYEIWARAIDSQGNSQPMVLAQWNPGGY
FT                   INNACHRVNVYGV"
FT   gene            6707..8008
FT                   /locus_tag="CJJ81176_0032"
FT   CDS_pept        6707..8008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0032"
FT                   /product="Na+/H+ antiporter family protein"
FT                   /note="identified by match to protein family HMM PF03553;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0032"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71947"
FT                   /db_xref="GOA:A0A0H3PCJ2"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCJ2"
FT                   /protein_id="EAQ71947.1"
FT                   /translation="MTLLTNPIIISVVLMTLLCLFRFNVLLSLLISALIAGVFSHLELV
FT                   DTMNILISGMKENLKTALSYILLGAIAAAISKTNLTAYLIKIVSHFISHKKYLLLLSIA
FT                   LISCFSQNLIPIHVAFIPLLIPPLLSLFNKLKIDRRAVACALTFGLTTPYMVLPVGFGL
FT                   TFQDLLKDNLNANNVSASLNDVTNTMYFAAICMIAGLFLALFVFYRKPREYQEVEIAKV
FT                   DLENLEMTRKEWGVLAGLVLTLILQILTMNLPLSGLLGFVLMVILGGVEFSKVNEVFDD
FT                   GLKMMGFIAFVILVAAGYGEVLKESGSVVDLVNSVVPWMEQSKFLAVFFMLLIGLIITM
FT                   GIGTSFGTIPIIATLFCPICLELGFSTALIIFILGVAGALGDAGSPASETTMGTTVGLN
FT                   ADKQHDHIKDTCIPTFIFYNGPLLILGSIIAMFL"
FT   gene            8142..12629
FT                   /gene="gltB"
FT                   /locus_tag="CJJ81176_0033"
FT   CDS_pept        8142..12629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="CJJ81176_0033"
FT                   /product="glutamate synthase, large subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00310;
FT                   match to protein family HMM PF01493; match to protein
FT                   family HMM PF01645; match to protein family HMM PF04898"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0033"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72007"
FT                   /db_xref="GOA:Q1HG74"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HG74"
FT                   /protein_id="EAQ72007.1"
FT                   /translation="MDLENILENNQSIGLYHPKNEHDACGIAAVANIRGIASYKVICDA
FT                   LEILMNLEHRGGAGAEENSGDGAGILIQIPHDFFKTQELGFELPKKGDYAVAQMFLSPN
FT                   TDAKEEAKEIFLQGLKDKKLEFLGFREVPFNPSDIGASALKAMPYFLQAFVKKPSKISA
FT                   GLEFERVLYSTRRLIEKRAINVPKFYFSSFSSRTIVYKGMLLSTQLSDFYLDFKDVNMK
FT                   SAIALVHSRFSTNTFPSWERAHPNRYMVHNGEINTIRGNVDSIRAREGLMQSEYFENLD
FT                   EIFPIIAKPSSDSAMFDNTLEFLALNGRTLEEAFMMMVPEPWHKNENMESKKRAFYEYH
FT                   SLLMEPWDGPAAIVFTDGVIMGASLDRNGFRPSRYYLTKDDMLILSSETGALKLDEKNI
FT                   KAKKRLEPGKLLLVDTARGRVIADNEIKEHYANAKPYKKWLKNLVELEKQKSGVYKHQF
FT                   LKEDEVLKLQKAFGWSYDELKMSVAAMAQNGKEAIAAMGVDTPLAILSKTYQPLYNYFK
FT                   QLFAQVTNPPLDAIREEIVTSTRIYLGSEGNLLKPDENNAKRVKIALPVISNEELFEVK
FT                   ALNKFQVKEFSILYDYSKKTLEKALDELCVKIEDEVKKGVSIIILSDKGVDEKNAYIPA
FT                   LLAVSGVHNHLVRKNLRTHTSLIIESGEPREIHHFACLLGYGATVINPYLVYESIQKLI
FT                   VNKDLDLSYEKAVENFIKASSSGIVKIASKMGVSTLQSYNGSALFECLGLSSKVIDKYF
FT                   TSTTSRIEGMDLEDFEKELIALHKHAFNDTHKALDSKGIHGFRSAKEEHLIDPLVIFNL
FT                   QQACRNKDYKSFKKYSALVDEKQVNLRSLMEFDFSEAISIDKVESVESIVKRFRTGAMS
FT                   YGSISKEAHECLAQAMNKIGAKSNSGEGGEDEERYEIKEGVDKNSAIKQVASGRFGVDL
FT                   NYLSHAKEIQIKVAQGAKPGEGGQLMGFKVYPWIAKARHSTAGVTLISPPPHHDIYSIE
FT                   DLAQLIYDLKHANKDAKISVKLVSENGIGTVAAGVAKAGANLILVSGYDGGTGASPRTS
FT                   IPHAGIPWELGLAETHQTLILNKLRDRVRLETDGKLMNGRDLAIAALLGAEEFGFATAP
FT                   LIVLGCTMMRVCHLNTCPFGIATQDTELRDRFKGKVDDVINFMYFIAEELREYMARLGF
FT                   ERLDDMIGRVDKLRQKSVQGKAGKLNLDKILKSLPTYNRTAVHFKDYKDNKLEKMIDYR
FT                   ILLPLCKNAVEKKEPIKLSLEVGNQSRTFATMLSSEILKTYGKDALDEDSIHIKAIGNA
FT                   GNSFGAFLLKGIKLEIIGDSNDYLGKGLSGGKIIAKISNEATFSPEENIIAGNACLYGA
FT                   TKGEVYLDGIAGERFCVRNSGALAVVLGTGVHGCEYMTGGQVVVLGDVGANFAAGMSGG
FT                   VVYIFGRHNEAHVNTELVDIKDLNAKDEKELKAVIEKHITYTDSKKAKDILEKFDKKDF
FT                   FKVMPRDYEKMLKMLDLCKNEKDPNLAAFLKITQ"
FT   gene            12649..14370
FT                   /locus_tag="CJJ81176_0034"
FT   CDS_pept        12649..14370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0034"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03235;
FT                   match to protein family HMM PF07510"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0034"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71931"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HG73"
FT                   /protein_id="EAQ71931.1"
FT                   /translation="MIKKVKEVLNNSIFFIPNYQRDYAWEEKNLDDLWEDLLEAEQAVS
FT                   DQMGHFLGTIVVSKNSKNPEIYDIIDGQQRITTIFMLRYALNFRTQNSQRNIVYFCDDN
FT                   DNFRLQVQDENKLFFNEVLKQAENNKINIELENKAQTQGQQKLYKVFKAIWSYVASLES
FT                   DKALKLFNIIGNMSIMWLEEQDSGKAIRMFQTVNDRGIPLLILDKLKSLLILYSNKYCK
FT                   GELDEVINERFGKIFKISMNIKKHKTIHSLGDVQFYQELEARIFNYHSLGVKEIAHYRN
FT                   SANIHYNELKRVLKNKDKTKEEFKKWLDDYSKDLLQFFETFLKILEKTQDNIEMFKIFM
FT                   ILKINPYFYSSLIRLEMNNILDDECLRLFSQAEIIFYSFGQTNDSTAFKLGEVTESKDE
FT                   FKNRIIDDCNKCIKRAGYYDINEFISEISEDNYEWGKYFHYLFLTYNNVGIEECMKLID
FT                   EKIYAFTIEHIIPQNIINNGLLKNYKFENEDDFNKLKNTFGNLIPLEKILNSICSDRSL
FT                   LDKKEYYKKSKLSCNLSFANDENFLNFEKKQIIKRNEDFTKWARKFFVDFLKITQK"
FT   gene            14381..15826
FT                   /gene="gltD"
FT                   /locus_tag="CJJ81176_0035"
FT   CDS_pept        14381..15826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="CJJ81176_0035"
FT                   /product="glutamate synthase, small subunit"
FT                   /EC_number="1.4.1.13"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01317"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0035"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71981"
FT                   /db_xref="GOA:Q1HG72"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q1HG72"
FT                   /protein_id="EAQ71981.1"
FT                   /translation="MGNTRGFLDFKRMDFKKIAPKERILNYKEFTIPLDKKEQEIQGGR
FT                   CMDCGVAFCHTGVMSEGKDVGCPLNNLIPEWSDLIYRSLWEEAYERLDLTNPFPEFTGR
FT                   VCPAPCEDSCVCAINGTSVSIKNNELSIIENAFKENLVRVNKPKQYNGKKIAIIGSGPA
FT                   GLACANTLNSLGYKVSVFERSDKIGGLLMYGIPDMKLDKSIVQRRVDLLKKSGIEFKVN
FT                   ENIDNKDKVSKLLKEFDALVLCTGASKPIDLDIEGRKLKGVEFALDFLTQNTKTLLKTG
FT                   KGADVAKGKNVLVIGSGDTSVDCIAVATRQGAKSIVRFERSPKKPLQRSQNNPWPLKAD
FT                   IFTTDYGLEEAIAVYGKDPREYQKMTKKFLGKTYVEGVEANDLKREFKEGKAINVEIPN
FT                   SKKTYKVDLVLLAMGFSGCEEAIAKNFGVKLDEKNNISTENFQTTHKKIFACGDARKGQ
FT                   SLVVWAIKDGIECALSLHQNLAK"
FT   gene            complement(15827..16402)
FT                   /gene="rnhB"
FT                   /locus_tag="CJJ81176_0036"
FT   CDS_pept        complement(15827..16402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="CJJ81176_0036"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="identified by match to protein family HMM PF01351"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0036"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71905"
FT                   /db_xref="GOA:A1VX88"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VX88"
FT                   /protein_id="EAQ71905.1"
FT                   /translation="MKTLFDTKELLNEFDINLIGIDEAGRGALAGPMMMAACKLNKQLD
FT                   GLCDSKKLSEKKREELYEIIIKNSNYLILAFSSEQIDALGLSTCLKKGLKLIKKHFKTE
FT                   NNFLYDGNTNLGINGIKTQIKADTSILQVSAASILAKVSKDRVMNFLAKDFPCYEFEKN
FT                   KAYGTKAHKEFIAKFGICKLHRKSFKLL"
FT   gene            complement(16435..16674)
FT                   /gene="comEA"
FT                   /locus_tag="CJJ81176_0037"
FT   CDS_pept        complement(16435..16674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="CJJ81176_0037"
FT                   /product="competence protein ComEA"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM TIGR00426"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0037"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71974"
FT                   /db_xref="GOA:A0A0H3PA75"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA75"
FT                   /protein_id="EAQ71974.1"
FT                   /translation="MKKLLFLFFALTAFLFGAVNINTATLKELKSLNGIGEAKAKAILE
FT                   YRKEANFTSIDDLKKVKGIGDKLFEKIKNDITVE"
FT   gene            complement(16739..17290)
FT                   /gene="rbr"
FT                   /locus_tag="CJJ81176_0038"
FT   CDS_pept        complement(16739..17290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr"
FT                   /locus_tag="CJJ81176_0038"
FT                   /product="rubrerythrin"
FT                   /note="identified by match to protein family HMM PF00301;
FT                   match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0038"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71904"
FT                   /db_xref="GOA:A0A0H3PCH2"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCH2"
FT                   /protein_id="EAQ71904.2"
FT                   /translation="MKCITTDLTAVNLMKAFAGESMARNKYDLFADVAEEEGWHAVARH
FT                   FREAAENEKWHARAEFKAYHEIVDGKPLEVTTKNLVTAAEGENYEHTTMYPNFAKIAED
FT                   EGKKAIARLFTAIGKVEIEHEREYLALKKMLEEEEFFNSEVEELWVCEVCGHIHRGKKA
FT                   PAACPLCKAPKEYFKREFLG"
FT   gene            17546..19222
FT                   /gene="ilvD"
FT                   /locus_tag="CJJ81176_0039"
FT   CDS_pept        17546..19222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="CJJ81176_0039"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0039"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72020"
FT                   /db_xref="GOA:A1VX91"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VX91"
FT                   /protein_id="EAQ72020.1"
FT                   /translation="MRSDAIKKGHLKAPNRSLLRACGLKDEDFDKPFIGVANSYIDIIP
FT                   GHYFLNDYAKIIKDEIRKNGCVPFEFNTIGVDDGIAMGHEGMLYSLPSREIIANSIETV
FT                   MNAHQLDALICIPNCDKITPGMLMGALRVNVPTIFVSGGPMASGVTKKGEKISLSSVFE
FT                   AVGAYEAKKISEEEFKDIECSACPSGGSCSGMFTANSMNTLCEAMGIALEGNGTILALS
FT                   KEREELLRKAARRICEIALDERFKIRNIITQKAVRNAMVVDMAMGGSSNTVLHMLAISR
FT                   EAGVALDIKDLNFISSKVAHIAKIAPSLNSVYMDDIHKAGGVSAVMAEISSRQGHILEL
FT                   DALTITGESLEERLKNAKIKDENIIRKVDNAYSKVGGLAILFGNLAEQGCVIKTAGIIG
FT                   ERKFKGEAVCFNSQDEAIKGIIKGKVKKGNVCVIRYEGPKGGPGMQEMLSPTSLLMGMG
FT                   LGADVALITDGRFSGATRGLSVGHISPEAAEGGLIGLLKDGDEIEIDVDAYTIHANLSE
FT                   EEITQRKKEFVLPQKEVPSRWLRMYQKLVSNASKGAVLDME"
FT   gene            complement(19234..19383)
FT                   /locus_tag="CJJ81176_0040"
FT   CDS_pept        complement(19234..19383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0040"
FT                   /product="inner membrane protein YagU"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0040"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71950"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGP5"
FT                   /protein_id="EAQ71950.1"
FT                   /translation="MPLIAEVPPLCEIPFDEHLSEIFGHIVWLWGMEIVRRDIRNRITK
FT                   EIEE"
FT   gene            complement(19349..19630)
FT                   /locus_tag="CJJ81176_0041"
FT   CDS_pept        complement(19349..19630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0041"
FT                   /product="membrane protein, putative, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0041"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72010"
FT                   /db_xref="GOA:A0A0H3PA96"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA96"
FT                   /protein_id="EAQ72010.1"
FT                   /translation="MKKYFQKRYTLAFFIGILAGIFGAIVKWGWEVPFPPRNPNVFWPA
FT                   DALERVTPPKIFLEQLGLPTERCSFWIFCLSFCPCYCNAFNCRSSTTL"
FT   gene            complement(19722..20948)
FT                   /locus_tag="CJJ81176_0042"
FT   CDS_pept        complement(19722..20948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0042"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71969"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P999"
FT                   /protein_id="EAQ71969.1"
FT                   /translation="MINIKLIEHIFKAASISRWNDYPRMANLVELDKQAHKFIIAYFIA
FT                   KMEKDVDMRVIIEGGIFEFLSRVVVTDIRPDVYHEIVRQKKAEVNAWVLSKIEPMIEDI
FT                   EDGEFLKRFEAYLNGNAYAKERLILKAASYFATRWEFNIVYQTSAFLNDIDEIKNKVEE
FT                   ELEDYYELIGARKIALNQKIAKIIDLSGRLRFQKRWAQTPRIPETAVLGHMLVVAILGY
FT                   FYSLKIKACDKRLENNFYCALFHDLPESLTRDIISPVKYGIDGLHDIINDYEMKLINER
FT                   ILPFVPEGLRAEFSYILGIREGRNGESNFVKNEFENRTYKNAKIELCSGSLSSFNENEF
FT                   GAIDGKALKYCDKIAAYIEAGLSISYGVKSKELESGFLGMHEFFKENPTIDGVNFFEIC
FT                   ESLREYFKI"
FT   gene            21025..21699
FT                   /locus_tag="CJJ81176_0043"
FT   CDS_pept        21025..21699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0043"
FT                   /product="exsB protein"
FT                   /note="identified by match to protein family HMM PF02568;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00364"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0043"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71929"
FT                   /db_xref="GOA:A1VX95"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VX95"
FT                   /protein_id="EAQ71929.1"
FT                   /translation="MSKKALCIISGGMDSTLCAYLAKKEGYEIIALHFDYEQRTQEKEK
FT                   ECFKQICKALKVEKSYILDVSFIKDIGGNALTDKSIDIPKNELCISDVPPITYVPFRNG
FT                   IFLSIAGSLAEKENCESIFIGVVEEDGSGYPDCTDEFIQKAQEFINEGTSKNFKVCIKT
FT                   PLVRLNKAKIVELALKENVPLELTWSCYESEDEACGECDSCLLRLRGFEKAGFKDKIKY
FT                   KS"
FT   gene            complement(21720..23246)
FT                   /locus_tag="CJJ81176_0044"
FT   CDS_pept        complement(21720..23246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0044"
FT                   /product="disulfide bond formation protein, DsbB family"
FT                   /note="identified by match to protein family HMM PF02600"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0044"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71919"
FT                   /db_xref="GOA:A0A0H3PCI0"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCI0"
FT                   /protein_id="EAQ71919.1"
FT                   /translation="MNEINKTKNFYTLMCLAGFLIILLPVGIANLIFGYMLGDSPCTLC
FT                   WGQREAMIFIGVMALFIVRYGMKGKYLAALLIMTAVGLYQSFAHYGNHAHRDLDQGFGL
FT                   AVFGIHTYFWAEVVFWAVVLLLGVIFAFAPKFNAFEAELNGEKFRKYTKFSFAAVLISA
FT                   IIVASNVFQAFVSTGIPPYVGQGDPVRFSLNPKYIIWSKEGWNGLWQNISFLGKRDVKA
FT                   PDYAFAPASEKLGIKFDNDINNAPFAKINDELKITNEQTINFDKAINTLDYINNEFVAS
FT                   SKWDVAFLDNNFSVKEGFELDPYFSASIDPIIGIIPYMNDKFILMGSNKSFLRFAKNPN
FT                   ASEEDIAKQYADFVKGNDKFKGQGESLGRGRLDTVRAKFNHVASMTTDGNYLYLATVPN
FT                   NKDAKTFVISKVSLKDRVLSGEFTPKANLKEGKTLGDLYVTSMTFKDGEIYALSKNHNV
FT                   IAVIDPVKEEVVKTIAFPSSITNARSIFFKDGKINILSYQDGANKLYTLN"
FT   gene            complement(23258..23425)
FT                   /locus_tag="CJJ81176_0045"
FT   CDS_pept        complement(23258..23425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0045"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0045"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71971"
FT                   /db_xref="GOA:A0A0H3P9M0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9M0"
FT                   /protein_id="EAQ71971.1"
FT                   /translation="MEFLELLLVLIALILIIKKPEKENLAFGLVMVAWLLMVFFYVGHK
FT                   TGALLTIMNL"
FT   gene            complement(23531..25285)
FT                   /locus_tag="CJJ81176_0046"
FT   CDS_pept        complement(23531..25285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0046"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0046"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71906"
FT                   /db_xref="GOA:A0A0H3P9J9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9J9"
FT                   /protein_id="EAQ71906.2"
FT                   /translation="MIKFIILSTLVLAFILVLLGIIFNNYSSSKDNKELINIVQQLEIS
FT                   DEKINSVFQNSFNFINYDPSVQAIKKMQENFTKLKTFGIDINKAEEIFNAKLIQLNYFK
FT                   SANSIAVNSKLYLFELAKNYFEELEQNHETNKNNYKTMSSMLSVLSTENILQKTTLNQL
FT                   NNLMKEIKNDTKSENLQLFLKHYNMIVKQISIMQDNSSIYENNSLMKELKQLNTFTQNT
FT                   IEQSNLFKFYIALAVFGITLVLFVFFILLTLKKVIMPIHTLEKLSANLASKEANLHSRL
FT                   NIEPKSELGQSAQYINSFISTVQNSIIEAIENAKSSHQNSQKLKNNSMMLENSSNSQHE
FT                   QIQGVKEITHVLDDHINLAGNLAQESIENMQDMHILMDKVELTLSELVNLINENNEKEQ
FT                   NIVANMDNLTQSADNIIEITNSIKDIADQTNLLALNAAIEAARAGEHGRGFAVVADEVG
FT                   QLADKTSKSLLNINATVNTIVQQINDNKALMDLIHDSMKETSSKTNDLQQELVNSMHKL
FT                   ESSIESTQTMKDKSMEVKDKMLILGTNIDKVNELANSVKDLSCEINNISQNVLNGASKL
FT                   SEKLSSFQ"
FT   gene            complement(25299..26213)
FT                   /gene="ccpA-1"
FT                   /locus_tag="CJJ81176_0047"
FT   CDS_pept        complement(25299..26213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA-1"
FT                   /locus_tag="CJJ81176_0047"
FT                   /product="cytochrome c551 peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0047"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71899"
FT                   /db_xref="GOA:A0A0H3PCG8"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCG8"
FT                   /protein_id="EAQ71899.1"
FT                   /translation="MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMD
FT                   KSLSKDGKVSCNTCHRLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRA
FT                   KDLAEQATVPFFNPKEMGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAIAEFEK
FT                   TLITPNSPFDRYLSGDQNAISAQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEY
FT                   PNQEDLGRYEITKREADKMVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKF
FT                   LDQETVDNIVAFLESLTGEYHDK"
FT   gene            complement(26277..27155)
FT                   /locus_tag="CJJ81176_0048"
FT   CDS_pept        complement(26277..27155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0048"
FT                   /product="fumarylacetoacetate hydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01557"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0048"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71978"
FT                   /db_xref="GOA:A0A0H3P9M3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9M3"
FT                   /protein_id="EAQ71978.1"
FT                   /translation="MKFVNFIQGQKHNLGVLNSSGKIVSFTDLGIETNDMNEFIIYFDK
FT                   FKHKLTDLDSKIAYEIPKENYLAPIIEPRQDIICLGINFLDHAKESAKFKGEKFEEREY
FT                   PVYFGKRCNQATAPFGDIPLHADVTSQLDYECELAFILSKDAYKIKAKDAKDYIFGYTI
FT                   INEISARELQKRHKQFYRAKSLEGSTIMGPYITSVDEISYPPKLQLQSYVNDELRQNSN
FT                   TQLFIFDIAYVLEELSAGMLLKAGSIISMGTPSGVGMGLNPPTFLKSGDKVRCVIENLG
FT                   ELCNKIKNINY"
FT   gene            complement(27267..28169)
FT                   /locus_tag="CJJ81176_0049"
FT   CDS_pept        complement(27267..28169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0049"
FT                   /product="RNA pseudouridine synthase family protein"
FT                   /note="identified by match to protein family HMM PF00849"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0049"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72031"
FT                   /db_xref="GOA:A0A0H3P9P1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9P1"
FT                   /protein_id="EAQ72031.2"
FT                   /translation="MAYIKIKLSNNGKKAFQVLMENLKISINEAQKLIDKKRLFCDGIL
FT                   VEEKNKILNGLVELIVYENNPKGVEIVFENEDFAILEKESGILSHPNGRHCKYSLSDEI
FT                   WHLWGKEACVAHRLDKETSGLILIAKNKKAQIDLKSLFEKKLVQKEYLALAHGKIEENF
FT                   IVDKAINLTKNYDDVKTRMQICKEGKQAITEFEILEYFPKINATLLLCKPLTGRQHQIR
FT                   VHLHYKNHTILGDPLYGLSKQQIESILDEKLNPKERLKLTGALRLCLHSYRLKFQYKNQ
FT                   NFDINSKINIKEIFNNSIK"
FT   gene            28247..29575
FT                   /gene="purB-1"
FT                   /locus_tag="CJJ81176_0050"
FT   CDS_pept        28247..29575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purB-1"
FT                   /locus_tag="CJJ81176_0050"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00928"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0050"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71984"
FT                   /db_xref="GOA:A0A0H3P9M5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9M5"
FT                   /protein_id="EAQ71984.1"
FT                   /translation="MVERYSREIMAKKWDMQAKYDAWLKVELAAVKAWNKLGLIDDTDC
FT                   EKILKNAKFDIARIDEIEKTTKHDVIAFLTSVSESLGEESRFVHYAMTSSDCIDTAVAL
FT                   QIKESLELILEDVSLLLEAIKKRALEHKNTLMVGRSHGIHGEPITFGLVLAIWYDEISH
FT                   AKELLEHAKEVISYGKISGAMGNFAHAPLEFEEEVCKNLGLKAAPVSNQVIQRDRYAQV
FT                   ISAIAILASSCEQIAVAIRHFQRTEVYEAEEYFSVGQKGSSAMPHKRNPVLSENITGLC
FT                   RVLRSFVTPALENVALWHERDISHSSVERFILPDAFITADFMLMRLTNLIDKLLVYPEN
FT                   MMKNLNLTGGLVFSGRVLLELPFKGISREEAYKIVQRNAMKVWADLQNGKAAINEKNES
FT                   LFLLALLSDEDLRKSLSEEDVRKCFDYNYYTKNVDAIFKRTFK"
FT   gene            29591..31960
FT                   /gene="nrdA"
FT                   /locus_tag="CJJ81176_0051"
FT   CDS_pept        29591..31960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="CJJ81176_0051"
FT                   /product="ribonucleoside-diphosphate reductase, alpha
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00317;
FT                   match to protein family HMM PF02867; match to protein
FT                   family HMM PF03477; match to protein family HMM TIGR02506"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0051"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71983"
FT                   /db_xref="GOA:A0A0H3PCL7"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCL7"
FT                   /protein_id="EAQ71983.1"
FT                   /translation="MKVIKRNGRTEELDVSKIKKCTSDAVKDLEGVNLSELELDAKIQF
FT                   RDGISTEEIQKTLIKTAVDKIDIDCPNWTFVAARLFLFDLYKKVNGMNRYNHLREYFQK
FT                   GEKEGRILLGLKEKYDLDDLNAYIKPERDMQFTYLGIKTLYDRYLIKDSKGMPIELPQQ
FT                   MFMAIAMFLAQNEFNPQEWAKKFYDLISKFELMLATPTLSNARTTRHQLSSCYIGSTPD
FT                   NIEGIFDSYQEMALLSKFGGGIGWDWSKVRAMGGSIDGHKNAAGGIIPFLKITNDIAVA
FT                   VDQLGTRKGAIAVYIEPWHMDISDFIDLRKNSGEERRRAHELFPALWINDLFMKRVRAN
FT                   DKWTLFDPADTADLCDLYGEAFEKRYEEYEKDESITKEIVEAKELWKKILLNYFETGLP
FT                   FLCFKDSANRANPNAHVGIIRSSNLCTEIFQNTEPNYYQIKVVFENGDELHFDEEQKVA
FT                   IDGGYEKPAKKISTLDSIDGNKVYIVEKYKNDGKTAVCNLASINLSKVYTKEDIERVVP
FT                   TAIRMLDNVIDLNFYPHRKVKDTNLKSRAIGLGVMGEAQMLAEAKIYWGSDEHLNKIDE
FT                   IMEQISFEAINASSNLALEKGSYEDFEGSNWSKGIFPIDVASPKAKALTLREGLFDQSE
FT                   CDWVKLREKVKKDGMRNGYLMAIAPTSSISILVGTTQTIEPVYKRKWFEQNLSGMIPVV
FT                   VPNLSLDTWQYYTPAYELDQKILVKAAAVRGKWIDQGQSLNIFLSLDKASGGYLNEIYQ
FT                   LAWELGVKSTYYLRSESPDSEKVNVADRSIECEGCQ"
FT   gene            complement(31999..33384)
FT                   /locus_tag="CJJ81176_0052"
FT   CDS_pept        complement(31999..33384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0052"
FT                   /product="sodium/dicarboxylate symporter"
FT                   /note="identified by match to protein family HMM PF00375"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0052"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72029"
FT                   /db_xref="GOA:A0A0H3P9A9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A9"
FT                   /protein_id="EAQ72029.1"
FT                   /translation="MDKQFFQDFLMLSQAHTITTLAMLCVVFYALKKMRDIKINFSLRM
FT                   LFALLMGLGFGFALQYLANFPDAKEASNILWYSETKHWFAFVSSVFVAFIKMLVVPLVS
FT                   ICIIKVIIEIDKNIKISSLLGISLFWILFSTAIAATLGIFLGYSFDLGSNFAIYEGNKQ
FT                   IREIQTFSNIILGLIPSNIIAAINKENIIAIVIFSFFIGISAKKISKKEEYEQAFKSFH
FT                   NFILTFYNIMMNMTATVIRFMPYAVVCMMANVLLSNGFEAIKTAGLFIMLIYIAMLIMF
FT                   GVHFLLLASQGLNPIKYAKKAFPVWLFAFSSRSSLGTLPMTTSTLQNKFGVNSAIANFV
FT                   ASIGTTTGLNGCAGYFPALAAVFVAFATHTHIDFTFALMIVLVAVIGSLGIAGVPGSAT
FT                   MAASIMLAGIGFGNNFVMLSLILAIDPIIDMARTASNVSGAMTSALCTAKNLKALDKEI
FT                   YNS"
FT   gene            complement(33504..34127)
FT                   /gene="thyX"
FT                   /locus_tag="CJJ81176_0053"
FT   CDS_pept        complement(33504..34127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyX"
FT                   /locus_tag="CJJ81176_0053"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="identified by match to protein family HMM PF02511;
FT                   match to protein family HMM TIGR02170"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0053"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71986"
FT                   /db_xref="GOA:A0A0H3PA81"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA81"
FT                   /protein_id="EAQ71986.1"
FT                   /translation="MQITLLFHTPLSVCSHATRTCWQSFEKGDCGGEKDKELIDRVGNK
FT                   FKHASTLEHLNYTFYIQGISRACLQEVARHRHTSPSVKSTRYTLKELRNEAEFKIGDFE
FT                   NASRYLVLCGNEEVDNASIKALENLRTILQKSISLDIAKYCLPESYKTELTLTINARSL
FT                   QNFISLRSSKSALWEIRNLANALFEALPQEHKFIFEHCLHKDIE"
FT   gene            34247..35878
FT                   /gene="pyrG"
FT                   /locus_tag="CJJ81176_0054"
FT   CDS_pept        34247..35878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="CJJ81176_0054"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF06418; match to protein
FT                   family HMM TIGR00337"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0054"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72004"
FT                   /db_xref="GOA:A1VXA6"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXA6"
FT                   /protein_id="EAQ72004.1"
FT                   /translation="MKQTKYIFVTGGVLSSLGKGIAAASIATLLKNSGLKVSILKADPY
FT                   INVDPGTMSPFEHGEVFVTDDGAETDLDLGHYERFLDESLSQDNNFTTGRVYQSVIEKE
FT                   RRGEYLGKTIQVIPHIVGEIKDRIKKAGEGKDILIVEIGGTVGDIEGLPFLEAIRALRL
FT                   EVGKNNAMNIHLTLVPFIKAAGELKTKPTQHSVGELRRIGISPDMIICRSEKALDRDLK
FT                   DKIAISCGVEKNCVIESVDAASIYQIPLNFLKQDILSPIAEILDLKNLKPNMENWDSLV
FT                   KRVIAPSNEVKIAFVGKYVDLKESYKSLTEAIIHAGAALDTKVELKWVDSEKLENMESS
FT                   EVFKDVSGILVAGGFGYRGVEGKIKAIQYARENKIPFLGICLGMQLALVEFARNVLKLK
FT                   DANSSEFNEKCQNPVVYLIDEFMDTNGEKQIRTAKTPLGGTMRLGAYKCDIKEKSLLAK
FT                   VYNEVKSVKERHRHRYEANPKYRADFEKHGLIVSGESKGLIEAVELNCHPFFLAVQFHP
FT                   EFTSRLEHVNPVICSFIKAAINYEDN"
FT   gene            35865..37436
FT                   /gene="recJ"
FT                   /locus_tag="CJJ81176_0055"
FT   CDS_pept        35865..37436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="CJJ81176_0055"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /EC_number="3.1.-.-"
FT                   /note="identified by match to protein family HMM PF01368;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM TIGR00644"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0055"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71903"
FT                   /db_xref="GOA:A0A0H3P989"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P989"
FT                   /protein_id="EAQ71903.1"
FT                   /translation="MKIINKNEIKKILASRFEKDLHTKLCDLPLPCCLKDAYKAANRIK
FT                   EAVEKNEKVAIVGDYDVDGIISCVIMAEFFDDIGFDYIIRIPNRFKDGYGLNAEIINEL
FT                   DVNLIITVDNGIAALEAAKLCKEKNIDLIITDHHMPQDVLPDAFAIINPKQKDCDFPEI
FT                   EICGAQVAWYLIAALKEVCKLKYDMCKFLELLAIAIVADMMELRDLNRALVRRGIDHIN
FT                   KSKRAAFRAIKHYYQKDKFALDNIGFLIAPLINSAGRMDDASISYEFLHTKDFNKALEY
FT                   LEQIVSFNESRKDEEKQLFEDSLNQIDENDSCIVVSGLNWHEGVLGIVASRLAKHFNKP
FT                   AFVFSQNEEHLKGSARSVGKIDILALISKTNSILSNYGGHKGAAGISLNSENFEQFKNK
FT                   IKKECSQISESEFLDTDEILGILEPSEIDFEMLEILESFEPFGHKNPRPFFVLENLCVK
FT                   NKKLLGKDEKHLKLVLTKENKTIEALFFNFDKEPELNQNISLLGSISKNEFRGMVTPQF
FT                   VIKEIL"
FT   gene            37522..38568
FT                   /gene="ansA"
FT                   /locus_tag="CJJ81176_0056"
FT   CDS_pept        37522..38568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="CJJ81176_0056"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="identified by match to protein family HMM PF00710;
FT                   match to protein family HMM TIGR00520"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0056"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71964"
FT                   /db_xref="GOA:A0A0H3PCK6"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCK6"
FT                   /protein_id="EAQ71964.1"
FT                   /translation="MKKLLLCVLVFLSIGACMAEAKPKIAILATGGTIAGSIDSAVATT
FT                   GYTAGVVGVDVLIKAVPQIQDLANISGEQIANIDSSNMRDEIWLKLAKEINKLFAEGVD
FT                   GVVITHGTDTMEETAYFLNLTIKSDKPVVLVGAMRPSTAISADGPKNLYNAVALAADKE
FT                   SKGKGVMVAMNDKILSARGVVKTHSLNVDAFSSPDFGDLGYIVDGKVFFYNNVIKAHTK
FT                   NAPFDVSKLTSLPKVDILYSYSNDGSGVAAKALFEHGTKGIVVAGSGAGSIHEDQKNVL
FT                   KELMKKGLNVVVSSRVVAGRVAVSDSDEKLGFISAEDLNPQKARVLLMLALTKTSDPKK
FT                   IQEYFLKY"
FT   gene            39155..40667
FT                   /gene="rrsA"
FT                   /locus_tag="CJJ81176_1704"
FT   rRNA            39155..40667
FT                   /gene="rrsA"
FT                   /locus_tag="CJJ81176_1704"
FT                   /product="16S ribosomal RNA"
FT   gene            40772..40847
FT                   /locus_tag="CJJ81176_1705"
FT   tRNA            40772..40847
FT                   /locus_tag="CJJ81176_1705"
FT                   /product="tRNA-Ala"
FT   gene            40856..40932
FT                   /locus_tag="CJJ81176_1706"
FT   tRNA            40856..40932
FT                   /locus_tag="CJJ81176_1706"
FT                   /product="tRNA-Ile"
FT   gene            41513..44306
FT                   /gene="rrlA"
FT                   /locus_tag="CJJ81176_1707"
FT   rRNA            41513..44306
FT                   /gene="rrlA"
FT                   /locus_tag="CJJ81176_1707"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(44542..44694)
FT                   /locus_tag="CJJ81176_0061"
FT   CDS_pept        complement(44542..44694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0061"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0061"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71914"
FT                   /db_xref="GOA:A0A0H3PGM7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGM7"
FT                   /protein_id="EAQ71914.1"
FT                   /translation="MNLRIKLNLFISLLFSLFSFFFCFSLFFSYLLSLISFYIEYLKNN
FT                   VKSKF"
FT   gene            44720..44839
FT                   /gene="rrfA"
FT                   /locus_tag="CJJ81176_1708"
FT   rRNA            44720..44839
FT                   /gene="rrfA"
FT                   /locus_tag="CJJ81176_1708"
FT                   /product="5S ribosomal RNA"
FT   gene            45264..47234
FT                   /locus_tag="CJJ81176_0063"
FT   CDS_pept        45264..47234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0063"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71979"
FT                   /db_xref="GOA:A0A0H3PGR5"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR032897"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGR5"
FT                   /protein_id="EAQ71979.1"
FT                   /translation="MKKLISKGKVLTLLLGVGFALNVSSAENSNVLIQGEAAQDGDTKP
FT                   RTLEGYVHQEDAFFKYLKEHHPMFKYEKEGRIVGKYAISDREEEYVEFSNGPTFAQQNN
FT                   LAHTSVTYRLGMESFLDFPNKFVGPKKCGECHPAQYKAWERSRHAKTVRFPDEFEEVGN
FT                   DLKKPMYNSQSTILPDGIYPDDVYAVIGTPRTKYGFIDRWLVRGTYHVEDGNLSNMTGK
FT                   IVAGGNQFSRLWSEFLTPEMTKKIAEFSPGFPTTMEQFGGNGSQVWGTNSYAAQYRKNM
FT                   LFQPASSYCETCHSFKFDFKSKEEFYKALGNTQELRKHTISKGISCEECHGAGAHLYGA
FT                   RGAGMPSNCERCHQRFSYNEEDAKKNPRKPFNAFFKSSCPACGTEGAQMYSSAHYDKGM
FT                   RCSTCHDPHEVTFNDWKDGYTKVGLKKTCTDCHDTQASFFKQGGIHSKDNCTACHMPNM
FT                   MSCENFGAVQNPDKGGFDNVRASHIWKIKVDKTAKTLNPPEGKERSPKTPGWTIARDDD
FT                   GRFFLDLMWACGRTSFSDPNLMGPGASGCHSAVQSNLPKKLHFTDQETIYDIVVGWQKP
FT                   VKDGYENILKGVKEIDKAMAENPKLSVEKKSRVITLANQARAIAEKLQKDGSWGVHGPV
FT                   YSKKIVDEALVYIQEAKNILK"
FT   gene            47275..49344
FT                   /locus_tag="CJJ81176_0064"
FT   CDS_pept        47275..49344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0064"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0064"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72022"
FT                   /db_xref="GOA:A0A0H3P9A8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A8"
FT                   /protein_id="EAQ72022.1"
FT                   /translation="MKQSLIKFILLAVFCFSTPFLLADGKIQIGIVEGVTPISMKDAEK
FT                   LLGQKNVYFVDVNSKEEREVAGNIPNAVLVDAQNWQNLLPDDFNATLIFYGSNRFTFDA
FT                   SNIANLSQKLGYTHVYVMLDGIESWVLSGRKVQKEQIEKWQNAKNLDDFKDSIHSRMYF
FT                   GDVPSCRDCHGKGEDKKSIRYNNAANLDLINKNCASCHKDVDKEFKHSIHQNISQIQLD
FT                   KDGKKKKIPTCTTCHDIHNNDPLMNAMTLKQRSDFKCGECHQDKQDRYHDTFHGKAMVL
FT                   NSPGSAPKIAACYDCHGKHNILKVEDLNSTLSSLNRVQTCAQCHPNSNENFANFIAHAD
FT                   HSDGENYPLLHGAYIFMTALVIGVFVFFGLHTLLWSIRLILARLSHPIEWKKAKENAHN
FT                   DKILIKRFSTFHKIQHFFMAASFLGLAFSGLPQKFYTAPWAQTMIDLMGGPIGATIVHH
FT                   ISAIVMFIVFFSHIGEIILVNWKRRDLVRDPQTGKLDKMKILKALFGPDSLMPNWQDFK
FT                   DMKAHFKWFFGMGERPQFDRWTYWEKFDYLAVFWGMFVIGLSGLVLWFPTFFSAFLPGW
FT                   MINLCSLVHSDEALLATGFIFAIHFFNTHFRADRFPMDMVIFSGTQSEAEIKQERNAYY
FT                   QRLKESGRLESLYEKNSKFNSYKGIAKLAGYLMLITGMIFLFLMIYAFIVDLLK"
FT   gene            49388..49972
FT                   /locus_tag="CJJ81176_0065"
FT   CDS_pept        49388..49972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0065"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71952"
FT                   /db_xref="GOA:A0A0H3P996"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P996"
FT                   /protein_id="EAQ71952.1"
FT                   /translation="MLKKLILGFIILLFCACNDEKIDENILSKGTKTTEQYKQDANNLD
FT                   LNSYKEIAEFFKDNQNIVFSDKPVLIIFSANNCVYCDKLKHEIQNDKEVQNILKNTYNS
FT                   YYINTSYHKIHNYDNKKTSTEELSREFNIDATPTLVFFTPKHKTLLIYPGFMSAKRLAL
FT                   TMEILKDEKNQKLNEDELFKTLFLAYKEKNV"
FT   gene            49965..52670
FT                   /locus_tag="CJJ81176_0066"
FT   CDS_pept        49965..52670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0066"
FT                   /product="cytochrome c biogenesis protein"
FT                   /note="identified by match to protein family HMM PF01578"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0066"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72011"
FT                   /db_xref="GOA:A0A0H3P9A6"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A6"
FT                   /protein_id="EAQ72011.1"
FT                   /translation="MFKKIFFSFWMSLILLFIYALSCAVATFVENDFGTNAAKALVYNA
FT                   LWFDILHLLLLINLIGIIFIHKLLQRKKYASLLLHSAFIVILLGAAITRYFGIEGGMHI
FT                   REGQSSDIIVTRDEFIALMLYNDEGKVVEYQSFGVAFNPLLHNSFEKKVSMQQNKTINL
FT                   KLLDYEKAPNAMSNPIIKMQISFNNESKEILLTPNYNNENVLPFRLGGEIFALNWGPEE
FT                   IKLPFSLALKDFILDRYAGSMSPSSYASDIEVIDQDKSFEYKIFMNNVLDYGGYRFFQS
FT                   SYDQDEQGTILSVNKDPGKIPTYIGYTLLTLGFLWILFAKNSRFQKLSNYLKNQKNLLL
FT                   ILFCLFAFNIKSFADENTLKLIQNIKENSAKHSMLFGSLLVQDFDGRIKPIDTLAMNYI
FT                   HKITKKNDFLGLNYNQIFLGMMMYPQHFRQIKMISVKTAKLKEILGVDKNEKYLAYDDV
FT                   FDGDFYKLSNYIEEANRKKPALRDQFDKDILALDEKINTAFYIYSGEIFRIFPDPSQKT
FT                   YTWYSPATPMPFDLKDIENIQSLLAKYFFDFEQALSTKDFSKADESLERLKNFQNFYGS
FT                   NLIPTPTQISLELFLNHYNIFDNLTPIYLLLGSMLFILLVYEILSLKKAPKMLKNAIFI
FT                   LIALSVLAHALALIFRWYVGDHAPWSNAYESMVYIAFACAFAGLVFYKRSSLALCTASI
FT                   MAGISLFVAHLGFMDPQITNLVPVLKSYWLNIHVSIITASYGFLGLCFLLGVFSLILFM
FT                   LRNPKKAQIDQSILNLHCINEMAMIIGLALLTIGNFLGGVWANESWGRYWGWDSKETWA
FT                   LISIIVYTMILHLRFISKFNNPYAFASASVIGFYSILMTYFGVNFYLSGLHSYATGDPV
FT                   PVPKFLYFFIAFTVILILGAFFKRKLKSPA"
FT   gene            complement(52705..54375)
FT                   /gene="ggt"
FT                   /locus_tag="CJJ81176_0067"
FT   CDS_pept        complement(52705..54375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="CJJ81176_0067"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0067"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71956"
FT                   /db_xref="GOA:A0A0H3PA64"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA64"
FT                   /protein_id="EAQ71956.1"
FT                   /translation="MRYLAIFAISITLSFGAANPPIQDRTGTGLVLSSHELANKIGKEV
FT                   LDKGGNAIDAAIAVGYALAVVHPAAGNIGGGGFAVIHLANGENTTLDFREMAPLKASRD
FT                   MYLDSKGEIIKDASTIGYLAAGVPGTVKGMSAMLDRYGTMKLKDLMAPAIKLAEKGYLI
FT                   NDRQEQTMLEAKDMFKEFPSSSKYFLKKDGSTYKSGDLFVQKDLAKTLKLIAKEGPDAF
FT                   YKGKIADLIAADMAKNKGIITKEDLAQYQAIWRKPVEGTYRGYDIISMSPPSSGGAHII
FT                   EILNIMENANIENLGFASSKTLHIMAEAMRQAYADRSEYMGDPDFVKIPLDKLTSKEYA
FT                   KEIYAKIPKDKALPSSKVKPGLGQIHEGHNTTHYSVLDSKGNAVSITYTINASYGSGAT
FT                   VEGAGFLLNDEMDDFSIKPGVPNLYGLVGGEANAIEPKKRPLSSMSPTIILKDGKVFMV
FT                   VGSPGGSRIITTVLQVISNVIDHKMDISTAVESPRFHMQWLPDEIRTEPFGIIKDVQNN
FT                   LEKMGYKITKEPYMGDVNAIMVDPKTGKIIGSMDTRKEF"
FT   gene            54605..58339
FT                   /locus_tag="CJJ81176_0068"
FT   CDS_pept        54605..58339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0068"
FT                   /product="type II restriction-modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0068"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71930"
FT                   /db_xref="GOA:A0A0H3P9K6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR025931"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9K6"
FT                   /protein_id="EAQ71930.1"
FT                   /translation="MKFEAINEKEFLNPYHRKKPILETELNEFIKTLKDYKINLENNLK
FT                   NNEDSLVANALSKFFENLSFQCEVKSIHKGNSGIDLALKKDGLTQVIIEAKLPNSREFF
FT                   SPSKPNCKALHECILYYLRERKALNSSLKHIIITDFYSFFIFKADLFEELFNKNKYFKE
FT                   AFENFESKNSLFKGNTDEIYKEFEKILNGDSTLKGLFVDLKPILEQDKLSFSKLKPLFK
FT                   IFSKDCLLGEFNPNDANSLNNAFYKELLYILGLYESKQNSKLIITKSEESKEEQGTFYT
FT                   AINSKLKEENFETILKLLILWLNRILFLKLIESNLVRFNDDKNLKFLNFKKIPDFDKLS
FT                   ELFFEVLAKEKSTRKKSEFAYLPYLNSSLFEKQSIENTLEISSLSNDLKLFYYKNTVLK
FT                   DDKCKAKKGQVGLLEYLFEFLDSFDFGSDDEQSEILSQKELISSSVLGNVFEKLNGYKE
FT                   GSFYTPSFITSYMCKESITKVVLDKFNAQFDLDAKDISELRRSLRKEDKKAQKELLNSI
FT                   KICDPAVGSGHFLVSALNVMLSIYDELNLFDEEFYLEVQNDEILITGRKGEFIEYKRPK
FT                   TPKDKAHLIQQELFHTKKDIIENNLFGVDINPNSCEITKLRLWIELLKHSFYQSFDDET
FT                   YHDLKTLPNIDINIKCGNSLVSYFETGKSLNHYPNIKERMGKYKRIVKDYKEGFYTDKS
FT                   RINQEIKNLKISFKNFCFADKFKKEMKGFNDKCEKYSKKYGNFLAVDDENLKFFVSANL
FT                   TLFDFDEKEATKEFANLKKEYDNIFNLESNHPFEWRFEFPEILDDDGNFKGFDLIIGNP
FT                   PYIRQEELKELKPHLAKNYKVYKGTSDIYTYFYELGFNVLKDRGGVLSYITSNKYTRAG
FT                   YGEALREFLLKNVKFLEYTDLNGIKVFDSATVDTSILCFEKSKSKDNKFKYLALSNEIL
FT                   KTCAYDIGLYKDFAEFSQNSLSKESFTFSDENTSALKAKIERIGTPLKEWHGLNIYRGI
FT                   LTGYNEAFIITTEKRNEILANCKDEAEKERTAKLIRKMLRGRDIKRYSYEWAGLWVINT
FT                   HNGYKNQNGEKVEAINIENYPSLKKHFDEFYPQLEKRADKGLTPYNLRNCAYIEEFEKE
FT                   KIVYPCIMAKEPCFSYETSFAFAMAPANIITSNSDILKYILAFLNSDFIYLMLRKFYMG
FT                   GGIEGELKTNNLEKLPIPKINSKNQKLADELINLVDKILKAKEQDKNANTQELENKINS
FT                   LVYKLYNLTEEEIKIIEGK"
FT   gene            58339..59223
FT                   /locus_tag="CJJ81176_0069"
FT   CDS_pept        58339..59223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0069"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCM2"
FT                   /protein_id="EAQ71988.1"
FT                   /translation="MERKIYNIKRGWLFKTKRDFAKRWNIEIEDRFYERCITLIGDIIN
FT                   PKQLSELEQKIFLIVGEIYKGEKKFSGVISIFNHFNGLHDSYFAFHETALYSLLMQLKD
FT                   VKFLEALENIINFCKKDKDDEFLLTFNDIVLMSNKPFRLYYNDKYEFHPSNIEIFDQVL
FT                   INDVLEFLKDYPKAKKQLSEALKIFITKENYRDVVDKTRLSLELFLTQLLNNEKSLENQ
FT                   KDEILRYFGNLLDENFKKMFLEILNYYQRLNNNRAKHCKSNGQEFKDYEVEFLIYLVGN
FT                   FLQLFMTFNKFKK"
FT   gene            59461..60903
FT                   /locus_tag="CJJ81176_0070"
FT   CDS_pept        59461..60903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0070"
FT                   /product="transglycosylase domain protein"
FT                   /note="identified by match to protein family HMM PF00912"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0070"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72027"
FT                   /db_xref="GOA:A0A0H3PGV0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGV0"
FT                   /protein_id="EAQ72027.1"
FT                   /translation="MKNYNKVLKTKKTENFSNSKNYEEQVVNWQQYFPTYHFDYKKNRD
FT                   IALEEYKFCCKILESEERIFDNLIKYMLTFGTIIISLLSGASEKIKAIFKDVTENPNYI
FT                   IWFIIALVLLFFIFMTKNFAEKQKSIIFAKRKIIILRRMLGMDYGTQEFLFKKGMLEGA
FT                   NMPFSIKLRFNYLYHIIPILCVTALLIIIHMFLGYSLMYAIVFNSIIIIALYLFYIYCI
FT                   LDINETILLVIIRILFSRLGINFVDNFEHVLYRAKLSAYECKRQKIDLDNLKKILVAIE
FT                   DQKFYQHKGVDFKALCRALLSRGRKIPFFNKISFIKNIPFTGGSTITQQLFRTLFIENM
FT                   NKKRYRRKIAEILLSYLWFNKILSKEEQLEIYLSAVRFDKKIFGIMQAIRHFYGGDKYI
FT                   KNLSKAQSFFLIERVSVTSGTMLPKVIDTIVRLEKEKILNKEDIEDIIKIYTKAQQDNK
FT                   ITVFFKNRNILEELSKKYKHQN"
FT   gene            61018..62559
FT                   /locus_tag="CJJ81176_0071"
FT   CDS_pept        61018..62559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0071"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0071"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71957"
FT                   /db_xref="GOA:A0A0H3P997"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P997"
FT                   /protein_id="EAQ71957.1"
FT                   /translation="MTNTQINDKILELANYLKIDNKCVAHNARLQSIQINGAVIKNFSF
FT                   KLFNEYKLSFFNCKFLCEINEAPGFFEIENPVYIYGCTFEENVISYNIKFKSNVVIAYC
FT                   RFNKNFYFEANTFCNSSNFERNFYNYASFKKSHFEKNVTFYNSTFKGLDFSQAIFNENL
FT                   NIVNTKLNFTFSNLEEKIEQEYEEFNKNKKEEDQKSLDKFANDFRDSFRTFKSALIKDN
FT                   NALDASNFHKYELYCKEIELKQNWDKKGENVKNTTDLEKNVSRIRDFMDFLLLGFYRKL
FT                   CDHHTDFLKVFNNLILLIALYALFVFGFTWLHDDKLEDTRAILTLFGFFDKFRLYFDII
FT                   STIFVVFGCGFFVCKLDSYEKKNNVSKKQNINFIYIIGDFLNLIKSLLFASFIPCVFYG
FT                   LFSLFGFFLNLGKDFGYSLLINTLFVSLYICLVYTKSLFFGRYVVLIFSYIVFIIMLIK
FT                   QPNVIHPLIGKIANESDKFFNYPSLIVLNILYTILLALVLFSLQKTARKNSIVPS"
FT   gene            complement(62588..63289)
FT                   /locus_tag="CJJ81176_0072"
FT   CDS_pept        complement(62588..63289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0072"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04402"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0072"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71928"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="InterPro:IPR016907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCI2"
FT                   /protein_id="EAQ71928.1"
FT                   /translation="MKTNNIFMALAIVLASLILAFGFNKALSDFKTLERSVSVKGLSQK
FT                   EVEADTLILPIKFTRSNNNLTNLYEELEQDKENIIKFLKEQGVKEDEISYNSPNIIDRL
FT                   SDPYGNDTQATYRYIGTANLLIYTQNVKLGKSILENISSLAKFGIVTKIDNYDIEYLYT
FT                   KLNDIKPQMIEEATLNARNAAIKFAQDSNSHLGKIKKASQGQFSISNRDKNTPYIKTIR
FT                   VVSTIEYYLKD"
FT   gene            complement(63276..64487)
FT                   /locus_tag="CJJ81176_0073"
FT   CDS_pept        complement(63276..64487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0073"
FT                   /product="drug resistance transporter, Bcr/CflA family"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00710"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0073"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71913"
FT                   /db_xref="GOA:A0A0H3P9K2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9K2"
FT                   /protein_id="EAQ71913.1"
FT                   /translation="MQKHTKIHGFAKFKLIVILALMSSIAPLSTDMYLPALSHVEQSFQ
FT                   TNSFLTQLSIASFFIAFALGQLIYGPLSDIFGRKIPALVGIFFFIVSSLFCVIIDDIYA
FT                   FIALRFFEALGGCAGVVIARAIVNDLFEIKEAAGIFALMMVFSSLAPMLSPTFGGFLLE
FT                   YFSWHSIFATLFALGILLFLMILFGLKESAPHLKNKKFSHHEAMKSYKFVLSDKRFLVY
FT                   ILCASFALAAMFAYITGSSFVFTQFFGLSEQKFALLFGANALGFVICANINARLVLKYE
FT                   SEKILAKALMIMFISTVILLVNAFFHPNFLLFELSIFTSIAMLGFIAPNTTTLAMARFK
FT                   EHSGTASAVLGTVQFGFAGLISFVVGAINANTPIILAFVMCACVLVANMIYFLIKIKEK
FT                   NENK"
FT   gene            64590..65939
FT                   /locus_tag="CJJ81176_0074"
FT   CDS_pept        64590..65939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0074"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71953"
FT                   /db_xref="InterPro:IPR019219"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCJ6"
FT                   /protein_id="EAQ71953.1"
FT                   /translation="MQNLNQNEQIKCPSCGSFIDISTALYAQILDKAKQEMLKQKKEFD
FT                   DEVNAKRAEYTKALNDLKTQKIEQEKLINEQVSQKLLLEKQKFEQELLAQKQNFQKEFS
FT                   EKFNKEHENEMKIMQEELEKKSKELSEFLSIKAENERLKREQKENEERLKFQAKEEAFK
FT                   EFKEQESKNLEFEREKMRLEFQKSTQEQDLKYKELETNFKSVAQKLEDAQRRIEQGSQQ
FT                   LQGEAAELLIEEYIQSEYLSDEVKEVPKGVNGADCLHIVKDNFGNICGSILYESKRTKE
FT                   FNKEWLDKLKLDSIAAKSDIAVLITKTMPKDKEKTHFKEGILICTFNEFKGVLAVLRES
FT                   IINAYKLKNALQNKDEKNHILYEYLNSKEFNTQITFILKTYQNMKEELEAEKRALQNIW
FT                   KKRERAIENLSFNSTAIVSSLNAIFSDLQGGNLIGEEGIKSLENLAKDED"
FT   gene            complement(65963..67006)
FT                   /locus_tag="CJJ81176_0075"
FT   CDS_pept        complement(65963..67006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0075"
FT                   /product="cytochrome c family protein"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0075"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72013"
FT                   /db_xref="GOA:A0A0H3P9N5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9N5"
FT                   /protein_id="EAQ72013.1"
FT                   /translation="MKKHILLLGLCLSLSLSAKSVSDYKVGEELSDKEGVEYFKELSKR
FT                   PVQEWPNKNLSINDVPKGKQGDLIRYGIELLSKTESTLGPYSKLKKTSNEVNCISCHMD
FT                   NDGNGLPGTKKYVIPFLNVLNNYPRLDIETMKIISVEDRIRGMGGTDSHRFPNDSKEMK
FT                   AILAYFKWLKEAYGIKDGVKLEGDFFAKMNFPNRPADPVRGKKLFEENCVACHGERGLG
FT                   VKNDNYEQGSGHLYPSLLIYPDGGHMAMIPFLARFLKSAMPFGASADNPILSDEDALDI
FT                   AAYVNTGFVRMPITTTENRAGLDTAYSKSPSLKPEYFASPQQNLDPKEYIKVKYGPWKN
FT                   PNHFPGE"
FT   gene            complement(67184..67831)
FT                   /locus_tag="CJJ81176_0076"
FT   CDS_pept        complement(67184..67831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0076"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72001"
FT                   /db_xref="GOA:A0A0H3PGT6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGT6"
FT                   /protein_id="EAQ72001.1"
FT                   /translation="MDLKSLENNRLYILKRLGILKFLSIIEALLVGFLAFVFIRDALIA
FT                   VILAVFVGVFFFRFTAKKLKLAQKELQINALNLFLRRFGAKFKKQSLSQKDFLKLGLTK
FT                   DLKEFKSQNCFEFKDFKIYDIQFLDENKRFFCGILLEILSANKNPSFENEEQIYIKLQD
FT                   KNFTLNHVFSKENHYLIATLSNPFFIDIKKDLESNFKDLEENLNSIKNKLFK"
FT   gene            complement(67831..69639)
FT                   /gene="typA"
FT                   /locus_tag="CJJ81176_0077"
FT   CDS_pept        complement(67831..69639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="CJJ81176_0077"
FT                   /product="GTP-binding protein TypA"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR01394"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0077"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71966"
FT                   /db_xref="GOA:A0A0H3PGQ5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGQ5"
FT                   /protein_id="EAQ71966.1"
FT                   /translation="MENIRNIAVIAHVDHGKTTMVDELLKQSGTFSEREQISERVMDSN
FT                   DIEKERGITILSKNTAINYKGTKINIIDTPGHADFGGEVERVLKMIDGVLLLVDAQEGV
FT                   MPQTKFVVKKALSLGLKPIVVINKIDKPAADPERVINEIFDLFVALDANDEQLDFAIVY
FT                   AAAKNGYAKLDLNDESDNMEPLFKTILERVPAPSGTNDNPLQLQVFTLGYDNFVGKIGI
FT                   ARIFNGVVKKNQSVMLAKADGTKVNGRISKLIGFMGLEKMDIEEAGSGDIVAIAGFEAL
FT                   DVGDSVVDPNNPMPLDPLHIEEPTLSIVFSVNDGPLAGTEGKHVTSNKIAERLEAEMKT
FT                   NIAMKYESTGEGKFKVSGRGELQITILAENMRREGFEFCMGRPEVIVKVEDGVKTEPFE
FT                   HLVIDVPEEFSGAVIEKLGKRKAEMKTMAPTGDGQTRLEFEIPARGLIGFRSQFLTDTK
FT                   GEGVMNHSFLEFRPFSGAVEKRNNGALISMENGVALGYSLFNLQERGVLFIEPQTKVYT
FT                   GMIIGEHSRPNDLDVNPIKGKNLTNVRASGSDDAIKLVPPRKLSLERALEWIEEDELVE
FT                   VTPVNVRVRKRYLDPTQRKRMEKAKS"
FT   gene            69774..70097
FT                   /locus_tag="CJJ81176_0078"
FT   CDS_pept        69774..70097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0078"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0078"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71921"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9K4"
FT                   /protein_id="EAQ71921.1"
FT                   /translation="MSKPLNEEIFIEFKSDLAERKNEVLLQVLELLETFRSDKNEKMAR
FT                   ISSELTEILENEENLEKILNAKNLEELLNILIALNEDKMIKVYEDSYLKEKFPNVMVDK
FT                   FLK"
FT   gene            70117..71946
FT                   /locus_tag="CJJ81176_0079"
FT   CDS_pept        70117..71946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0079"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0079"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71975"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A0"
FT                   /protein_id="EAQ71975.1"
FT                   /translation="MSNLAPQNDVLNLTPSKTSNTSSSFSKTSKNKEHESSDSKNSTQD
FT                   DTESFLNSLLNSIDETNEFLPDHMKISQKEVVNEAMNRLQKGAFDESDKISIFESASFM
FT                   QILSLLDKLKTDTADVKLANLSTQLSSLIKTEANFNALKGASNLSELLDIAKDLGLNVK
FT                   NIKVDRLLDLKATFPNLDKADFFKGAVDNVFKEIINNKISNVSKNLNHNLENTTHTTST
FT                   HSTQKTNSKDSGSLLSQTLKNLDSILSSKESKHEKNDKVKSKIEEDTTDAKNTLKNLKN
FT                   DEFAKNLTEELNIKDKKNQDNLNKDNNLKDLNKESKDLNKDFNKELNKELNKNQEKNNL
FT                   NQENIQDQNKNLKNNDQNLNLDKNLNKEIVKDTQNLVSNLTQKDFNLNKEPKNNNKENK
FT                   DIKQNFFDQKLNFENLNKTQVVQNKENNANFNNNATNKETFTQEQTKTHSENVDKNSLD
FT                   ELNSLVKDLNKVTQNNARNITPKETLQYFSQDLKEAVDQYKAPITKLSITLNPNNLGEV
FT                   EVTLIQRGNNLHINFNSNTNAMNLFIQNQAEFKNSLVNMGFTGLEMNFSDQGKREQNQN
FT                   QGKNRSGYGFKDALDGKNESEKVNLELVLAKYF"
FT   gene            72000..72884
FT                   /gene="flgD"
FT                   /locus_tag="CJJ81176_0080"
FT   CDS_pept        72000..72884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="CJJ81176_0080"
FT                   /product="flagellar hook assembly protein"
FT                   /note="identified by match to protein family HMM PF03963"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0080"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71927"
FT                   /db_xref="GOA:A0A0H3P992"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P992"
FT                   /protein_id="EAQ71927.1"
FT                   /translation="MISSSDWNLNTTATTSGTTSSGSTSGTTRTDSSSSSGIVSNPNAT
FT                   LDKDAFLKLLLIELQHQDPTDPMDSDKMLTQTSQLSALEMQQNTNTTMQKMVETMQKLS
FT                   DSFSTSMSTSALGAIGKMATVSDNKIKLTGADELIALKMYLPEDSDENGVTLEIYDSNN
FT                   KLVFSEKSDAKSISQGLFTMEWPGRNNDGVYAGDGEYTVKMVYNNKNGEKITANYGTYP
FT                   IEGVVFKDGVAYAKMAGQEVPFDAIQEITDYKLGSSSSTGGSGSSGDSSGGSSDGDSSG
FT                   SGSTEDGDKEEKA"
FT   gene            72888..74525
FT                   /gene="flgE-1"
FT                   /locus_tag="CJJ81176_0081"
FT   CDS_pept        72888..74525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE-1"
FT                   /locus_tag="CJJ81176_0081"
FT                   /product="flagellar hook protein"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM PF07559"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0081"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72017"
FT                   /db_xref="GOA:A0A0H3PCN9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCN9"
FT                   /protein_id="EAQ72017.1"
FT                   /translation="MMNSFYNGISGVKSNSFGIDITANNIANVNTTGFKYSDAQFKDIF
FT                   YTTITTQSTNPAQGGYGSGAASSQVVFEQGSPVASDGEFDVALQGKGFFGVLGADGNAY
FT                   YTRNGSFRRDANGYLVDSYGNFVLGTMNPAFTGINYSDRVAGLMGDYLNTGTPVNNGFT
FT                   VNSNNSFSIGTTASQGAIKVPVNMYLPPQVTQNVKWSGSLNTNTTTEVVKVDLDPSKFN
FT                   ITKTEDGKYVVSGSVSKEDVFSAKAGDRIILNFTDDNGVKTSFEATLDENLNFKSNELD
FT                   LKGLDENSIKLDTAQISTEQQKANKDILESPIYNADGSKSTLRVTLERVLPQEGDNIQY
FT                   KAIAQIYDSNGNAVGNPTEGNMVFDKNGALLQNNITSIANPNGGTINIDLGSPYDANKP
FT                   GSGYSGIYIKEGVEKNVVTQQDGVAEGFFEQYNISDDGSIVAQFSNGKNAIVGKLALYN
FT                   FINEQGLVAMGDNIFAATANSGDASFIMKDGQVVNTAKFKGGFLEQSNVDLSAELSNLI
FT                   VTQKAFDASSKSITTSDQMIQKAINMKR"
FT   gene            complement(74529..76397)
FT                   /locus_tag="CJJ81176_0082"
FT   CDS_pept        complement(74529..76397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0082"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71922"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGN0"
FT                   /protein_id="EAQ71922.1"
FT                   /translation="MNFQVKTLETFNPFESLNHEQANTEQILDFRVIDFKLLCSSVKPA
FT                   KTKTYERKDFDLFYADDFFVKNYNTIIQKFLIEIYPKKSFPFTVKLRSNSNLTHLKASI
FT                   NLTENFKYYPNLKFDILQNIYKIMIKQKFLILRLDKNLFTKIDDFILSIQKNPSIKELE
FT                   LEIAKGVDKIEHKSDEIIYHRNVEEVCFSENANYDEGNYCKPIEKNELLFEYIYRILGK
FT                   EGRNLRGEILHLNPIAFLNNPFIIKDESIYVEELEDRIKYFSANYGFLNKDHSGYSVIN
FT                   NLKLSQVGLKTTGSIKTNTNENINLEITNFDISDDAIKSGIVNVQASDIKVNGSIGATK
FT                   LYGKNISIKGLTHAKSEIFAQDVFVAIHKGTLQADTVYIKNLENGTIIAKNVFVENCMG
FT                   GKIEAENIYICNLLTDNTLYPRKNLIIANNIKFKNNIVVSPLVSIENNSDTECENLKNL
FT                   SLKIKSKLDDTISKMQNYYDYLIKNQIKIIKLQKTKNPSAIEMKFSNLYHDIIKKYNHL
FT                   SILYKKLIKLKYQIDAKLNFLNEMVYNVKIYIKAKNIGKDNFLKFYPKTNTNLELKHHI
FT                   NLKDYEKVLYLEKGQQVSYIKSSHNYSESDIEEIKIIFEKLEKDNS"
FT   gene            complement(76682..77116)
FT                   /locus_tag="CJJ81176_0083"
FT   CDS_pept        complement(76682..77116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01814;
FT                   match to protein family HMM TIGR02481"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0083"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71934"
FT                   /db_xref="GOA:A0A0H3PCI6"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCI6"
FT                   /protein_id="EAQ71934.1"
FT                   /translation="MEVKWSRDFSIKNMQLDKQHELIFEITNLANDLALNIQDNNTQHK
FT                   NDLKQILVKLFQYIKIHFKDEEKFMESIDFPLIEEHKKSHQILVEKTKELLEHSDNIVK
FT                   MSQELSILTKDWILDHFANEDLWIANFTKKPYTFKKSIIP"
FT   gene            77645..77764
FT                   /locus_tag="CJJ81176_0084"
FT   CDS_pept        77645..77764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0084"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0084"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71985"
FT                   /db_xref="GOA:A0A0H3PGR9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGR9"
FT                   /protein_id="EAQ71985.1"
FT                   /translation="MHFLEFFIAVIMAVILQVMPFIAIAIVALSGITTTQLKI"
FT   gene            77987..78322
FT                   /locus_tag="CJJ81176_0085"
FT   CDS_pept        77987..78322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0085"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0085"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71933"
FT                   /db_xref="GOA:A0A0H3P993"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P993"
FT                   /protein_id="EAQ71933.1"
FT                   /translation="MARGVIKTGLGEHLAYHFISILGKKTLGIAYSIAFCETILAPVTP
FT                   SNTARAGAIINPIVQVIARSFKSTPEDGTQNKIGTYLSLVNYQEPILFHQLCLLQLQLQ
FT                   ILWWLIL"
FT   gene            78274..78453
FT                   /locus_tag="CJJ81176_0086"
FT   CDS_pept        78274..78453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0086"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0086"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71970"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCL0"
FT                   /protein_id="EAQ71970.1"
FT                   /translation="MFITATAPNPLVVDLIAQATNLEVHLTWGGVIGFRDVFTWYSCYA
FT                   FDAFDALFSLSARN"
FT   gene            78413..78604
FT                   /locus_tag="CJJ81176_0087"
FT   CDS_pept        78413..78604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0087"
FT                   /product="2-oxoglutarate/malate translocator"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0087"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72014"
FT                   /db_xref="GOA:A0A0H3PGU4"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGU4"
FT                   /protein_id="EAQ72014.1"
FT                   /translation="MPLMLYFLSPLEIKSTPNASTFAKDKLKELVKMKNSEKIMLSVFV
FT                   SLLLLWAGALGLFFWNFS"
FT   gene            78615..78782
FT                   /locus_tag="CJJ81176_0088"
FT   CDS_pept        78615..78782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0088"
FT                   /product="anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0088"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71958"
FT                   /db_xref="GOA:A0A0H3PCK0"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCK0"
FT                   /protein_id="EAQ71958.1"
FT                   /translation="MALLGLSLVLISGVLTFGEVLAEKAAWNTLVWFSALVMMATLLGK
FT                   LGVTQFLAEA"
FT   gene            78801..79151
FT                   /locus_tag="CJJ81176_0089"
FT   CDS_pept        78801..79151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0089"
FT                   /product="2-oxoglutarate/malate translocator"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0089"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71937"
FT                   /db_xref="GOA:A0A0H3PA53"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA53"
FT                   /protein_id="EAQ71937.1"
FT                   /translation="MGLGEISIMIFLSLAFLYTHYFFASTTAHISAMFFVFYSAGLALG
FT                   APPLLYAFIMIASGNVMMALTHYATGTAPVIFGTGYVTLKKWWSIGFVISMVDIVVMIA
FT                   VGLFWWKILGFY"
FT   gene            complement(79179..80195)
FT                   /gene="trmU"
FT                   /locus_tag="CJJ81176_0090"
FT   CDS_pept        complement(79179..80195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="CJJ81176_0090"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /EC_number="2.1.1.61"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF03054; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00420"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0090"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72009"
FT                   /db_xref="GOA:A1VXD7"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXD7"
FT                   /protein_id="EAQ72009.1"
FT                   /translation="MKILVAMSGGVDSTVTAYKLKNLGHEVIGCYMKLHGKPNYHEENI
FT                   KKVEKVANFLQIPYHILDLQEDFKNKVYMPFVDTYKEGKTPNPCALCNRFIKLGKLLEF
FT                   AKSLGCEKLATGHYARLENNLIKTAVDESKDQSYFLASADKEALKYLIFPLGEMKKEDV
FT                   KKFASTIEVLKSFATQKESSEICFVEDTYVQVLDQFMDTKIPGEVLDSSGKVVGKHEGY
FT                   MHYTIGKRRGFEVRGAHEPHFVLKINPKQNQIIVGTKEELKISEFNLKNINLFIDAKEL
FT                   DCEVKIRYRSKSTPCKVEIYEDKSAKITLKDPVYGLASGQMAVFYDHDKVIASGFIE"
FT   gene            complement(80195..80800)
FT                   /locus_tag="CJJ81176_0091"
FT   CDS_pept        complement(80195..80800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0091"
FT                   /product="lysine decarboxylase family protein"
FT                   /note="identified by match to protein family HMM PF03641"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0091"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71940"
FT                   /db_xref="GOA:A0A0H3P9L0"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9L0"
FT                   /protein_id="EAQ71940.1"
FT                   /translation="MNEKISQDLEKFANIPNLKNAVTFFGSARLKEDNFYYQQAKILAQ
FT                   KCVQNGFCVISGGGGGIMRAANEGAFSQKNNTNSMSSVGFNIFLPHEQKLNEFVEYNIT
FT                   FESLAIRKMALIEKSLAFVIFPGGFGTLDELCEILTLKQLEFKKDVPIILFGSEFWRGF
FT                   DEFVRNSLLKLEVISKGDELKYKITDDLDFIINTLKEI"
FT   gene            complement(80921..81709)
FT                   /locus_tag="CJJ81176_0092"
FT   CDS_pept        complement(80921..81709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0092"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGU7"
FT                   /protein_id="EAQ72019.1"
FT                   /translation="MINSLNSNLNYDYNTSNFKQDKNIDFKINKHGVAVITGEGALPYR
FT                   GKKFEYNPKIFGLDESISKKDMQEFNNFMKSNALKDPNKIEKSPLKDFNPAYTKWDPTT
FT                   EKMMLGFFVSYSKMFHLGYDIIKKADEFYKEFDALISKDLSLNEFKTKYIDFKQRHDEF
FT                   VKEYEMAMGDKMLLSSDNEIITQQSEKPFKAIQGESKNKETYKDDSTRNELVKKLLEGK
FT                   FSTSKELELLFGMKFSDDDAGEFNKILSLNSTPKSIDIKA"
FT   gene            complement(81723..82316)
FT                   /locus_tag="CJJ81176_0093"
FT   CDS_pept        complement(81723..82316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0093"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGT9"
FT                   /protein_id="EAQ72008.1"
FT                   /translation="MTSSVFAEDFLAKLTKGALSDTSPGVKELSLEEMKEVKGGYITYL
FT                   KRLSDNEVIAFAKPDWNLELTLFQDSNGDQYYWNREGLVRFGGMCGIETTNCLVNGKHS
FT                   YINQKRLWETMSIVGDDPYRNFLGYTVKRNIGISNLGKRFVYFSYGVAVINEQSGSWYR
FT                   VKSSPVLNNYRVVKEISSNYKDFLERYLGGYSIK"
FT   gene            82860..83504
FT                   /locus_tag="CJJ81176_0094"
FT   CDS_pept        82860..83504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0094"
FT                   /product="hmcD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0094"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9L5"
FT                   /protein_id="EAQ71954.1"
FT                   /translation="MFLTQTFIYTLTPKFDILISGGGSYARQEYTNFFTNAYSHKDRIG
FT                   FDNLWLGFIYTGDSIADLIPQITFQTTVVQREKAINQTKNFYLKSQSLQASLRGYSDPV
FT                   VYSIYTGFGYNQSRKFKTLKIEYGNSIYVGGDLSIILSPKITLDLGAEQRFQMKQKING
FT                   YQNSEVRSIPTLSLGSTYSINSDTAVSVNASFGGSSASPDSIFGISLWKKF"
FT   gene            83489..83692
FT                   /locus_tag="CJJ81176_0095"
FT   CDS_pept        83489..83692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0095"
FT                   /product="peptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0095"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72024"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCP2"
FT                   /protein_id="EAQ72024.1"
FT                   /translation="MEKILKILLFLPILALSTKAEWVVKSYQEIKNERVIRQTYEQSCG
FT                   ASSLATLLNILDDQKSLMNLNF"
FT   gene            83698..84087
FT                   /locus_tag="CJJ81176_0096"
FT   CDS_pept        83698..84087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0096"
FT                   /product="peptidase family protein"
FT                   /note="identified by match to protein family HMM PF03412"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0096"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71996"
FT                   /db_xref="GOA:A0A0H3PGT0"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGT0"
FT                   /protein_id="EAQ71996.1"
FT                   /translation="MSGQELYTDMVSFADLNDAVKKLGFQSNSYQINRENLDKLVNIPM
FT                   LVKIEDDPRFPHFVIIINHKGNYLQVLDPSHGEYISSKSQFFSIWDRYNKGGYALIVAP
FT                   KKELKPFKLNTPKSLHFDFSPFSLF"
FT   gene            complement(84136..84957)
FT                   /gene="fliY"
FT                   /locus_tag="CJJ81176_0097"
FT   CDS_pept        complement(84136..84957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliY"
FT                   /locus_tag="CJJ81176_0097"
FT                   /product="flagellar motor switch protein"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM TIGR02480"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0097"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71980"
FT                   /db_xref="GOA:A0A0H3PA78"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA78"
FT                   /protein_id="EAQ71980.2"
FT                   /translation="MFTNECISTIEGLTGKSAEFSEYKEFDVNASDTLKAPLVYAIFNI
FT                   ANGGKIGILAGAVLMSAIGEWMMGEEEITKNDKLGPDEMDAAKEAIQNIISAFSTTLGA
FT                   QKDIPKMDFSIESCEFVPESVDFKDFKKLFLYDVKIGDLEEQVSLAMDQTLHNILSGKP
FT                   AETGNTSTDSNHNTEEKAIMLSEELKNINLIMDVRLPVRVRIGNKKMLLKDVLTMDIGS
FT                   VVELNQLANDPLEILIGDKRIAYGEVVIVDGNFGVQITEIGSKKERLEQLR"
FT   gene            complement(84975..86054)
FT                   /gene="fliM"
FT                   /locus_tag="CJJ81176_0098"
FT   CDS_pept        complement(84975..86054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="CJJ81176_0098"
FT                   /product="flagellar motor switch protein FliM"
FT                   /note="identified by match to protein family HMM PF01052;
FT                   match to protein family HMM PF02154; match to protein
FT                   family HMM TIGR01397"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0098"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71948"
FT                   /db_xref="GOA:A0A0H3P9L2"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9L2"
FT                   /protein_id="EAQ71948.1"
FT                   /translation="MAEILSQEEIDALLEVVDDNTDTPIASNSKDEKDERNIVVYDFKR
FT                   PNRVSKEQLRTIKGIHDKLARNLASQISSMMRSIVETKLHSVDQMTYGEFLMSLPSPTS
FT                   FNVFSIKPLDGNCVLEINPSIAFPMIDRLLGGQGDSYEASRELTDIELNLLDSILRIIM
FT                   QRLKESWATVTEIYPSIEAKESSPNVVQIVSQNEIVIMVVMEIIIGNSSGMVNICYPVV
FT                   HLESILSRLANRDIMMGETSAKKSRNKELKTLIGRAEVVYEAILGKTLINVHEFLELKQ
FT                   GDILRLDREADDKAIVSIDKKDVFLAQIGLHRFRKSIKILELIRTDKDEIKEILEKYEE
FT                   ERKAKASVYDEPEEEDEEI"
FT   gene            complement(86054..86746)
FT                   /gene="fliA"
FT                   /locus_tag="CJJ81176_0099"
FT   CDS_pept        complement(86054..86746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliA"
FT                   /locus_tag="CJJ81176_0099"
FT                   /product="RNA polymerase sigma factor, sigma-F"
FT                   /note="identified by match to protein family HMM PF04542;
FT                   match to protein family HMM PF04545; match to protein
FT                   family HMM TIGR02479; match to protein family HMM
FT                   TIGR02937"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0099"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71961"
FT                   /db_xref="GOA:A0A0H3PGQ1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR012845"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGQ1"
FT                   /protein_id="EAQ71961.1"
FT                   /translation="MLKEPPKAYAQMLKKEQDELVLSYMPALRAMAFRLKERLPSSIDV
FT                   NDLISIGVEEMIKLSRRYDKEQNDNFWGFARKRVNGSMLDYLRSLDVMSRNNRKIIKDI
FT                   DAIMDEYFLEHECEPDDEYLAKKLDLDVEKIKEVRTAHAISYTLPIDEQIELYNEDNTL
FT                   EKIEKEELLEKIHEVLDDLKERDQLIIQLYYYEELSLKEISEILQISESRISQIHKKLL
FT                   KKLRERLV"
FT   gene            complement(86727..87083)
FT                   /locus_tag="CJJ81176_0100"
FT   CDS_pept        complement(86727..87083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0100"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0100"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71909"
FT                   /db_xref="GOA:A0A0H3PA41"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA41"
FT                   /protein_id="EAQ71909.1"
FT                   /translation="MRPENYVAFFTVCGFFIGLTFSIISIDEAFDILIFTCFITFMFYV
FT                   FVHIAIMNFIDVKKISGRIFNKHDYEKTSNNIINDLVIREKKMDIILEKLNEEREELKK
FT                   NEFKERRRNAKRAA"
FT   gene            complement(87102..87968)
FT                   /locus_tag="CJJ81176_0101"
FT   CDS_pept        complement(87102..87968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0101"
FT                   /product="ATPase, ParA family"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0101"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71939"
FT                   /db_xref="GOA:A0A0H3PCJ0"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCJ0"
FT                   /protein_id="EAQ71939.1"
FT                   /translation="MNNQANKLRNLMSQNGTKKSQNTHFIAITSGKGGVGKSTISANLA
FT                   NVLANNGYKVGLFDADIGLANLDVILNVRIQKNLLHVLRGECSLEDILIEVKPNLWLIP
FT                   GESGDEILKYNDKNIYERFLNQASILDELDFLIIDTGAGIGGNILNFLEMADEVIVVTV
FT                   PDPAAITDAYATIKTTSKTKENLLMLFNVVKNENEALKVFENIKKVADANIKNPLNLEF
FT                   LGHLSASKDVSGSIKKRTLFSDENTASSDEIKALASKLLYRLERKVLDNVSNRSFSSFF
FT                   RKIIERF"
FT   gene            complement(87961..89415)
FT                   /gene="flhF"
FT                   /locus_tag="CJJ81176_0102"
FT   CDS_pept        complement(87961..89415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhF"
FT                   /locus_tag="CJJ81176_0102"
FT                   /product="flagellar biosynthetic protein FlhF"
FT                   /note="identified by match to protein family HMM PF00448"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0102"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72000"
FT                   /db_xref="GOA:A0A0H3P9N0"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR020006"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9N0"
FT                   /protein_id="EAQ72000.1"
FT                   /translation="MGQLIHTFTVEDTEQIIPKVKEDYGNKALIITNKQIRPKTLNRSA
FT                   LYEVMVAIEESDYEEHLKKQGKSLPAKKSSPKPSSTSLAEEKIRSQIPQEDEDVVLDFS
FT                   NTRLNTNLNTVKNNDLTKKTYQDFPQNKINPHQNKTLGFDDFKEKLSEVSNEISKVTNT
FT                   PLENYTPNPNYNKKIENFEKQFEKQINKLNDKIDLLADMMWDDKAEARKNLMIPPEFAS
FT                   IYKQAKESGMLENHLEAIMKATIENMPAAMKTNKDAVQRYFHSLLRNILPCRVESDIKK
FT                   QKIMMLVGPTGVGKTTTLAKLAFRYAYGDKRYKTGIITLDTYRIGAVEQLFQYAKMMKL
FT                   PIIDSIEPKDLDEAIKSLNNCEVILVDTIGNSQYDQSKLAKTKEFLMHSNAEIDVNLVV
FT                   SANTKHEDLMEIYKNFSFLNIDTLIITKFDETKVFGNIFSLVYETNIPLSFFSIGQEVP
FT                   DDLEVANSDFLVHCILEGFNKGKNNE"
FT   gene            complement(89425..89898)
FT                   /gene="folK"
FT                   /locus_tag="CJJ81176_0103"
FT   CDS_pept        complement(89425..89898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="CJJ81176_0103"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="identified by match to protein family HMM PF01288;
FT                   match to protein family HMM TIGR01498"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0103"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71898"
FT                   /db_xref="GOA:A0A0H3P988"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P988"
FT                   /protein_id="EAQ71898.1"
FT                   /translation="MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRF
FT                   DMLFRVMMDDKRFKILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYE
FT                   VKFKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI"
FT   gene            complement(89901..90380)
FT                   /gene="aroQ"
FT                   /locus_tag="CJJ81176_0104"
FT   CDS_pept        complement(89901..90380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroQ"
FT                   /locus_tag="CJJ81176_0104"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="identified by match to protein family HMM PF01220;
FT                   match to protein family HMM TIGR01088"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0104"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71994"
FT                   /db_xref="GOA:A1VXF1"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXF1"
FT                   /protein_id="EAQ71994.1"
FT                   /translation="MKIMIIQGPNVNMLGVREVGIYGAMKMEEIHEQMKLAASQNNVEL
FT                   DFFQSNFEGEIVDKIQECLGTVDGIIINAAGYTHTSVAIRDAIAAVALPTIEVHISNVY
FT                   RREEFRQKSLIAPVCSGTIVGFGPFGYHLALMGIIQICEQIKNLRAMQQAQQTNK"
FT   gene            90471..91700
FT                   /locus_tag="CJJ81176_0105"
FT   CDS_pept        90471..91700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0105"
FT                   /product="amidohydrolase family protein"
FT                   /note="identified by match to protein family HMM PF01979"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0105"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72016"
FT                   /db_xref="GOA:A0A0H3P9A7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A7"
FT                   /protein_id="EAQ72016.1"
FT                   /translation="MFIVAARYLFLCDEDFTILENQAFVFEDKILELGELDNLKKKYPK
FT                   AKIIKTPKNSVILPAFINPHTHLEFSANSTTLHFGEFLIWLKSVINSRSILNAQAKEEL
FT                   ILQSIKKMQKSGIGTIGEISSFGSDLDPCLKASHKGMRIVFFNEILGTNENQVEDKKQE
FT                   FLKRFENSLKFKNDFFIPAISIHSPYSTHPSLAYFALDLAKKQNLLASTHFLESKAENI
FT                   WLRESKGGFKKWLENFTLHPKPLYTPKDFVKLFKGVRTLFTHCVYLKEYEWLDKNLHSI
FT                   THCAFSNRLLSQKSLDLKTALKSGLNIHLGTDGLSSNISLSLLDEMRANLLIHKNFDLL
FT                   ELASKLLQMVTLYPARALNLNLGELKKGKIADFSVFELGECDKKQAPLQFILNAKEVDK
FT                   LFIKGKECKF"
FT   gene            91688..92584
FT                   /gene="sppA"
FT                   /locus_tag="CJJ81176_0106"
FT   CDS_pept        91688..92584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="CJJ81176_0106"
FT                   /product="signal peptide peptidase SppA, 36K type"
FT                   /EC_number="3.4.-.-"
FT                   /note="identified by match to protein family HMM PF01343;
FT                   match to protein family HMM TIGR00706"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0106"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71972"
FT                   /db_xref="GOA:A0A0H3PGQ9"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGQ9"
FT                   /protein_id="EAQ71972.1"
FT                   /translation="MQILKSFFKALGCGIKFINTYFKTFVLLLIVIWILMPSANSSSNL
FT                   ANLERIDLKGEIFDSSAVLEKIINAKNDSNIKGVLFVIDSPGGAFAPSMELALAIKDLK
FT                   IKKPVLVYASGTMASGSYLAGVGANKILANPASFIGSIGVIMQGADLSGLANKLGIKEQ
FT                   TIQAGEFKSAGTFARAWNENERNFLQGLIDQSYDLFTGFVAKERALDLNKKDQWANARV
FT                   FLAAKAKELGLIDELSNYENAKKELEKLANVSNPVWKEEDKIDKFLNRLEGQTSSLISK
FT                   SLIEIVYKTNSSFISAR"
FT   gene            92663..93694
FT                   /locus_tag="CJJ81176_0107"
FT   CDS_pept        92663..93694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0107"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAB0"
FT                   /protein_id="EAQ72033.1"
FT                   /translation="MKKNIVFFEVKGGSDKGEDGYRKDTMPMVNALKAKGWNAEVIFFE
FT                   VGKKDEIYKYVKENFDGYVSRINPGNLKEENEYFDMLRKLCADKLVGMPHPDAMIGYGA
FT                   KDALTKLADTDLVPSDTYAYYDIKTFKENFPKSLAKGERVLKQNRGSTGEGIWRVSVEG
FT                   NVSGDSLPLNTKIKCTEAKDNHVEHRELGEFMDFCEQYIIGDNGMLVDMTFLPRIKEGE
FT                   IRLLMLYNTPVNVVHKKPAEDADAFSATLFSGAKYRYDKPEDWKTLVDMFLGELPKVRE
FT                   KLGNYDLPLIWTADFILDTDEKGNDKYVLGEINCSCVGFTSHLELADEVASNIINIVSK
FT                   TKA"
FT   gene            93707..93829
FT                   /locus_tag="CJJ81176_1709"
FT   CDS_pept        93707..93829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_1709"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_1709"
FT                   /db_xref="EnsemblGenomes-Tr:ABM55253"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACS4"
FT                   /protein_id="ABM55253.1"
FT                   /translation="MSILLLQNGHSFSIVFKFELYSIEKKFSQNEHFVSLVSIG"
FT   gene            complement(93936..94052)
FT                   /locus_tag="CJJ81176_0108"
FT   CDS_pept        complement(93936..94052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0108"
FT                   /product="non-heme iron protein, hemerythrin family"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0108"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71911"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P990"
FT                   /protein_id="EAQ71911.2"
FT                   /translation="MHDVPFGIHQKIQLKGVKFKCKKCKEAIQFYKKYSENF"
FT   gene            complement(94262..94558)
FT                   /locus_tag="CJJ81176_0109"
FT   CDS_pept        complement(94262..94558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0109"
FT                   /product="conserved hypothetical protein, authentic
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0109"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71946"
FT                   /db_xref="GOA:A0A0H3P995"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P995"
FT                   /protein_id="EAQ71946.2"
FT                   /translation="MLLDKLIPTWNEKYSIHNTMIDIQHQKLCELASKVESAVYKFVKR
FT                   EELKEILTELFNYMKEHFSNEEDYMQEIHYPYLNEHKIMHKISFVICLILYKT"
FT   gene            complement(94731..95387)
FT                   /locus_tag="CJJ81176_0110"
FT   CDS_pept        complement(94731..95387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0110"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02589"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0110"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72018"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9N6"
FT                   /protein_id="EAQ72018.1"
FT                   /translation="MSKIDEISSKSKANILEHLKKAYKETTFTRIESIDPVEHIQTTQD
FT                   MLTEMKQKMSDNKYIVENATKDTLEEKINEIVAKYGFKSMIYGADLNLNLEQIKAEKKI
FT                   CFDKEIENLRSEVFHSDFSIIHARAGVSSHGVALIPSSKTQPRMLSLAPKLCIVLLKKE
FT                   NVVKSLSEALNLVKKENEILPTNILFIAGPSRTADIELITVFGVHGPQIAHIIIY"
FT   gene            complement(95380..96819)
FT                   /locus_tag="CJJ81176_0111"
FT   CDS_pept        complement(95380..96819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0111"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR00273"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0111"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71935"
FT                   /db_xref="GOA:A0A0H3P9K8"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR004452"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR024569"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9K8"
FT                   /protein_id="EAQ71935.1"
FT                   /translation="MSQKIPHEQIVQIKLNDKQMQENLMTAMHTLQKNRLNVIDARFKD
FT                   WQGLRAKAKQAKNNALMSLEERLLEFEKNATKNGIKVHWASSDEDACEIVYEIMKEKNI
FT                   TKLLKGKSMASEEIGLNHYLEKKGLKAIETDLGELILQLNEEPPLHIVVPAIHRNRHEI
FT                   GEIFKEKLGANLENDEPESLNAVAREHLRKDFEGLKLGLSGVNFAMSREGAFWLIENEG
FT                   NGRMCTTAPDIHIALCGIEKVMESFEDAATMVSLLTPSATGQFIPTYNNIITGPRKNGD
FT                   LDGPKEVHVILFDHNRSKMLAHEDYYEALRCIRCGACMNFCPVYDQIGGHAYQTTYPGP
FT                   IGEVISPNIFGIDHTGDILNFCSLCGRCSEVCPVQIPLADLIRKLRCDKIGQGKNPPLG
FT                   ANNVHHNALEAFAFKQFKNIATNGDKWRFSLSKAHYFNWTVQNFASILPVIKKWYAFKE
FT                   LPQIKMDLYKEVQKLEGVSYE"
FT   gene            complement(96816..97556)
FT                   /locus_tag="CJJ81176_0112"
FT   CDS_pept        complement(96816..97556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0112"
FT                   /product="cysteine-rich domain protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0112"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72003"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A5"
FT                   /protein_id="EAQ72003.1"
FT                   /translation="MMKKVYFYATCLGSAAMQQSVLNAIKLLRREGIEVIFKKNQTCCA
FT                   QPSFNSGYFDESREIALYNVDLFDKDYPIVVPSGSCAGMMSHDYKELFKNRPEFSKIKT
FT                   FSPRVIELSQYLDEVLKVDYEDKGAPIKVTWHSNCHALRVQKSIQASKNLIKKLKNVEL
FT                   VELQYEEECCGFGGTFSVKEPEISNAMVRSKIKDIQNSGAKYLISGDGGCLLNIDGTMK
FT                   RMGLDIKGIHLYDFLLKRLEGERL"
FT   gene            complement(97679..99361)
FT                   /gene="lctP"
FT                   /locus_tag="CJJ81176_0113"
FT   CDS_pept        complement(97679..99361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lctP"
FT                   /locus_tag="CJJ81176_0113"
FT                   /product="L-lactate permease"
FT                   /note="identified by match to protein family HMM PF02652;
FT                   match to protein family HMM TIGR00795"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0113"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71943"
FT                   /db_xref="GOA:A0A0H3PGP1"
FT                   /db_xref="InterPro:IPR003804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGP1"
FT                   /protein_id="EAQ71943.1"
FT                   /translation="MEQILTWQQIYDPFSNIWLSALVAFLPILCFLVCLVVLKLKGYQA
FT                   GFLTVILATLVALFAYKMPWNLVGASFIQGFTNGMWPIAWIIIAAIFLYKLSIKSGSFE
FT                   IIKKSVMSITPDHRIQVILIGFCFGSFLEGAIGFGGPVAITAALLVGLGLRPLQAAGLC
FT                   LIANTAPVAFGAVGIPIIAMANLVGIEQHSVSAMVGRMLVPLSLTIPFFIVFLMDGFKG
FT                   IKETFPAILVAALSFTTTQFLSSNHLGAELPDIISAVVSLAVTTVFLKFWKPKNIFRFD
FT                   NESNFTQDNTLSFNQILKAWSPFILLIVCIIIWTQPWFKALFDKDGILSYTSITLQFSN
FT                   ITTGILSPSITGIGEAKPLSLALGVDLINGKTVAQAGTAILLAAFLTIAILKIKAEDAA
FT                   ECFWVTLKEMAIPCITIGLVVAFAFISKNSGMSTTLGLAFAHTGDAFSFFSPIIGWIGV
FT                   FLTGSDTSANLLFGTLQQVSAQKLGISEALFLAANSVGGVVGKMISPQSIAIACAAVGL
FT                   VGKESDLFKFTLKYSVAFIILIGIWTCIIAFFLQGIIPEVIVK"
FT   gene            complement(99533..100102)
FT                   /gene="cdtC"
FT                   /locus_tag="CJJ81176_0114"
FT   CDS_pept        complement(99533..100102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdtC"
FT                   /locus_tag="CJJ81176_0114"
FT                   /product="cytolethal distending toxin, subunit C"
FT                   /note="identified by match to protein family HMM PF03498"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0114"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72030"
FT                   /db_xref="GOA:A0A0H3PCP5"
FT                   /db_xref="InterPro:IPR003558"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCP5"
FT                   /protein_id="EAQ72030.1"
FT                   /translation="MKKIITLFFMFITLAFATPTGDLKDFTEMVSIRSLETGIFLSAFR
FT                   DTSKDPIDQNWNIKEIVLSDELKQKDKLADELPFGYVQFTNPKESDLCLAILEDGTFGA
FT                   KSCQDDLKDGKLETVFSIMPTTTSAVQIRSLVLESDECIVTFFNPNIPIQKRFGIAPCT
FT                   LDPIFFAEVNELMIITPPLTAATPLE"
FT   gene            complement(100113..100910)
FT                   /gene="cdtB"
FT                   /locus_tag="CJJ81176_0115"
FT   CDS_pept        complement(100113..100910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdtB"
FT                   /locus_tag="CJJ81176_0115"
FT                   /product="cytolethal distending toxin, subunit B"
FT                   /note="identified by match to protein family HMM PF03372"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0115"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71976"
FT                   /db_xref="GOA:A0A0H3PCL3"
FT                   /db_xref="InterPro:IPR003539"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCL3"
FT                   /protein_id="EAQ71976.1"
FT                   /translation="MKKIICLFLSFNLAFANLENFNVGTWNLQGSSAATESKWSVSVRQ
FT                   LVSGANPLDILMIQEAGTLPRTATPTGRHVQQGGTPIDEYEWNLGTLSRPDRVFIYYSR
FT                   VDVGANRVNLAIVSRMQAEEVIVLPPPTTVSRPIIGIRNGNDAFFNIHALANGGTDVGA
FT                   IITAVDAHFANMPQVNWMIAGDFNRDPSTITSTVDRELANRIRVVFPTSATQASGGTLD
FT                   YAITGNSNRQQTYTPPLLAAILMLASLRSHIVSDHFPVNFRKF"
FT   gene            complement(100907..101713)
FT                   /gene="cdtA"
FT                   /locus_tag="CJJ81176_0116"
FT   CDS_pept        complement(100907..101713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdtA"
FT                   /locus_tag="CJJ81176_0116"
FT                   /product="cytolethal distending toxin, subunit A"
FT                   /note="identified by match to protein family HMM PF03498"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0116"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71960"
FT                   /db_xref="GOA:A1VXG4"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR003558"
FT                   /db_xref="InterPro:IPR015957"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXG4"
FT                   /protein_id="EAQ71960.1"
FT                   /translation="MQKIIVFILCCFMTFFLYACSSKFENVNPLGRSFGEFEDTDPLKL
FT                   GLEPTFPTNQEIPSLISGADLVPITPITPPLTRTSNSANNNAANGINPRFKDEAFNDVL
FT                   IFENRPAVSDFLTILGPSGAALTVWALAQGNWIWGYTLIDSKGFGDARVWQLLLYPNDF
FT                   AMIKNAKTNTCLNAYGNGIVHYPCDASNHAQMWKLIPMSNTAVQIKNLGNGKCIQAPIT
FT                   NLYGDFHKVFKIFTVECAKKDNFDQQWFLTTPPFTAKPLYRQGEVR"
FT   gene            101790..102059
FT                   /locus_tag="CJJ81176_0117"
FT   CDS_pept        101790..102059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0117"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72012"
FT                   /db_xref="GOA:A0A0H3PCN6"
FT                   /db_xref="InterPro:IPR027853"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCN6"
FT                   /protein_id="EAQ72012.2"
FT                   /translation="MFYFVVFKGRIYMYLKHLYFSISQIFNFYKEGFKNLTLGKTLWKI
FT                   IFIKLFVMFVILKLFVFDVNFNSIFKSDKEKSTFVLKNLTLEGK"
FT   gene            102060..103622
FT                   /gene="cydA"
FT                   /locus_tag="CJJ81176_0118"
FT   CDS_pept        102060..103622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="CJJ81176_0118"
FT                   /product="cytochrome d ubiquinol oxidase, subunit I"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF01654"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0118"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71902"
FT                   /db_xref="GOA:A0A0H3PA38"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA38"
FT                   /protein_id="EAQ71902.1"
FT                   /translation="MNELSSVDWSRAQFALTALYHFLFVPLTLGLSFMIAIMETIYVKT
FT                   KNERWKKITKFWLSLFAINFAIGVATGIIMEFEFGTNWANYSWFVGDIFGAPLAVEGIM
FT                   AFFLEATFFAVMFFGWDKVSKGFHLLSTWCVAIGSNLSAFWILVANGWMQYPVGMSFNP
FT                   DTARNEMQSFFEVALSPVAISKFLHTIGSGYVISALFVMGISAWFMLKGRHIIEAKKSL
FT                   VVGASFGLVCSIFLFFSGDESAYRVTQTQPMKLAAMEGVYQGEHRAGLVPFGILNPKKT
FT                   IDNNESVFLFDITIPYALSILGNRDPNSFVPGIEDLIYGNESKGIEPMQNRIDRGKIAI
FT                   QALKDYKLAKENNDTIAMANHKSILETHFKDFGYGYLEKPSDTIPPVALTFYSFHIMVA
FT                   LGSFFFLLFIVTLYLTMANDIEKFRKVLWVCLLSIPLGYIAAEAGWIVAEVGRQPWAIQ
FT                   DLLPVHIAATQLGKVNVQISFWIFAVLFTALLIAEVKIMLTQIKKGFDAHAGHTPLMGK
FT                   GEK"
FT   gene            103622..104746
FT                   /gene="cydB"
FT                   /locus_tag="CJJ81176_0119"
FT   CDS_pept        103622..104746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="CJJ81176_0119"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="1.10.3.-"
FT                   /note="identified by match to protein family HMM PF02322;
FT                   match to protein family HMM TIGR00203"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0119"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72028"
FT                   /db_xref="GOA:A0A0H3PAA7"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAA7"
FT                   /protein_id="EAQ72028.1"
FT                   /translation="MFFGLELEGLQIYWWLILSLLGGLLVFMFFVQGGQTLIDELSKDE
FT                   LEKTMLVNSLGRKWELGFTTLVLFGGAAFAAFPLFYSTSFGGAYWAWLCILFCFILQAV
FT                   AYEYRKKENNVYGSKTYEIFLKINGYLGVFLIGVAVSSFFSGSEFILNEHNFVSWQNPL
FT                   HGLELLLNPFNYLLGLALVFLARLLGAAYFMNNINDENIKIRAMKKLMINSILFLPFFL
FT                   GFLAWIFLKDGFSVDTNGVVSMSANLYLYNFLNQMIFAVLLVIGVILVLLGMVQGTKGC
FT                   SKAIFTLGLGTVLTVFALLSSIGLGQSAFYPSLSDLQSSLTLKNASSSYYTLSVMAYVS
FT                   LLVPFVLAYIIYVWNAMDKVKITREEIANDDHAY"
FT   gene            complement(104940..105635)
FT                   /locus_tag="CJJ81176_0120"
FT   CDS_pept        complement(104940..105635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0120"
FT                   /product="aspartate racemase, putative"
FT                   /note="identified by match to protein family HMM PF01177;
FT                   match to protein family HMM TIGR00035"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0120"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71998"
FT                   /db_xref="GOA:A0A0H3P9A4"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A4"
FT                   /protein_id="EAQ71998.1"
FT                   /translation="MKTIGIIGGMSFESTITYYKTINQAINDKLKSLNSAKILLYSVNF
FT                   EEIENLQSQDKWQEAAQILTQCAKKLELAGANFIIIATNTMHKVFNEIQQNINIPILHI
FT                   AKSSAKALKQENIQKIGLLGTKYTMTQDFYKKMLIEENISVITPSDEDIKIVNDIIFNE
FT                   LCKGKIKQDSKEKYLNIIKKLQEKGAKGVLLACTEIGLLISKNDTNIKIFDTSLIHALD
FT                   AANEALKDL"
FT   gene            complement(105755..106450)
FT                   /gene="ung"
FT                   /locus_tag="CJJ81176_0121"
FT   CDS_pept        complement(105755..106450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="CJJ81176_0121"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00628"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0121"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71923"
FT                   /db_xref="GOA:A1VXG9"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXG9"
FT                   /protein_id="EAQ71923.1"
FT                   /translation="MEEITINIDKIKINDDWKEFLRDEFQKKYFLEIKKQYLNAINQNI
FT                   IIYPPANLIFNAFNLCPLKEIKIIILGQDPYHQPNQAMGLSFSVPKNVKIPPSLNNIFK
FT                   ELQNDLNITPAKSGDLSSWAKQGVLLLNSILSVEANKAASHSSWGWQEFSDAIIHKLSN
FT                   EKSGLVFMLWGNYAKSKEILIDNTKHLILKAAHPSPLARTGFLGCKHFSKANEFLKKVG
FT                   KIPIDWKIV"
FT   gene            106721..108127
FT                   /gene="aspA"
FT                   /locus_tag="CJJ81176_0122"
FT   CDS_pept        106721..108127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="CJJ81176_0122"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00839"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0122"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71907"
FT                   /db_xref="GOA:A0A0H3PGM1"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGM1"
FT                   /protein_id="EAQ71907.1"
FT                   /translation="MGTRKEHDFIGELEISDEVYYGVQTFRAVENFDISHDRLKDFPRF
FT                   VRALARVKKAAAMANHELGLLDKNIQDAIIKACDKILEGGYYDQFVVDMIQGGAGTSTN
FT                   MNANEVIANIGLELMGHKKGEYQYLHPNDHVNLSQSTNDAYPTALHLALHDYLSDLAKA
FT                   MEHLKKAYERKAEEFKDVLKMGRTQLQDAVPMTLGREFKTFAVMIGEDIQRVLEARKLI
FT                   LEINLGGTAIGTGINSHPDYPKVVERKIREVTGFEYTVAEDLIEATQDTGAYVQISGVL
FT                   KRVATKLSKVCNDLRLLSSGPKCGLNEINLPKMQPGSSIMPGKVNPVIPEVVNQVCYFV
FT                   IGADVTVTFACEGGQLQLNVFEPVAAYSLFNSIVMLEKAMYTLADKCIDGITANEKICS
FT                   DFVYNSVGIVTALNPYIGYENSASIAKEAMNTGKRVADIALERGLLSKEQIDEILTPSN
FT                   MLNPHMEAKK"
FT   gene            108153..109481
FT                   /gene="dcuA"
FT                   /locus_tag="CJJ81176_0123"
FT   CDS_pept        108153..109481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcuA"
FT                   /locus_tag="CJJ81176_0123"
FT                   /product="anaerobic C4-dicarboxylate membrane transporter
FT                   DcuA"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF03605; match to protein
FT                   family HMM TIGR00770"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0123"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71951"
FT                   /db_xref="GOA:A0A0H3PA60"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA60"
FT                   /protein_id="EAQ71951.2"
FT                   /translation="MIILQVIVLLGAIFIGIRLGGIAIGYAGGLGVVILGLVLGMKPGN
FT                   IPWDVILIIAAAIAAISAMQQAGGLDYMVRVTEKILRSSPKFINYLAPACGWLLTILAG
FT                   TGNAVFSLMPVVVDVAKSQNIKPSVPLSLMVVSSQIGITASPVSAAVVYMSGVLEPLGW
FT                   NYPTLIGIWISTTFIACMLTAFIVSLITPMDLSKDSVYQERLKAGLVKDAGAILHGEDK
FT                   PGAKLSVGIFLITVLAVVLYATAISSNIKWIDPVVVPRDAAIMSFLLTAATLITWLCKV
FT                   EPGKILDTSVFKSGMTACVCVFGVAWLGNTFVAGHEASIKEVAGDWVKQTPAMLAVAFF
FT                   FASMLLYSQAATAKAIVPVIITALGISAANPHDSYMLVACFAAVSALFVLPTYPTLLGA
FT                   VQMDDTGTTRIGKFIFNHSFFIPGVLAIAIAVALGFVLAPMLI"
FT   gene            109589..110950
FT                   /locus_tag="CJJ81176_0124"
FT   CDS_pept        109589..110950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0124"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0124"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71917"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA44"
FT                   /protein_id="EAQ71917.1"
FT                   /translation="MKIKVGLIFSGIVCLFLTACVNQVKQNTTFENALTQKYCGDDFFN
FT                   QNLEKIKKNDDVIYTGLNAGLIARNCGDFNKSNVFFDAAEESYKYDVDLENVGSKAAKF
FT                   VGTTLLNDTIVDYDGSLYERIMVNIYKALNYMEEDDYENARVEFNRALMRQDKAKEYFA
FT                   KEIEKNRADLDKAKEDKNYDKNMNENSKVIEAQYDNLFKEFDTTKNFINPYATYLASIF
FT                   FFMDKDYRKATDLFREVAIIYPKNKTIKKEAKIFKEYATKIKVKKAKKYVFVVYENGFG
FT                   VVKDEFALTLPFIVDKKIISTNIALQTLKKREASFANLNINGQNTNDFVDLDNIVATEF
FT                   KINMPAMIAKALAQTIIKTTLNVAVANNDSTGGWLSLATAVATAATNKADVRSWRGLPK
FT                   SIAMATIENDGNLEIKDPQGNILFQKSLDKNKNALVIVRSFAPYLPASVAIMEK"
FT   gene            110960..111328
FT                   /locus_tag="CJJ81176_0125"
FT   CDS_pept        110960..111328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0125"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0125"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71997"
FT                   /db_xref="InterPro:IPR010824"
FT                   /db_xref="InterPro:IPR038483"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA88"
FT                   /protein_id="EAQ71997.1"
FT                   /translation="MKKIILFILMFLLSACAPSYQINSNQNTVILGSNLPKSLVKQFQK
FT                   RINSNGYLEFEVILRSTFAKDVIYKVDWLDKDGFVLRDVLNEDYQALRIPAGQEVILRK
FT                   LASDIRAKDFRLEIKAKN"
FT   gene            111352..111975
FT                   /locus_tag="CJJ81176_0126"
FT   CDS_pept        111352..111975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0126"
FT                   /product="lipoprotein, putative"
FT                   /note="identified by match to protein family HMM TIGR02722"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0126"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71932"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA50"
FT                   /protein_id="EAQ71932.1"
FT                   /translation="MKKTKILGTALIGALLFSGCAQTAYTDGKASQVKKGDALTLGLDR
FT                   QDFESAAETMINSMLSDPAFANIKPGTRKVIAIGRVVNDTPQRIDTEKLTAKITSALRK
FT                   SGKFVLTSAVAAGGALDSMSEDVRELRDNDEFNQKTIAKKGTLVSPDFSLAGKIRQDNV
FT                   KLSNGKTQVEYFFLLRLTDLTSGLVYWEDEQTIDKTGSSKTVTW"
FT   gene            112057..113394
FT                   /locus_tag="CJJ81176_0127"
FT   CDS_pept        112057..113394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0127"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0127"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCN0"
FT                   /protein_id="EAQ71999.1"
FT                   /translation="MKKILFIGSLVMASLLYAQGSQPVEITQQDINTQNEMSDASTKDI
FT                   TPKSIEDFFEEFADNFGIEYGITKDGKTFYTGKSTVAVNDTDPQFAQALQNAYQKAMLN
FT                   LQSEFIRDVFGRIATSRIQNYEADNSTNAKEFDELPKGDKVDQILNKLTQLAGAQLDKA
FT                   LKDLGIDTNSLSEDRKKTLLKQEFLNKTMTNAIGSMSGLVPVQTIVTQRRGEYDVGVIA
FT                   VISNKTRQLAKDMALARQSAIKGKGKAISEYLPKDTKGFLNEYGIRLVYDENGAPIILS
FT                   YGNWGYVADPSNAKKTNILEDRAKETALTMADAAIIEFINTNLSLKDERTTGDTYEEII
FT                   KQSINVNDSSTQEQTQNITNIIDKVNSKIKASASGKIRGIRTLKKWSYTSENGIEHVGA
FT                   VRFYSYENLANTNEALNSKSNATKNEAKKSSSIQRSSNVVNSMDDF"
FT   gene            113404..114606
FT                   /locus_tag="CJJ81176_0128"
FT   CDS_pept        113404..114606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0128"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71959"
FT                   /db_xref="GOA:A0A0H3P9L7"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9L7"
FT                   /protein_id="EAQ71959.1"
FT                   /translation="MKIIKILFLGLFLSLSLNAKVVTTTSTKSSTGEGTGLTREDAINN
FT                   AIIEAIGKMSGVSINSLKKSNTSVSTDNSGSNIQDNYSEQISKATKGRADTYEINSVEQ
FT                   DANGKYTANVTIFKTTTTKKYQVPGLSADNRRSITVFDSTLDAAKRGIGSALQQKIISD
FT                   LLQSRKFNVLDRDSSGYYEMEKALIKSGDAASDEVYKLKNMLATDYILLFSISGLEGKQ
FT                   KTSNLTGKSKTEIEVIVDYRVLLFATRQIKFSNTLSMKVNLKDNSLSANETALKQIANR
FT                   IAGDILNAIYPLKVASVENNEVIFSQSLNQGDVYECFALGKVIKDTYTKENTGRVESKT
FT                   GSIEITRTSPKFSYAKITEGSVKVGDICRPLSNTGSGNGYTIGRDANYQTQEGGGVNLG
FT                   F"
FT   gene            114765..115073
FT                   /gene="rplU"
FT                   /locus_tag="CJJ81176_0129"
FT   CDS_pept        114765..115073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="CJJ81176_0129"
FT                   /product="ribosomal protein L21"
FT                   /note="identified by match to protein family HMM PF00829;
FT                   match to protein family HMM TIGR00061"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0129"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71924"
FT                   /db_xref="GOA:A1VXH7"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXH7"
FT                   /protein_id="EAQ71924.1"
FT                   /translation="MYAIIKHSGKQYKVSVGDELKLDHFEAESKASIEVSEVLAINDKE
FT                   LKVGAPFVAGAKVVLEVINHGKDKKVVIYKKRRRKDSKLKRGFRRQFTRVVVKDIKA"
FT   gene            115084..115338
FT                   /gene="rpmA"
FT                   /locus_tag="CJJ81176_0130"
FT   CDS_pept        115084..115338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="CJJ81176_0130"
FT                   /product="ribosomal protein L27"
FT                   /note="identified by match to protein family HMM PF01016;
FT                   match to protein family HMM TIGR00062"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0130"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71977"
FT                   /db_xref="GOA:A1VXH8"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXH8"
FT                   /protein_id="EAQ71977.1"
FT                   /translation="MAHKKGQGSTQNNRDSIGRRLGVKKFGGEFVRAGNIIIRQRGTAT
FT                   HAGNNVGMGKDHTIFALIDGFVKFERKDKDRKKVSVYPA"
FT   gene            115444..116514
FT                   /locus_tag="CJJ81176_0131"
FT   CDS_pept        115444..116514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0131"
FT                   /product="GTP-binding protein, GTP1/Obg family"
FT                   /note="identified by match to protein family HMM PF01018;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM TIGR02729"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0131"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71968"
FT                   /db_xref="GOA:A1VXH9"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXH9"
FT                   /protein_id="EAQ71968.1"
FT                   /translation="MFIDSVKITLASGDGGKGAVSFRREKHVPLGGPDGGDGGNGGDII
FT                   FVCDNNTHTLVNFKGKRELRAQNGAGGMGRNKNGKKGENLELIVPEGTQVIDAQTNEIL
FT                   LDLTEEGQRELFLKGGKGGLGNTHFKHATNQRPDYAQPGIKGESRLVRLELKLIADVGL
FT                   VGFPNVGKSTLISVVSNAKPEIANYEFTTLTPKLGLVDVNEYNSFVMADIPGIIEGASG
FT                   GKGLGLAFLKHIERTSFLLFVLDPMRQMPLKEQFIVLRKELEKFSNELFGRKFGIMISK
FT                   SDSVRLGEEFAEQIALNINELDNYLKEINNPQSFLIKVSSLEKTGLKELKFMLLEEIKT
FT                   LRNNKKNFNNLGSVLY"
FT   gene            116566..117357
FT                   /gene="proB"
FT                   /locus_tag="CJJ81176_0132"
FT   CDS_pept        116566..117357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="CJJ81176_0132"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR01027"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0132"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71967"
FT                   /db_xref="GOA:A0A0H3PA70"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA70"
FT                   /protein_id="EAQ71967.2"
FT                   /translation="MAKIIKIFQGISMKRIVVKVGSHVISEENTLSFERLKNLVAFLAK
FT                   LMEKYEVILVTSAAISAGHTKLDIDRKNLINKQVLAAIGQPFLISVYNELLAKFNKLGG
FT                   QILLTGKDFDSRKATKHAKNAIDMMINLGILPIINENDATAIEEIVFGDNDSLSAYATH
FT                   FFDADLLVILSDIDGFYDKNPSEFSDAKRLEKITHIKEEWLQATIKTGSEHGTGGIVTK
FT                   LKAAKFLLEHNKKMFLASGFDLSVAKTFLLEDKQIGGTLFE"
FT   gene            117431..118348
FT                   /gene="fmt"
FT                   /locus_tag="CJJ81176_0133"
FT   CDS_pept        117431..118348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="CJJ81176_0133"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM PF02911; match to protein
FT                   family HMM TIGR00460"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0133"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72025"
FT                   /db_xref="GOA:A1VXI1"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXI1"
FT                   /protein_id="EAQ72025.1"
FT                   /translation="MKKIIFMGTPSYATCILKALVENENFKLVALFTQPDKAVGRKQIL
FT                   TPSDTKAFLSQNYPSIPIFTPSSLKDENIIREIKDLNPDFIVVAAYGKILPKAILDLVP
FT                   CVNLHASLLPKYRGASPIQSAILNKDEKSGVCTMLMEEGLDTGAILESLECDIKDKNSS
FT                   EVFELLANLAAKLILTTLLNFDKITPKKQEESLATLCRKIKKEDGLINLQNARELYQKY
FT                   LAFTPWPGVFLENGLKFLELELVDELKQNARMGEILELEKESFLLACKQGVLRIKKLQE
FT                   SGKKALDGRTYLNGKRLKSEDSLC"
FT   gene            118311..118964
FT                   /locus_tag="CJJ81176_0134"
FT   CDS_pept        118311..118964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0134"
FT                   /product="biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00121"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0134"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71944"
FT                   /db_xref="GOA:A0A0H3PA56"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA56"
FT                   /protein_id="EAQ71944.1"
FT                   /translation="MEKGLKVKIVCVESIDSTHLFLCEQIRNGKIDGNFAIYALEQTNG
FT                   VGSRENSWQSSKGNLHLSFCIKEEDLPKDLPLASVSIYFAYLLKELLQEKGSKIWLKWP
FT                   NDLYLDDKKAGGVISAKISNFIIGGMGLNLKFSPQNTALCDIEILLKDLVSEFLQKVEK
FT                   KILWKNIFSKYMLEFEKSRKFSVHHEGKVFSLENSFLYEDGSILLGDKRVYSLR"
FT   gene            118961..119746
FT                   /locus_tag="CJJ81176_0135"
FT   CDS_pept        118961..119746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0135"
FT                   /product="chromosome partitioning protein, ParA family"
FT                   /note="identified by match to protein family HMM PF01656"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0135"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72034"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9B0"
FT                   /protein_id="EAQ72034.1"
FT                   /translation="MSEIITIANQKGGVGKTTTAVNLAASLAVAEKKVLLIDVDPQANA
FT                   TTGLGFNRNNYEYNIYHVFIGRKKLSDIILKTELPQLHLAPSNIGLVGIEQELAKGENN
FT                   EKKMLLKNQIQEVIDEYDFIIIDSPPALGSITINAFAASDSVIIPIQCEFYALEGVAMV
FT                   LNTIKIIKKTINSKLRVRGFLPTMYSSQNNLSKDVVDDLKQNFKKQLFTINGNEDDFIV
FT                   IPRNVKLAESPSFGKPIILYDIKSPGSVAYQNLAYSILG"
FT   gene            119752..120588
FT                   /locus_tag="CJJ81176_0136"
FT   CDS_pept        119752..120588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0136"
FT                   /product="chromosome partitioning protein, ParB family"
FT                   /note="identified by match to protein family HMM PF02195;
FT                   match to protein family HMM TIGR00180"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0136"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71995"
FT                   /db_xref="GOA:A0A0H3P9M8"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9M8"
FT                   /protein_id="EAQ71995.1"
FT                   /translation="MGLNKDRGLSSLISDMDTVYSKELGFDKNQSTMIEIDQISPNPFQ
FT                   PRKNFDQEALDELANSIKEFGLIQPIIVFKKNNKFILIAGERRLRAVKALGKKEILAFI
FT                   ADIDENKLRELALIENIQRENLNPIELANSYKDLMQVHKITQENLAELIHKSRTQITNT
FT                   LRLLNLDIRTQELIASGKISQGHAKVLVGLGQKDEKMLVDSIIGQKLNVRDTEKIVKKI
FT                   KNNESLPNQEFEDEIKKLKQILNRFGFDCKNKNNDFVIHLENIDKIKKLIKMLEKL"
FT   gene            120649..121074
FT                   /locus_tag="CJJ81176_0137"
FT   CDS_pept        120649..121074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0137"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0137"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71900"
FT                   /db_xref="GOA:A0A0H3P9J7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9J7"
FT                   /protein_id="EAQ71900.1"
FT                   /translation="MFEDMHPSIMLATMAIFLAMIVILNSMLYKPLLKFMDERNDSIKN
FT                   DENKVKENSQEVLGVNDELEAIHINTREEIQKIKQSAIAAAKEEAEQILRSKKEELERK
FT                   MASFYADLAVQKKELQEHLNIHLPELKQALQNNIKKI"
FT   gene            121085..121597
FT                   /locus_tag="CJJ81176_0138"
FT   CDS_pept        121085..121597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0138"
FT                   /product="ATP synthase F0, B' subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00430"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0138"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71965"
FT                   /db_xref="GOA:A0A0H3P9L8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9L8"
FT                   /protein_id="EAQ71965.1"
FT                   /translation="MSKLFFIIFLLPLYAFGASNGSGEYDIIPRTINFLIFVAILYYFV
FT                   ATPFKNFYKNRIVKISSKLDEIQKKLLESKAKKLDTMKKLEEAKASAAAALITAKKEAE
FT                   ILVQNIKKETQDELDLLQKHFEEQKDYEFRKMEKELVSNTLNEIFSDPNMTLKQSEIIE
FT                   LMMKKVS"
FT   gene            121600..122121
FT                   /gene="atpH"
FT                   /locus_tag="CJJ81176_0139"
FT   CDS_pept        121600..122121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="CJJ81176_0139"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00213;
FT                   match to protein family HMM TIGR01145"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0139"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71908"
FT                   /db_xref="GOA:A1VXI7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXI7"
FT                   /protein_id="EAQ71908.1"
FT                   /translation="MENIIARRYAKAIASRADINDFYQNLCILNSAFVLPKFKNIIESN
FT                   EIKKERKMEFLDSFFDIKNSSFQNFLRLLIENSRLECIPQIVKELERQKAFKENIFVGI
FT                   VYSKEKLSQENLKDLEVKLNKKFDANIKLNNKISQDDSVKIELEELGYELSFSMKALQN
FT                   KLNEYILKII"
FT   gene            122135..123640
FT                   /gene="atpA"
FT                   /locus_tag="CJJ81176_0140"
FT   CDS_pept        122135..123640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CJJ81176_0140"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR00962"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0140"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71942"
FT                   /db_xref="GOA:A1VXI8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXI8"
FT                   /protein_id="EAQ71942.1"
FT                   /translation="MKFKADEISSIIKERIENFDLNLEIEETGKIISVADGVAKVYGLK
FT                   NIMAGEMVEFENGDKGMALNLEESSVGIVILGKGEGLKEGASVKRLKKLLKVPVGEALI
FT                   GRVVNALGEPIDAKGVINANEYRFVEEKAKGIMARKSVHEPLHTGIKAIDALVPIGRGQ
FT                   RELIIGDRQTGKTTVAVDTIISQRGQGVICIYVAIGQKQSTVAQVVKRLEEHGAMEYTI
FT                   VVNAGASDPAALQYLAPYTGVTMGEFFRDNAKHALIVYDDLSKHAVAYREMSLILRRPP
FT                   GREAYPGDVFYLHSRLLERASKLNDELGAGSLTALPIIETQAGDVSAYIPTNVISITDG
FT                   QIFLETDLFNSGIRPAINVGLSVSRVGGAAQIKATKQVSGTLRLDLAQYRELQAFAQFA
FT                   SDLDEASRKQLERGQRMVELLKQPPYSPLSVEKQVVLIFAGTKGFLDDIAVSRIEEFED
FT                   GIYPFIEAKHPDIFEQIRSKKALDSDLEEKLAKAINEFKANHL"
FT   gene            123649..124533
FT                   /gene="atpG"
FT                   /locus_tag="CJJ81176_0141"
FT   CDS_pept        123649..124533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="CJJ81176_0141"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00231;
FT                   match to protein family HMM TIGR01146"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0141"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71920"
FT                   /db_xref="GOA:A1VXI9"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXI9"
FT                   /protein_id="EAQ71920.1"
FT                   /translation="MSNLKEIKRKIKSVYNTQKTTNAMKLVSTAKLKKAEEAAKRSKIY
FT                   AQKIDEILSEISVQINKIVHNEDDVRLFLFHKKEQIKTVDLIFITADKGLCGGFNIKTL
FT                   KTVSEMLKEYEAKNINIRLRAIGKTGIEYFNFQKIELLEKYFHLSSSPDYEKACEVIHA
FT                   AVDDFLNGNTDEVILVHNGYKNMITQELKINHLIPVEPKSIEQTHNSLLELEPEGTELL
FT                   EDLIKTYFEYNMYYALIDSLAAEHSARMQAMDNATNNAKARVKQLNLAYNKARQESITT
FT                   ELIEIISGVESMK"
FT   gene            124558..125955
FT                   /gene="atpD"
FT                   /locus_tag="CJJ81176_0142"
FT   CDS_pept        124558..125955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CJJ81176_0142"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF00306; match to protein
FT                   family HMM PF02874; match to protein family HMM TIGR01039"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0142"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71910"
FT                   /db_xref="GOA:A1VXJ0"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXJ0"
FT                   /protein_id="EAQ71910.1"
FT                   /translation="MQGFISQVLGPVVDVDFNDYLPQINEAIVVNFESEGKKHKLVLEV
FT                   AAHLGDNRVRTIAMDMTDGLVRGLKAEALGAPISVPVGEKVLGRIFNVTGDLIDEGEEI
FT                   SFDKKWAIHRDPPAFEDQSTKSEIFETGIKVVDLLAPYAKGGKVGLFGGAGVGKTVIIM
FT                   ELIHNVAFKHSGYSVFAGVGERTREGNDLYNEMKESNVLDKVALCYGQMNEPPGARNRI
FT                   ALTGLTMAEYFRDEMGLDVLMFIDNIFRFSQSGSEMSALLGRIPSAVGYQPTLASEMGK
FT                   FQERITSTKKGSITSVQAVYVPADDLTDPAPATVFAHLDATTVLNRAIAEKGIYPAVDP
FT                   LDSTSRMLDPNIIGEEHYKVARGVQSVLQKYKDLQDIIAILGMDELSEEDKLVVERARK
FT                   IEKFLSQPFFVAEVFTGSPGKYISLEDTIAGFKGILEGKYDHLPENAFYMVGNIDEAIA
FT                   KADKLKG"
FT   gene            125959..126348
FT                   /gene="atpC"
FT                   /locus_tag="CJJ81176_0143"
FT   CDS_pept        125959..126348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CJJ81176_0143"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF02823;
FT                   match to protein family HMM TIGR01216"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0143"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71973"
FT                   /db_xref="GOA:A1VXJ1"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXJ1"
FT                   /protein_id="EAQ71973.1"
FT                   /translation="MNDLINFEIVTPLGVIYQGEVKSVTLPGSEGEFGVLKGHAALVSS
FT                   LKSGVIDIEKADLNHELIAIDAGHAKVDEDKICVLAKGAVWVCGSDESEIEKNLAQAKD
FT                   LIKSMSSDNAALAATFSKLDNARMH"
FT   gene            126348..126902
FT                   /locus_tag="CJJ81176_0144"
FT   CDS_pept        126348..126902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0144"
FT                   /product="MotA/TolQ/ExbB proton channel family protein"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0144"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71938"
FT                   /db_xref="GOA:A0A0H3P994"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR017269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P994"
FT                   /protein_id="EAQ71938.1"
FT                   /translation="MNFEAIFHFFNNSSIITYIVLLWLSLYFILAFSILFARLTYLATW
FT                   RNKEKESLETLLLGEKDLSRTDSILRKCNDTTSNHLEIYKNLASRRASAGLTWLSIIAS
FT                   TSPFIGLFGTVISILETFGGLGTQNSLSIIAPKISEALVATGCGILVAIPAYTFHLIIK
FT                   RKAFELLSIIDSEIKVISSSK"
FT   gene            126911..127300
FT                   /locus_tag="CJJ81176_0145"
FT   CDS_pept        126911..127300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0145"
FT                   /product="TonB system transport protein ExbD, putative"
FT                   /note="identified by match to protein family HMM PF02472;
FT                   match to protein family HMM TIGR02801"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0145"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72026"
FT                   /db_xref="GOA:A0A0H3P9N8"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9N8"
FT                   /protein_id="EAQ72026.1"
FT                   /translation="MPFDDEKPELNITPLVDIMLVLLAILMVTAPSITYEEKINLPQGS
FT                   QKNTSAPTVKSLIISINAKKEIFLNQEKYDFISFADNLAQRKAQFNTEDPVFIRADKSL
FT                   KYDDVISVLRSVKNLGFNKVALQTE"
FT   gene            127303..128082
FT                   /locus_tag="CJJ81176_0146"
FT   CDS_pept        127303..128082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0146"
FT                   /product="TonB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0146"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ71987"
FT                   /db_xref="GOA:A0A0H3P9A2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P9A2"
FT                   /protein_id="EAQ71987.2"
FT                   /translation="MKNYGLSNLNSFLLALAIYISIVILVFFRLVSEVEPAIQYTDIKD
FT                   SFVDIELAEPSKQVITQSNTPKEIQKPTEQVDIEKLFAQTTNKTVKTEDIDQKASNFNE
FT                   LFGNIKEIQEEKTTKIQSSAKSGASSAPKPQASELVKQLNDSLLQEESSTQGQSTKAQK
FT                   IGIYDEFLGKVVRIITQRWTQYYPNSEKISVKVKIFIDENGKFGYTSVEKSGNPLYDAK
FT                   VAEFLESQKGKFITYPPQNKNISITMNLRDEAKVKND"
FT   gene            128092..129300
FT                   /locus_tag="CJJ81176_0147"
FT   CDS_pept        128092..129300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0147"
FT                   /product="tolB protein, putative"
FT                   /note="identified by match to protein family HMM PF04052;
FT                   match to protein family HMM TIGR02800"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0147"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72978"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA97"
FT                   /protein_id="EAQ72978.1"
FT                   /translation="MKKIVAIFLVFLGSLWAEDPVIDVVNSGVVLPKIIVKDNSNLSDE
FT                   NLKKSFYNIIVNDLKVSSNFEVVANATETSNYTFEYALNKNGNTLSLNVKIKAGSSDKS
FT                   EQTYTLNGLEQYPFLAHKSVKASVNALGLASVDWMDHKILIARNSSSKKSQIIMADYTL
FT                   TYQKVIVDGGLNLFPKWGNKEQTLFYYTAYDHDKPTLYRYDLNTNKASKILSSGGMVVA
FT                   SDVSVDGSKLLVTMAPKDQPDVYLYDLNTKNLTQLTNYSGIDVNGNFIGSDDSKVVFVS
FT                   DRLGYPNIFMQDLNSNSAEQVVFHGRNNSAVSTYKDFLVYSSREPNQAGVFNIYLMSIN
FT                   SDYIRQLTANGKNLFPRFSSDGGSIVFIKYLGVQSALGVIRVNANKTFYFPLRVGKIQS
FT                   IDW"
FT   gene            129377..129874
FT                   /locus_tag="CJJ81176_0148"
FT   CDS_pept        129377..129874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0148"
FT                   /product="peptidoglycan-associated lipoprotein Omp18"
FT                   /note="identified by match to protein family HMM PF00691;
FT                   match to protein family HMM TIGR02802"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0148"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73298"
FT                   /db_xref="GOA:A0A0H3PEU8"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR014169"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEU8"
FT                   /protein_id="EAQ73298.1"
FT                   /translation="MKKILFTSIAALAVVISGCSTKSTSVSGDSSVDSNRGSGGSDGWD
FT                   IDSKISQLNDTLNKVYFDFDKFNIRPDMQNVVSTNANIFNTEVSGVSITVEGNCDEWGT
FT                   DEYNQALGLKRAKAVKEALIAKGVNADRIAVKSYGETNPVCTEKTKACDAQNRRAEFKL
FT                   SR"
FT   gene            129878..130825
FT                   /locus_tag="CJJ81176_0149"
FT   CDS_pept        129878..130825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0149"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73189"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBT1"
FT                   /protein_id="EAQ73189.1"
FT                   /translation="MKKIFTVALLGATLLYAESSAFGAGDITSNSSYGLTSNEKLFKEK
FT                   LDNLNNENIQTNARINEINERIEGLQSTLEGINSQYAKSNSRLSQVEENNQNIENNFTS
FT                   EIQKLKAYVEESRKIQEANNKQVKKVLAELSSLVDAINANYVSKNELNDANLSVKTITP
FT                   SVVVSTTDSNSTIENNNTQNTQDDKAKQIDESWKKKKNNEILELAIKDVDKNAFEDSKA
FT                   KLNFLITKQYKPARANFWLGEIEYKQKNYNNAIVYYKKSSSLSTKGDYFPKLLYHTAIS
FT                   LDKTGDTKTANGFYKALKTNYPNSPEAKASPNRK"
FT   gene            130840..131415
FT                   /gene="slyD"
FT                   /locus_tag="CJJ81176_0150"
FT   CDS_pept        130840..131415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slyD"
FT                   /locus_tag="CJJ81176_0150"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   SlyD"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0150"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73020"
FT                   /db_xref="GOA:A0A0H3PAZ2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ2"
FT                   /protein_id="EAQ73020.1"
FT                   /translation="MAIEKNSVVSMFYELKDANTNEVLESNLYSQPISFILGKGQILES
FT                   LEEEVMKLDCPSNADVVIKKEKGLGEYDENAVQTLPKEQFAGIDLKVGMELFGEGENGE
FT                   TVRVTVKEIGENDVTIDYNHPYAGRDLLFSLNIVDARAASEDEILTGIIAGSHSCGCGS
FT                   GHGHDHHHGHGHGHGGGGCCGGGGCGCH"
FT   gene            131415..132335
FT                   /gene="fabD"
FT                   /locus_tag="CJJ81176_0151"
FT   CDS_pept        131415..132335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="CJJ81176_0151"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /EC_number="2.3.1.39"
FT                   /note="identified by match to protein family HMM TIGR00128"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0151"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73063"
FT                   /db_xref="GOA:A0A0H3PB04"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB04"
FT                   /protein_id="EAQ73063.2"
FT                   /translation="MKTAFIFPGQGSQSLGMGKDFYENSIKAKELLQNASDFCKIDFKH
FT                   LLFEENEKLNQSEFTQPAIVLNSLMAYSVLLEKKPDLSSKFALGHSLGEFSALAVNGAF
FT                   DFLEALSLVNKRGLFMQEDCAKVEAGMMVVLGLDDEKVEELCQKAQKENKQIFAANYNC
FT                   DGQIVVAGLKPDLASYESVFKEAGAKRAMLLNMSVASHCPLLENASAKLCVELEKVLKP
FT                   NFKAVLSNANAKIYTCKEEALELLKAQLISPVLYKQSIKACENEVDYFIEFGASVLKGL
FT                   NKKITSKETYALTNMNDIDEFLKVI"
FT   gene            132335..133021
FT                   /gene="mtnA"
FT                   /locus_tag="CJJ81176_0152"
FT   CDS_pept        132335..133021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnA"
FT                   /locus_tag="CJJ81176_0152"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /EC_number="3.2.2.16"
FT                   /note="identified by match to protein family HMM PF01048;
FT                   match to protein family HMM TIGR01704"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0152"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72979"
FT                   /db_xref="GOA:A0A0H3PEB1"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEB1"
FT                   /protein_id="EAQ72979.1"
FT                   /translation="MKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELVL
FT                   AYSKIGKVNSTLSASVMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYDLDITA
FT                   FGHPLGFVPGNEIFIKTDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIRE
FT                   IFNADACEMEGASVALVCDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVL
FT                   KMCEKL"
FT   gene            133018..133773
FT                   /locus_tag="CJJ81176_0153"
FT   CDS_pept        133018..133773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0153"
FT                   /product="PP-loop family protein"
FT                   /note="identified by match to protein family HMM PF01171"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0153"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73149"
FT                   /db_xref="GOA:A0A0H3PJ11"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ11"
FT                   /protein_id="EAQ73149.1"
FT                   /translation="MINLSKKLIRQVAQANAKFGLIKDGDRVLLGLSGGKDSLALAHLL
FT                   NRMQAHAPFKFELEAVTLSYGMGEDYSHLHAHCEEHGIKHSVLDSNIYEVSGDTIRENS
FT                   SFCSYFSRMRRGALYTYALEKGFNKLAIAHHLDDAAESFFMNFIHNGALRTLAPIYQSK
FT                   RGVTVIRPLIFVRERQLRDNATQNELSVIGNEFCPGMKLSEKNVKFPHAREEAKQLLAN
FT                   LEKNHPKLFTSLKTAFANLHTESFWLEKE"
FT   gene            133778..134299
FT                   /locus_tag="CJJ81176_0154"
FT   CDS_pept        133778..134299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0154"
FT                   /product="pyrazinamidase/nicotinamidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0154"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73374"
FT                   /db_xref="GOA:A0A0H3PJF3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJF3"
FT                   /protein_id="EAQ73374.1"
FT                   /translation="MKKAFVLVDYQNDFIDGSLGFDKALKIKENILKALNQIDFNNTHL
FT                   LLTYDTHDEHYLQSKEGLNLPVKHCIKESLGWQMPKEFEPFLQKAHKIFYKNTFGSLEL
FT                   ANFIQKSDYKELHFAGLVSHICVFCNIILAFGAKPNARIILHQNLSASFDKNLEKSAFD
FT                   LLRAYGIEIV"
FT   gene            134299..134913
FT                   /locus_tag="CJJ81176_0155"
FT   CDS_pept        134299..134913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0155"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72994"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY5"
FT                   /protein_id="EAQ72994.1"
FT                   /translation="MQGFILHTQKVKDEDLIVYILSPKMLIKVYRFYGLRHSSILSGYK
FT                   IDFALEENPSFLPRLKDVLHLGFLWIMQRDKMLIWQEFIRLLYRHLKDVEELDSFYFDL
FT                   LQECVKRFEKQNPKRVIVDAYLKILEFEGRLHKDFFCFACDEKIQNSITLLRAFLPSHS
FT                   QCALGFEFEEKKLKQFYSSKNCAIFDDEEIENLYHLIKEGL"
FT   gene            134910..135314
FT                   /locus_tag="CJJ81176_0156"
FT   CDS_pept        134910..135314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0156"
FT                   /product="conserved hypothetical protein TIGR00043"
FT                   /note="identified by match to protein family HMM PF02130;
FT                   match to protein family HMM TIGR00043"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0156"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73238"
FT                   /db_xref="GOA:A1VXK4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXK4"
FT                   /protein_id="EAQ73238.1"
FT                   /translation="MILSDEKCDFLESIASFLGPKDVELVFVDSKEMQEINLEQRKQDK
FT                   TTDVLSFPLENIDESLPLGSVVINVDLAKEKAKELGHSYEEEISLLFIHAMLHLLGFDH
FT                   ENDNGEMREKEKELIEYFNLPKSLIVRTLG"
FT   gene            135405..136658
FT                   /locus_tag="CJJ81176_0157"
FT   CDS_pept        135405..136658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0157"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73118"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIZ5"
FT                   /protein_id="EAQ73118.1"
FT                   /translation="MSIFSINDNSNYGSILSQAKANKESKENSKISFANAFLKQNASKL
FT                   NEIQNANSQTLARSEVLNSTNTTNTSNNTNFSISSKTSSPNYDISSEFKNSIYTLKYKQ
FT                   EDTSNIVSLAYGYGVDANGYMGSDFNKAAGLPEDFKIHKSTLDEIERFNQHNMASETSG
FT                   NYYDSFDMASIVKSHYNSFNQVISAFPNDKTSFSEADLEQLPKGLNDGCNQNKEYIVTH
FT                   IFNAEQFHEAQAIKYSTMNLGMNLMKLDFSPQSMEQGPSNEGEFNPDMSVYPQNEDGSY
FT                   SKEALFMSFLKSYSPIPSPNQVVLSPEAKVREAKLELEMKANPSFSVSLDDIMTGKVDF
FT                   ASLLKGYAQDGWLDAGIYAMEKGVAWQNTSIGYGGAWFDNQFNQAKANGWKASSESINS
FT                   YVGSIMDRLNNLIGQTRV"
FT   gene            complement(136655..137572)
FT                   /gene="dusB"
FT                   /locus_tag="CJJ81176_0158"
FT   CDS_pept        complement(136655..137572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dusB"
FT                   /locus_tag="CJJ81176_0158"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF01207"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0158"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73389"
FT                   /db_xref="GOA:A0A0H3PAT2"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAT2"
FT                   /protein_id="EAQ73389.1"
FT                   /translation="MIDFSKKPLFLAPMAGFSDLPFRNVVKKFGADITISEMISSNALV
FT                   YESSKTLHMLERAELENPYIVQIAGGDKEVLKKAVQMLNEMDFVDGIDFNCGCPVNKVV
FT                   KQCAGSALLENLELFKNLVGVIKENNKKSLTSVKFRLGFNEKYPEKMAKICESLGVDFI
FT                   SIHGRTRKQLYSGKADYESIASAKASVSIPVIANGDINAQNAKEVYKITKCDGLMIGRA
FT                   SVGNPWIFYEIKSGKSVDEKLKKEIILTHFDEMIKHYKDQGVSIFRKHLHEYSKGHKDA
FT                   SAFRDEVNRINDAKIMQEKIESFF"
FT   gene            complement(137569..138429)
FT                   /locus_tag="CJJ81176_0159"
FT   CDS_pept        complement(137569..138429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0159"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73409"
FT                   /db_xref="GOA:A0A0H3PAU3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAU3"
FT                   /protein_id="EAQ73409.2"
FT                   /translation="MIWLVIPLFIYMILAVLHIAFYGFLRYLKFKHFFKDAAKFEAYTQ
FT                   DLLLEKDLKTTFQTKEFRAVAQLFKTIKTHEKIPHSNKINEILDLIDGLNKNEFFNLSK
FT                   FKLENNNVLYLQNEKNHLKNDANYAYNKLKNLNEIKDEFEEIAFNTLIEKASYEQIKNV
FT                   KIPKKPSEVLTLIKRFKEGNLELSVAEYEVLLSHNTLSEKDYLNAAKLSTKLLNPDAIL
FT                   GIFNKIKNEKSEALRAHLYLLAEFGLLDELREQIHNDDKKFNDFKAFLVLREKNIKIDL
FT                   NQLIQ"
FT   gene            complement(138545..138907)
FT                   /locus_tag="CJJ81176_0160"
FT   CDS_pept        complement(138545..138907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0160"
FT                   /product="dnaK suppressor protein, putative"
FT                   /note="identified by match to protein family HMM PF01258"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0160"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73045"
FT                   /db_xref="GOA:A0A0H3PAZ8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ8"
FT                   /protein_id="EAQ73045.1"
FT                   /translation="MKKNEIQNFKNILEERKKAILENLQSNSNEIEALHNSVPSDSVDF
FT                   SVIETGSQIDFAISTNLKEELIEIEDSLDKIKNGTYGICESCDDEIDSQRLKVKPHARY
FT                   CITCRQIAEQGKKHEN"
FT   gene            complement(138919..139368)
FT                   /locus_tag="CJJ81176_0161"
FT   CDS_pept        complement(138919..139368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02590"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0161"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73003"
FT                   /db_xref="GOA:A1VXK9"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXK9"
FT                   /protein_id="EAQ73003.1"
FT                   /translation="MQVNIFCIQKSDEFKTWSEKYSKLISKYATLKEINVFNKKIALAQ
FT                   NLNAIEAKKSYEEAFMPYKKGYCIALDEKGKDLTSIEFAKLIQDKNELSFFIGGAYGLR
FT                   EEFNQSLDFRLSLSKLTLAHQFVKTLLLEQIYRAFCINNNHPYHK"
FT   gene            complement(139370..140212)
FT                   /gene="accD"
FT                   /locus_tag="CJJ81176_0162"
FT   CDS_pept        complement(139370..140212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="CJJ81176_0162"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM TIGR00515"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0162"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73239"
FT                   /db_xref="GOA:A0A0H3PBU8"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBU8"
FT                   /protein_id="EAQ73239.1"
FT                   /translation="MNFADIFSKIRRQQPSIKEAPNHWVKCQSCHALMYYKEIESCFNV
FT                   CPKCNYHMRISADERIKLLSDEGSFIEYDANLEAIDPLKFVDSKSYKKRLSEGESKTGR
FT                   KSSVISGECEINSLKTQLVVFDFSFMGGSLGSVEGEKIVRAIQRAITSKTPLVIVSASG
FT                   GARMQESTYSLMQMSKTSAALKLLSKEKLPYISILTNPTMGGVSASFAWLGDLIIAEPE
FT                   ALVGFAGARVIKQTIGADLPEGFQKAEFLLEHGLIDAIVERGEQKQYLSDVLKFFSGK"
FT   gene            complement(140221..140943)
FT                   /locus_tag="CJJ81176_0163"
FT   CDS_pept        complement(140221..140943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0163"
FT                   /product="Inositol monophosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0163"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73415"
FT                   /db_xref="GOA:A0A0H3PF12"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF12"
FT                   /protein_id="EAQ73415.1"
FT                   /translation="MKEFLDACLNANLQIRKYLNNIPQNDLKLCSKLGYDKNQGYELDL
FT                   KCEQIFIKYLSCFGQIFSEESGLIGKASPKQMILDPLDGSSNFVSKIPFYGTSIALMEK
FT                   DQAKSAFVCNLVSQEIFAFNNNQAFKSNLSDPKYSPLTPNLFSKIGIVEKISLHPELLD
FT                   FLTKNQLKFRSLGATALSLAYASYFSFVLILGKTRIFDTAAALAIHQNLYIEKNENFLL
FT                   LSQDKKIFDIILEFLKNN"
FT   gene            complement(140943..143162)
FT                   /locus_tag="CJJ81176_0164"
FT   CDS_pept        complement(140943..143162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0164"
FT                   /product="outer membrane protein, OMP85 family"
FT                   /note="identified by match to protein family HMM PF01103;
FT                   match to protein family HMM PF07244"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0164"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73202"
FT                   /db_xref="GOA:A0A0H3PJ47"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ47"
FT                   /protein_id="EAQ73202.1"
FT                   /translation="MKKHLISICALVAIANAATIKDIKFIGLNHLSNTSAINITGLKIG
FT                   EEINPAKINTAILNLYKQNYFENIAVENNNGILEIIVTEKPTIAKVTITGIASNDRKQV
FT                   ESILGIKRGTLLDEGSIKEAIERIKAYYEAKSYFDTIVEYKKKTLENTDGLELEFIVNR
FT                   GENIIIDNVHLSGAKKFSYSDIEPAVVNKEKEFMGWMWGRNDGKLKVFELSNDSSRIAD
FT                   EYMKKGYLDVQVSSPYLKTYTDTYQANLTYFIKEGKPYKIKSISIENPLFDDKQNAQTV
FT                   KDLRSSAGKTINIEDIRKDVKTIETQSADLGYAFVEVYPDIQKNDQTQEATVVFKVIPH
FT                   DKVYIRNVIISGNSRTVDRVIRRELYITEGNLYNRTDLSESKNALKRTSYFDDVNIKEE
FT                   KVDDTHIDLIVDVKEASTGAISGGIGYGSSDGILLNASLSDTNIFGSGIKSSVSVDKSD
FT                   DTLSGRISLINPRVLDSQYSLGGTLYSNDYEWDNYSEKNYGFDITVGRQFARYYNVSLT
FT                   YNLEQSDIYHLSPTLLRTGYELGKSIKSSITPAITFNNTDDYYLPRSGIIASTSLEYAG
FT                   LGGDQEFISSSSKFNFYQGLQDYIGYDLIYRYKASFYKVWDEGYLPINQRIYLGGIRSI
FT                   RGFESRTVSPKNQWGDEVGGTIAFANSVELSFPLIDRIKLRGSVFFDYGMIGRKNLDEI
FT                   KRMSTGIGIEWITPIGPLQLVFAKPLNDKKGDDTNSFEFNLGTRF"
FT   gene            143239..144066
FT                   /gene="tyrA"
FT                   /locus_tag="CJJ81176_0165"
FT   CDS_pept        143239..144066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="CJJ81176_0165"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02153; match to protein
FT                   family HMM PF03721"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0165"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73151"
FT                   /db_xref="GOA:A0A0H3PAH1"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAH1"
FT                   /protein_id="EAQ73151.1"
FT                   /translation="MKIAIIGLGLMGGSLGLCLKENKLISCVYGMDLSKENEKDALRLG
FT                   LIHELIEFKDLALCDMIFVATPVNAIIEILQKLVDLPSNVTIIELGSTKRKIIESLPKN
FT                   LIKQTLFAHPMTGTENSGPKAAFKELYKDAVCVLCDSEIADDLHQKRAVEIFSHLGMKI
FT                   VFMDSKAHDHHAAIISHLPHVISFSLANFVMKEEDKRNIVHLAGGSFKGMSRIAKSSPQ
FT                   MWESIFLQNKDNLLSSIDFFQQELERCKQMIQLDKNDELREWMKQANTLREIL"
FT   gene            144146..145519
FT                   /locus_tag="CJJ81176_0166"
FT   CDS_pept        144146..145519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0166"
FT                   /product="peptidase, M23/M37 family"
FT                   /note="identified by match to protein family HMM PF01551"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0166"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72962"
FT                   /db_xref="GOA:A0A0H3PIR6"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIR6"
FT                   /protein_id="EAQ72962.1"
FT                   /translation="MAKRKGKTYLSVLILVLIAILIFFISRLSIFEKNPPQILMPDVVY
FT                   TDLKKPILVHVKDDESSIKNVQIILHKDDNTSAMVIADEKISNLKDITLQVALPKFGYK
FT                   ENVKSFVLEVIAKDSSFWNFFSGNEARKQIAVLVDNTAPKINIISNSYQIEQGGAGAVV
FT                   FKAEDANLDKVYIETNKGKIFKVTPYVKEGYYAALIAWDARDEEFRAFVIATDKAGNIS
FT                   KERIRYYFVNRKYRVSNINLTDKFLDGKIENLANQYAPKDNNLNRYEKFKFVNETLRNS
FT                   NEELIHEITSKVPEEKIDNFDLNLFLPLKNGMKVADFADHRYYSYNGQFVSDSYHMGLD
FT                   LASVAQAPIISNNAGKVVFAAENGIYGLNLIVYHGFGVYSLYGHCSSKNVDLDEMINKQ
FT                   SIIGKTGTSGLALGDHLHFGVLVQGVETRPEQWQDKKWVENNIYNVLNDGKKIILGKN"
FT   gene            145519..146403
FT                   /gene="lpxC"
FT                   /locus_tag="CJJ81176_0167"
FT   CDS_pept        145519..146403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="CJJ81176_0167"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF03331;
FT                   match to protein family HMM TIGR00325"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0167"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73166"
FT                   /db_xref="GOA:A1VXL5"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXL5"
FT                   /protein_id="EAQ73166.1"
FT                   /translation="MKQLTLAKTVKGVGIGLHKGEPIEITLEPLEANSGIVFFRSDLNA
FT                   SYKASPENVINTQMATVLGDDRGFISTIEHLMSAINAYGIDNVRIVLNANEAPVMDGSS
FT                   ISFCMMLDEAEVKELDAPKKIMVIKKPVEVRDGNKFVRLTPTKEPRINYTIKFDNAVIG
FT                   EQSYNFEFSKKNYIENIARARTFGFLKDVQALRSMNLALGGSLENTIVVDENRILNPEG
FT                   LRFKDEFVRHKILDAIGDLTLLGYRVFGDYISYAGSHHLNHLLTKEVLKDKDAYEIVSL
FT                   EKTTQKAYEKVFA"
FT   gene            146442..146843
FT                   /locus_tag="CJJ81176_0168"
FT   CDS_pept        146442..146843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0168"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73470"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF46"
FT                   /protein_id="EAQ73470.2"
FT                   /translation="MIGIYQDDKLIKTYKSEEKASEFLPKILDELLKEYDFTSLIYANG
FT                   PGSYMGIKISYVGLSTLSIVKNIPLFAVSAFELNGYKPISANKNFCFVYKEGEICLEQN
FT                   IPAEFFLPKNLQELKLNNDNLPFYFLDAI"
FT   gene            146852..147730
FT                   /gene="thrB"
FT                   /locus_tag="CJJ81176_0169"
FT   CDS_pept        146852..147730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="CJJ81176_0169"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00191"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0169"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73367"
FT                   /db_xref="GOA:A1VXL7"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXL7"
FT                   /protein_id="EAQ73367.1"
FT                   /translation="MKILVPATSANLGPGFDCLGLSLKLFNETQIQKSGVFSISIGGEG
FT                   SDNIFLKKNNIFVNIFYEIYEKLSGKKDNFRFIFQNNIPLSRGLGSSSAVIVGAIASAY
FT                   YMSGFKVEKERILDEALIYENHPDNIAPATLGGFVCSLVEKNKVYSIKKEIDKDLAAVV
FT                   VIPNLAMSTEQSRQALAKNLSFNDAVFNLSHASFLTACFLEKKYEFLKFASQDKLHEIN
FT                   RMKNLPELFEVQKFALENKALMSTLSGSGSSFFSLAFKDDALALAKKIQTKFKDFRVQY
FT                   LEFDDNGFEIC"
FT   gene            147755..148012
FT                   /locus_tag="CJJ81176_0170"
FT   CDS_pept        147755..148012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0170"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04296"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0170"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73293"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEU4"
FT                   /protein_id="EAQ73293.2"
FT                   /translation="MKKHIPIRMCIVCKNRFEQNMLFRFKVVLGDIVPKAEHGRSGYLC
FT                   QNCIEREDKVLQKAFSKICKNLNTKITQQGLKEIFLNGKD"
FT   gene            147999..150614
FT                   /gene="infB"
FT                   /locus_tag="CJJ81176_0171"
FT   CDS_pept        147999..150614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="CJJ81176_0171"
FT                   /product="translation initiation factor IF-2"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF01926; match to protein
FT                   family HMM PF03144; match to protein family HMM PF04760;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00487"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0171"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73271"
FT                   /db_xref="GOA:A1VXL9"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXL9"
FT                   /protein_id="EAQ73271.1"
FT                   /translation="MAKIRIHEIAKELGYDSKEIIEKANELGLGIKTASNAVEPEIAAA
FT                   IYEYIQTREIPEAFKKNIKTPTAKKPKKENIKEQEKLNESEKKEPKKEEKLKQEVKKEE
FT                   LKIEKENAKEEEKQEIIDAHKPQSLASATLAKRRGLVIVKKKKDEEEIQVKKEEVKNSN
FT                   DISINNEERLSLKTMFSNADESLKKKKKEKKSFVASKKESTEKMNFLDEHDFGDISLDD
FT                   EDEVVLPDFSVKEQEKPQNINKKQPNFIRQAVGNSAGFGLEGGIQRRSRKKPSKKIEKK
FT                   EVEEVGSVAISKEIRVYEFADKIGKSTSEVISKLFMLGMMTTKNDFLDEDAIEILAAEF
FT                   GIEINIINEADEFDYVKDYEEETDEKDLVTRAPVITIMGHVDHGKTSLLDYIRKSRVAS
FT                   GEAGGITQHVGAYMVEKNGRKITFIDTPGHEAFTAMRARGASITDIVIIVVAADDGVKP
FT                   QTKEAINHAKAAGVPIIIAINKMDKEAANPDMVKTQLAEMEIMPVEWGGSYEFVGVSAK
FT                   TGMGIEDLLEIVLLQADILELKANPKSFAKASIIESSVQKGRGAAATIIVQNGTLTVGS
FT                   TVVAGEAYGKVRAMSDDQGKALKEIKPGECGVIVGLSEVADAGEILIAVKTDKEAREYA
FT                   NKRHEYNRQKELSKSTKVSIDELGAKIKEGNLKALPVILKADVQGSLEALKASLEKLRN
FT                   DEIKVNIIHSGVGGITQSDIELASASENSIVLGFNIRPTGEVKERSKDKGVEIKTYNVI
FT                   YNLLDDVKALLGGMMSPIISEEQLGQAEIRQVINVPKIGQIAGCMVTEGVINRGAKIRL
FT                   IRDGVVVYEGNVSSLKRFKDDAKEVAKGYECGVGIEGCDDMRVGDYIESYKEVEEQASL
FT                   "
FT   gene            150611..150973
FT                   /gene="rbfA"
FT                   /locus_tag="CJJ81176_0172"
FT   CDS_pept        150611..150973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="CJJ81176_0172"
FT                   /product="ribosome-binding factor A"
FT                   /note="identified by match to protein family HMM TIGR00082"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0172"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73193"
FT                   /db_xref="GOA:A0A0H3PBB3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBB3"
FT                   /protein_id="EAQ73193.1"
FT                   /translation="MNPNEIKKLRTESILKELIPEALANLDDENLKNLCVVDVECKKGR
FT                   YDAFVYLDKMFFNVHEQEKILSSLKKASRALQNYCMSEQGWYRCPNFHFKFDDRLEYQN
FT                   HMDALFEKIKKDKNES"
FT   gene            150963..151385
FT                   /locus_tag="CJJ81176_0173"
FT   CDS_pept        150963..151385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0173"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02576"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0173"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73102"
FT                   /db_xref="GOA:A1VXM1"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXM1"
FT                   /protein_id="EAQ73102.1"
FT                   /translation="MNLEALCKEAELSFYDDELVSENGRKIYRIYVQKEGGVNLDDCAR
FT                   LSEILSPIFDVEPPVNGEYFLEVSSPGLERKLSKIEHFAKSIGELVKITTNEKEKFEAK
FT                   IIAVDDENITLENLENKEKTTINFNDIKKARTFIIW"
FT   gene            151590..153401
FT                   /locus_tag="CJJ81176_0174"
FT   CDS_pept        151590..153401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0174"
FT                   /product="McrBC restriction endonuclease system, McrB
FT                   subunit, putative"
FT                   /note="identified by match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0174"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73019"
FT                   /db_xref="GOA:A0A0H3PED2"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PED2"
FT                   /protein_id="EAQ73019.2"
FT                   /translation="MSSKDEVVNFNFFKKYDFYVDLSYGKGNVAKIPWIIFIRMDTQEY
FT                   KASYGVYVYCGIKRENREIVVCIGESEDKTVNYLARNKVDEYNAQFNHQVYNYSNLSND
FT                   INLIVDKIILNMQWFKELPLNEIQDININTLESKSLEVENNVQQISSKMENKNMPLNQI
FT                   LYGSPGTGKTYHTIDKALEILGKNLESRDDKKAKFDEYVKKGQIVFTTFHQSYGYEEFV
FT                   EGIKPRIDSKENSKEIEYKIKDGIFKELCEKALDNYENSILNADELNKKIELKEKVENF
FT                   LNWLLETNEPIGKTKGGNFFVVEIDNKTIVIYSEGVERFDGIFNLNLSIFMELLKCKDE
FT                   FNNATEMFKKVFNRDYADRTHTYYFNLVKKFKAYEEKQLAAKIENNKNNDNSLKPYIII
FT                   IDEINRGNLSKIFGELITLIEPSKRIGEKEELKVTLPYSGEKFGVPKNVYIIGTMNTAD
FT                   RSITSLDTALRRRFEFVEMMPDVSKLSIDCEGINLQELLKAINTRIEYLLDREKTIGHA
FT                   FFISVENLESLKKVFKNRIIPLLQEYFYNDYALIDAVLNKNGMLEISVENKDYLKNMTE
FT                   FIESDKIVYKFSDSNNWNKDTFIKIYK"
FT   gene            153401..153880
FT                   /locus_tag="CJJ81176_0175"
FT   CDS_pept        153401..153880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0175"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73431"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAV8"
FT                   /protein_id="EAQ73431.1"
FT                   /translation="MKTSNTFSIIEHQAFSKEDLKEIFKEKAEGFYKELEDFAKNNENL
FT                   LGFKNKNTLKAKNYVGIIQTKSGVLEILPKCTNLDSYKKEDSSSNHDKEKLKRYYELDN
FT                   ISKNNDFYEQDFKFNPKNLLINMLKTLKNFPFKNHKFHLCKVLKFLYLKCLSLCF"
FT   gene            153871..154737
FT                   /locus_tag="CJJ81176_0176"
FT   CDS_pept        153871..154737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0176"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0176"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73244"
FT                   /db_xref="InterPro:IPR019292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBD6"
FT                   /protein_id="EAQ73244.1"
FT                   /translation="MFLDEFDSVYKKGLMRSYLSCEENRAFLKGKLLFNEHIKRNLIHK
FT                   ERFFTSNDEFVLDIAPNRLIKSTLNFLKSKTSLNKFRLIKSMQILDEVEFSKNYEKDFS
FT                   YKISRHFDYYENLLLWCKIFLKNESFMPYHGKNEAFALLFPMEKIFEDYVAYMLKKVNP
FT                   AQDIKVQNNGKYLISKNDENCFMLKPDLYIENKMILDTKWKIPNDSEDEKKQGIEQSDL
FT                   YQMFAYACKFKIYDIKLVYPLCEKTQDLQRKIAEKFFVFKASEHLYFKEQGQKDIKVQV
FT                   CFAPLPF"
FT   gene            complement(154726..155529)
FT                   /locus_tag="CJJ81176_0177"
FT   CDS_pept        complement(154726..155529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0177"
FT                   /product="cation ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00950;
FT                   match to protein family HMM PF01032"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0177"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73385"
FT                   /db_xref="GOA:A0A0H3PEZ6"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEZ6"
FT                   /protein_id="EAQ73385.1"
FT                   /translation="MLEILNFTFFQNALLGAILVSIACGIIGTLVMINRLFSMAGGITH
FT                   GAFGGIGIAFYFSLPILLSTGIFTLFLAFLVAFLAKRYEHRSDSIIAVIWAFGMAVGII
FT                   LIDLSPSYNTDLMAYLFGSILAVGTQDLWLMALVDSVVVLLIFLFYRQFEALSFDAEFA
FT                   KVRGINTSFFHYLLIALMAFCIVISIRLVGLILVMALLSIPSFIAENFTKKLGFIMVLA
FT                   SFLSMIFCVLGLILSYYLNLSSGACIIAVACFGFLMHLIGKFLKR"
FT   gene            complement(155522..156376)
FT                   /locus_tag="CJJ81176_0178"
FT   CDS_pept        complement(155522..156376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0178"
FT                   /product="cation ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0178"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73212"
FT                   /db_xref="GOA:A0A0H3PBC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBC1"
FT                   /protein_id="EAQ73212.1"
FT                   /translation="MLFFEISNLNYAYNNEIILKNINLSYDNKDFLSIIGPNGVGKSTL
FT                   VKLILGLLKSKNEIHFKALQKKEIGYVPQHTLANPNFCPRVLEIVLMGLVSKKIFGFYG
FT                   KKDKEKAMQALKSVGMEKFWNKTIDSLSGGQRQRVFIARALASECKMLILDEPTASVDN
FT                   KSAIQIFELLSSLHQKGMGILLICHDINLVLAYSDKIAHLNKELFLHTNTKEKEKSSFL
FT                   KHLYENHSHFCDVEMSLNTCFCDEKNCDSKKLCEQEFTRRNLKKTEFKKENFCLKFSKE
FT                   NNA"
FT   gene            complement(156389..157279)
FT                   /locus_tag="CJJ81176_0179"
FT   CDS_pept        complement(156389..157279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0179"
FT                   /product="cation ABC transporter, periplasmic
FT                   cation-binding protein"
FT                   /note="identified by match to protein family HMM PF01297"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0179"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73053"
FT                   /db_xref="GOA:A0A0H3PIV9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIV9"
FT                   /protein_id="EAQ73053.1"
FT                   /translation="MKKILLFILSLGIFYTFTQAKNLEQEQNTSSNLVSVSIAPQAFFV
FT                   KKIAANTLDVNVILPPNSNEHNFEFKPSTMKKLEKSDIYFTIGLEFEKVFTDKFKQNFS
FT                   KLQVVNMQKNIALIQTHDTHEHSHEHEHHEHEHFDPHTWLDPILVQTMALNIYDTLIQK
FT                   YPQNENLYKENLDKFLAELDSLNLQIASKLEKLKNREFVVYHPSWTYFAKRYNLTQIPV
FT                   EILGKEPKSKDLQKLITLMKDKNLKVIFVQNGFPENAAKTLAKECDAKIYKIDHLSYDW
FT                   ENELLKTADAFSHNL"
FT   gene            157478..159457
FT                   /locus_tag="CJJ81176_0180"
FT   CDS_pept        157478..159457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0180"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0180"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73062"
FT                   /db_xref="GOA:A0A0H3PEF7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEF7"
FT                   /protein_id="EAQ73062.1"
FT                   /translation="MKSVKLKVSLIANLIAVVCLIILGVVTFIFVKQAIFHEVVNAEIN
FT                   YVKTAKNSIESFKARNSLALESLAKSILKHPIEQLDSQDALMHYVGKDLKNFRDAGRFL
FT                   AVYIAQPNGELVVSDPDSDAKNLDFGTYGKADNYDARTREYYIEAVKTNKLYITPSYID
FT                   VTTNLPCFTYSIPLYKDGKFIGVLAVDILAADLQAEFENLPGRTFVFDEENKVFVSTDK
FT                   ALLQKGYDISAIANLAKTKEDLEPFEYTRPKDGNERFAVCTKVSGIYTACVGEPIEQIE
FT                   APVYKIAFIQTAIVIFTSIISVILLYFIVSKYLSPLAAIQTGLTSFFDFINYKTKNVST
FT                   IEVKSNDEFGQISNAINENILATKRGLEQDNQAVKESVQTVSVVEGGNLTARITANPRN
FT                   PQLIELKNVLNKLLDVLQARVGSDMNAIHKIFEEYKSLDFRNKLENASGSVELTTNALG
FT                   DEIVKMLKQSSDFANALANESGKLQTAVQSLTTSSNSQAQSLEETAAALEEITSSMQNV
FT                   SVKTSDVITQSEEIKNVTGIIGDIADQINLLALNAAIEAARAGEHGRGFAVVADEVRKL
FT                   AERTQKSLSEIEANTNLLVQSINDMAESIKEQTAGITQINDSVAQIDQTTKDNVEIANE
FT                   SAIISSTVSDIANNILEDVKKKRF"
FT   gene            159592..161373
FT                   /locus_tag="CJJ81176_0181"
FT   CDS_pept        159592..161373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0181"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05787;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0181"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73176"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBS6"
FT                   /protein_id="EAQ73176.1"
FT                   /translation="MERRLFLKGSALGSMVAFFASSNLSAAMLKDKDLLGFKAVSASTQ
FT                   DKVIVPQGYEAKVLISWGDPLFSKAKPYDENKIIDMNAVKNAHLVFGDDNDGMSFFPLS
FT                   KNRGILAVNNEYINPEIMFNHHGKNLSKEDILYEQASVGVSILEIEKKGDDWTVVLDSK
FT                   YNRRIDANTKMQVSGAAKKEVLKNEKFVHGTFANCANGQTPWGTYITCEENFDDFFGSS
FT                   DENLEFNDAFKRYGFNKTSLYGWEKFDERFDLAKNIDEANRFGWIVEINPFDAKSTPVK
FT                   RTSLGRFKHENAEIIVEKDGSVIVYMGDDEMNEFIYKFVSKHKYKKGADTSKILDEGTL
FT                   YVGQFNGNMGDFKGQGKWIALEYGKNGLDEKNGFKSQAQVLINTRLAASIVGATPMDRC
FT                   EWIASHKQSGSKEVFATLTNNKNRQEPNAANPRTKNVYGQILKWMPKNSHKDDDFTWEI
FT                   FALAGNPDNQQGLYKGSNNITSENKFNSPDGLKFDRDGRLWIQTDGSYSNKDEYEGMGN
FT                   NCMLAANPKTGEIRRFLTGPIACELTGIAFSEDYTTMFVGIQHPGEGLKGSTFPYGKTP
FT                   RSSVMMIRKLDGGVIGS"
FT   gene            complement(161411..162349)
FT                   /gene="trxB"
FT                   /locus_tag="CJJ81176_0182"
FT   CDS_pept        complement(161411..162349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="CJJ81176_0182"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992; match to protein
FT                   family HMM TIGR01292"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0182"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73090"
FT                   /db_xref="GOA:A0A0H3PAE7"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAE7"
FT                   /protein_id="EAQ73090.1"
FT                   /translation="MLDVAIIGGGPAGLSAGLYATRGGLKNVVMFEKGMPGGQITSSSE
FT                   IENYPGVAQVMDGISFMAPWNEQCMRFGLKHEMVGVEQILKNSDGSFTIKLEGGKTELT
FT                   KAVIVCTGSAPKRAGFKGEDEFFGKGVSTCATCDGFFYKNKEVAVLGGGDTALEEALYL
FT                   ANICSKVYLIHRRDEFRAAPSTVEKVKKNEKIELITSASVDEVYGDKMGVTGVKVKLKD
FT                   GSIRDLNVPGIFTFVGLNVRNEILKQDDGKFLCNMEEGGQVSVDLKMQTSVAGLFAAGD
FT                   LRKDAPKQVICAAGDGAVAALSAMAYIESLH"
FT   gene            complement(162483..162797)
FT                   /gene="trx"
FT                   /locus_tag="CJJ81176_0183"
FT   CDS_pept        complement(162483..162797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="CJJ81176_0183"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0183"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73309"
FT                   /db_xref="GOA:A0A0H3PAP0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAP0"
FT                   /protein_id="EAQ73309.1"
FT                   /translation="MGKYIELTSDNFAQAKEGVALVDFWAPWCGPCRMLAPVIDELAND
FT                   FDGKAKICKVNTDEQGDLAAEFGVRSIPTLIFFKNGEVVDQLVGAQSKQAISDKLNSLL
FT                   "
FT   gene            complement(162854..163192)
FT                   /locus_tag="CJJ81176_0184"
FT   CDS_pept        complement(162854..163192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02021"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0184"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73230"
FT                   /db_xref="GOA:A1VXN2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXN2"
FT                   /protein_id="EAQ73230.1"
FT                   /translation="MGVKAYLDGILGEDKACKFLKKQGFEILKRNFHSKFGEIDIIAKK
FT                   DEILHFIEVKFTQNDYEVSERLDRKKLEKILKTIEFYHLKNGISSDFQIDLICIKNDVI
FT                   QFCENISF"
FT   gene            complement(163192..164439)
FT                   /gene="hom"
FT                   /locus_tag="CJJ81176_0185"
FT   CDS_pept        complement(163192..164439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hom"
FT                   /locus_tag="CJJ81176_0185"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00742;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0185"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73424"
FT                   /db_xref="GOA:A0A0H3PC31"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC31"
FT                   /protein_id="EAQ73424.1"
FT                   /translation="MKVAILGYGTVGSAVVKFLLENDKLIRARCGQSITPVIALARSPK
FT                   KNALIPITHSVEEILNADVDVFVELMGGVDEAFKIVSEILKKKKAVVTANKAMLAYHRY
FT                   ELENLAKNLAFGYEASVAGGIPIIKVLKEGLSANNILAIKGILNGTSNYILSSMSQKNM
FT                   SFEQALQIAQNLGYAEADPTFDIEGQDAAHKLLVLSSIAYNLKAKPEDILIEGISEIGP
FT                   EDMYFANEFEFTIKLLGIAKVRENKVELRVHPTMIDKEKMLAKVDGVMNAISINGDLLG
FT                   ESLYYGVGAGGEATASAVISDLMDIARDQVKAPMLGFVNTLEYELLSKDEIYTKYYLRV
FT                   KVEDKIGVLSKITQLMSENNISIDSFLQKPKKNDENYSTLFFTTHLTYEKSIQNLLEIL
FT                   RKQDFIKTKPFMMRIE"
FT   gene            complement(164443..165645)
FT                   /locus_tag="CJJ81176_0186"
FT   CDS_pept        complement(164443..165645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0186"
FT                   /product="aminotransferase, classes I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0186"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73404"
FT                   /db_xref="GOA:A0A0H3PF06"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF06"
FT                   /protein_id="EAQ73404.1"
FT                   /translation="MFDEIRFNTIERLPNYVFAEVNAIKMAARRAGEDIIDFSMGNPDG
FT                   KTPQHIIDKLCESANKDKTSGYSTSMGIYKLRLAICNWYKRKYNVNLDPENEVVATMGS
FT                   KEGFVNLARAIINPGDVAIVPTPAYPIHTQAFIIAGGNVAKMPLAYNEKFELDENQFFE
FT                   NLHKTLNESIPRPKYVVVNFPHNPTTVTCEKSFYERLIATAKKERFYIISDIAYADLTY
FT                   DDYKTPSILEIEGAKDVAVETYTLSKSYNMAGWRVGFVVGNKRLVSALKKIKSWFDYGM
FT                   YTPIQVAATIALDGDQTCVDEIRATYDKRMHILLEAFENAGWKLQKPRASMFVWAKLPE
FT                   SKRHLKSLEFSKQLLQRASVAVSPGVGFGEAGDEYVRIALIENENRIRQATRNIKKYLK
FT                   E"
FT   gene            complement(165657..166463)
FT                   /locus_tag="CJJ81176_0187"
FT   CDS_pept        complement(165657..166463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0187"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73036"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM5"
FT                   /protein_id="EAQ73036.1"
FT                   /translation="MVKKIIILTLWVNISFAISSLELAKNLVNNPSKNSQLELLFSNNS
FT                   YIDNNGNCDIAKISQILKTNSLIALTLSNPQSLRLNFKAKADEVMFFKILSDVLTDAGY
FT                   IYFIPTDLILREGNIDYTIQVESQYVLDPGTLYNLLKENSVYINNIKRIGAYDYEYDLN
FT                   FSNAVLKTNTNVNLNTPKSLEKPLKDYVLDLKNATNLIIDANDLDNWFPKIFFLDKNLN
FT                   LIKAVKSENKNNHFSELIPNGAIYAIVSDMYSLDNIRRGLKITLKK"
FT   gene            complement(166457..167395)
FT                   /locus_tag="CJJ81176_0188"
FT   CDS_pept        complement(166457..167395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0188"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73013"
FT                   /db_xref="GOA:A0A0H3PIU3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIU3"
FT                   /protein_id="EAQ73013.1"
FT                   /translation="MLNWKKIQELNLKEVAAKTQIELDFLEALVEKNFAVLSRFNVKGF
FT                   VKILSREYELDFSDFNEEYEAYLNENNPTPQTKSKMITPKLDAYSQKSSNAWPFLIVLI
FT                   VLVIIGSGIYYFDTLKTFFKDEQNNTSATVIDIIGQAQENLKSLGGNNVVVIDNNKAQE
FT                   TNQTESVLPSQNISLQENDKNISIENNISENNTTLLDEEKNTQIQEDTNTPKTDSLKEA
FT                   HFKTSTKIWIGLIDLKSLKKTSFVKEKDFNISLDKDQLILTGAAALTMFDQENKEQKFP
FT                   AGISKRFLIKDGKITSISAAEFVKLNKGKEW"
FT   gene            complement(167388..168071)
FT                   /locus_tag="CJJ81176_0189"
FT   CDS_pept        complement(167388..168071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0189"
FT                   /product="RNA methyltransferase, TrmH family"
FT                   /EC_number="2.1.-.-"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM PF08032"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0189"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72998"
FT                   /db_xref="GOA:A0A0H3PEC2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEC2"
FT                   /protein_id="EAQ72998.1"
FT                   /translation="MIVYGKQIFFYILEYHKDCINELYLAKECDKITFSKIAKSGFKIK
FT                   KLDFKTAQAYAKGGNHQGFLLDIKESSFANLNEIKKNDFIVMLYGISDVGNIGAITRTA
FT                   YALGVGALIFIGEKLAMEGVIRTSSGAALDLPIVISNDALSVINELKQVGFYFYASDGS
FT                   GKEIHSVKINNGKKVLVLGSEGFGLSSKIVKKCDECVGIAMKNNFDSLNVSAAFAILCD
FT                   RMLNA"
FT   gene            complement(168085..168909)
FT                   /locus_tag="CJJ81176_0190"
FT   CDS_pept        complement(168085..168909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0190"
FT                   /product="tetrapyrrole methylase family protein"
FT                   /note="identified by match to protein family HMM PF00590;
FT                   match to protein family HMM TIGR00096"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0190"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73234"
FT                   /db_xref="GOA:A0A0H3PEQ8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEQ8"
FT                   /protein_id="EAQ73234.1"
FT                   /translation="MLYFIPTPIGNLSDISFRALELLKTCDLVFCEDTRVSKSLISLLN
FT                   TKFHTDIHISKFIALHSHNEKEVLASIDLKIFEKNVAYLSDAGMPGISDPGKALVEFAQ
FT                   ENNITYEILPGANAALVALVSSAFCQKEFIFIGFLANKGKERQKDIEKILNFPYPSIIY
FT                   ESPKRILSLVEQIMILDSQREIFLIKEISKKFEKKFKGNAKELSEILKKSNLNGEWVVV
FT                   LQSKEQNFLQNTLCEKDIMDLELPLKAKAKLLSKINGKNAKEIYQKLLLSQD"
FT   gene            complement(168912..169112)
FT                   /gene="rpmE"
FT                   /locus_tag="CJJ81176_0191"
FT   CDS_pept        complement(168912..169112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="CJJ81176_0191"
FT                   /product="ribosomal protein L31"
FT                   /note="identified by match to protein family HMM PF01197;
FT                   match to protein family HMM TIGR00105"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0191"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73181"
FT                   /db_xref="GOA:A1VXN9"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXN9"
FT                   /protein_id="EAQ73181.1"
FT                   /translation="MKKEIHPEYVECKVSCACGNTFTTKSNKAELRVDICSNCHPFFTG
FT                   SEKIVDAAGRVEKFKKKYAMQ"
FT   gene            complement(169191..169847)
FT                   /locus_tag="CJJ81176_0192"
FT   CDS_pept        complement(169191..169847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0192"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0192"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73076"
FT                   /db_xref="GOA:A0A0H3PAE1"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAE1"
FT                   /protein_id="EAQ73076.1"
FT                   /translation="MQFLYNKQAGEEFIQLQGENFNHLKVRRVKENSELNLRNLQDNFL
FT                   YNYTITNLTRNSCTLKFLNKKSQNIKQSELNLALAIIDIKILEKTLPFLNELGVKKLHL
FT                   VFTNFSQRNFKIDLERFEKIIISSCEQCGRNTKMDLIIHQSTQEFIQKFPNAIMVDFQG
FT                   KQQSHFDEKELYFIGPEGGFNNDERLLFNRKISLKSSNILKSQTAIIAIASKILL"
FT   gene            complement(169849..170256)
FT                   /locus_tag="CJJ81176_0193"
FT   CDS_pept        complement(169849..170256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0193"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0193"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73069"
FT                   /db_xref="GOA:A0A0H3PIX0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIX0"
FT                   /protein_id="EAQ73069.1"
FT                   /translation="MDQSYEFFLALHLYSLYASGFLMLFYLILTQGNFKTEFIFIRRIR
FT                   LFLPIYYLFLALIIFTGCLLSAMKQFQMNVNIWVMIFSWILIFALAIFHFVCFKKARRF
FT                   RKYATFRWISCLILPFEIFLLFLPFLIERYL"
FT   gene            complement(170256..170681)
FT                   /locus_tag="CJJ81176_0194"
FT   CDS_pept        complement(170256..170681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0194"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0194"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73180"
FT                   /db_xref="GOA:A0A0H3PJ35"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ35"
FT                   /protein_id="EAQ73180.1"
FT                   /translation="MQKAKILIALSFFLLVLSACSNDEKNISKTQNTDQEVVQIEQNDE
FT                   KTELSDSNLPLPVDDEAQSSDDEHEANPTIINSLYKQKCATCHGEKGELKPKNSTAIKT
FT                   LGNKIFIQKIKMIKDKNHSFLSDEQIQNLADFINKGK"
FT   gene            complement(170681..171262)
FT                   /locus_tag="CJJ81176_0195"
FT   CDS_pept        complement(170681..171262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0195"
FT                   /product="6-pyruvoyl tetrahydrobiopterin synthase, homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0195"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73107"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBQ0"
FT                   /protein_id="EAQ73107.1"
FT                   /translation="MIIRKLFEFENAHIVRFCSSKRCKSSIHGHSYKVEVLLESKYLDN
FT                   AGMVYDFGLLKTYIRQIIDSFDHAITLFKYDDAKYLEEMKKYSSRWICLPVNVSAENFC
FT                   RVFFILIDALLKQTKMINGEQGVTLQSIIVHETRTGYAQGFREDAYSELMPKISLQDIE
FT                   FSNGIKAEWNDIDFYNKLKNEEIFINPKEI"
FT   gene            complement(171259..172002)
FT                   /locus_tag="CJJ81176_0196"
FT   CDS_pept        complement(171259..172002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0196"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0196"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73291"
FT                   /db_xref="GOA:A0A0H3PAN0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAN0"
FT                   /protein_id="EAQ73291.1"
FT                   /translation="MQLVESFLSIQGEGKYNGKLAIFMRFAGCNFNCLGFNVKISKNDK
FT                   TLIGCDTIRAVFTKDFKESYETLNANELLKRVIKLKQDFNPIVVITGGEPLIHYENPEF
FT                   IKFIQMLLKNKFEIHFESNGSIEIDFDRYPFYKECIFALSVKLQNSGIKKDKRLNFKAL
FT                   KAFKNYAKDSFYKFVLDANTLDNSFLEINEILKEAPNQIFCMPMGENEQNLKKNAQKIA
FT                   EFCIKNGYNYSDRIHIRLWNDKEGV"
FT   gene            complement(172005..172967)
FT                   /locus_tag="CJJ81176_0197"
FT   CDS_pept        complement(172005..172967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0197"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06463; match to protein
FT                   family HMM TIGR02666"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0197"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73263"
FT                   /db_xref="GOA:A1VXP5"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXP5"
FT                   /protein_id="EAQ73263.1"
FT                   /translation="MLIDQFGRKINYLRISVTQRCNFRCLYCMPKIPFDYQPKENLLSF
FT                   EELFLFVKAAIDEGIEKIRITGGEPLLRKDLSIFIKMISDYKSDIDLAITTNGFLLKDF
FT                   AKDLKNAGLKRLNISLDTLDHKKAKTLAQKDVLDSVLSGIDEALNLDLKVKLNTVALKN
FT                   LNDDELISLLEFAKSKKAQIRFIEFMENTHAYGKLQGLKRDEIIQILSQKYQIQLIKKD
FT                   EKAPVSIYKADDYEFGIIDPHSHEFCDSCNRIRLSAEGLLIPCLYFDEALSIKEAVRKG
FT                   DIKAAVEILQEVLRNKPEKNKWSVVDNETSSRAFYQTGG"
FT   gene            complement(172980..173495)
FT                   /locus_tag="CJJ81176_0198"
FT   CDS_pept        complement(172980..173495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0198"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73480"
FT                   /db_xref="GOA:A0A0H3PC80"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC80"
FT                   /protein_id="EAQ73480.1"
FT                   /translation="MSDDVLYLVFIIVLLIAMLAYMNIKERENNAKIAKLQNVIEDITK
FT                   ELHYFRKELGVKDDSEEDEDYKTSLLKEEIMIELDKQISSKITPVLRTLKTMEHIIEDF
FT                   QNEQQNRLLNLEQKAQSMAKLTPNYDTEEQKIENLFKEGKSIEQIAKDLRIGTGNVELV
FT                   LKFKKLIK"
FT   gene            complement(173492..173692)
FT                   /locus_tag="CJJ81176_0199"
FT   CDS_pept        complement(173492..173692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0199"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73043"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAC5"
FT                   /protein_id="EAQ73043.2"
FT                   /translation="MDTILEEDKEYYLRFDLNNQKIAIFIKAQSQTLAKIIKIKPEDKM
FT                   AFDAFVVEIQRNMIRNKKGQE"
FT   gene            complement(173980..174864)
FT                   /locus_tag="CJJ81176_0200"
FT   CDS_pept        complement(173980..174864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0200"
FT                   /product="4-hydroxybenzoate octaprenyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01040;
FT                   match to protein family HMM TIGR01475"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0200"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73344"
FT                   /db_xref="GOA:A0A0H3PBZ7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006371"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBZ7"
FT                   /protein_id="EAQ73344.1"
FT                   /translation="MNTFWIKFKDILELVVFKHSIFALPFLFSSMIVASKLANDTAWFG
FT                   FKALILGIICAVGARNFAMATNRLMDEDIDKDNPRCANRPNVSGKIGRKSVWIFIIINA
FT                   LIFISCSYFINTLAFYLSFPVLFVLAIYSAFKRFSSLAHLVLGFCLGLAPIAGSVIIMG
FT                   KIHIYSVILCLGVTFWTAGFDLLYSLQDMEYDKKVGLHSIPAKFGSKATLFISAFCHIL
FT                   AVLFWLLFVWEVWGVALGKIALIGVIISGIILALEHRIVHKNFAHINRAFFTLNGYLSI
FT                   IFFIFIWIDLLWN"
FT   gene            174935..175804
FT                   /gene="miaA"
FT                   /locus_tag="CJJ81176_0201"
FT   CDS_pept        174935..175804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="CJJ81176_0201"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="identified by match to protein family HMM PF01715;
FT                   match to protein family HMM TIGR00174"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0201"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73203"
FT                   /db_xref="GOA:A1VXP9"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXP9"
FT                   /protein_id="EAQ73203.1"
FT                   /translation="MFFEIALIGTTASGKTYIANTLAREFDAVVLSLDSLCVYKEINIA
FT                   SAKPSQDDLASIKYFGVNLLSVNEHFNVELFIREYQKAKEFALARNLPLIIVGGTGFYL
FT                   KTMIDGLSEKTLESKSSLNNDEIYTLLLNIDPNYKIEKNDTYRLKKWLGIYEQTREIPS
FT                   EFLKRTQKTGVLKDIEIYELSWDKEILKKRIQTRTKEMLDNGLLDEAKILFSKFDHKLK
FT                   ALNSIGLKECKEYLDGEISFKELENLITIHTTQLAKRQRTFNKKFQSKALEFDKALAIL
FT                   RMKFSIEK"
FT   gene            complement(175790..176353)
FT                   /locus_tag="CJJ81176_0202"
FT   CDS_pept        complement(175790..176353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0202"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF02659"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0202"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73168"
FT                   /db_xref="GOA:A1VXQ0"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXQ0"
FT                   /protein_id="EAQ73168.1"
FT                   /translation="MDFYSLIFLSCALGMDAFAVSLCKGFSVKKLHLKHYLIVGIYFGG
FT                   FQALMPTIGYFIGITFASFIASIDHWIAFILLSLIGLKMIKESLENENCDSNANQFGFK
FT                   TMLALAIATSIDALAVGVSFAFLNVNLLLAIFLIGIITFILCIIALKIGNKFGIYLKNK
FT                   AELLGGLVLIILGVKILIEHLFFD"
FT   gene            176501..176575
FT                   /locus_tag="CJJ81176_1710"
FT   tRNA            176501..176575
FT                   /locus_tag="CJJ81176_1710"
FT                   /product="tRNA-Glu"
FT   gene            complement(176711..176893)
FT                   /locus_tag="CJJ81176_0204"
FT   CDS_pept        complement(176711..176893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0204"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0204"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72993"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEB8"
FT                   /protein_id="EAQ72993.1"
FT                   /translation="MKKVVLISALLGAFAANVFAANTPSDVNQTHTKAHHSKAKADKKH
FT                   EAKTHKKTKEQTPAQ"
FT   gene            177161..177823
FT                   /gene="sodB"
FT                   /locus_tag="CJJ81176_0205"
FT   CDS_pept        177161..177823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="CJJ81176_0205"
FT                   /product="superoxide dismutase, Fe"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0205"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73242"
FT                   /db_xref="GOA:A1VXQ2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXQ2"
FT                   /protein_id="EAQ73242.1"
FT                   /translation="MFELRKLPYDTNAFGDFLSAETFSYHHGKHHNTYVTNLNNLIKDT
FT                   EFAGKDLVSIIKTSNGGVFNNAAQVYNHDFYFDCIKPSTGCGCGGSCQSIDANLQAALE
FT                   KEFGSLENFKAEFIKGATGVFGSGWFWLVYNTKNQKLEFVGTSNAATPITEDKVPLLVV
FT                   DVWEHAYYVDHRNARPAYLEKFYAHINWEFVAKAYEWALKEGMGSVSFYANELHPVK"
FT   gene            177892..178110
FT                   /locus_tag="CJJ81176_0206"
FT   CDS_pept        177892..178110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0206"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73137"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB66"
FT                   /protein_id="EAQ73137.1"
FT                   /translation="MDNSLSAYTQKYDKEGYGLQYPDGHVIRFYERILKYKLSKTSGKL
FT                   LDFGCGNGVHSKYFKNITGGGYRALWH"
FT   gene            178220..178582
FT                   /locus_tag="CJJ81176_0207"
FT   CDS_pept        178220..178582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0207"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEZ9"
FT                   /protein_id="EAQ73390.1"
FT                   /translation="MDFIFANQSLYYLTKQAFKEAVQEFYELCNEGAIIFATMMSDKGY
FT                   SMYERGELMDNGLREVKGCPSGRLSGSSYIRFTKDIEELKEDFKPFKPLFWGDYELINL
FT                   YNFEGSVEHFIYIGQK"
FT   gene            complement(178595..179800)
FT                   /locus_tag="CJJ81176_0208"
FT   CDS_pept        complement(178595..179800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0208"
FT                   /product="saccharopine dehydrogenase"
FT                   /EC_number="1.5.1.7"
FT                   /note="identified by match to protein family HMM PF03435"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0208"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73467"
FT                   /db_xref="GOA:A0A0H3PJM2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJM2"
FT                   /protein_id="EAQ73467.1"
FT                   /translation="MKNLLIIGAGGVSRVTTVKCAMNSDTFSKITLASRTKSKCDEIAA
FT                   FIKERLGVQIETAQIDADDSNAVVELIKKTEAQILLNVALPYQDLSLMDACIKARIDYV
FT                   DTANYEHPDLAKFEYKEQWARNDEFKQAGILGLLGSGFDPGVTNVFCAYAQQNLFDEIS
FT                   YIDILDCNAGDHGYAFATNFNPEINLREVSAKGRYWENGKWIETQPMEIKMEWDYPEVG
FT                   VKDSYLLYHEELESLVKNIKGLKRIRFFMTFGQSYLTHMKCLENVGMLGIKPVMHQGKE
FT                   IIPIEFLKTLLPDPASLGPRTKGYTNIGCVIRGKKDGKDKQVYIYNVCNHEECYKETGA
FT                   QAVSYTTGVPAMIGTKLIAKGIWQGKGVFNMEEFDAKPFMEELNSQGLPWKIIEMTPSL
FT                   GE"
FT   gene            complement(179842..180750)
FT                   /locus_tag="CJJ81176_0209"
FT   CDS_pept        complement(179842..180750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0209"
FT                   /product="iron ABC transporter, ATP binding subunit"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0209"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73012"
FT                   /db_xref="GOA:A0A0H3PAZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ0"
FT                   /protein_id="EAQ73012.2"
FT                   /translation="MMLEIKNLSKNFGKIQALENINLHVKEGEFLSILGGSGSGKSTLL
FT                   RIIAKLEQASSYDLFSCKGEVALMFQNYALFPHLNVEKNILFALYDKKDKNQILNHLLK
FT                   TFEIEDLRYKKIDEISGGQAQRVAFARAIARGCQLLLLDEPFSNLDQNLKQDLRRELKK
FT                   MIENQGITAIMVTHDIEDAYCMSDQIAFLEKGKILAHANPKELYFKPDFKSAQILPDLN
FT                   IIEEKLDLEDEFFAWIASKNYIFGYAELKIGNRFEAKILQKEFLGAFCRLKLLYKNIIF
FT                   FILVSSSYDLEEKISFDIINF"
FT   gene            complement(180734..182350)
FT                   /locus_tag="CJJ81176_0210"
FT   CDS_pept        complement(180734..182350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0210"
FT                   /product="iron ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0210"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73129"
FT                   /db_xref="GOA:A0A0H3PEJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEJ5"
FT                   /protein_id="EAQ73129.1"
FT                   /translation="MYKTLKYYKLGAILLALFLALPIFGIFAELFYILFQNFNTSNLTQ
FT                   FSSIKENLSHFFDYLFLKFIKDTFIISMGVLCLSLILGVSSAYLIANYDFYFCKILEKL
FT                   LILPLAIPAYILAFVYVGIMDFQGFFHENFGFRIDFFNHYGVIFVLAISLYPYIYLFAK
FT                   TAFKSEAKEAYEVAKIMKYSEFRIFTRVALLSARPAIFSGALLVLMETLSDYGASAYLG
FT                   VDTFSAGIFKLWYDLNDSYSSSVLSGILMLFVFLIMYVDYYYKNKHHYSFNQNLALFIK
FT                   KRKLNPIKQILSCIYCFMIAFVGFILPFIWLVYWGLKDHKLFESQFYIISFQTIILALV
FT                   TALITTFLAYFLMFSSRIVKNHFFNLFILKISSLGYSIPAAALGISIIVLFVFLDKIFH
FT                   MSLLGNSLLVLVFAYVIRFLASAIYSLEGGYNKIHLNIDEASLNLRTSYFILFFKIHTP
FT                   LMKHFLFLAFIIVFIDTIKELPLSRILAPFGFETLSVKAFWFASDERIYDAALPSLFIV
FT                   FLSLMVVVWMDKITRKDDVRN"
FT   gene            complement(182350..183354)
FT                   /locus_tag="CJJ81176_0211"
FT   CDS_pept        complement(182350..183354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0211"
FT                   /product="iron ABC transporter, periplasmic iron-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0211"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73324"
FT                   /db_xref="GOA:A0A0H3PEW2"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEW2"
FT                   /protein_id="EAQ73324.1"
FT                   /translation="MKKIFLMFLTAFSFLGASELNIYSARHYDADFEIIKKFEEKTGIK
FT                   VNHTQAKASELIKRLSLEGSNSPADIFITADISNLTEAKNLGLLSPVSSKYLEEFIPAH
FT                   LRDKDKEWFAITKRARIIAYNKNANIDISKMKNYEDLARAEFKGEIVMRSATAPYSKTL
FT                   LASIIANDGNKEAKAWAKGVLDNLATNPKGGDRDQARQVFAGEAKFAVMNTYYIGLLKN
FT                   SKNPKDVEVGNSLGIIFPNQDNRGTHINISGIAMTKSSKNQDAVKKFMEFMLSPEIQKI
FT                   LTDSNYEFPIRNDVELSQTVKDFGTFKEDQIPVSKIAENIKEAVKIYDEVGFR"
FT   gene            complement(183365..183481)
FT                   /locus_tag="CJJ81176_0212"
FT   CDS_pept        complement(183365..183481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0212"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0212"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73262"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ89"
FT                   /protein_id="EAQ73262.1"
FT                   /translation="MSMKKIILFLLCVGFAFACSEHSHTDFKDLNKTEYNSQ"
FT   gene            183674..184873
FT                   /locus_tag="CJJ81176_0213"
FT   CDS_pept        183674..184873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0213"
FT                   /product="antibiotic transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0213"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73364"
FT                   /db_xref="GOA:A0A0H3PBI6"
FT                   /db_xref="InterPro:IPR009248"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBI6"
FT                   /protein_id="EAQ73364.1"
FT                   /translation="MFSSFFASKKWALWAYLGLFLLLFFLYIQTSLNVAINSWYSDFYN
FT                   VLQKPKIELLDSNSTQKIEENLENNTTLIQEANQRAEQNFQKANFINKGALYYYQNLLE
FT                   YFFNSRAMIEKPNYSANDFYALILVFLAIAIPYVLIATINIYFASVYAFKWREAMTFSY
FT                   LKFWKNKDDNIEGSSQRIQEDTYNFSKIVESLGLSFIKALMTLVAFIPILWSLSDVVSK
FT                   ALFANLSENSSFYFLKNIDGLLVYIALLISLGGLVVSWFVGIKLPGLEYNNQKAEAAFR
FT                   KELVYAEDNRKEYAKNETMIELFTGLKFNYKRLFLHYGYFNIWLILFEQMIVIVPFLIM
FT                   APGLFAGAIGLGIVMQINNAFDQVRSSFSVFITNWTTITQLRSIYKRLKEFEKNISYKS
FT                   "
FT   gene            185044..186330
FT                   /locus_tag="CJJ81176_0214"
FT   CDS_pept        185044..186330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0214"
FT                   /product="transporter, putative"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01595; match to protein
FT                   family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0214"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73353"
FT                   /db_xref="GOA:A0A0H3PJE1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJE1"
FT                   /protein_id="EAQ73353.2"
FT                   /translation="MVVVALALVFLNGFFVLSEFSIVKVRRSKLEEMVKEKKAGAKKAL
FT                   EVTSRLDTYLSACQLGITLSSLALGWIGEPAIAKMLEIPLINLGFSTVIIHTIAFIIAF
FT                   SIITLLHVVLGELVPKSIAIAVADKAVLFIARPLHWFWILFLPCIKIFDFLAAISLKLF
FT                   GIKPAKESELTHSEEEIKIIASESQKGGVLDEFETEIIRNAVDFSDTVAKEIMTPRKDM
FT                   ICLNKQKSYEENMQIICEHKHTRFPYIDGSKDTILGMIHIRDIIQNELSHKSQNLDTFV
FT                   KPLILVPENISISKVLVMMNKERSHTALVVDEYGGTAGILTMEDIMEEIIGEIKSEHEE
FT                   DSYKKLAENIYEFQGRCDIETVEEMLVINYDEDLEQVTIGGYVFNLLGRLPMVGDRIED
FT                   ELCYYEVKKMDGNSIERVKVVKKTNKDEE"
FT   gene            complement(186343..187527)
FT                   /locus_tag="CJJ81176_0215"
FT   CDS_pept        complement(186343..187527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0215"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0215"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73029"
FT                   /db_xref="GOA:A0A0H3PBM3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM3"
FT                   /protein_id="EAQ73029.1"
FT                   /translation="MRILLVLRGNYYAGQEEFIKNNKLQNYTLDLNALRLLSGSVKNIV
FT                   SEYKILNVKNDEDLSKILLKLLEMRMQKGEFCIINAYNETLKIYKDLAKQYRYKMYVIV
FT                   FDSSLKQCQEKNLLEAKKNGYIIPYALLEKTQDLLKKNPKKYPILDSSDWKKCLYQMPN
FT                   LSKYKKIHHIGDLQGCYSVLKEYIKTIKEDEFYIFLGDYINRGIENGKVIKFLLKICEK
FT                   ENVCLLEGNHERHLIKWANGELSNSKEFNENTLKDFRKEKLTPRDARKLYPHLKECLYY
FT                   KFQNKFIFCSHGGVNFIPSKPEKISFIPSHDFIYGVGGYEDSQKVANQFCNFTSDNLYQ
FT                   IFGHRNKEKLPMKIAKRVFLCEGKIDGGGYLRVVTLDKKGFECIEIKNQIYKKK"
FT   gene            complement(187537..187746)
FT                   /locus_tag="CJJ81176_0216"
FT   CDS_pept        complement(187537..187746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0216"
FT                   /product="PhnA domain protein"
FT                   /note="identified by match to protein family HMM PF03831"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0216"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72970"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIS1"
FT                   /protein_id="EAQ72970.1"
FT                   /translation="MAKDANGTELNAGDSVSVIKDLKVKGASTTLKRGTTIKNIKLTSK
FT                   EGEIEARVDKFGVIVLKTEFLKKI"
FT   gene            complement(187739..188458)
FT                   /locus_tag="CJJ81176_0217"
FT   CDS_pept        complement(187739..188458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0217"
FT                   /product="integral membrane protein, TerC family"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0217"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73178"
FT                   /db_xref="GOA:A0A0H3PEM3"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEM3"
FT                   /protein_id="EAQ73178.1"
FT                   /translation="MFEWIFSIDAWITLATLSALEIVLGIDNIIFLAILVSKLPPEHRD
FT                   KGRILGLAFAMITRILLLLSLFWVMKLVTPLFSVLGNEISGRDLVLLLGGLFLIVKSIK
FT                   EIKEQISHQEESQSHFKASNKLWIVVAEIAVIDIVFSLDSVITAVGIAQDVTIMIIAVI
FT                   IAVAVMLFASKPIADFVEKYPSIKILALAFLVLIGVVLVAESFDIHIDKAYIYTAMAFA
FT                   LVVQILNILDQRKEKNG"
FT   gene            complement(188530..189096)
FT                   /gene="purN"
FT                   /locus_tag="CJJ81176_0218"
FT   CDS_pept        complement(188530..189096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purN"
FT                   /locus_tag="CJJ81176_0218"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="identified by match to protein family HMM PF00551;
FT                   match to protein family HMM TIGR00639"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0218"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73325"
FT                   /db_xref="GOA:A0A0H3PBG9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBG9"
FT                   /protein_id="EAQ73325.1"
FT                   /translation="MLVKLAVLFSGNGGNLENILEKLHKKTIGENTYEVVLCLCNKKDA
FT                   FGIQRAKKFGLDTVIVDHKAYNTREEFDTILVQKIKESGANLTVLAGFMRILSPVFTKN
FT                   IKAINLHPSLLPLFKGAHAIKESYESDMKVAGVSVHWVSEELDGGMIIAQKAFEKRNLS
FT                   FEEFEEKIHSLEHEILPLSVIEIFS"
FT   gene            complement(189087..190457)
FT                   /locus_tag="CJJ81176_0219"
FT   CDS_pept        complement(189087..190457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0219"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01256;
FT                   match to protein family HMM PF03853; match to protein
FT                   family HMM TIGR00196; match to protein family HMM
FT                   TIGR00197"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0219"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73277"
FT                   /db_xref="GOA:A0A0H3PJ97"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ97"
FT                   /protein_id="EAQ73277.1"
FT                   /translation="MKAIIDNIKILEQNAINKGLDELILMENAGLNLAKLIKKEAKKIR
FT                   IQRKIRKVKTLFLLGGGNNASDGLVALRNLKHAKAYKIGFKENTLFKKQEQILQNYAFK
FT                   FCKKEPNFKKFHIIVDCILGTGSNRCLDEKTSLIIQKVNQSKALKIACDIPTNLGFYPC
FT                   FKADITFCMGALKEILLEDFAKEFVGRIKIANLGISSKKFYPNSQAFLLEKKDLKTIDR
FT                   KINANKGNFGHIYIVANASAGTLAGLGALNFGAGLVSLVAQKSFSPLLMLKEKIENNAS
FT                   AIALGMGLENLDFLKDEILQNTPLILDANCFLSEALLWYLNRKDIVITPHPKEFIKLYK
FT                   MCFDENLDIETLQKNRFFYARKFSQNYDCVLVLKGANPIIAQKEKLFVVNLGNQALAKG
FT                   GSGDVLSGMIAAHLGFGFSALEAAKNATLAHGLVAKKYKFNKNSFDALKLIKGLKCL"
FT   gene            complement(190441..191139)
FT                   /locus_tag="CJJ81176_0220"
FT   CDS_pept        complement(190441..191139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0220"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01936"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0220"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73057"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR025605"
FT                   /db_xref="InterPro:IPR041966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB02"
FT                   /protein_id="EAQ73057.1"
FT                   /translation="MENKSIAIFIDAENIPAKYAKSIFDIASDYGEVIIKRIYGDWTQK
FT                   NIQGWREQIAEYSLIAMQQFNFAANKNSSDMYLITEIMSIFYEKNIDIFVIVSSDSDYT
FT                   SLIQKLRENKKQVIGMGLEKSIKSYVNAFSEFFYLDKDESKKEDILSKDYLRALINITE
FT                   QLIDEKGRAEYAQIRTNMNRKYSDFHPQNYGFKNFRALIQKFLPKMKKFEEEREKNIYF
FT                   LVKKDYESYY"
FT   gene            complement(191141..192646)
FT                   /locus_tag="CJJ81176_0221"
FT   CDS_pept        complement(191141..192646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0221"
FT                   /product="Mg chelatase-related protein"
FT                   /note="identified by match to protein family HMM PF01078;
FT                   match to protein family HMM PF07728; match to protein
FT                   family HMM TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0221"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73209"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBT8"
FT                   /protein_id="EAQ73209.1"
FT                   /translation="MKKLKCISFHEGLDIIEVESTFTRGLPNLSIVGLASVAIKESVER
FT                   IKATLLSCDFAFPAKKITINLSPSGIPKKGSHFDLAIALLILLQNEELDDFFVVGELGL
FT                   DGSIKSTNELFSLLLFLSAKIKKAKIVVPKSIAQKASMIPNLEVYGLENLNEAIEFFKE
FT                   KNYENFRFSHNHPLFASPLQIENEIFLQNMDFKLDFKDIKGQEKAKRACMIAALGMHNI
FT                   LFEGSPGSGKSMCAKRLVYIMPPQSLSEILMQNAYMSLDSKDCEFTKIRAFRHPHHTST
FT                   RASIFGGGTKNARIGEVALANGGVLFFDEFPHFNKQIIESLREPLEDHKIHISRVNSKI
FT                   TYETKFSFIAAQNPCPCGNLFSKNLSCVCSENEIKKYKNHISAPIMDRIDLYVAMDEIS
FT                   KDDKTSISSKEMSEKILQAFIFGKKRGQKEFNGKLKDEDLSRFCVLEKDAKDTLDLAIS
FT                   RYNLSLRSLNKILKVSRSIADLEQSLNISKTHILEALSFRARN"
FT   gene            complement(192643..193170)
FT                   /gene="def"
FT                   /locus_tag="CJJ81176_0222"
FT   CDS_pept        complement(192643..193170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="CJJ81176_0222"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="identified by match to protein family HMM PF01327;
FT                   match to protein family HMM TIGR00079"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0222"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73001"
FT                   /db_xref="GOA:A0A0H3PBL2"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL2"
FT                   /protein_id="EAQ73001.1"
FT                   /translation="MVRKIITYPNPRLFLNSEIVNKFDTELHTLLDDMYETMIASNGVG
FT                   LAAIQVDIPLRVLLVNIFNENDEQKKEDLLEIINPEIIPLDEEMITCTEGCLSVPDFFE
FT                   EVKRYNHILLKYQDRFGEFKELEAKGFLAVAIQHENDHLNGHLFIEKISFAKRQKFDKE
FT                   FKKKKKNHKKEK"
FT   gene            complement(193206..193790)
FT                   /gene="clpP"
FT                   /locus_tag="CJJ81176_0223"
FT   CDS_pept        complement(193206..193790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="CJJ81176_0223"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="identified by match to protein family HMM PF00574;
FT                   match to protein family HMM TIGR00493"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0223"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73303"
FT                   /db_xref="GOA:A1VXS0"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXS0"
FT                   /protein_id="EAQ73303.1"
FT                   /translation="MFIPYVIEKSSRGERSYDIYSRLLKDRIIMLSGEIHDELAASIVA
FT                   QLLFLEAEDPTKDIYLYINSPGGVITSGFSIYDTMNYIKPDVCTICIGQAASMGAFLLS
FT                   CGAEGKRFALPNSRIMIHQPLGGARGQATDIEIQAKEILRLKTILNDILAKNTKQKVAK
FT                   IAKDTERDFFMSTQEAKEYGLIDKVLEKSFK"
FT   gene            complement(193790..195124)
FT                   /gene="tig"
FT                   /locus_tag="CJJ81176_0224"
FT   CDS_pept        complement(193790..195124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="CJJ81176_0224"
FT                   /product="trigger factor"
FT                   /EC_number="5.2.1.8"
FT                   /note="identified by match to protein family HMM PF00254;
FT                   match to protein family HMM PF05697; match to protein
FT                   family HMM PF05698; match to protein family HMM TIGR00115"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0224"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73279"
FT                   /db_xref="GOA:A1VXS1"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXS1"
FT                   /protein_id="EAQ73279.1"
FT                   /translation="MEVKAKQLDSVNATASVKIPSGMIKSEVENLAKKASKSVKMDGFR
FT                   PGKVPVSAVLKRYERELTQDAEQNLFKSAVNSALQELKKESKELVGEPYFEKFDRKDGE
FT                   IIAELILSFKPEIKLDGYEKLIPEYQTPKVNKKEIDEKKDELLKRFSTPEAIKTKRALK
FT                   EGDFAKFDFEGFVDDKAFEGGKAENYVLEIGSKQFIPGFEDGMVGMKIGEEKDIKVTFP
FT                   KEYGAAHLADKDAVFKVKLHEIQELKIPELDDEMLKKLLPGEEKASVEVLDEKLKEQIK
FT                   NEKLFKLVNDELKGKFADALIEKYNFDLPKGIVEQETDMQMRAAFNTFSEKEIEELKAS
FT                   KEKYQEKRDSFKEEAQKSVKLTFIIDELAKLRKIEVNDQELIQAIYFEAYRYGMNPKEH
FT                   LENYKKQGALPAVKMALIEEKLFNDIFMPKTEKSEKASKKEKEDK"
FT   gene            195268..195840
FT                   /gene="folE"
FT                   /locus_tag="CJJ81176_0225"
FT   CDS_pept        195268..195840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="CJJ81176_0225"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="identified by match to protein family HMM PF01227;
FT                   match to protein family HMM TIGR00063"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0225"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73420"
FT                   /db_xref="GOA:A1VXS2"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXS2"
FT                   /protein_id="EAQ73420.1"
FT                   /translation="MQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKTYEFLTSGYTQ
FT                   NVKEILNDALFESSNNEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPR
FT                   LVEVFARRLQIQEQLTEQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSA
FT                   LRGIFLKNEKTREEFFSLINSAKQVRF"
FT   gene            195840..197225
FT                   /gene="fliI"
FT                   /locus_tag="CJJ81176_0226"
FT   CDS_pept        195840..197225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="CJJ81176_0226"
FT                   /product="flagellum-specific ATP synthase FliI"
FT                   /EC_number="3.6.3.14"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM TIGR01026; match to protein
FT                   family HMM TIGR02545"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0226"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73350"
FT                   /db_xref="GOA:A0A0H3PAR2"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAR2"
FT                   /protein_id="EAQ73350.1"
FT                   /translation="MNLEKLRSKLGKENLSAIFGEITKISATSIEIRGLKTGVGDIVKL
FT                   VSNENENLNTLAMVVEIKEQFSYLSPFSFIEGFKIGDRAFISDAGMQIGVSDELLGRVV
FT                   DPFMRPKDGKGAIEVSKYMPIMRAPIDAMKRGLIEEVFPVGVKTIDALLTCGVGQKLGI
FT                   FAGSGVGKSTLMGMIVKNSKAPIKVVALIGERGREIPEFIQKNLGGKLDDTVIIVATSD
FT                   DSALMRKYGAFCAMSVAEYFKEQGKDVLFIMDSVTRFAMAQREIGLALGEPPTTKGYPP
FT                   SVLSLLPQLMERTGKEEGKGTITAFFTVLVDGDDMSDPIADQSRSILDGHIVLSRELTD
FT                   FGIYPPINIQNSASRVMSDIISPEHKLWARKFKRLNSLLKENEVLLRIGAYQKGSDKEL
FT                   DEAISKKEFMQKFLGQNPEESFEFNQTLELLSQIDTPNTPLPPTQNINVGSASATLPNP
FT                   NLK"
FT   gene            complement(197228..198565)
FT                   /gene="purF"
FT                   /locus_tag="CJJ81176_0227"
FT   CDS_pept        complement(197228..198565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="CJJ81176_0227"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM PF00310; match to protein
FT                   family HMM TIGR01134"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0227"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73031"
FT                   /db_xref="GOA:A0A0H3PAB8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAB8"
FT                   /protein_id="EAQ73031.1"
FT                   /translation="MCAVVGVINSKNASTYAYYALFAMQHRGQEASGISVSNGKNIKTI
FT                   KAKGEVSQIFNPDNLKTLEGEIAIGHNRYSTAGNSSLNDAQPIAATSVLGDIALAHNGN
FT                   LVNKEEVRSRLIQDGAIFQTNMDTENVVHLIARSKQESLKDRFIESLKECIGAYCFVLA
FT                   SKDKLYVVRDPHGVRPLSLGRLKDGGYIVASETCAFDLIEAEFIRDVKPGEMLIFTQGN
FT                   DKFESIELFSQTPRICAFEYIYFARPDSIVEGKSVYEVRKKMGEALAKKFAYKADFVVP
FT                   VPDSGVSAAIGFAQYLQIPLEMAIVRNHYVGRTFIEPTQELRNLKVKLKLNPMRKVLEG
FT                   KEIVVIDDSLVRGTTSKKIISLLRAAGASKIHLAIACPEIKFPDTYGIDTPTFEELISA
FT                   NKNAEEVREYVEADTLSFLSIEELTQSIGDERKYSLISFDGDYFIK"
FT   gene            complement(198567..199295)
FT                   /gene="dapB"
FT                   /locus_tag="CJJ81176_0228"
FT   CDS_pept        complement(198567..199295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="CJJ81176_0228"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0228"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72960"
FT                   /db_xref="GOA:A1VXS5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXS5"
FT                   /protein_id="EAQ72960.1"
FT                   /translation="MIKIGIYGAKGRMGKQIEECLKSETQARISILYDKGGNLGELFEK
FT                   SDVIIDFSSPSGTHELLNYARTMPKPLVIGTTGLDEKILHLMQSASEVMPIFYATNMSL
FT                   GVAVLNYLASKASQMLRNFDIEILEMHHRHKKDAPSGTAMTLAQSVAKARNLELEKVRV
FT                   SGRDGIIGERSKDEIAVMSLRGGDIVGRHTVGFYEDGEFLELNHTATSRATFAKGAIKI
FT                   AIWLSKQEAKMYSINDFLGI"
FT   gene            complement(199358..200539)
FT                   /locus_tag="CJJ81176_0229"
FT   CDS_pept        complement(199358..200539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0229"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0229"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73034"
FT                   /db_xref="GOA:A0A0H3PIV2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIV2"
FT                   /protein_id="EAQ73034.1"
FT                   /translation="MSLALTFRPENFDDILGQYELIEIFKKFTALQKLPHSIFFGTAGS
FT                   GKTTFARVVAKEFGLDFYEFDGGNFKLEELRKILDNYKNSLYKPLIFIDEIHRLSKTQQ
FT                   EMLLIPMENYRLILIGASTENPYFVLSSGIRSRSMLFEFKSLGAKELETLLLRVQEKMK
FT                   FSIDKEAKDFLLKSADARAMLNLLEFVLVLDEKHISLENLKKLRNTINSEGVSSKDTHY
FT                   ILASAMIKSLRGSDVDAAIYYLARLIDAGESADFIARRLVIFSSEDVGNADPNALNLAV
FT                   STLDAVKNIGYPEARIILAQCVVYLASTIKSNASYKAINEALNYVKNNEALEIPNYLNN
FT                   NHQEKQNYLYPHDFGGWVEQKYLSKNLKFYHSKGLGEEAKLLDNLYKLKNHKA"
FT   gene            complement(200539..201666)
FT                   /locus_tag="CJJ81176_0230"
FT   CDS_pept        complement(200539..201666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0230"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0230"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73160"
FT                   /db_xref="GOA:A0A0H3PJ19"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ19"
FT                   /protein_id="EAQ73160.1"
FT                   /translation="MKKWIFIVFCFILGFIIHIFYIGYTNELLFNKFIKNSNPDYTITD
FT                   IYFKKGFLTSKGSFTLNHSHTQLSTKINLKFNNYFFLNKIIKGNFTNPFDFLDKVLKNN
FT                   KLGTFTLKLHDNNSKIFLNIKDINLSNEGGDTIINGGYIEALMNKNLEIKNIKIHFDMI
FT                   NFSQFYTKFVLQNLNYEQFFNNPVQFYELNLFSKSQQQINFDYLVLDNNKINSFYSKNL
FT                   VNFNEENSTINLNIQGKSNEIDIDLKSLLGQNLNFDKTKFNITINKFLNSNFNISHFIQ
FT                   KNLDLEIQNLILEKNKQNISLQGNLNINNSYQAKLQVISSDEPDEIFPWTKDYGGLNQY
FT                   FLKENNNFFLNLSYDSLANPQLKINGSEFSNMDLN"
FT   gene            complement(201801..202148)
FT                   /locus_tag="CJJ81176_0231"
FT   CDS_pept        complement(201801..202148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0231"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0231"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73103"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAF3"
FT                   /protein_id="EAQ73103.1"
FT                   /translation="MKKSILFASALLASSMLFADSLKLEGTIAQIYDNNKTLLIDSIYG
FT                   GQMAIKVLPNTEIEMDDCGIFGTDKDGTFKDLQVGNFLESKISYGIPATPNTQAIPVAR
FT                   KIEIQCYKKAY"
FT   gene            complement(202247..202852)
FT                   /locus_tag="CJJ81176_0232"
FT   CDS_pept        complement(202247..202852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0232"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73075"
FT                   /db_xref="GOA:A0A0H3PBP2"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBP2"
FT                   /protein_id="EAQ73075.2"
FT                   /translation="MFFLLKKIENGLFYLNKILYFFLILFLLIGILGFFINSNPSNQII
FT                   KKPYLPFLEIGDLVFRAGIGSESFLIENLSQSPYSHIAMVVKTSPTILIHATTDDDKNA
FT                   KNQVILSSMDDFLKLSHKIAIKRLKFDEKTKQKIVAKALEHLGRKFIISTDKDAFYCTT
FT                   FLEQSINSITPFHLQYTLIKAPFNEGLYLFPQAFFENN"
FT   gene            complement(202803..203030)
FT                   /locus_tag="CJJ81176_0233"
FT   CDS_pept        complement(202803..203030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0233"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0233"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73073"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB08"
FT                   /protein_id="EAQ73073.1"
FT                   /translation="MKKKTFVSDKITQVVAENAAKAKRMGGVKDIQIEEKTINKDSAKI
FT                   RVLVLFNNDNNQSSNVFLAKKDRKWLVLLK"
FT   gene            complement(203008..203145)
FT                   /locus_tag="CJJ81176_0234"
FT   CDS_pept        complement(203008..203145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0234"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0234"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73131"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ02"
FT                   /protein_id="EAQ73131.1"
FT                   /translation="MAYGSSNPEDLAKNFTKDLYSGDTKSVMSYIDLSEAKSDEEKNIC
FT                   "
FT   gene            203388..204734
FT                   /locus_tag="CJJ81176_0235"
FT   CDS_pept        203388..204734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0235"
FT                   /product="citrate transporter, authentic frameshift"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF06808"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0235"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73205"
FT                   /db_xref="GOA:A0A0H3PAJ3"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAJ3"
FT                   /protein_id="EAQ73205.1"
FT                   /translation="MEIFLALLGFFSLGLIVWLLLKDYTTPALAFISVSISVACILLIL
FT                   ERLGFGVGVALGVKGGVFDIKTLVVFIKDGVKSVTDTAALFVFSILFFSVLNASGFFTK
FT                   ILNAFLSKMKANVYQVCILTVFIAAAVHLDGSGASTFLIVIPALLPIYERLGIRKTSML
FT                   LIITSAMGVMNVIPWGGPTLRAATNIGMDANLLWHHIIPIQIVGLVLSLLLAIWIAKIE
FT                   IKRGAGAGNLSGINLNIEKSEHHNEKWFWLNLLVAIGVIGLLISGIIPSYICFMIGLAI
FT                   ILPLNYPNLKTAKKVLDRASGGAMLMYITLIGAGILIGVFDKSGIMEKMGVLILNFVPD
FT                   YLGAYIPLMVGILAVPMAIIFCTDSYFYGVMPIVLSVTKAFGAEPLTIAIIMVIARNCA
FT                   TFISPVVPATLLGCGLAEVNIKDHIKRSFFYIWGISIICLIFAEVAGII"
FT   gene            204920..206914
FT                   /locus_tag="CJJ81176_0236"
FT   CDS_pept        204920..206914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0236"
FT                   /product="oligopeptide transporter, OPT family"
FT                   /note="identified by match to protein family HMM PF03169;
FT                   match to protein family HMM TIGR00728; match to protein
FT                   family HMM TIGR00733"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0236"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73255"
FT                   /db_xref="GOA:A0A0H3PBE0"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBE0"
FT                   /protein_id="EAQ73255.1"
FT                   /translation="MYKKQNLPELTLRGLILGSILTIIFTASNVYLGLKVGLTFSSSIP
FT                   AVVISMAVLSLFKTSNILENNMVQTQASAAGTLSSVIFVIPGLFMCGYWSEFPLWQTFM
FT                   ICLCGGGLGVLFTIPLRRTMVVESKLAYPEGRAAAEILKVANKDQSSKKGKQGIKEIAL
FT                   GSFIAAIFSLLSNGFKLAASESNFAFIWNKMAFGFSMGYSLALLGAGYLVGLAGAIALF
FT                   VGMFLAWGIFTPYLSNFEFDSAKNAVDLASSVWSSKVRLIGTGAIAIAALWTLIELLKP
FT                   VIEGIKEIVKNVKITNQEKNERTNIDLSLKSIFILFVLMVVGLFITFYSFVEDANLSIY
FT                   YQMLFSFVGTLVSVLIGFFVAAACGYMAGLVGSSSSPISGIGLIGVIISSIVFLVLGVE
FT                   LFQDPMLSKFAVALAIFTTSVILATAAISNDNLQDLKTGHLVGATPWKQQVALLVGCVF
FT                   GALAIVPVLNLLYQAYGFVGAMPREGMDASSALAAPQANLMSTIAQGIFHHNIEWGYMA
FT                   FGVFVGILMIIIDKILKGTQKMSLPPLAVGIGIYLPPAINIPLVIGGILKYIVMQHLTK
FT                   KYAKNSHKEEKLASCEQRGTLFASGLIVGESIFGVIIAGITVFSVSMGGSENPLALNLA
FT                   NFHDSELFALIFFVGVVLYFIKRIVKKDA"
FT   gene            206988..207791
FT                   /locus_tag="CJJ81176_0237"
FT   CDS_pept        206988..207791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0237"
FT                   /product="undecaprenol kinase, putative"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0237"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73233"
FT                   /db_xref="GOA:A1VXT4"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXT4"
FT                   /protein_id="EAQ73233.1"
FT                   /translation="MENLYALILGIIEGLTEFLPISSTGHMILGTTILGIDIDEFWKSF
FT                   LIIIQLGSILAVIFVFWRKLFQGLDIWLKLAVGFFPTGVIGLFVAKYLNALFNGWVVVG
FT                   MLIFGGVVFILIELAHKNKQYRINSLEEISFKQAFCIGIFQSLAMIPGTSRSGASIIGG
FT                   LLLGFNRKVAAEFSFLLAIPTMIIATAYSIYKEPELLSNANSLIPLGIGFITAFIVAVL
FT                   VIKFFLKFISKFDFIPFGIYRIILGFVFFYLYYSGILNAGSEFKL"
FT   gene            207922..209730
FT                   /gene="thrS"
FT                   /locus_tag="CJJ81176_0238"
FT   CDS_pept        207922..209730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="CJJ81176_0238"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00418"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0238"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73340"
FT                   /db_xref="GOA:A1VXT5"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXT5"
FT                   /protein_id="EAQ73340.1"
FT                   /translation="MEKEVIAYLDNETIIDSQSVKNTNLKEIYFDNSKESLEVIRHSCA
FT                   HLMAQAIKSLYPEAKFFVGPVIEDGFYYDFRVESKIGEEDLVKIEKKMKELAEAKIEIS
FT                   KYEITKSEALAKFQNDDLKQEVLLRIPDGAVSIYKQGEFEDLCRGPHAPNTKFLRFFKL
FT                   TRVAGAYLGGDEKREMLTRIYGTAFADKESLKEYLTIIEEAKKRDHRKLGTELKLFTFD
FT                   DEIGGGLPIWLSNGARLRSKLEHMLYKIHRLRGYEPVRGPELLKADAWKISGHYANYKE
FT                   NMYFTQIDEQEYGIKPMNCVGHIKIYQSDVRSYRDLPLKFFEYGVVHRHEKSGVLHGLF
FT                   RVREFTQDDAHIFCMPSQIKEQVLEILAFVDNLMKLFDFSYEMEISTKPEKAIGDDEIW
FT                   EIATKALKEALNEQGLKYGIDEGGGAFYGPKIDIKITDALKRKWQCGTVQVDFNLPSRF
FT                   KLEYTDSDNEKKQPVMLHRAILGSFERFIGILTEHCAGEFPFFIAPTAVGIVPIGEAHI
FT                   AYAKEIQKELLELNIDSEVYEKNESLSKKIRIAEKQKLPMILVLGDDEVVKRSVALRDR
FT                   RAKEQKNLSLDEFIKLVKEKMSEVHF"
FT   gene            209727..210245
FT                   /gene="infC"
FT                   /locus_tag="CJJ81176_0239"
FT   CDS_pept        209727..210245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="CJJ81176_0239"
FT                   /product="translation initiation factor IF-3"
FT                   /note="identified by match to protein family HMM PF00707;
FT                   match to protein family HMM PF05198; match to protein
FT                   family HMM TIGR00168"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0239"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73407"
FT                   /db_xref="GOA:A1VXT6"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXT6"
FT                   /protein_id="EAQ73407.1"
FT                   /translation="MSKEKEVLLNEEIRADEIRCVGDDGKVYGIISSDEALEIANRLGL
FT                   DLVMIAADAKPPVCKIMDYGKFRYQQEKKQKEAKKKQKVIDIKEIKLSVKIAQNDINYK
FT                   VKHALEFLEQGKHVRFRVFLKGREMATPEAGVALLEKIWTMIENEANRDKEPNFEGRYV
FT                   NMLVTPKKA"
FT   gene            210284..211375
FT                   /locus_tag="CJJ81176_0240"
FT   CDS_pept        210284..211375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0240"
FT                   /product="D12 class N6 adenine-specific DNA
FT                   methyltransferase"
FT                   /note="identified by match to protein family HMM PF02086"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0240"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73456"
FT                   /db_xref="GOA:A0A0H3PC44"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC44"
FT                   /protein_id="EAQ73456.1"
FT                   /translation="MKENPSFLKEQIITYLGNKRALLSFLNNGFKVAKKELGKDKFSFC
FT                   DIFSGSGVVSRFAKAHSNYILANDLEDYSKLINECYLANKDKDLLQNIKKYYKNLIQNL
FT                   DFQKGFISELYAPKDDDDIKKNERVFYTFKNALYLDTIRQKIENEIPKELRHFFIAPLI
FT                   YEASVHSNTSGVFKGFYKGKDGIGKFGGEGQNALKRIKGEIELKIPIFSNFSCEFEVMQ
FT                   KDANMLAKELDFFDVVYLDPPYNQHPYSSNYFMLNLIANYKKPEEISKISGIPKDWNRS
FT                   TFNKSKFAQDALFELINDLKARVILLSYNCEGFVKKEIFLKRLSTLGKCRILEQKYNTF
FT                   RASRNLKNRNIHLHEQLYILVKN"
FT   gene            211605..211730
FT                   /locus_tag="CJJ81176_0241"
FT   CDS_pept        211605..211730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0241"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEA2"
FT                   /protein_id="EAQ72959.2"
FT                   /translation="MAMIDFSTSNRGGKFQGEFTNIGQSYIVSASHMSTSLNTGK"
FT   gene            211850..212296
FT                   /locus_tag="CJJ81176_0242"
FT   CDS_pept        211850..212296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0242"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0242"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73472"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJM7"
FT                   /protein_id="EAQ73472.2"
FT                   /translation="MSKISLNKSANLSKDLNLIEKNSGDGGDIYEYKDPFWDSCQSGKC
FT                   DYSKGKGKLFDSSRYEYFVREGSGIVALGFEDTNKVPIKIFDSNEINLGGFVSLTPKNT
FT                   EDKRFKLQFLNYTNDKRNSFTSSSISRDSGSGVYVYDKMDKNGI"
FT   gene            212460..212690
FT                   /locus_tag="CJJ81176_0243"
FT   CDS_pept        212460..212690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0243"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73185"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBA8"
FT                   /protein_id="EAQ73185.1"
FT                   /translation="MKDGKKIENVSLISKTNVGYVSYKNSFDDKNNCDKRIEEMQNSKD
FT                   LYFSQNGSINLNSDVDLGASVLNLIKIQIGK"
FT   gene            212753..213331
FT                   /locus_tag="CJJ81176_0244"
FT   CDS_pept        212753..213331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0244"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0244"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73039"
FT                   /db_xref="InterPro:IPR012332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ5"
FT                   /protein_id="EAQ73039.1"
FT                   /translation="MLKPKKMIFFIKWAKESLLSKVKVWIQDLEWVRTKVSLEGEGLSF
FT                   GEIYMNGRTLDLSGLTLNFDQIKTNSNNVFITSSQSGTHLNLENKQDYLYHGNIFSDEA
FT                   VTMSANTDKALIFDGNIYNKEGVFRTENAKLNFQGHARIHAYVSKEQAKKLQEHGLSAL
FT                   TKPVSFTQEDWVFVLKELNLEKKRVLFRA"
FT   gene            213489..213752
FT                   /locus_tag="CJJ81176_0245"
FT   CDS_pept        213489..213752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0245"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ38"
FT                   /protein_id="EAQ73188.1"
FT                   /translation="MAFEQKLQNTQNAKIEKVYFSVNLNLDHSDVTLQNTFFSGNIKGI
FT                   NDTQKNLAIKDSLLESHIQMSNLQVEKSAIYRKVDAKKIKCK"
FT   gene            213727..213885
FT                   /locus_tag="CJJ81176_0246"
FT   CDS_pept        213727..213885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0246"
FT                   /product="pathogenicity domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0246"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAF0"
FT                   /protein_id="EAQ73097.1"
FT                   /translation="MQKKLSANNTIFKINVDFENSKADYINSKESTQGVNNTLVLIFLN
FT                   NPSKKRV"
FT   gene            214455..214622
FT                   /locus_tag="CJJ81176_0247"
FT   CDS_pept        214455..214622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0247"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0247"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAP8"
FT                   /protein_id="EAQ73323.1"
FT                   /translation="MGYRKAYDKFYLELSLEFISGYVGAMDLKGDIASLKRFSYIPLVV
FT                   KTAFFIGSQN"
FT   gene            214736..214867
FT                   /locus_tag="CJJ81176_0248"
FT   CDS_pept        214736..214867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0248"
FT                   /product="pathogenicity protein, putative, truncation"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0248"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73287"
FT                   /db_xref="GOA:A0A0H3PET9"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PET9"
FT                   /protein_id="EAQ73287.1"
FT                   /translation="MFINLGNDYKLNDKTRFSFEFEKTFFGDLNVDWSANANLRYSF"
FT   gene            214948..215976
FT                   /gene="argC"
FT                   /locus_tag="CJJ81176_0249"
FT   CDS_pept        214948..215976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="CJJ81176_0249"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR01850"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0249"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73473"
FT                   /db_xref="GOA:A1VXU6"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXU6"
FT                   /protein_id="EAQ73473.1"
FT                   /translation="MKIKVGILGASGYAGNELVRILLNHPKVEISYLGSSSSVGQNYQD
FT                   LYPNTLLNLCFENKNLDELELDLLFLATPHEFSAKLLNENLLKKMKIIDLSADFRLKNP
FT                   KDYELWYKFTHPNQELLQNAVYGLCELYKEEIKKASLVANPGCYTTCSILSLYPLFKEK
FT                   IIDFSSVIIDAKSGVSGAGRSAKVENLFCEVNENIKAYNLALHRHTPEIEEHLSYAAKK
FT                   KITLQFTPHLVSMQRGILISAYANLKEDLQEQDIRDIYTKYYQNNKFIRLLPPQSLPQT
FT                   RWVKSSNFADINFSVDQRTKRVIVLGAIDNLIKGAAGQAVQNMNLMFDFDEDEGLKFFA
FT                   NL"
FT   gene            215985..216431
FT                   /locus_tag="CJJ81176_0250"
FT   CDS_pept        215985..216431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0250"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0250"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73286"
FT                   /db_xref="GOA:A0A0H3PAM7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAM7"
FT                   /protein_id="EAQ73286.1"
FT                   /translation="MLIRAMQKSDYEAVYKLWCEIKGFGIRSIDDSKENIENFLDRNPD
FT                   LSVVAVLGEEIVGSILCGHDGRTGGFYHVCVHKDHRKKGIAHEMTKFCLEALKAQKINK
FT                   IALIAFKNNDLGNEFWKHYGFTLREDANYYDLSLNEYNQTSFNA"
FT   gene            216441..217280
FT                   /gene="argB"
FT                   /locus_tag="CJJ81176_0251"
FT   CDS_pept        216441..217280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="CJJ81176_0251"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00761"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0251"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73446"
FT                   /db_xref="GOA:A1VXU8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXU8"
FT                   /protein_id="EAQ73446.1"
FT                   /translation="MQKYLEKANVLIEALPYIRKFNSKIILIKYGGSAMENEELKHCVM
FT                   QDIALLKLVGLKPIIVHGGGKDISAMCEKLGVKSEFKNGLRVSDKATTEVASMVLNHIN
FT                   KNLVHSLQNLGVKAIGLCGKDGALLECVKKDENLAFVGTIQKVNSKILEELLEKDFLPI
FT                   IAPIGMDENFNTYNINADDAACAIAKALRAEKLAFLTDTAGLYEDFNDKNSLISKISLE
FT                   QAKILAPKIEGGMHVKLKSCIDACENGVKKVHILDGRVKHSLLLEFFTDEGIGTLVG"
FT   gene            217290..218471
FT                   /gene="argD"
FT                   /locus_tag="CJJ81176_0252"
FT   CDS_pept        217290..218471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="CJJ81176_0252"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00707"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0252"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73229"
FT                   /db_xref="GOA:A0A0H3PJ70"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ70"
FT                   /protein_id="EAQ73229.1"
FT                   /translation="MDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGIGV
FT                   CALGYNHAKFNAKIKAQVDKLLHTSNLYYNENIAAAAKNLAKASALERVFFTNSGTESI
FT                   EGVMKTARKYAFNKGIKGGQFIAFKHSFHGRTLGALSLTANEKYQKPFKPLISGVKFAK
FT                   YNDISSVEKLVNEKTCAIILESVQGEGGINPANKDFYKALRRLCDEKDILLIADEIQCG
FT                   MGRSGKFFAYEHAQILPDIMTSAKALGCGLSVGAFVINQKVASNSLEAGDHGSTYGGNP
FT                   LVCAGVNAVFEIFKEEKILENVNKLTPYLEQSLDELINEFDFCKKRKGLGFMQGLSLDK
FT                   NVKVAKVIQKCQENALLLISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF"
FT   gene            complement(218491..219120)
FT                   /gene="pcm"
FT                   /locus_tag="CJJ81176_0253"
FT   CDS_pept        complement(218491..219120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcm"
FT                   /locus_tag="CJJ81176_0253"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="identified by match to protein family HMM PF01135;
FT                   match to protein family HMM TIGR00080"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0253"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73008"
FT                   /db_xref="GOA:A0A0H3PIU0"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIU0"
FT                   /protein_id="EAQ73008.1"
FT                   /translation="MNAFEQKRCQNMAEEIAQKVFINEELFNAFCQIPREIFSPLKAHA
FT                   YRLDALPLANSQWISSPLTVAKMTMALDFKNADSILEIGCGSGYQAAILSKVIRRVFTI
FT                   ERIENLAKKAAQTFRELELFNINVKFDDGQNGWKNYAPYDRILFSAYATQIPEILLDQL
FT                   SDDGILVAPILHNGKQFITRLRKNGTNLQKEILEECLFVPIVDGKE"
FT   gene            219209..219757
FT                   /locus_tag="CJJ81176_0254"
FT   CDS_pept        219209..219757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0254"
FT                   /product="transferase, hexapeptide repeat family"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0254"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73154"
FT                   /db_xref="GOA:A0A0H3PB85"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB85"
FT                   /protein_id="EAQ73154.1"
FT                   /translation="MLIKFKNHSPKLGQNVFVAEGAKIIGEIEIGDESSIWFNCVLRAD
FT                   VNFIKIGKRTNIQDLSTVHVWHREFDEKGKLKDAGFPTIIGDDVTIGHNCVIHACVIKN
FT                   RVLIGMNAVIMDNALIEEDSIVGAGSVVTKGKKFPPRSLILGNPAKFVRELNDEEISFL
FT                   KQSALNYMDFKNEFLKDLQ"
FT   gene            complement(219726..221096)
FT                   /locus_tag="CJJ81176_0255"
FT   CDS_pept        complement(219726..221096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0255"
FT                   /product="nicotinate phosphoribosyltransferase, putative"
FT                   /note="identified by match to protein family HMM PF04095;
FT                   match to protein family HMM TIGR01513"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0255"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73078"
FT                   /db_xref="GOA:A0A0H3PB10"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB10"
FT                   /protein_id="EAQ73078.2"
FT                   /translation="MTSKTSLALLCDFYEFTMSQGYFKNNKKDQICYFDIFFRKIPDSG
FT                   SFAIFAGLEDILDFVENLSFDAEDIEFLRKQGIFDTEFLDFLANFKFKGEIYAMREGEV
FT                   IFPNEPLLCIKATTIEAQLLETFLLLSLNHQSLIATKTNRIVRAAKDSKILEFGSRRAQ
FT                   GSEAALKGARAAFIGGCIGSACTLAGKIYNIPINGTMAHSWVQMFENELEAFKAYVKIY
FT                   PKNPVFLIDTYDCLNSGLKNAIKVFKEFGIQKGGVRIDSGNLLKLSLKIRQELDQAGLQ
FT                   KCKIIVSNALDEWSIKKLKEQNAPIDIFGVGERLITASSDPIFSCVYKLAALEDQGIKP
FT                   KIKISENNEKSTLPHFKKLFRVYDKNTQKILFDELYVFDENPNQDENLERKELLKLVYK
FT                   EKRLLKKSSLNTMQDYTKEQISKLDESFLDLDRFVKFEVKLSPKLQNITEDLLKTRF"
FT   gene            complement(221086..222108)
FT                   /gene="nrdB"
FT                   /locus_tag="CJJ81176_0256"
FT   CDS_pept        complement(221086..222108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="CJJ81176_0256"
FT                   /product="ribonucleoside-diphosphate reductase, beta
FT                   subunit"
FT                   /EC_number="1.17.4.1"
FT                   /note="identified by match to protein family HMM PF00268"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0256"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73173"
FT                   /db_xref="GOA:A0A0H3PJ30"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ30"
FT                   /protein_id="EAQ73173.1"
FT                   /translation="MQRKRIYNPSSNETLGDRKVFDGNPHGILNFTKAKYTWALKLWDL
FT                   MEANTWFPKEVDTTKDALDYRCNLTAGEKRMYDLVWSQLISMDSFQTNNLADNINPYIT
FT                   APEINAVLARQAYEEANHSKSYAVMVEAICDNTDLIYEMEKHDETLREKNDFISSIYEE
FT                   LAGDVDDNKLLLAMVANQILEGVYFYSGFTAIYALARAGKMLGSAQMIRFIQRDEITHL
FT                   LLFQNMINSVRKERPDLFHDENINKIYDMFKKAGDLEIKWGKYITQNQIMGFTDDIIEE
FT                   YIHYLVDQRLSAINLDKLYNAKHPIKWVDDFSKFNDQKSNFFESKVTNYSKGSISFDDF
FT                   "
FT   gene            complement(222122..222532)
FT                   /locus_tag="CJJ81176_0257"
FT   CDS_pept        complement(222122..222532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0257"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06271"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0257"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73313"
FT                   /db_xref="GOA:A0A0H3PBY5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBY5"
FT                   /protein_id="EAQ73313.1"
FT                   /translation="MKTKAKISSRWLRFRALLIDIFLIYVPILYLFYFLLGSKEAFLNN
FT                   HFITTLCTFLFGLIQAIFLTKKAQSPGLKAYDLYLIDIKTGKKLSFLRILLRYVIFIIS
FT                   FGLLFGLFVSFARKDRLNLHDILTQSCIVTKA"
FT   gene            complement(222533..223141)
FT                   /gene="pyrE"
FT                   /locus_tag="CJJ81176_0258"
FT   CDS_pept        complement(222533..223141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="CJJ81176_0258"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01367"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0258"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73110"
FT                   /db_xref="GOA:A1VXV5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXV5"
FT                   /protein_id="EAQ73110.1"
FT                   /translation="MNLEQIYKDCGAYLEGHFLLSSGKHSQFYLQSAKVLEDPKLAAKL
FT                   CNELAKIIASYKIEFDSICSPALGGILAGYELARACSKRFIFTERVNKEMTLRRGFEVK
FT                   KGEKFIICEDIITTGGSALESAKIIESLGGIVVGFAALANRGFCAVENLKSPRKDNAKL
FT                   PENLPLFTLGNFEFEIYDETNCPLCKKGSKAIKPGSRGN"
FT   gene            complement(223144..223701)
FT                   /gene="frr"
FT                   /locus_tag="CJJ81176_0259"
FT   CDS_pept        complement(223144..223701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="CJJ81176_0259"
FT                   /product="ribosome recycling factor"
FT                   /note="identified by match to protein family HMM PF01765;
FT                   match to protein family HMM TIGR00496"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0259"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73437"
FT                   /db_xref="GOA:A1VXV6"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXV6"
FT                   /protein_id="EAQ73437.1"
FT                   /translation="MLNEIFNKQKTQSEKSLEALKKDFTTLRTGKVNIHILDHITVDYY
FT                   GTQTPLNQVATVLASDASTISITPWEKPLLKTIESAIAAANIGVNPNNDGESVKLFFPP
FT                   MTREQREENVKQAKAMGEKAKVSIRNIRKDANDAVKKLEKDKAISEDEAKKAYDEVQKL
FT                   TDTYTTKIDESVKSKESELLKV"
FT   gene            complement(223717..224088)
FT                   /gene="secG"
FT                   /locus_tag="CJJ81176_0260"
FT   CDS_pept        complement(223717..224088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secG"
FT                   /locus_tag="CJJ81176_0260"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="identified by match to protein family HMM PF03840;
FT                   match to protein family HMM TIGR00810"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0260"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73038"
FT                   /db_xref="GOA:A0A0H3PEE2"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEE2"
FT                   /protein_id="EAQ73038.1"
FT                   /translation="MITLLIILQFIIVVVICIAVLLQKSSSIGLGAYSGSNESLFGAKG
FT                   PAGFLAKFTFVMGILLIANTIGLGYLYNKASKDSLAEKIKVENNNTTIPSAPIVPTTPN
FT                   TNSIAPSAPQLPSDVNSSK"
FT   gene            complement(224192..224887)
FT                   /locus_tag="CJJ81176_0261"
FT   CDS_pept        complement(224192..224887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0261"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01027"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0261"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73010"
FT                   /db_xref="GOA:A0A0H3PAB1"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAB1"
FT                   /protein_id="EAQ73010.1"
FT                   /translation="MSLYDRDYSRSKEFENTRSSELSIFIKQTYQLFAASLLAATVGAY
FT                   VGIFALASFFIQSQVTFWILFAVEIGLLFALQWKKREAPLNLVLLFGFTFCSGLTLTPL
FT                   LISVLALPAGGIIIAQAFALTTVAFAGLSVFAMNTKKDFTVMGKALFIVLIVIVAASLL
FT                   NLFFQSSIVNLAISAVAAILFSFYILYDTQNIIRGNYETPIEGAVALYLDFVNLFVSLL
FT                   NILRSFNSR"
FT   gene            225047..225682
FT                   /gene="cynT"
FT                   /locus_tag="CJJ81176_0262"
FT   CDS_pept        225047..225682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cynT"
FT                   /locus_tag="CJJ81176_0262"
FT                   /product="carbonic anhydrase"
FT                   /EC_number="4.2.1.1"
FT                   /note="identified by match to protein family HMM PF00484"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0262"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72969"
FT                   /db_xref="GOA:A0A0H3PAX6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAX6"
FT                   /protein_id="EAQ72969.1"
FT                   /translation="MENLISGAIKFMQEDFKEHEELFESLKNKQNPHTLFIGCSDSRVI
FT                   PNLITNTGPGELFVIRNIANIVPPYRVGEDYLATTSAIEYALNSLHIKNIVVCGHSNCG
FT                   GCNALYYSDEELNKIPNVKKWLTMLDPIKKDVMIFARDDLAMRSWLTEKLNLVNSLQNI
FT                   LTYPGVQEALDEGKIEVHAWYYIIETGEIYEYDFKAKIFTLIQDRKVQ"
FT   gene            225679..227562
FT                   /locus_tag="CJJ81176_0263"
FT   CDS_pept        225679..227562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0263"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /note="identified by match to protein family HMM PF00924"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0263"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73306"
FT                   /db_xref="GOA:A0A0H3PJB3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJB3"
FT                   /protein_id="EAQ73306.1"
FT                   /translation="MKKIIFSLCFFILYLGAQEFKFIDANISKEDEGIYALVEKYVDLN
FT                   NQIKEFKKNNDENSSTFNGILSEFEKDKKTILAKIPDMIVGQKINEEAVARFLKAKEKL
FT                   LDVQKKNINKPYIYTDATLNLVYFNIVESFYSSLFEVEKLFKNTASSEDLIATVDKAME
FT                   NLQNSSSINLNSFKSKITNPEELEKITLKERYISNAVDSYSEILKYLRSNADLLESNYI
FT                   FSLLELQVWIDRINEAIGVGFINIGKIVISALVLAFFISLRRFFANIVYFFLVQLFYRN
FT                   KNDVDDIKVIFIENIKKPVGFLLIVYAISLCLTIATYPAPLSVNLSNFFHIVYAVLIAW
FT                   LILRMLDGYGVVLVSKLAQKSGKKEVVNLIIKILYFVIIIIALLYILAQLGFNISAIIA
FT                   SLGIGGLAVALAAKDIIANFFASILLLFDNSFNQGDWVEVSGIEGTVVETGLRKTTIRT
FT                   FDNCLVFLPNSTIMGANIKNWSKRRMGRHVRMYLGVGYDATPEKLEQCVKDLREFLHTS
FT                   DLVAHDEDSALKYGDHTTKYRQNLVSINDLEGYKNACYVALSEFADSSINIELYFYIKE
FT                   IGGKDFREARQSLMLEFMRIIEKNGLTFAFPSRSIYIENLPPLDLQAKAIK"
FT   gene            complement(227587..228558)
FT                   /locus_tag="CJJ81176_0264"
FT   CDS_pept        complement(227587..228558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0264"
FT                   /product="NifU family protein"
FT                   /note="identified by match to protein family HMM PF01106;
FT                   match to protein family HMM PF01592; match to protein
FT                   family HMM PF04324"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0264"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73220"
FT                   /db_xref="GOA:A0A0H3PAK2"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAK2"
FT                   /protein_id="EAQ73220.1"
FT                   /translation="MGKNSLIGGSIWDEYSQKVQDRMNNPQHMGEFSEEDAKARNAKLI
FT                   VADFGAESCGDAVRLFWLVDEKTDKIIDAKFKSFGCGTAIASSDTMVDLCIGKTVDEAV
FT                   KITNLDVEFAMRDNPETPAVPPQKMHCSVMAYDVIKQAAAHYKGISPEDFEDQIIVCEC
FT                   ARVSLGTIKEVIKLNDLHSVEEITQYTKAGAFCKSCIKPGGHEKRDYYLVDILAETRAE
FT                   IDREKLKNTMKSDVAFDEMTVVGQLKAVESVLDAEIRPMLHNDGGDLEVIDIQKAEGAA
FT                   IDVYIRYLGACSGCSSGSGATLYAIETILQEELSPNIRVMPV"
FT   gene            complement(228568..229749)
FT                   /locus_tag="CJJ81176_0265"
FT   CDS_pept        complement(228568..229749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0265"
FT                   /product="cysteine desulfurase, putative"
FT                   /note="identified by match to protein family HMM PF00266"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0265"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73257"
FT                   /db_xref="GOA:A0A0H3PBV6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017773"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBV6"
FT                   /protein_id="EAQ73257.1"
FT                   /translation="MKVYLDNNATTMLDPNAYELMLPFLKDMYGNPNSLHQYGSATHPA
FT                   LREALDKLYTGLGANDLDDIVVTSCATESINWVLKGVYFDHILDKERNEVIISSVEHPA
FT                   VTAAAYFLKSLGVKVIELPVNEEGVSTVEDLRKVISDKTALVSVMWANNETGMIFDIKA
FT                   MAELAHEFGALFHTDATQAVGKIKVNLTQVGVDFASFSAHKFHGPKGVGGLFIKKGLKL
FT                   TPLLHGGEHMGGRRSGTLNVPYIVAMGEALRIANTMLDFEDSHIRRLRDKLEDQILALP
FT                   DTTVVGKRERRVPNTILASIKGVEGEAMLWDLNKNGIAASTGSACASEALESNPIMEAI
FT                   GAEHDLAHTALRLSLSRFNTEEEIDYAAKQIKNATQRLRAISCTYAYNPNNYK"
FT   gene            complement(229927..230328)
FT                   /locus_tag="CJJ81176_0266"
FT   CDS_pept        complement(229927..230328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0266"
FT                   /product="conserved hypothetical protein, authentic
FT                   frameshift"
FT                   /note="identified by match to protein family HMM PF01814;
FT                   match to protein family HMM TIGR02481"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0266"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73292"
FT                   /db_xref="GOA:A1VXW3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR023504"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXW3"
FT                   /protein_id="EAQ73292.1"
FT                   /translation="MTYNEKIISMNNDLLDHQHKELFEISKKLSLMNQRHVGTKELKIV
FT                   LRELLIMINRHFSDEEAFMREIGYPYINHHTRIHRKIILEIEEIIISEAKFVNIMTEKL
FT                   NLVVQDFIFKHTAKEDSKIVKYYEEKFKK"
FT   gene            complement(230465..231631)
FT                   /locus_tag="CJJ81176_0267"
FT   CDS_pept        complement(230465..231631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0267"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC21"
FT                   /protein_id="EAQ73393.1"
FT                   /translation="MTINSANPYQNLTLSNPLQNSSALNLIKDSKALDQEGNENSLEQL
FT                   SYIFNNTTYASEFGFRINEEGFFDKDLNKIANIPESYNINIKSVRSIAKELAKQDENLN
FT                   YNKIDLPYLLNSYHSSLKSINSEFLQDDNAYLSRDLISKLSSGFSTDNGEFLSQISRIY
FT                   NNQEEIDLALSNITNLNTLMLDNKITNFHFDKAIENTSSNEILKPYLTKNAEVSKSGLL
FT                   MNFIYHDIKTQNEKEFNFFMKPATLELSSHQNLQKILKGETDIEDYIKKENEKKMSFDL
FT                   YLYVNGVDKKTSTQDKLSVFFQQYINYQKDMDLREFANSSSIFQIYIDQNRNDFDALKK
FT                   QYQNQSQDTQRLEEANQLRSNSIENFLDRRQKQANINKILNSYMSVMV"
FT   gene            complement(231702..231830)
FT                   /locus_tag="CJJ81176_0268"
FT   CDS_pept        complement(231702..231830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0268"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0268"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73050"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEF0"
FT                   /protein_id="EAQ73050.1"
FT                   /translation="MKRLTALLTLFIFGIRFPYLDKFLFFKLKEKLNTIKFFLIFD"
FT   gene            231787..231978
FT                   /gene="rpmI"
FT                   /locus_tag="CJJ81176_0269"
FT   CDS_pept        231787..231978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="CJJ81176_0269"
FT                   /product="ribosomal protein L35"
FT                   /note="identified by match to protein family HMM PF01632;
FT                   match to protein family HMM TIGR00001"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0269"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73162"
FT                   /db_xref="GOA:A1VXW6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXW6"
FT                   /protein_id="EAQ73162.1"
FT                   /translation="MPKMKSVKSAVKRFKVGKNKIKRGSAFRSHILTKKPAKRMRDLRT
FT                   AKYVHSTNVKAVEKMLGI"
FT   gene            232072..232425
FT                   /gene="rplT"
FT                   /locus_tag="CJJ81176_0270"
FT   CDS_pept        232072..232425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="CJJ81176_0270"
FT                   /product="ribosomal protein L20"
FT                   /note="identified by match to protein family HMM PF00453;
FT                   match to protein family HMM TIGR01032"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0270"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72992"
FT                   /db_xref="GOA:A1VXW7"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXW7"
FT                   /protein_id="EAQ72992.1"
FT                   /translation="MARVKTGVVRRRRHKKVLKLARGFYSGRRKHFRKAKEQLERSLVY
FT                   AYRDRRRKKRDFRRLWIVRINAACRLNDLSYSRFINGLKKAGIELDRKILADLAMNDAA
FT                   AFAKIAEAAKKAL"
FT   gene            complement(232477..232731)
FT                   /locus_tag="CJJ81176_0271"
FT   CDS_pept        complement(232477..232731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0271"
FT                   /product="putative MCP-domain signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0271"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBI1"
FT                   /protein_id="EAQ73352.1"
FT                   /translation="MEGAIKLVIQTIQSIAKSSNSSTQEMNFIRDKSNEFSKIISNLIN
FT                   SGKEISDKLEQRSNVSEDFEKNVNELKCYEDVLAKLNQC"
FT   gene            complement(233117..233290)
FT                   /locus_tag="CJJ81176_0272"
FT   CDS_pept        complement(233117..233290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0272"
FT                   /product="putative MCP-domain signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0272"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAN6"
FT                   /protein_id="EAQ73302.1"
FT                   /translation="MGIAKSLVAIFFYEVENFNDFKPRYLKTFIQKYSDFKYYYLNIRA
FT                   QKLEITNEIKIK"
FT   gene            complement(233407..233778)
FT                   /locus_tag="CJJ81176_0273"
FT   CDS_pept        complement(233407..233778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0273"
FT                   /product="putative MCP-domain signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0273"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBH1"
FT                   /protein_id="EAQ73333.1"
FT                   /translation="MKSQNFNPQSNITFTILDASLYDKTIHEFIDKKTSQSINAVEALC
FT                   NYFNCTFEELKNKIQEYTFALKIGEDYLISPMEINPDKTLFSYCDIESAQELCLLKKTN
FT                   FIEAIKKIMKNFLLINQNH"
FT   gene            complement(233783..234454)
FT                   /locus_tag="CJJ81176_0274"
FT   CDS_pept        complement(233783..234454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0274"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73272"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBW2"
FT                   /protein_id="EAQ73272.1"
FT                   /translation="MFFNFKNKSSTKKEESKKVLEALYLQENELEEKLKKINIKPKLII
FT                   GFASYQLNLAIIGNKIQNSINEQCDIILSSATDLLCNLDSNSNIENSPYKQNIQGISLM
FT                   LFSEDMIENLCTNKIKLFSNIKDYTERKKLIEKEVLSINVPFEAHCINTLHYLIYDGLS
FT                   QSESSLLELLYKHNPYPCALVGGGSSGNMDFSGTFIFYNGEILKNQALSLHIQFKPKIS
FT                   F"
FT   gene            234632..235489
FT                   /locus_tag="CJJ81176_0275"
FT   CDS_pept        234632..235489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0275"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73223"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ65"
FT                   /protein_id="EAQ73223.1"
FT                   /translation="MIGDMNELLLKSVEVLPPLPDTVSKLRKYVSEANSNIETMKVAEI
FT                   ISSDPLMTAKLLQLANSPYYGFTREITTINQVITLLGVGNIINIVTADSIRDNFKIDVS
FT                   PYGLNTQNFLKTCNEEATFITNWLNDEDKKLSHLLVPCAMLLRLGIVIFSNFLIQNHKD
FT                   KDFLAFLNKNENLALAENEFLGVDHISFLGFLLHRWNFDDVLIESICFVRTPHAAREEV
FT                   KKSAYALAITDHLFAPHDGSSPFNAKAAVALLEEAKTQGINFDLNNLLSKLPSKAKENL
FT                   NKED"
FT   gene            235520..235996
FT                   /locus_tag="CJJ81176_0276"
FT   CDS_pept        235520..235996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0276"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0276"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73022"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM0"
FT                   /protein_id="EAQ73022.2"
FT                   /translation="MKSLILPPNEFLDHYILNAEFHRFAGISKNAYKFWKNVEIGRYQG
FT                   TRIIFLHRNCILEKHQQALRQCSGLNGFVLASAFCSFTGLAPSHLVEKNNSSIYKLLEL
FT                   KEICGIKFVNLKKFYDFLGLNYHQHIYIEKCHFFSPAPFEKRIKITESMCVGYY"
FT   gene            complement(235965..237275)
FT                   /locus_tag="CJJ81176_0277"
FT   CDS_pept        complement(235965..237275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0277"
FT                   /product="major facilitator superfamily protein"
FT                   /note="identified by match to protein family HMM PF00083;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0277"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73093"
FT                   /db_xref="GOA:A0A0H3PB28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB28"
FT                   /protein_id="EAQ73093.1"
FT                   /translation="MSKTLNQKDIKVLGLSSLGGTLEFYDFIIFVFFANYISTNFFPKD
FT                   LSSFWQMFNTYGIFAAGYLTRPLGGVILAHFGDKFGRKRMFMISILLMVIPTFTLAFIP
FT                   NYESIGFLCIVLLVFIRICQGIAIGGELPGAWVFVYEHAPQGQKRTYLGILTASVVGGI
FT                   LLGSLVFLIMNKIYTQEELHEWAWRIPFFLGGIFGIISAYLRKFLRETPVFEQMKKDKA
FT                   LEKFPLKEVFKKAKMGIVLSMMITWVLTGCIVVMILLMPSYMAKILQINTSIQTYLQIG
FT                   GILLICLGCIISGILADKIGIIKSCVFFSVFFGIVSLLYFNTLYRQNADFNLVACLYLL
FT                   VCFFSGVMNFCPLIMSEVFDAKIKFSGLSFSYNIAYAIAGGLTPQLAFFLHSFALDNLS
FT                   NFWRFSLGIYVFFLAIIALLCAFIFSYLNNTQRTYSQ"
FT   gene            complement(237278..237433)
FT                   /locus_tag="CJJ81176_0278"
FT   CDS_pept        complement(237278..237433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0278"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73054"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN2"
FT                   /protein_id="EAQ73054.1"
FT                   /translation="MAYEDEEDLNYDDYENEDEEYPQNHHKNHNYDDDDYEYDDDNNDD
FT                   DFYEMD"
FT   gene            237526..237999
FT                   /gene="moaC"
FT                   /locus_tag="CJJ81176_0279"
FT   CDS_pept        237526..237999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="CJJ81176_0279"
FT                   /product="molybdenum cofactor biosynthesis protein MoaC"
FT                   /note="identified by match to protein family HMM PF01967;
FT                   match to protein family HMM TIGR00581"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0279"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73124"
FT                   /db_xref="GOA:A1VXX6"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXX6"
FT                   /protein_id="EAQ73124.1"
FT                   /translation="MKLSHLDEKNHPKMVDVGDKNITSRIATASGMIYMSQEAFDVIKN
FT                   NTAKKGPVLQTAIIAAIMGAKKTSEIIPMCHPLMLSKVETDIMEFVKECAFKLIVTVKC
FT                   EGKTGVEMEALSGVSIGLLTIYDMIKAIDKSMRITDIVLESKEGGKSGKFVRS"
FT   gene            237977..238240
FT                   /locus_tag="CJJ81176_0280"
FT   CDS_pept        237977..238240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0280"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73164"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEL5"
FT                   /protein_id="EAQ73164.1"
FT                   /translation="MVNLCDLKKEPQINYPTFWDYKVIFEVHVRASEIFQEILGQREYK
FT                   FEHSNSSASGKYQSYLLNVYVDSKKDRLDIFDKLKAKAKFVL"
FT   gene            238254..239390
FT                   /locus_tag="CJJ81176_0281"
FT   CDS_pept        238254..239390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0281"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0281"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73216"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEP7"
FT                   /protein_id="EAQ73216.1"
FT                   /translation="MKNTLIIFENSLSNLGKDEASDLLEDLSFNLAYKQISHNPHETKK
FT                   VLNSLLVEFLTILKKLDFFDDENVTKVIKALVKASIVDAQNSLYEYISEAELLNKQIEN
FT                   QKNLIKNQISDNFFEFENILQECSFCDEFSGGLNDAILFDIEMLGILKETAESAFLTTL
FT                   EKAEDIELTSSEIAKNLVYNAICEAHFEKERILKISSIILNTAFEIANESMAYAKDLCL
FT                   GVIKGTRDGIVLAMEKFKASLTYANFEEDVSLKSKELIGIEDDFIALLKKEIQLQNDPC
FT                   KSIVENLLEHELDNLFAKFRRLAGESREQLILVLNDIKKNPKINDFNKLTQRKLNRFKQ
FT                   EIFELEKIASEKYKDLNSKKAKKLGVRLWEKAKKIVKK"
FT   gene            complement(239410..240189)
FT                   /gene="xth"
FT                   /locus_tag="CJJ81176_0282"
FT   CDS_pept        complement(239410..240189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xth"
FT                   /locus_tag="CJJ81176_0282"
FT                   /product="exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="identified by match to protein family HMM PF03372;
FT                   match to protein family HMM TIGR00195; match to protein
FT                   family HMM TIGR00633"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0282"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73304"
FT                   /db_xref="GOA:A0A0H3PEV1"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEV1"
FT                   /protein_id="EAQ73304.2"
FT                   /translation="MKILRKIMKLLSWNVNGLRAICDKNALDWIAQEKIDFIGFQEIKA
FT                   HEDKFPKKIYEYPFKHMYFNSAKRAGYSGVMSLCNFDSEVKKCEFFDDEEGRVLEHRFK
FT                   NIALFNIYFPNGQKDEERLNFKMKFYADFLVYLDKLLKDGFEIIICGDVNTAHKEIDLT
FT                   HPKANANTSGFLPIERAWIDDLLKLGFIDTFREINGEIKEKYSWWSYRMKARERNVGWR
FT                   IDYFFISKGLKDKLKNAFIRDDIFGSDHAPVGIEIDI"
FT   gene            240286..241824
FT                   /locus_tag="CJJ81176_0283"
FT   CDS_pept        240286..241824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0283"
FT                   /product="sulfatase, putative"
FT                   /note="identified by match to protein family HMM PF00884;
FT                   match to protein family HMM PF08019"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0283"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73399"
FT                   /db_xref="GOA:A0A0H3PBK1"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK1"
FT                   /protein_id="EAQ73399.1"
FT                   /translation="MLRLTWFQFTFFNSLMIVLLNFNLFYFVYEKNTQNWFITFVFIVA
FT                   YFALVHVICSLLFIKFFTKFFSILFIISSFLSVYFISFYGVLIDSDMIQNVVQTDIKEV
FT                   KDLLNLKLILFIVLALLLVFYVVKVKIDYYGSFKSHIKIKIINIISGLIVVCAVLIPLS
FT                   KTFLPFFRNYNEIRMYNTPFYQIYAVYRYYVRFVKAKPEFKTIANDAYRENNHTKKLLV
FT                   LVVGETARAANYSLGGYTKNDTNFYTKKDNVVFFDNFSSCGTATAVSLPCMFSISKREN
FT                   YSSSEFQENAMDVLYKTGVDAAWFDNNSGGCKGVCDRLAYKQKLSSDLDENLLIPFKEK
FT                   LNHLSDQNIIVLHLQGSHGPTYYKRYPSEFKKFTPTCDTNELSKCDSEALINTYDNTLL
FT                   YTDYLLSEIIKLLKEQKSYESSLFYLSDHGESLGENGIYLHGMPYAIAPSYQTHIPAIF
FT                   WSNDEKLMNLAKEHKGLKLSQDNLFSTLLGYFNVKTSVYEPEYDLLNPKLKANP"
FT   gene            241821..242177
FT                   /gene="dgkA"
FT                   /locus_tag="CJJ81176_0284"
FT   CDS_pept        241821..242177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgkA"
FT                   /locus_tag="CJJ81176_0284"
FT                   /product="diacylglycerol kinase"
FT                   /EC_number="2.7.1.107"
FT                   /note="identified by match to protein family HMM PF01219"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0284"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73433"
FT                   /db_xref="GOA:A0A0H3PBL8"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL8"
FT                   /protein_id="EAQ73433.1"
FT                   /translation="MKPKYHFLNNARYALEGLFALFKNEMAFRIELCIIIPAIVFSFFL
FT                   KVSFLEHLLLISVLILILIVEALNSAIEACVDLITNKWHEKAKIAKDCASAAVFFSVLL
FT                   ALFVWGFILYSIYL"
FT   gene            242174..242419
FT                   /locus_tag="CJJ81176_0285"
FT   CDS_pept        242174..242419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0285"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0285"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73423"
FT                   /db_xref="GOA:A0A0H3PJI9"
FT                   /db_xref="InterPro:IPR008813"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJI9"
FT                   /protein_id="EAQ73423.1"
FT                   /translation="MKFENLIREILGKKRFELLKFLCENADENGFIMIKISDLEEKLHQ
FT                   SKPTIIATFKFLEEKKLFKRLKNGFYQLNIGGKNDT"
FT   gene            242409..243416
FT                   /gene="pyrC"
FT                   /locus_tag="CJJ81176_0286"
FT   CDS_pept        242409..243416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="CJJ81176_0286"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF04909; match to protein
FT                   family HMM TIGR00856"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0286"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73414"
FT                   /db_xref="GOA:A0A0H3PAU6"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAU6"
FT                   /protein_id="EAQ73414.1"
FT                   /translation="MILKNPLDMHLHLRDNQMLELIAPLSVRDFCAAVIMPNLIPPLCN
FT                   LEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIKLYPVGITTNSNG
FT                   GVSSFDIEYLKPTLEAMSDLNIPLLVHGETNDFVMDRESNFAKIYEKLAKHFPRLKIVM
FT                   EHITTKTLCELLKDYENLYATITLHHLIITLDDVIGGKMNPHLFCKPIAKRYEDKEALC
FT                   ELAFSGYEKVMFGSDSAPHPRDTKECCGCAAGIFSAPVILPVLAELFKQNSSEENLQKF
FT                   LSDNACKIYDLKFKEDKILTLEEKEWQVPNVYEDKYNQVVPYMAGEILKFQLKH"
FT   gene            complement(243441..243662)
FT                   /locus_tag="CJJ81176_0287"
FT   CDS_pept        complement(243441..243662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0287"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73115"
FT                   /db_xref="GOA:A0A0H3PAF8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAF8"
FT                   /protein_id="EAQ73115.1"
FT                   /translation="MVKNLIIKFGRLILDAIAAISFVVALLYSLFMMFSIGFLAGLLSL
FT                   IVSFIALFLSFFVIYLVIDIRDALVNKA"
FT   gene            complement(243718..244437)
FT                   /locus_tag="CJJ81176_0288"
FT   CDS_pept        complement(243718..244437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0288"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72991"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAA2"
FT                   /protein_id="EAQ72991.1"
FT                   /translation="MNLWDKKAKTYARYQNTLNTIQKQTFEYLQNLNISFQNKSIIDIG
FT                   CGTGVWTLHLAKEAKEILALDSANTMLEILQEDAKKLNLNNIKCENLSFETWMQNNPNV
FT                   KFDLAFLSMSPALQNEKDYTNFLNLAKIKIYLGWADYRKSDFLDPIFKYFNTEFKGFYK
FT                   KDLENYLLEKNIFFHKIVFDETRKVQRTKEEAIENALWHLSMNKITTSKEAVSSFVEND
FT                   IIETIESKIKLLIINNL"
FT   gene            complement(244517..246514)
FT                   /locus_tag="CJJ81176_0289"
FT   CDS_pept        complement(244517..246514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0289"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672; match to protein
FT                   family HMM PF02743; match to protein family HMM PF05581"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0289"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73158"
FT                   /db_xref="GOA:A0A0H3PEL1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEL1"
FT                   /protein_id="EAQ73158.1"
FT                   /translation="MQSINSGKSVGISAKLTLWVGILVVLILAITSAISYFDSRNNTYE
FT                   LLKDTQLKTMQDVDAFFKSYAMSKRNGIQILANELTNRPDMSDEELINLIKVIKKVNDY
FT                   DLVYVGFDNTGKNYQSDDQILDLSKGYDTKNRPWYKAAKEAKKLIVTEPYKSAASGEVG
FT                   LTYAAPFYDRNGNFRGVVGGDYDLANFSTNVLTVGKSDNTFTEVLDSEGTILFNDEVAK
FT                   ILTKTELSINIANAIKANPALIDPRNQDTLFTAKDHQGVDYAIMCNSAFNPLFRICTIT
FT                   ENKVYTEAVNSILMKQVIVGIIAIIIALILIRFLISRSLSPLAAIQTGLTSFFDFINYK
FT                   TKNVSTIEVKSNDEFGQISNAINENILATKRGLEQDNQAVKESVQTVSVVEGGNLTARI
FT                   TANPRNPQLIELKNVLNKLLDVLQARVGSDMNAIHKIFEEYKSLDFRNKLENASGSVEL
FT                   TTNALGDEIVKMLKQSSDFANALANESGKLQTAVQSLTTSSNSQAQSLEETAAALEEIT
FT                   SSMQNVSVKTSDVITQSEEIKNVTGIIGDIADQINLLALNAAIEAARAGEHGRGFAVVA
FT                   DEVRKLAERTQKSLSEIEANTNLLVQSINDMAESIKEQTAGITQINDSVAQIDQTTKDN
FT                   VEIANESAIISSTVSDIANNILEDVKKKRF"
FT   gene            246707..247582
FT                   /locus_tag="CJJ81176_0290"
FT   CDS_pept        246707..247582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0290"
FT                   /product="zinc transporter ZupT"
FT                   /note="identified by match to protein family HMM PF02535"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0290"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73400"
FT                   /db_xref="GOA:A0A0H3PJG9"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR023498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJG9"
FT                   /protein_id="EAQ73400.1"
FT                   /translation="MQFTFEQIFIAMLLTLFAGFSTAIGSIIAFFSRKDDLRVLSLGLG
FT                   FSAGVMIYISFMEILPTALKDFKNHYDSHWAELLGLACFFGGILISLLIDKLIPEDVNP
FT                   HEPKEDLSELKICPLPQKGQNPPKFHPGEKLHQINTKALKRTGIFTALAIAIHNFPEGF
FT                   ATFISSLDNLTLGIAIAIAVAIHNIPEGLAVSLPIYHATGDKKKAFIYSALSGFAEPLG
FT                   AFVGALILLPFIGDLTLAISFAVIAGIMVFISLDELLPAAKTYDKAHDSLYGLIAGMAI
FT                   MALSLNLLGQ"
FT   gene            complement(247606..250122)
FT                   /locus_tag="CJJ81176_0291"
FT   CDS_pept        complement(247606..250122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0291"
FT                   /product="biotin sulfoxide reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0291"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73099"
FT                   /db_xref="GOA:A0A0H3PB33"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006658"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="InterPro:IPR041954"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB33"
FT                   /protein_id="EAQ73099.1"
FT                   /translation="MLDRRKFLKIGASLSALPLIPSLSAGKTVEASKVSLGLVKNGEVI
FT                   TAAHWGILKLTIKDGKIVKSEPWEKVTKMDNPLQHYTADMVYKSRVKYPYVRKSYLENP
FT                   DNPKPELRGKDEFVRVSYDEAIKLIAKELKKTRDSKGASAIFGGSYGWKSSGNMQNSRI
FT                   LLHRFLNVTGGFVGATGDYSTGASQVIMPYVVGSIEVYEQQTSWENILSDSKYVVIWGA
FT                   DPLSTLRIAWTSNEQRGLAYFEKLKNSKIKVICIDPVKTTTAKFLNAKWIAPRPNTDVA
FT                   LMMGMASHLIAKKKVNYEFLDTYTTGFDKFKDYLEGKEDGVKKDTKWASKICGIDEKTI
FT                   KNLAETFYDNPTMIMSGWGMQRAHHGEQPHWMLVTLCAMLGQIGTKGGGFGLSYHYSNG
FT                   GVPTCKGGVIGGMTAGSLGIWKNGKFKGLSKAEASSEGAEWLQNAASYSFPVARIADAL
FT                   LHPGKTIDHNGAKITYPDIDFIYWVGGNPLVHHQDTNTNVKAWRKPRTVVVNEIYWTPT
FT                   AKMADIIMPVTSSYERDDITMTGDYSNMHIAPMKQAVEPVGESKDDYVIFSDICKIYGK
FT                   DVFNAYTENGKKAKDFIKEYYNSALKQTQSFGEAFATPMPSFEEFWAKNEPITFEPTAE
FT                   SLEWTRFSEFIEDPILNALGTDSGLIEIYSETIKNYNYDDCKAHPTWFEPIEWLGNASK
FT                   EAPFHLLTNHPRDRLHSQLCHTSLRDTYAIKDREPILINSKDAKKLGIKNGDVVRVFNK
FT                   RGEVLAGAVVSDEIMQGVVRLCEGAWYDPNENGLCKCGNANVLTMDIPTSKLANGNISH
FT                   TGLVNIEKFKGELPKLTAFSAPKGAN"
FT   gene            complement(250133..250708)
FT                   /locus_tag="CJJ81176_0292"
FT   CDS_pept        complement(250133..250708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0292"
FT                   /product="putative cytochrome C-type hem-binding
FT                   periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0292"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73191"
FT                   /db_xref="GOA:A0A0H3PEN1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEN1"
FT                   /protein_id="EAQ73191.1"
FT                   /translation="MKKIFISFVVLATCLWAKNIAYTDEVVSLYLNKDDTKVIGRLLPT
FT                   NPFEVLKSENNKVLLKIDGYVNPKALSVIYFNDSQRIIVAAFSKNTKLNFSQRVAGKDG
FT                   KWDKVSLEIWADKKEFAKDNKEMLNRAKELFVNNCGICHAIHKEKEFTANAWPAIFRSM
FT                   ADRTGIDKKDRWLVIEYLQKNAKDFKTK"
FT   gene            complement(251189..251698)
FT                   /locus_tag="CJJ81176_0293"
FT   CDS_pept        complement(251189..251698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0293"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0293"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73059"
FT                   /db_xref="GOA:A0A0H3PBN5"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN5"
FT                   /protein_id="EAQ73059.1"
FT                   /translation="MHFTIFHIIAFIILLICFALICILIFLKVKQKEMALISYTIATIF
FT                   TALLIYSIFLTINQFTTQADLSKLTYTRDLRHESVIVSGKVQNLTKFEIRKCYLMLSIL
FT                   NQKQVGGEIFNDKNVRNAKMQNTSVSYTIEIIDTLPGNTYKEFRASVPFPPSFNNPEFY
FT                   HTLKCI"
FT   gene            complement(251698..252207)
FT                   /locus_tag="CJJ81176_0294"
FT   CDS_pept        complement(251698..252207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0294"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0294"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73108"
FT                   /db_xref="GOA:A0A0H3PAF6"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAF6"
FT                   /protein_id="EAQ73108.2"
FT                   /translation="MLFYTTHLYLVDYMLILLVFFLFTCVLLLCVFLRHRPIAALFIIA
FT                   FDIIICFLVYIYGYKLIDNEVRTRKTAITDQKMIQSSNDLIVDFNITNNSKNNFKECKI
FT                   TAKIFADKIPNDNIIEEYKKKFIPFRQKSREIKDLKKNATQVQRIAFENFNYENNYTIR
FT                   LVSECF"
FT   gene            complement(252241..253329)
FT                   /locus_tag="CJJ81176_0295"
FT   CDS_pept        complement(252241..253329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0295"
FT                   /product="SPFH domain / Band 7 family protein"
FT                   /note="identified by match to protein family HMM PF01145"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0295"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73196"
FT                   /db_xref="GOA:A0A0H3PBT4"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBT4"
FT                   /protein_id="EAQ73196.1"
FT                   /translation="MPADLNDYFNKKNGNSNNNGNNNRQNFNFKAPEFNFKGFGKFSPF
FT                   VYGVIIIILFLIVAKPFMVINSGEMGIKSTTGKYDPNPLEPGLHFFLPFVQKITIIDTR
FT                   VRQINYASIEGSNENLSSGSGVINKNSISVLDSRGLPVSIDVTVQYRLNPLQVPQTIAT
FT                   WSLNWENKIIDPVVRDVVRSVVGKYTAEELPTNRNTIAAQIEEGIRKTIEAQPNEPVEL
FT                   RAVQLREIILPSKVKEQIERVQIAKQEAERTKYEVERANQEALKKAALAEGEANATIIS
FT                   AKGKAMAVKIEADAQAYSNKEIANSLNTPLLNLKQIETQKEFNEALKVNQDAKIFLTPG
FT                   GAVPNIWVDTKDAKKQSAANMN"
FT   gene            complement(253342..254256)
FT                   /gene="ilvE"
FT                   /locus_tag="CJJ81176_0296"
FT   CDS_pept        complement(253342..254256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="CJJ81176_0296"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by match to protein family HMM PF01063;
FT                   match to protein family HMM TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0296"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73145"
FT                   /db_xref="GOA:A0A0H3PEK3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEK3"
FT                   /protein_id="EAQ73145.1"
FT                   /translation="MISADKIWMDGKLVDFKDATLHFLTHSLHYGNAVFEGTRAYKTDK
FT                   GLAIFRLEDHTKRLLESAKITLLNCPFSQKDLENAQIELLKANNFQSNVYIRPLIFLGD
FT                   GVMGLYHIKAPVRVGIAAWEWGAYLGEEGLEKGIKVKISSFARNSVKSCMGKAKASANY
FT                   LNSQIAKFEAIEAGYEEALMLDEEGFIAEGTGECFFIVKDGVLITPPNDFSLKSITQDT
FT                   VLKIAHDLGITVLRQRISRDEVYTADEAFFTGTAAEITPINNIDARIIGNGLRGSVTKK
FT                   LQDAYFDVVYGRNEKYASMLTYI"
FT   gene            254432..254638
FT                   /locus_tag="CJJ81176_0297"
FT   CDS_pept        254432..254638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0297"
FT                   /product="4-oxalocrotonate tautomerase family protein"
FT                   /note="identified by match to protein family HMM PF01361;
FT                   match to protein family HMM TIGR00013"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0297"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73280"
FT                   /db_xref="GOA:A0A0H3PAM5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAM5"
FT                   /protein_id="EAQ73280.1"
FT                   /translation="MPLVNIKLAKPSLSKEQKAELIADITELLSTKYNKSKERVVVVLE
FT                   DVENYDIGFGGESVEAIKAKANK"
FT   gene            254635..255090
FT                   /locus_tag="CJJ81176_0298"
FT   CDS_pept        254635..255090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0298"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0298"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73322"
FT                   /db_xref="GOA:A0A0H3PBY8"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBY8"
FT                   /protein_id="EAQ73322.1"
FT                   /translation="MSLNIGDKAPQFELLNQDGVKIALKDFIGKKVILYFYPKDNTPGC
FT                   TTEACDFSANYDKFGGKNAVIIGISPDSVTSHEKFISKFNLKHILLSDSEKEVAKAYRA
FT                   WGLKKNYGKEYEGIIRSTFVIDETGKIAQIYSNVRVKDHALKVLESL"
FT   gene            255090..256181
FT                   /locus_tag="CJJ81176_0299"
FT   CDS_pept        255090..256181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0299"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02677"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0299"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73382"
FT                   /db_xref="GOA:A0A0H3PC15"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC15"
FT                   /protein_id="EAQ73382.1"
FT                   /translation="MLVHICCSVDSHYFIEELRKTYPDEKIIGYFYDPNIHPLSEYELR
FT                   FLDVKRSCDKLGIKLYKGEYEYEKWLNAVRGYEDEPEKGARCEICFDVRMGSSVKFAAK
FT                   IGEKKLTTTLLTSPKKDLEQLKNALQKECEPYGVEFLAPDFRKNGGTQRQFALAKKEML
FT                   YHQNYCGCIYGLKKQKQDKNFIDELMSSVNKQILPASIEARIALYKKVVLWEKKGIKFE
FT                   ILREKFLNYRLLSALIKLDKKPVKSHILFYSHFKNAYTRFSLDEESLKQNLKEGFYRST
FT                   KDEMVFVEFWRFNAFFKNKWKNFEDFLKKPLSIQAEVRWRNQVFGAYNLSPVIILEEIF
FT                   PSRYEVIAKSEIYHDNQEVLAKI"
FT   gene            256276..256716
FT                   /gene="fabZ"
FT                   /locus_tag="CJJ81176_0300"
FT   CDS_pept        256276..256716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabZ"
FT                   /locus_tag="CJJ81176_0300"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /EC_number="4.2.1.-"
FT                   /note="identified by match to protein family HMM PF07977;
FT                   match to protein family HMM TIGR01750"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0300"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73095"
FT                   /db_xref="GOA:A1VXZ7"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="PDB:3D6X"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXZ7"
FT                   /protein_id="EAQ73095.1"
FT                   /translation="MIDVMQIQEILPHRYPFLLVDKITELKVKEVVLGYKNISISDHVF
FT                   MGHFPGHPIYPGVLILEGMAQTGGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPG
FT                   DRLDYEMSVVKNRGNMWIFKGQAFVDGNLVAEAELKAMIVDK"
FT   gene            256716..257507
FT                   /gene="lpxA"
FT                   /locus_tag="CJJ81176_0301"
FT   CDS_pept        256716..257507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxA"
FT                   /locus_tag="CJJ81176_0301"
FT                   /product="acyl-(acyl-carrier-protein)--UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /EC_number="2.3.1.129"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM TIGR01852"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0301"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73051"
FT                   /db_xref="GOA:A1VXZ8"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VXZ8"
FT                   /protein_id="EAQ73051.1"
FT                   /translation="MKKIHPSAVIEEGAQLGDDVVIEAYAYVGKDTKIGNDVVIKQGAR
FT                   ILSDTTIGDHSRVFSYAIVGDIPQDISYKEEQKSGVVIGKNATIREFATINSGTAKGDG
FT                   FTRIGDNAFIMAYCHIAHDCLLGNNIILANNATLAGHVELGDFTVVGGLTPIHQFVKVG
FT                   EGCMIAGASALSQDIVPFCLAEGNRASIRSLNLVGTRRRFDKDEVDRLSRAFKTLFRQG
FT                   DLKENAKNLLENQESENVKKMCHFILETKRGIPVYRGKNNA"
FT   gene            257500..258723
FT                   /gene="clpX"
FT                   /locus_tag="CJJ81176_0302"
FT   CDS_pept        257500..258723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="CJJ81176_0302"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF06689; match to protein
FT                   family HMM PF07724; match to protein family HMM TIGR00382"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0302"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72983"
FT                   /db_xref="GOA:A0A0H3PIS8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIS8"
FT                   /protein_id="EAQ72983.1"
FT                   /translation="MPRKCSFCNEVENPQRRILANENDDAFICEYCVEGAYSIIYGEEK
FT                   EFKEPKQSHNTEFKDITPKELKAYLDRYVIGQDRAKKVFSVGVYNHYKRLFKAELQDDD
FT                   TELFKSNILLVGPTGSGKTLLAQTLAKFLDVPIAICDATSLTEAGYVGEDVENILTRLL
FT                   QAADGDVQRAQKGIVFIDEIDKIARMSENRSITRDVSGEGVQQALLKIIEGSLVNIPPK
FT                   GGRKHPNQEFIQIDTSNILFVCGGAFDGLETILKRKLGDKVVGFFDDAKEENKALLEKI
FT                   EPDDLVHFGLIPELIGRLHVIASLNELNEEDMVRILTEPKNAIIKQYQKLFAIDGVNLK
FT                   FEEDALRAIAQLALERKTGARGLRSIIEEMMVDLMFELPEYKNYDIVITKEVVKDNAKA
FT                   LLIKRKIS"
FT   gene            258734..259774
FT                   /gene="mreB"
FT                   /locus_tag="CJJ81176_0303"
FT   CDS_pept        258734..259774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="CJJ81176_0303"
FT                   /product="cell shape-determining protein MreB"
FT                   /note="identified by match to protein family HMM PF02491;
FT                   match to protein family HMM PF06723; match to protein
FT                   family HMM TIGR00904"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0303"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73273"
FT                   /db_xref="GOA:A0A0H3PAM2"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAM2"
FT                   /protein_id="EAQ73273.1"
FT                   /translation="MILDQLIGFFSSDMGIDLGTANTLVLVKDKGIVINEPSVVAVERE
FT                   RYGSKAKILAVGKEAKDMVGKTPGNIEAIRPMKDGVIADFDMTEKMIRYFIEKTHRRKS
FT                   FLRPRIIISVPYGLTQVERKAVRESALSAGAREVFLIEEPMAAAIGASLPIQEPKGNLV
FT                   VDIGGGTTEIGVISLGGLVISKSIRTAGDKLDMSIVNYVKEKYNLIIGERTGEEIKITI
FT                   GSAIQLPKELSMVVKGRDQVSGLLSRIELTSEDVREAMREYLKEIADALKMVLEMMPPD
FT                   LASDIVENGVVLTGGGALIRGFDKYLSEIVRLPVYIADEPLLAVAKGTGKALEEISLLQ
FT                   QLTNEE"
FT   gene            259803..260513
FT                   /locus_tag="CJJ81176_0304"
FT   CDS_pept        259803..260513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0304"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="identified by match to protein family HMM PF04085"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0304"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73088"
FT                   /db_xref="GOA:A0A0H3PIX8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIX8"
FT                   /protein_id="EAQ73088.1"
FT                   /translation="MVFISFYYGGLIKQNVLRVNDFVIGNFYNIKDYLGKKISEHFNQA
FT                   NQIQQLKARNKELEDIAVKVTSFANQLNRILEDQNSTKYLPQVSLTRVISYVQLNDYKK
FT                   LWLDWSKIPVGKNRGLIYQGYAAGIAINKNGRAMALLQGDDQCVFSVYIGKSKAPGLIQ
FT                   GEDGRIVVKFIPKWAKINTGDEILTSGLDNIFFSDIPVGIVNRVNDEDMYQSVEVKPYV
FT                   KISIPAYLYVVDNL"
FT   gene            260774..264043
FT                   /gene="carB"
FT                   /locus_tag="CJJ81176_0305"
FT   CDS_pept        260774..264043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="CJJ81176_0305"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF02142; match to protein
FT                   family HMM PF02222; match to protein family HMM PF02655;
FT                   match to protein family HMM PF02786; match to protein
FT                   family HMM PF02787; match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0305"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73406"
FT                   /db_xref="GOA:A0A0H3PJH5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJH5"
FT                   /protein_id="EAQ73406.1"
FT                   /translation="MPKRTDIKSILLIGSGPIVIGQACEFDYSGTQAAKTLKELGYRVV
FT                   LINSNPATIMTDPEFADATYIEPITKESILSIIKKEKIDAILPTMGGQVALNVAMEVYE
FT                   SGLLGDVKFLGANPEAIKKGEDRQVFKECMKKIGMDLPKSMYAYNYDEALKAADEIGFP
FT                   LMIRASYTLGGAGSGVVYNMDEFKELANTALALSPIHEILIEESLLGWKEYEMEVIRDR
FT                   ADNCIIVCSIENIDPMGVHTGDSITIAPALTLTDKEYQVMRNASFAILREIGVDTGGSN
FT                   VQFAINSKNGRMIVIEMNPRVSRSSALASKATGYPIAKVATLLAVGFSLDEIKNDITGT
FT                   PASFEPVIDYIVTKIPRFTFEKFPGANTTLGTAMKSVGEVMAIGRTFKESIQKALCSLE
FT                   RSLSGFDRVKFEDRNDLVFKIRNANEKRLLYVAQAFREGFSVEELYELCKIDPWFLTQI
FT                   KEIVDFEEQIDMDILNNKALLRKAKTMGFSDKMIALLVNLKDNLELSQNDIYYARMKQK
FT                   IIAEFSEVDTCAGEFEALTPYLYSSINVSELTQSKNDAKDKKEKKVMIIGGGPNRIGQG
FT                   IEFDYACVHASFALKDMGIKTIMYNCNPETVSTDYDTSDILYFEPIDFEHLRAVIEREK
FT                   PDGVIVHFGGQTPLKFAKRLSAFGAKIIGTSARVIDVAEDRKKFAEFITKLGINQPKNS
FT                   TATSVEEAVLKASDIGYPVLVRPSYVLGGRAMRVVNDEAELRLYMQEAVDVSDKSPVLI
FT                   DQFLDNATEIDVDAICDGKDVYVAGIMEHIEEAGIHSGDSACSLPPCNIDEKMQEFIAQ
FT                   KTADIALNLGVVGLLNIQFALHNNELYMIEVNPRASRTVPFVSKATGIPLAKVATRVMW
FT                   QGNLKEALKFYDTFKVVNFDTKILRPKTPKYMSVKEAVFPFAKLSGSDLELGPEMRSTG
FT                   EVMGISKDFANSYAKSQIASFNHLPEQGVVFISLKDKDKKYTKKIAAEYVKLGFKLMAT
FT                   GGTCKEILESGFECELVHKISEGRPNVEDKLKNGEIHLVINTSDSHSFKGDTKKIRENI
FT                   IRFKIPYFTNLRSALAGAKSIKAIQSKSCLDVKSLQEWLKS"
FT   gene            264040..264462
FT                   /locus_tag="CJJ81176_0306"
FT   CDS_pept        264040..264462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0306"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73237"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ75"
FT                   /protein_id="EAQ73237.1"
FT                   /translation="MIYLAQTDTTVGFLSKNLEEINALKGRDKNQPCLITSAKFCELKS
FT                   LARIPKSFKNLVRRSKKTTFIYPNNQAIRIVKECKHANFLSKNGYFYSSSANKHGKEFD
FT                   EEWARSVADIILDEKFFENIPSKILKLSKNKMIKIR"
FT   gene            complement(264463..265440)
FT                   /gene="tal"
FT                   /locus_tag="CJJ81176_0307"
FT   CDS_pept        complement(264463..265440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="CJJ81176_0307"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="identified by match to protein family HMM PF00923;
FT                   match to protein family HMM TIGR00876"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0307"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73014"
FT                   /db_xref="GOA:A1VY04"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY04"
FT                   /protein_id="EAQ73014.1"
FT                   /translation="MKNFSLWCDFIENSFLDNEFLNLLSHGINGATSNPAIFKNAILNS
FT                   PIYKDKILKLKGKKTKDIYEELAISDIQKAADKLAPLFYQKNDGFISIEIDPRLHDNTT
FT                   LSLGEAKRLYSAISKENVMIKIPATKASYEVMYELMKNGISVNATLIFSLEQSQKCFEA
FT                   LNAGLVEFRKNNIALKEQNTRTPQAVISIFVSRFDRLLNPKAKEQNRIGILNANLAYNN
FT                   IYSKNEPNIRALFASTGVKGDDLPKDYYIKELLFENSVNTAPLDAIEAFKGKMHFKKPL
FT                   MNFEIYTELNQIISQSEREKACNDLLSDGLEQFCIAFEDILKAL"
FT   gene            complement(265440..266063)
FT                   /gene="serB"
FT                   /locus_tag="CJJ81176_0308"
FT   CDS_pept        complement(265440..266063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serB"
FT                   /locus_tag="CJJ81176_0308"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="identified by match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR00338; match to protein
FT                   family HMM TIGR01488"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0308"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73373"
FT                   /db_xref="GOA:A0A0H3PBI8"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBI8"
FT                   /protein_id="EAQ73373.1"
FT                   /translation="MIKLCVFDFDATLMDGETIDILATAHGKGNQTSEITRHAMAGELD
FT                   FFESLQKRVSLLKGMSYKKVLELGSTLPLMHGAHELIQYLKSKNIQIVIFSGGFHEGID
FT                   PAMQKLGISLGFANYLHHKNDILTGLVGGEMMFSNSKGLMLQRLKSFLNLKTDEVMCVG
FT                   DGANDLTMFNESGLKIAFCAKEILRSKADICIDIKDLKEIIKVI"
FT   gene            complement(266063..266584)
FT                   /gene="cheW"
FT                   /locus_tag="CJJ81176_0309"
FT   CDS_pept        complement(266063..266584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="CJJ81176_0309"
FT                   /product="purine-binding chemotaxis protein CheW"
FT                   /note="identified by match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0309"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73133"
FT                   /db_xref="GOA:A0A0H3PAG7"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAG7"
FT                   /protein_id="EAQ73133.1"
FT                   /translation="MSNEKLEQILQKQQTQMAGPDVDQREDDIIQLVGFVVGDEEYAIP
FT                   ILNIQEIIKPIEYTRVPSVPDYVLGVFNMRGNVMPLIDLAQRFHLGSSKMTPQTRYIVL
FT                   RGETNGTGVGGNAGFVIDRLTEAIKIHRNRIDPPPETLVKDKGMIYGIGKRDENILTIL
FT                   KVEALLKREF"
FT   gene            complement(266589..268898)
FT                   /gene="cheA"
FT                   /locus_tag="CJJ81176_0310"
FT   CDS_pept        complement(266589..268898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="CJJ81176_0310"
FT                   /product="chemotaxis protein CheA"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584; match to protein
FT                   family HMM PF01627; match to protein family HMM PF02518;
FT                   match to protein family HMM PF02895"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0310"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73265"
FT                   /db_xref="GOA:A0A0H3PAM0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAM0"
FT                   /protein_id="EAQ73265.1"
FT                   /translation="MEDMQEILEDFLVEAFELVEQIDHDLVELESNPEDLDLLNRIFRV
FT                   AHTVKGSSSFLNFDVLTKLTHHMEDVLNKARHGELKITPDIMDVVLESIDRMKTLLNSI
FT                   RDNGNDTAIGMDIEPICARLTAISEGESPVAATDSNEKSTPQAEPEAPKQETTTPEPEV
FT                   DVNQLSDSEVEAEIERLLKVRKAEDQARRAQKKQTTNAAPKPTNNTANKPAESGEKKVP
FT                   ASGSNTSSMDQTIRVEVKRLDHLMNLIGELVLGKNRLLKIYDDVEERYEGEKFLEELNQ
FT                   VVSQLSIITTDVQLAVMKTRMQPIAKVFNKFPRVVRDLSRELGKQIELEITGEETELDK
FT                   SIVEEIGDPIMHMIRNSCDHGVEDPATRAANGKPEKGIVQLKAYNEGNHIVVEITDDGK
FT                   GLDPNGLKAKAIEKNLITEREADQMTDKEAFALIFKPGFSTAAKVTNVSGRGVGMDVVK
FT                   TNIEKLNGVIEIDSELGKGSSFKLKIPLTLAIIQSLLVGTQEEFYAIPLASVLETVRVP
FT                   IDDIYTIEGKNVLRLRDEVLSLVRLSDVFGVKQVLESGDQTYVVVIGVAESKLGIIVDT
FT                   LVGQEEIVIKSMGDYLQNIQGIAGATIRGDGRVTLIIDVGAMMDMAKEIKVDIKAQLES
FT                   SAKKPKEQPSDYKVLIVDDSKMDRTLMQKALEPLGVSLVEATNGVEALNIIKSGEHDID
FT                   AMLIDIEMPRMDGYTLAGEIRKYSKYRNLPLIAVTSRTSKTDRLRGVEVGMTEYITKPY
FT                   SPEYLENVVRKNLKLG"
FT   gene            complement(268902..269858)
FT                   /gene="cheV"
FT                   /locus_tag="CJJ81176_0311"
FT   CDS_pept        complement(268902..269858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheV"
FT                   /locus_tag="CJJ81176_0311"
FT                   /product="chemotaxis protein CheV"
FT                   /EC_number="2.7.3.-"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF01584"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0311"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73267"
FT                   /db_xref="GOA:A0A0H3PBE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024181"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBE4"
FT                   /protein_id="EAQ73267.1"
FT                   /translation="MFDENIVKTGSNEMELVDFRIFKQGHDKVYEGIYGVNVSKVREII
FT                   KIPSLTELPGVPDYIEGIFDLRGVVIPVVNLAKWMQITEPESTMLKPRVIITEFSNILI
FT                   GFIVHEAKRIRRINWKDIEPATFSTGSGALDKGKITGVTRIENDEVLLILDLESVVEDL
FT                   GIYAPKTDIDFGKIEKFTGTALILDDSMTARKRVKEMMQQMGFQVVEAKDGVEGINKLE
FT                   ELSQVYGESLNDTLKIIVSDVEMPQMDGFHFAARIKEDPRFKDIPIVFNSSLSNEFMNE
FT                   KGVQEAGGEGYLVKFNASDFFNEIAKVIKKHQSQEQG"
FT   gene            complement(269851..270486)
FT                   /locus_tag="CJJ81176_0312"
FT   CDS_pept        complement(269851..270486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0312"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0312"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73170"
FT                   /db_xref="GOA:A0A0H3PAI0"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAI0"
FT                   /protein_id="EAQ73170.1"
FT                   /translation="MGDIFDLLIGEISATHEFAKPYIELLEELALKIEIIYLEGNHDFN
FT                   LSCFFKRVKIFNLQEQPIKLNLHTSKGNNLVLNNAFIKLAHGDIFLPPLLQFTLKTLRN
FT                   HYLLIFLNFLNIITCNFISNKILQNQNKKNLFYQIKDFENLAKKRYERYENLGFWVCEG
FT                   HYHQNHQINKENIKYLNLASFAYERSFFVVEYQQEIKFREQKLRGQNV"
FT   gene            complement(270619..271104)
FT                   /gene="greA"
FT                   /locus_tag="CJJ81176_0313"
FT   CDS_pept        complement(270619..271104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="CJJ81176_0313"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by match to protein family HMM PF01272;
FT                   match to protein family HMM PF03449; match to protein
FT                   family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0313"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73139"
FT                   /db_xref="GOA:A1VY10"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY10"
FT                   /protein_id="EAQ73139.1"
FT                   /translation="MQKEPMSQFGYDKLAAELKDLKDNQRPAVVIEIDTARSHGDLKEN
FT                   AEYHAAREKQALIESRIAELSDLLARAQVIDPSSYEHDSVKFGSSVVIIDLDTEKESKY
FT                   TLVGICEGDLDKGYISIASPIAKAMLGKKEGDDFKVRLPKGESEFEILSINYEPLKF"
FT   gene            complement(271116..272210)
FT                   /gene="lpxB"
FT                   /locus_tag="CJJ81176_0314"
FT   CDS_pept        complement(271116..272210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxB"
FT                   /locus_tag="CJJ81176_0314"
FT                   /product="lipid-A-disaccharide synthetase"
FT                   /EC_number="2.4.1.182"
FT                   /note="identified by match to protein family HMM PF02684;
FT                   match to protein family HMM TIGR00215"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0314"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73067"
FT                   /db_xref="GOA:A0A0H3PEG0"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEG0"
FT                   /protein_id="EAQ73067.1"
FT                   /translation="MKTFLVCALEPSANLHLKEVLKAYKKDFGEFELHGIYDESLCKEF
FT                   DLNSKPLYSSHEFSAMGFIEVLPLIFKAKKAIKELINLSFAQKINGILCIDSPAFNIPF
FT                   AKALKKAGSKIPRIYYILPQVWAWKKGRIPIIESHFDILASILPFDNQFFNKSTYVGHP
FT                   LLDEIKEFKNQEDINHTFSKKDDEKTIAFLPGSRRSEIRRLMPIFKELSQKFKGEKILC
FT                   VPSFNLEKLEIYGDISEFKIESNTPKVLKKADFAFICSGTATLEAALVGTPFVLTYKAK
FT                   AIDIFIAKLFVKLKHIGLANIFCDFAKKEALNPEFLQDKVNVLNLYEAYNKYDYKAFFA
FT                   KVDFLKEYLQFGSAKNLAKILSEI"
FT   gene            complement(272307..273059)
FT                   /locus_tag="CJJ81176_0315"
FT   CDS_pept        complement(272307..273059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0315"
FT                   /product="major antigenic peptide PEB3"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0315"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73032"
FT                   /db_xref="GOA:A0A0H3PED8"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PED8"
FT                   /protein_id="EAQ73032.1"
FT                   /translation="MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIASKYSEKT
FT                   GVKVNVNFGPQATWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIKPLYFREAII
FT                   LTQKGNPLKIKGLKDLANKKVRIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNN
FT                   IVAFVPNSGSARKLFAQDQADAWITWIDWSKSNPDIGTAVAIEKDLVVYRTFNVVAKEG
FT                   ASKETQDFIAYLSSKEAKEIFKKYGWRE"
FT   gene            complement(273323..274219)
FT                   /locus_tag="CJJ81176_0316"
FT   CDS_pept        complement(273323..274219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0316"
FT                   /product="glycerol-3-phosphate transporter, authentic
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0316"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73452"
FT                   /db_xref="GOA:A0A0H3PAW8"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAW8"
FT                   /protein_id="EAQ73452.1"
FT                   /translation="MRTWSLSGVFIGYMGYYLVRNNITLANWYPKKERGIYTAVWNISH
FT                   NIGGGIVAPIVSLSGFALAALLGVSMANFNETYWHMNHFYTPAACAVIISLYALYAVKG
FT                   NPKNEGLVDITEINEMRGIKTEEIKAIETPNLSSFEIFYHYVLKNKNAWYVAWMDTFVY
FT                   MVRFGLISWLPIYLLETKGFNKEQIGIAFWLFEWAAIPSTLLAGYISDKIFKGYRMPPA
FT                   IGAIVIIFFMIIGYFTSNNLYMVIFFAAMAGCLVYIPQFLASMQTMEVVPAFAVESCVG
FT                   LHGFMSYVVGASLGTKA"
FT   gene            274474..275250
FT                   /gene="surE"
FT                   /locus_tag="CJJ81176_0317"
FT   CDS_pept        274474..275250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="surE"
FT                   /locus_tag="CJJ81176_0317"
FT                   /product="acid phosphatase SurE"
FT                   /EC_number="3.1.3.2"
FT                   /note="identified by match to protein family HMM PF01975;
FT                   match to protein family HMM TIGR00087"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0317"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73372"
FT                   /db_xref="GOA:A1VY14"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY14"
FT                   /protein_id="EAQ73372.1"
FT                   /translation="MKEILITNDDGYESEGLKKLIKMLTKEFKAKITIVAPASEKSACS
FT                   HSITLTKPLRFVKVGKRFYKLDDGTPADCVYLALHALYKKRLPDLVISGINKGANVGED
FT                   ITYSGTCAGAMEAVLQGIPAIALSQFYKKSEKELDYKNALQITKKIIQNIFDKGFPLEK
FT                   KEFLNINFPAKSKIKGIKICKAGKRVYNFEAYSNVNPRGVEYYWLAAANLDFEDEKNSD
FT                   IALLKKGYATITPIMLDLTAYERMKKVKKWLKANDE"
FT   gene            275240..275893
FT                   /locus_tag="CJJ81176_0318"
FT   CDS_pept        275240..275893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0318"
FT                   /product="thiF family protein"
FT                   /note="identified by match to protein family HMM PF00899"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0318"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73307"
FT                   /db_xref="GOA:A0A0H3PBY2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBY2"
FT                   /protein_id="EAQ73307.2"
FT                   /translation="MMNDRFTRIKWLVGEEKFQKISQTKVLVCGLGGVGGICVDALYRS
FT                   GFQNLTLIDADKFEITNQNRQIHSENLGEEKAKVFARIYNVKGIVSKIDNEFLANFDLS
FT                   EFDLIIDAIDDIPAKVALANLIDFKRQIFISSTGGARKLDPTRIKTTSIFKTHGDALAK
FT                   KFRYELRKSGFKGNFDVVFSDEEAHCKDLGSFMGVTASFGLALASLALRKVLAR"
FT   gene            complement(275968..276348)
FT                   /gene="panD"
FT                   /locus_tag="CJJ81176_0319"
FT   CDS_pept        complement(275968..276348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panD"
FT                   /locus_tag="CJJ81176_0319"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="identified by match to protein family HMM PF02261;
FT                   match to protein family HMM TIGR00223"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0319"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73317"
FT                   /db_xref="GOA:Q29W39"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29W39"
FT                   /protein_id="EAQ73317.1"
FT                   /translation="MNITLLKSKIHRANVTEARLDYVGSISIDEKLLQASGILEYEKVQ
FT                   VVNVNNGARFETYTIATQEEGVVCLNGAAARLAEVGDKVIIMSYADFNEEEAKTFKPKV
FT                   VFVDENNTATKITNYEKHGAIF"
FT   gene            complement(276345..277193)
FT                   /gene="panC"
FT                   /locus_tag="CJJ81176_0320"
FT   CDS_pept        complement(276345..277193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="CJJ81176_0320"
FT                   /product="pantoate--beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="identified by match to protein family HMM PF02569;
FT                   match to protein family HMM TIGR00018"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0320"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73441"
FT                   /db_xref="GOA:A1VY17"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY17"
FT                   /protein_id="EAQ73441.1"
FT                   /translation="MQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKNAK
FT                   TQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDAAQMYLKNFST
FT                   YVDMNTITDKLCGAKRLGHFRGVCTVLAKFFNILNPDIVYMGQKDAQQCVVVRHMVDDL
FT                   NFDLKIQICPIIREEDGLAKSSRNVYLSEEERKASLAISQSIFLAEKLVQEGEKDTSKI
FT                   IQAMKDILEKEKLIKIDYIELVDFNTMENIKNIADNVLGAVAAFVGKTRLIDNFLVQGL
FT                   K"
FT   gene            complement(277204..278028)
FT                   /gene="panB"
FT                   /locus_tag="CJJ81176_0321"
FT   CDS_pept        complement(277204..278028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panB"
FT                   /locus_tag="CJJ81176_0321"
FT                   /product="3-methyl-2-oxobutanoate hydroxymethyltransferase"
FT                   /EC_number="2.1.2.11"
FT                   /note="identified by match to protein family HMM PF02548;
FT                   match to protein family HMM TIGR00222"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0321"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73429"
FT                   /db_xref="GOA:Q29W37"
FT                   /db_xref="InterPro:IPR003700"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29W37"
FT                   /protein_id="EAQ73429.1"
FT                   /translation="MRKSMISFLEKKAKNEKITMVSAYDYHSAKILDNCDIDIILVGDS
FT                   LAMTVLGMQDTLSVTMDEMLIFTKAVSRGAKKSFVLADMPFMSYQSSDRDAILNASRFI
FT                   KESHANGVKVEGGIEIASKIKLISQSGIPVVAHLGLTPQAVNMLGGYRVQGKDLQSAQK
FT                   IIDDAKAVQDAGACMLVVECVPVKLAQKISSILEIPTIGIGSGKYCDGQVLVYHDLLGL
FT                   NKDFKAKFVKHFDKIDPQVGVEKYRDEVKSGIFPSQEHSFDYLDDELLDKLY"
FT   gene            complement(278185..279075)
FT                   /gene="modC"
FT                   /locus_tag="CJJ81176_0322"
FT   CDS_pept        complement(278185..279075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modC"
FT                   /locus_tag="CJJ81176_0322"
FT                   /product="molybdenum ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.29"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0322"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73357"
FT                   /db_xref="GOA:Q29W36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W36"
FT                   /protein_id="EAQ73357.1"
FT                   /translation="MIKIDIKLPINTAKGKKQLELNTCLKANEITAIFGESGAGKTTLL
FT                   KIIAGLIKPEFGRIEVGDELWLDTQKNINLAIQKRKIGFVFQDYALFPNMSVKENISYA
FT                   ATSKQKVEELLSLMNLENLAKIYPKNLSGGQAQRVALARALAREPQILLLDEPLSALDF
FT                   KMRSFLQDELVKILQHFKITTLLVSHDLAEIYKLSHRILELSDGKIIKDARTNEFFTSS
FT                   NLSAKLRLSATLLEIKKSDILMIFTLLLNQDIVKITLSEEEFLRTYKNVKIGDTLLLSI
FT                   KAFNPIIVGKLDKQK"
FT   gene            complement(279085..279753)
FT                   /gene="modB"
FT                   /locus_tag="CJJ81176_0323"
FT   CDS_pept        complement(279085..279753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modB"
FT                   /locus_tag="CJJ81176_0323"
FT                   /product="molybdenum ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02141"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0323"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72999"
FT                   /db_xref="GOA:Q29W35"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W35"
FT                   /protein_id="EAQ72999.1"
FT                   /translation="MDNDFLQTLYLTFKLAFITTFILFFIGVFLAYLLSFVKFPFKSLV
FT                   QTFVALPLVLPPSVLGFYLLISFSQNSFLGQFLKEYFNLSLVFSFEGLVFASLIFSLPF
FT                   MVNPLQSAFSSINQNLLDASYALGKGKIYTLFRVILPNSKVGIFSACAMSFAHTIGEFG
FT                   VVMMIGGHKKGETLVASIAIYDELEVLNYTLAHQYAFTLFAISFAILLSLYFVNKKIAL
FT                   "
FT   gene            complement(279746..280051)
FT                   /locus_tag="CJJ81176_0324"
FT   CDS_pept        complement(279746..280051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0324"
FT                   /product="TOBE domain protein"
FT                   /note="identified by match to protein family HMM PF03459"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0324"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73206"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEN9"
FT                   /protein_id="EAQ73206.2"
FT                   /translation="MLDLHSLQDLKIGTKIQVLFKEHELGFALPHSILSVENSFLARIK
FT                   SIKKGKILYHIFFDFEGDEISSIIAKEKALELKLEEGQEWLCFVKENDIILKAIYG"
FT   gene            complement(280144..280893)
FT                   /gene="modA"
FT                   /locus_tag="CJJ81176_0325"
FT   CDS_pept        complement(280144..280893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="CJJ81176_0325"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdenum-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01256"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0325"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73155"
FT                   /db_xref="GOA:A0A0H3PJ16"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ16"
FT                   /protein_id="EAQ73155.1"
FT                   /translation="MKKLVLIFIVLFLSLNLNAQNLSVFVASSASKAMEEVKNEFLKSH
FT                   PNDNIDLVFGASGKYYQLLKQGREFDLFFSADTKYAQAIYEDQNALDKPKVYVLGILAL
FT                   YSLDESLLEGGIEKLKDKANKIHHLSLANPKVAPYGVAAKEVLENLKLDKLFEDKIVLG
FT                   ENISVPVLHVDSNNADLGIVAYSLVSSINHPKGKAILIDQKYFTPLKQSYVITRYAKDK
FT                   KLAFEFSDFISSQKAKEIFKKYGFDTP"
FT   gene            complement(280947..281633)
FT                   /locus_tag="CJJ81176_0326"
FT   CDS_pept        complement(280947..281633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0326"
FT                   /product="biotin biosynthesis protein BioC"
FT                   /note="identified by match to protein family HMM TIGR02072"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0326"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73337"
FT                   /db_xref="GOA:A0A0H3PBZ4"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBZ4"
FT                   /protein_id="EAQ73337.1"
FT                   /translation="MNFLKAKDYQKHAKVQDLMGLKLCEILKNLEISHFKKVFEFGCGR
FT                   GEFSDKLSKIITFDEYLKNDILDYPDNLNVEIFDMNTLATQILSKQKFDLITSNASLQW
FT                   LDLKQVLPTLANMLNEKGILLLSTFGKMNLKEIKQSTGLGLKYFSTKELEQIFKPYFSD
FT                   IKITEEIVNLEFQNALEVFKHLKLSGVNSLGFYRLNKQFLKEFEEKFQNKLTYHPIFIL
FT                   CKKDTK"
FT   gene            complement(281630..282241)
FT                   /locus_tag="CJJ81176_0327"
FT   CDS_pept        complement(281630..282241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0327"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04301"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0327"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73418"
FT                   /db_xref="InterPro:IPR007398"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC30"
FT                   /protein_id="EAQ73418.1"
FT                   /translation="MKISNLIQNENSQELILVFGGFASHPSHFAHLKSDKNVVLVYDYE
FT                   NLDFKFDLKSFSKITLIAFSMGVCVASRVLKDIEFSQKIAINGTPFGIDKLKGIHPAIF
FT                   AKQIKKFDLTAFKKSLFKERKNEAKNFIFKDEKDLKTELEKLFEFASKECNENFIWDKI
FT                   YSSNNDEIFPQNALKNTFSKLIFLNEPHFAFFHFKTWDEI"
FT   gene            complement(282238..283380)
FT                   /gene="bioF"
FT                   /locus_tag="CJJ81176_0328"
FT   CDS_pept        complement(282238..283380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="CJJ81176_0328"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0328"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73377"
FT                   /db_xref="GOA:A0A0H3PAS7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAS7"
FT                   /protein_id="EAQ73377.1"
FT                   /translation="MSLENILEALEKNHNLRKLTSLKHEGNFVFKEGKKLLNLAGNDYL
FT                   NLSSCKSLKDEFLDNVKEQDLFFSSSSSRSLSGNFTIYEELESFLKSKFKEKEILHFNS
FT                   GYHLNISCIAALVSIPNTLFLADKFIHASMIDGLKLGGAKFFRFHHNDMNHLENLIQKH
FT                   YDHYENIIILSEALFSMDGDFSDFNTLIAFKEKYPKIKLYIDEAHSVGCFDEEGLGLVK
FT                   ALNLEEKVDFIVFTFGKALASMGACMICNNLYKSFFINKARAFIYSTALPPINIAWTKF
FT                   IFEKMSELKEKREKLQIIGNFFKNQLIEKNHQILGDAYIISLVLGENQKTIELAKKLET
FT                   NGIFAPAIKEPTVPKNTARIRFSLHAGLSKEDLKKVIELL"
FT   gene            283447..284730
FT                   /gene="bioA"
FT                   /locus_tag="CJJ81176_0329"
FT   CDS_pept        283447..284730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="CJJ81176_0329"
FT                   /product="adenosylmethionine--8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.62"
FT                   /note="identified by match to protein family HMM PF00202;
FT                   match to protein family HMM TIGR00508"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0329"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73228"
FT                   /db_xref="GOA:A0A0H3PBD0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBD0"
FT                   /protein_id="EAQ73228.1"
FT                   /translation="MQNEILKKLDLEHIWHPCTQMKDHENLPLIPIKRAKGVWLYDFDD
FT                   KAYMDCVSSWWVNLFGHCNEKIANAIKKQVDELEHVILAGFTHEPIIKLSARLCEKVGR
FT                   NFNKCFYADNGSSAIEVALKMSFHYHLNKGVKKSKFLSLSNSYHGETLGALSVGDVALY
FT                   KDTYKPLLLECLSTPVPQSKDYTQELEILKDILEKNASEICAFILEPLVQCAGNMHMYE
FT                   AGFIDEAIKLCHKFGVQVIFDEIAVGFGRTGTLFALHQCKQSPDFICLSKGITGGFMPL
FT                   SVVLTRDEIYNAFYDTYESQKAFLHSHSYTGNTLACAAANAVLDIFEDENILVKNQILS
FT                   EFIKKEFSRLEKFDFLGNFRTCGMISAFDILSTKYKRVGLFVFQKALEKGLLLRPLANT
FT                   IYFMPPYIITKEQIVYVLESLEQIFKEF"
FT   gene            complement(284717..285322)
FT                   /gene="bioD"
FT                   /locus_tag="CJJ81176_0330"
FT   CDS_pept        complement(284717..285322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="CJJ81176_0330"
FT                   /product="dethiobiotin synthetase"
FT                   /EC_number="6.3.3.3"
FT                   /note="identified by match to protein family HMM TIGR00347"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0330"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73363"
FT                   /db_xref="GOA:A1VY27"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY27"
FT                   /protein_id="EAQ73363.1"
FT                   /translation="MQIYVSGIHTDVGKTHFSAAFCANFNYDYFKLIQAGTPTDSEFIA
FT                   KFSPKTKIFKEGIFLQTPASPHLGKIKEKLDYKALDIILPKSKNLLIELAGGLFSPMDE
FT                   NYTMIDFVNIFKHPTILVAKYYLGSINHILLSIEALKQRNINLLALVMMGKKDILQDDF
FT                   IKNYAKIPIINLDFFDENSILNKDFKEQMQEILQLKIP"
FT   gene            complement(285332..285646)
FT                   /locus_tag="CJJ81176_0331"
FT   CDS_pept        complement(285332..285646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0331"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0331"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73052"
FT                   /db_xref="GOA:A0A0H3PB00"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB00"
FT                   /protein_id="EAQ73052.1"
FT                   /translation="MEWFYLFLATACEIFGVVIMKELISTKNKLYLLALIVCFGFSFTF
FT                   LSLSMQNIAMSVAYAIWTGAGTAGGVMIGVLFYKESKSFLKLFLIAVIITCTAGLKFLS
FT                   "
FT   gene            complement(285650..285988)
FT                   /locus_tag="CJJ81176_0332"
FT   CDS_pept        complement(285650..285988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0332"
FT                   /product="multidrug resistance protein, SMR family"
FT                   /note="identified by match to protein family HMM PF00893"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0332"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73468"
FT                   /db_xref="GOA:A0A0H3PC51"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC51"
FT                   /protein_id="EAQ73468.1"
FT                   /translation="MNEKFNINIAWFLIILGGIIECFWVSGLKYSTEIWQYILTAIGVC
FT                   ISFTCFLKACERLEVSITYSVFVGIGTIGVVLNEMFIFNEAVSIIKLVLIAILLLSIIA
FT                   LKWVSKEA"
FT   gene            286122..286658
FT                   /gene="rplY"
FT                   /locus_tag="CJJ81176_0333"
FT   CDS_pept        286122..286658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplY"
FT                   /locus_tag="CJJ81176_0333"
FT                   /product="ribosomal protein L25"
FT                   /note="identified by match to protein family HMM PF01386;
FT                   match to protein family HMM TIGR00731"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0333"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73186"
FT                   /db_xref="GOA:A1VY30"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY30"
FT                   /protein_id="EAQ73186.1"
FT                   /translation="MLEGIVRESIGRKAAKALKRDGYLIANIYGKGLENINAAFKVNEF
FT                   IKEVRKKTTLIFDVKVGSQTLSVVVVDYQKDSVTAELKHVDLKVAQKGVISKYMVPVKI
FT                   TGTAIGLKNKGVLIQSKRRLKVKCAAENLPNFFELDVSKLDVGDALLVRDIVVPAGVTM
FT                   IDADRVAVVGVEKAR"
FT   gene            286655..287200
FT                   /gene="pth"
FT                   /locus_tag="CJJ81176_0334"
FT   CDS_pept        286655..287200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="CJJ81176_0334"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="identified by match to protein family HMM PF01195;
FT                   match to protein family HMM TIGR00447"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0334"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73144"
FT                   /db_xref="GOA:A1VY31"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY31"
FT                   /protein_id="EAQ73144.1"
FT                   /translation="MILVVGLGNIGVEYENTRHNVGFMLIDLLLKESNFTNLTNSKFKG
FT                   ELFKIGSSLLLLKPSTYMNNSGLSVKAVNDFYKCERMIVIHDDIDINLGALRFKKGGSS
FT                   GGHNGLKSIDTLCGNDYERVRIGVGKGENVISHVLGKFKSEEEITLSKVLEHTKKALLE
FT                   LIENDDLSAISSKYSLKA"
FT   gene            287202..288260
FT                   /locus_tag="CJJ81176_0335"
FT   CDS_pept        287202..288260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0335"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03739"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0335"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73214"
FT                   /db_xref="GOA:A0A0H3PBU0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBU0"
FT                   /protein_id="EAQ73214.1"
FT                   /translation="MWIFFRFISGIYLKNFFIIFFSLLGFYCGIDLLLNFKDLPKAANL
FT                   DLLYVMFLSFSAVPYVLPISLIFALVVSLISMIRANEFVSLYALGLSRNYVILFPFLWA
FT                   LFFCCIYIGLNFTSFAYANDYKRNILKNGTIMNQSGEVFLKFNNNFVYISKINNGQNSA
FT                   QNIKIFNINDLNLSSFVSAKNAHFEGESWILRDGNITLLPKNYELANDGLKIQDFSELK
FT                   SLEGFKPKIIEGVASNSDYSISDALESFELFKAQNVNTDTLKINLYKFVFTPFFAPFLM
FT                   LIMYYFFPVIARFFNLAIVTFVTFVVTLMIWGVLFLLTRLSENSVIASEIGIVVPIIIL
FT                   GCLSAYMYYKHR"
FT   gene            288304..289512
FT                   /gene="lysA"
FT                   /locus_tag="CJJ81176_0336"
FT   CDS_pept        288304..289512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="CJJ81176_0336"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="identified by match to protein family HMM PF00278;
FT                   match to protein family HMM PF02784; match to protein
FT                   family HMM TIGR01048"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0336"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73268"
FT                   /db_xref="GOA:A0A0H3PJ93"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ93"
FT                   /protein_id="EAQ73268.1"
FT                   /translation="MDYKQLKQEFNTPFYIYNFDFIKERFLNLKEAFKARKSQIFYAVK
FT                   ANSNLSLLQMLANLDSGFDCVSIGEVKRALKAGAKAYKIIFSGVGKTKEELRQALEYDI
FT                   LYINLESEAEMMLLESVAKELNLKARISIRVNPNVDAKTHPYISTGLNENKFGVEIDIA
FT                   RKMYLYAKNSSFLEPVGVHFHIGSQLLDISPIHEAAGIVAKLVRELKALQIDLKFFDIG
FT                   GGLGVAYEKDECESDLYDYAQGILAQLHGLDLTIGMEPGRYLVAKSGEFVCSVLYEKQN
FT                   KTKRFVVVDGAMNDLIRPSLYEAYHEIILPYNQAQESLCDVVGGICESGDFFAKARSLP
FT                   STQSGDIMVIKNTGAYGFSMSSNYNTRNKVCELALEEGQVRLIRQRENFENQIALEEKF
FT                   LKA"
FT   gene            289514..290281
FT                   /locus_tag="CJJ81176_0337"
FT   CDS_pept        289514..290281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0337"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="identified by match to protein family HMM TIGR01460"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0337"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73345"
FT                   /db_xref="GOA:A0A0H3PAQ8"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAQ8"
FT                   /protein_id="EAQ73345.1"
FT                   /translation="MFFLDVQGTLISDHDKSLIHGAKELIDFLNAKNLPYVIITNNTKK
FT                   LDFLEKLQQKGLAIKENAYIDPFSVLKHLLKPCKVAAFGADEFVKSLENLGFELDFVNP
FT                   SAVLVASYDDFKFVDFASMIELARREVRFIAMHETSIYKKDGRPYPGVGSIMAMLKNAI
FT                   DFEYEVVGKPSIAFYKEALNLIRKQNSKIDFEDIKIISDDFRGDLLKAKELGMKTLLVL
FT                   SGKISDTKGLDTDLLDGVYPSVFEFLKELKCQI"
FT   gene            290269..291342
FT                   /gene="pheA"
FT                   /locus_tag="CJJ81176_0338"
FT   CDS_pept        290269..291342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="CJJ81176_0338"
FT                   /product="chorismate mutase/prephenate dehydratase"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01817; match to protein
FT                   family HMM TIGR01807"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0338"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73435"
FT                   /db_xref="GOA:A0A0H3PJJ8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJJ8"
FT                   /protein_id="EAQ73435.1"
FT                   /translation="MPNLEEFRNKIDAVDDKILELLNERMTYVKSIGELKQSSGGAIYR
FT                   PERERAIINRLKNANLGLLDQNAIEAIYQEIFAVSRNLEMPQTIAYLGPEGTYTHQAAR
FT                   SRFGAMSRYIALANIEDVFKELSNKEAKYGVVPIENNTEGAVGITLDCLGKYNELKIFG
FT                   EIYMDIHHSFAGINENLKEIKRIYSHPQGYNQCRKFLESHELSAIEFVPSKSTANAAYL
FT                   ASQDKYAAAICSKIAAKLYNVPVLFDKIEDNAANKTRFLILSDIKNPKMPNCKTSILAH
FT                   TAHKPGGLSFLLEQFKKENINLTKLESRPVKSKEFLHSFYIDFEGHIDDENVKKALKDI
FT                   QEIVWLGSYLSGEKDEI"
FT   gene            291332..292426
FT                   /gene="hisC"
FT                   /locus_tag="CJJ81176_0339"
FT   CDS_pept        291332..292426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="CJJ81176_0339"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0339"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73354"
FT                   /db_xref="GOA:A1VY36"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY36"
FT                   /protein_id="EAQ73354.1"
FT                   /translation="MKFNEFLNHLSNYEPGKDIEVIAKEYGVKEVIKLASNENPFGTPP
FT                   KAIECLRQNANKAHLYPDDSMIELKSTLAQKYKVQNENIIIGAGSDQVIEFAIHAKLNS
FT                   KNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITHDLNEFKKLYEAHKDEIKLIFLCLPNN
FT                   PLGECLDASEVTKFIKGVDEDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDNVLYLG
FT                   TFSKLYGLGGLRIGYGIANANIISAFYKLRAPFNVSNLALKAAVAAINDDEFAKKTLEN
FT                   NFSQMELYKEFAKKYDIKIIDSYTNFITYFFDEKNSTDLSEKLLKKGIIIRNLKSYGLN
FT                   AIRITIGTSYENEKFFTEFDKILR"
FT   gene            292478..294160
FT                   /gene="fliF"
FT                   /locus_tag="CJJ81176_0340"
FT   CDS_pept        292478..294160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="CJJ81176_0340"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by match to protein family HMM PF01514;
FT                   match to protein family HMM TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0340"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73453"
FT                   /db_xref="GOA:A0A0H3PF34"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF34"
FT                   /protein_id="EAQ73453.1"
FT                   /translation="MDFKNMLHQIGQLYQNLTRKQRIVIAASIVVVVGFLVFLALFRGS
FT                   GSNANNGYAVLVENVSPSSSAAIVAKLEQNNIPYKLESENKILVPQDQVYRQRMFIASE
FT                   GLIKDSRVGFEAFDTQAFGATNEEQKVKYQRAIEGELARTIETLEPIRSAVVHIAFPKD
FT                   SVFTERQIPPTASVVVNVREGLKLTRKQIDGIKNIVSAAVPKLTKENVKISDQSGVPLD
FT                   EQEAYEDDLVRVQIKFKSDQEKALEDKIIENLAPFAGGMDKVKVSVNIDFDFSKQESQS
FT                   EIYDPNPIVRSEQTLNEERTGRKDPEIQGVPGAVSNIGPVEGLDNKGQIDTYKKNQVTT
FT                   NNELSKTITNTKKQFATVLRTSAAVTIDGKYQDVVDENGDVKSEYVPLTKEELASVESI
FT                   VKNTINFSATRGDSVVVQNLPFHRESIRVESKVKTFYNRFVEPFIPPVKYFIAAILLFI
FT                   FYKKVIAPFTQKMLEDVAAQEEMQQGPNAVLDDAEDALEKFNAARKKVEEQLGFGDNFN
FT                   EDSIQYEVLLEKLRGLVSDKGEEIAALLQNLIQNDSEFGEKDM"
FT   gene            294160..295188
FT                   /gene="fliG"
FT                   /locus_tag="CJJ81176_0341"
FT   CDS_pept        294160..295188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="CJJ81176_0341"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="identified by match to protein family HMM PF01706;
FT                   match to protein family HMM TIGR00207"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0341"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73253"
FT                   /db_xref="GOA:A0A0H3PAL4"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAL4"
FT                   /protein_id="EAQ73253.1"
FT                   /translation="MIKLSEEQKMVYDDLSMPEKVAIFLIQLGEDATTSVFSHMEIDVI
FT                   TEISRYIAMAKNVDRSVATAVLEEFYTLLQSNQYIKSGGLEYAKEILFRTFGPEIANKI
FT                   LEKLTKSMENNQNFAYLAQIKPQQLADFITKEHPQTIALILAHMDSIHAAETLEYFSDE
FT                   LRAEVVIRMANLGDISPSIIKRVSAVLESKLESLTSYKVEVGGPRAVAEVLNRLGQKAS
FT                   KSTITYIEQSDERLAETIKELMFTFDDIQKLSTQAIREILKVADKRDLMIGLKGASEEL
FT                   KQKFLANMSTRASEAFLEEMGFLGAVRVKDVEDAQRKVVEVVQKLAEQGLVQTGDADEM
FT                   IE"
FT   gene            295196..296026
FT                   /locus_tag="CJJ81176_0342"
FT   CDS_pept        295196..296026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0342"
FT                   /product="flagellar assembly protein FliH, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0342"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73294"
FT                   /db_xref="InterPro:IPR018035"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBF4"
FT                   /protein_id="EAQ73294.1"
FT                   /translation="MVNRSNVISGGASDQHVVEGYRFKVISEFDNHTGEKKHTQTPDEE
FT                   NANISLNDEKPVEENQAITPTQAVMETQIPTFQPSFVEDLLKKTDEMSSNIIKLQMQIE
FT                   SQENEFNNRLNSELENAKEKFAKEGYEKAKEEFQKELSDFKDKYLKSIAKLDNACENLE
FT                   NFIEKNEKELADTAIDIAKEVILKELELNSSKIAYALAKDLIGELKGASAIELKVNAED
FT                   YEYLKEQFDQNAHIKISLDDAISKGSVVIISDAGNIESNLNSRLTKIKKMVNNE"
FT   gene            296019..297866
FT                   /gene="dxs"
FT                   /locus_tag="CJJ81176_0343"
FT   CDS_pept        296019..297866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="CJJ81176_0343"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780; match to protein
FT                   family HMM TIGR00204"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0343"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73269"
FT                   /db_xref="GOA:A1VY40"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY40"
FT                   /protein_id="EAQ73269.1"
FT                   /translation="MSKKFAHTQEELEKLSLKELENLAASMREKIIQVVSKNGGHLSSN
FT                   LGAVELSIAMHLVFDAKKDPFIFDVSHQSYTHKLLSGKEEIFDTLRQINGLSGYTKPSE
FT                   GDYFVAGHSSTSISLAVGACKAIALKGEKRIPVALIGDGALSAGMAYEALNELGDSKFP
FT                   CVILLNDNEMSISKPIGAISKYLSQAMATQFYQSFKKRIAKMLDILPDSATYMAKRFEE
FT                   SFKLITPGLLFEELGLEYIGPIDGHNLGEIISALKQAKAMQKPCVIHTQTIKGKGYALA
FT                   EGKHAKWHGVGAFDIDSGESVKKSDTKKSATEIFSKNLLDLASKYENIVGVTAAMPSGT
FT                   GLDKLIEKYPNRFWDVAIAEQHAVTSMAAMAKEGFKPFIAIYSTFLQRAYDQVIHDCAI
FT                   MNLNVVFAMDRAGIVGEDGETHQGVFDLSFLAPLPNFTLLAPRDEQMMQNIMEYAYLHQ
FT                   GPIAFRYPRGSFILDKEFNPCEIKLGKAQWLVKNSSEIAFLGYGQGVAKAWQVLRALQE
FT                   MNNNANLIDLIFAKPLDEELLCELAKKSKIWFIFSENVKIGGIESLINNFLQKYDLHVK
FT                   VVSFEYEDKFIEHGKTSEVEKNLEKDVNSLLTKVLKFYH"
FT   gene            297952..298362
FT                   /locus_tag="CJJ81176_0344"
FT   CDS_pept        297952..298362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0344"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0344"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73204"
FT                   /db_xref="GOA:A0A0H3PBT6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBT6"
FT                   /protein_id="EAQ73204.1"
FT                   /translation="MELLQMLKKHELKATPQRLCVLKILKRHEHPNIDELYTEIKKEYP
FT                   SISLATVYKNLNTLQEQGLVVEINVLNQKTCYDIYEEEHIHVVCAKCGGIEDLSFKDAK
FT                   LYEYQEHLEKKIGNLVNHLSVCAYVDSCKKCH"
FT   gene            298408..299604
FT                   /locus_tag="CJJ81176_0345"
FT   CDS_pept        298408..299604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0345"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73387"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJG1"
FT                   /protein_id="EAQ73387.1"
FT                   /translation="MVYEIQKNFLLSDCTLLGNLKKDNIPFRNSKFETFYTQITSNHSV
FT                   KFQSFCNEFYKITKFNNSILEQNQEEKISKKKFEKARKKIIGKSIKKERFEFKFCSLKS
FT                   YIDMYEEPKICILKIFFPTLDSSNEFKIPKDFKIQKELHHDLNSKHIVLYGFEYQNFDI
FT                   EKYFKIIEKNQNFSLDFPNYINAYDGFRIFLFYLFKKLKFYWTLSLERKDKQSLCEFLF
FT                   YSRSLYIVLSSMNTILDKNLSNILALKFKDITKKTQDILASENSNQDLLLFLSDEKIQD
FT                   LFNDFDFFIKENSFYEGDCKDRFFKQLVALELRKKIILFRKNILKNFDLELFENSFFEL
FT                   AIFLEYFYRFLEIKNLNKLYEKYCKDRDKNIFSKIINNKNKFCKLLKKSSKNLKIYKG"
FT   gene            299607..300314
FT                   /gene="ubiE"
FT                   /locus_tag="CJJ81176_0346"
FT   CDS_pept        299607..300314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="CJJ81176_0346"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM TIGR01934"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0346"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73327"
FT                   /db_xref="GOA:A1VY43"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY43"
FT                   /protein_id="EAQ73327.1"
FT                   /translation="MQKQEKIIEMFNQIAPTYDKANRILSFGADVAWRKKACQRVMSLY
FT                   LKKDLKIADIACGTGDMIEIWQESALKMEKNILNIKGIDPSSGMLNVAKEKFPNVEFIE
FT                   AGAQNLPLESQSLDILSISYGIRNVVERQKALSEFARVLQKDGILVVLEFTKREKGGFI
FT                   AACRDFYLKNILPSIGGIISKNKSAYEYLPNSIEGFLSKEEFILELKNAGFEILDYKSF
FT                   SFGVSSMFIAKKL"
FT   gene            300311..301474
FT                   /gene="xseA"
FT                   /locus_tag="CJJ81176_0347"
FT   CDS_pept        300311..301474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="CJJ81176_0347"
FT                   /product="exodeoxyribonuclease VII, large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="identified by match to protein family HMM PF01336;
FT                   match to protein family HMM PF02601; match to protein
FT                   family HMM TIGR00237"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0347"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73041"
FT                   /db_xref="GOA:A1VY44"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY44"
FT                   /protein_id="EAQ73041.1"
FT                   /translation="MTPTELNLKAKALLETHFDDIVLSGEISKITLHGSGHWYFDLKDE
FT                   RSSIACAMFKGANLKVGFKPAVGNFLELCGSVSLYPESGRYQFIATSMKKAGFGDLEAQ
FT                   FLALKERLQKEGLFDPRFKKSLPKFPKKVGIITSKTSAALQDMLKLIHQKEYFLAKIYI
FT                   FDALTQGNNAPFSLIQALKKADDMDLDVLIIARGGGSREDLFCFNDENLAREIFKAKTP
FT                   IISAIGHEIDYVISDFVADFRAPTPSAAIDTLFYSKLDIEQSLDLMEEKLMQLWNYKIQ
FT                   NYENLLLNLSKFFKFNSLPKIIDEKIKQSHNIEKQLNHLLANQMRYNELKLDKLQNAYL
FT                   QHENFFNKSKKFICIRKNGKIANLEDLKSDDIVILSSQTSQKEAKIL"
FT   gene            301484..302560
FT                   /gene="serC"
FT                   /locus_tag="CJJ81176_0348"
FT   CDS_pept        301484..302560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC"
FT                   /locus_tag="CJJ81176_0348"
FT                   /product="phosphoserine aminotransferase"
FT                   /EC_number="2.6.1.52"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM TIGR01364"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0348"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72981"
FT                   /db_xref="GOA:A1VY45"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY45"
FT                   /protein_id="EAQ72981.1"
FT                   /translation="MRKINFSAGPSTLPLEILEQAQKELCDYQGRGYSIMEISHRTKVF
FT                   EEVHFGAQEKAKKLYGLNDDYEVLFLQGGASLQFAMIPMNLALNGVCEYANTGVWTKKA
FT                   IKEAQILGVNVKTVASSEESNFNHIPRVEFRDNADYAYICSNNTIYGTQYQNYPKTKTP
FT                   LIVDASSDFFSRKVDFSNIALFYGGVQKNAGISGLSCIFIRKDMLERSKNKQIPSMLNY
FT                   LTHAENQSLFNTPPTFAIYMFNLEMDWLLNQGGLDKVHEKNSQKAAMLYECIDLSNGFY
FT                   KGHADKKDRSLMNVSFNIAKNKDLEPLFVKEAEEAGMIGLKGHRILGGIRASIYNALNL
FT                   DQIKTLCEFMKEFQGKYA"
FT   gene            302557..302907
FT                   /locus_tag="CJJ81176_0349"
FT   CDS_pept        302557..302907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0349"
FT                   /product="endoribonuclease L-PSP family protein"
FT                   /note="identified by match to protein family HMM PF01042"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0349"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73295"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJA6"
FT                   /protein_id="EAQ73295.1"
FT                   /translation="MIKRFDECDRMSQIIVFDKYFKTAGQVAFEPSGDIKKQTKEALAE
FT                   LDALFEKIGASKGDLIQIQIWLANMQDFDAMNEIYDAWIKNYPKPVRACVGSALAEGYL
FT                   VEIQAFGKLREN"
FT   gene            complement(302904..303878)
FT                   /gene="fabH"
FT                   /locus_tag="CJJ81176_0350"
FT   CDS_pept        complement(302904..303878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="CJJ81176_0350"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM TIGR00747"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0350"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73083"
FT                   /db_xref="GOA:A1VY47"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY47"
FT                   /protein_id="EAQ73083.1"
FT                   /translation="MLKASLKSIASYIPEKILSNADLEKMVDTTDEWITRRTGIKERRI
FT                   ASENENTSDLGTKAALKAIERANLKPEDIDAILVATLSPDYFTMPSTACKIASNLGLVN
FT                   ISAFDISAACSGFIYLLEQAKALVESGLKKNVLIIGAEKTSSIMDYNDRSICILFGDGA
FT                   GAGVVSLDNENHILDVHTASNGNYGDLLMTQRSQKSSLCQTLSMQMKGNEVFKIAVNTL
FT                   SNDVVEILAKNNILAQEIDLFIPHQANLRIIKAVQEKLNLSDEKCVITVQKYGNTSAAS
FT                   IPMAMNDAYEEGRLKKGNLILLDAFGGGFTWGSALLKFGGENF"
FT   gene            complement(303871..304857)
FT                   /gene="plsX"
FT                   /locus_tag="CJJ81176_0351"
FT   CDS_pept        complement(303871..304857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="CJJ81176_0351"
FT                   /product="fatty acid/phospholipid synthesis protein PlsX"
FT                   /note="identified by match to protein family HMM PF02504;
FT                   match to protein family HMM TIGR00182"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0351"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73225"
FT                   /db_xref="GOA:A1VY48"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY48"
FT                   /protein_id="EAQ73225.1"
FT                   /translation="MINIAIDAMGGDFGEKPIIEGVLKALEAKPFNAILVGNSKILKPL
FT                   IPKKLEQYIQYEEASEIFSMNENATDALKNKETTIYKAINLLKEKKVDAVVSAGHSGAS
FT                   MSLATLRLGRLKGISRPAIATLMPNIVNKTLLLDVGANTDCKAENLFQFAIMGEVYARE
FT                   IMQIQKPRLALLSNGEEECKGNELTKESHQLMKKIPNFIGNAEGRDIFNGEIDVLVCDG
FT                   FDGNVILKACEGVATAIFQLLKNEVKQSFISKIGALLMKPSFKKLKKHTDWQEYGGAPL
FT                   LGVNGCVIISHGKSDSRAIKNAIFQAINFSQSHINKLIENELGKYNA"
FT   gene            complement(304863..305009)
FT                   /gene="rpmF"
FT                   /locus_tag="CJJ81176_0352"
FT   CDS_pept        complement(304863..305009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="CJJ81176_0352"
FT                   /product="ribosomal protein L32"
FT                   /note="identified by match to protein family HMM PF01783;
FT                   match to protein family HMM TIGR01031"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0352"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73477"
FT                   /db_xref="GOA:A1VY49"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY49"
FT                   /protein_id="EAQ73477.1"
FT                   /translation="MAVPKRRVSKTRAAKRRTHYKVSLPMPIKDKDGSYKMPHRANPTT
FT                   KEY"
FT   gene            complement(305033..305386)
FT                   /locus_tag="CJJ81176_0353"
FT   CDS_pept        complement(305033..305386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0353"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72975"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAX9"
FT                   /protein_id="EAQ72975.1"
FT                   /translation="MKIPFSKINTKEYPFKLNLENMIFEGNLVKINPKLVKINAIMQGF
FT                   IYRPCDSCGTELELEIKENLELFASDGIFKDEANELSNTIEFFDGHIDLIEVAISELEV
FT                   YLSDYFYCINCNN"
FT   gene            complement(305387..305800)
FT                   /gene="ndk"
FT                   /locus_tag="CJJ81176_0354"
FT   CDS_pept        complement(305387..305800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="CJJ81176_0354"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="identified by match to protein family HMM PF00334"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0354"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73035"
FT                   /db_xref="GOA:A1VY51"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY51"
FT                   /protein_id="EAQ73035.1"
FT                   /translation="MEKTLSIIKPDAVKKGVIGKILDRFESNGLRIAAMKKVQLSKEQA
FT                   ENFYAVHKERPFFKDLVEFMISGPVVVSVLEGEGAVLKNRDLMGATNPKEAKAGTIRAD
FT                   FAESIDANAVHGSDSLENAKIEIEFFFKPNEIC"
FT   gene            complement(305913..306197)
FT                   /locus_tag="CJJ81176_0355"
FT   CDS_pept        complement(305913..306197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0355"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0355"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73165"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB91"
FT                   /protein_id="EAQ73165.1"
FT                   /translation="MAVKITDICIACGSCIDECPVSAIVDDANNPEGEDRYYVYANKCV
FT                   ECVGHNDQPACASACPTDGCIVWSAVESGQPSRDNIGADMRSGDTPVFA"
FT   gene            306403..306999
FT                   /locus_tag="CJJ81176_0356"
FT   CDS_pept        306403..306999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0356"
FT                   /product="antioxidant, AhpC/Tsa family"
FT                   /note="identified by match to protein family HMM PF00578"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0356"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73058"
FT                   /db_xref="GOA:A0A0H3PIW2"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIW2"
FT                   /protein_id="EAQ73058.1"
FT                   /translation="MIVTKKALDFTAPAVLGNNEIVQDFNLYKNIGPKGAVVFFYPKDF
FT                   TFVCPSEIIAFDKRYQEFKNRGIEVIGISGDNEFSHFAWKNTPVNQGGIGQVKFPLVAD
FT                   LTKQIARNFDVLYAEAVALRGSFLLDADGTVRHAVVNDLPLGRNIDEMLRMVDTMLFTN
FT                   EHGEVCPAGWNKGDEGMKANPKGVAEYLGKNEAKL"
FT   gene            307118..308224
FT                   /gene="flhB"
FT                   /locus_tag="CJJ81176_0357"
FT   CDS_pept        307118..308224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="CJJ81176_0357"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /note="identified by match to protein family HMM PF01312;
FT                   match to protein family HMM TIGR00328"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0357"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73215"
FT                   /db_xref="GOA:A0A0H3PAJ9"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAJ9"
FT                   /protein_id="EAQ73215.1"
FT                   /translation="MAGEDQEKTEEPTSKKIEDARKEGNVPKSQDAAAIVTLIIGVTIT
FT                   LFMMSFMGERIVNLYRYYQSFIGVEFDLRIIQAIMIKSIFEVLIILAPIVLSIMIAGVL
FT                   GNIMQFGFIFTTKPIMPNLGKINPLKGLKNLFSLKKIVESIKIILKVGIVFTIAFIVLL
FT                   KFMQELPRVELYTMVTQLAWLRDRAIVLAAIVIVAFLIIAVLDVFLVRFQYFKGLRMSK
FT                   QEIKDEYKQMEGDPQVKGRIRRLQMEAARRRMVQDVAGADVVITNPTHYAVAIRYDTSK
FT                   EQAPRVVAKGVDFLALRIKQVAYENNVVVYENPPLARELYKACDVNDLIPREMFKAVAE
FT                   VLGFVYNTNNKSRLAGQVKKETKTFKVL"
FT   gene            complement(308211..308954)
FT                   /locus_tag="CJJ81176_0358"
FT   CDS_pept        complement(308211..308954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0358"
FT                   /product="chemotaxis protein MotB, putative"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0358"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73296"
FT                   /db_xref="GOA:A0A0H3PBX6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBX6"
FT                   /protein_id="EAQ73296.1"
FT                   /translation="MAKKHKCPECPAGEKWAVPYADFLSLLLALFIALWAISKTNPAKV
FT                   EALKTEFVKIFDYTSTQTVKEESKTQEKYKGAAKEESDELKSLKQMTMTQQETIKRLQA
FT                   ALDQSDNQVALNLPSKVEFERGSAQIVSADIQDYLKRMAELTTYLPPQAKIEIRGYTDN
FT                   SDSIIRSYELAYQRAENVLKYFIEGGANLKNISIKSYGLNNPINGNPQALENNRVEIYF
FT                   KVDTADTSTQKSVLELINKIGTKAP"
FT   gene            complement(308957..309733)
FT                   /locus_tag="CJJ81176_0359"
FT   CDS_pept        complement(308957..309733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0359"
FT                   /product="chemotaxis protein MotA, putative"
FT                   /note="identified by match to protein family HMM PF01618"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0359"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73419"
FT                   /db_xref="GOA:A0A0H3PAV1"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAV1"
FT                   /protein_id="EAQ73419.1"
FT                   /translation="MDLSTILGMVLAVTSISVGDILEGGNPLHVIHLSSFLIVMPTAAF
FT                   CAMTSTHKKIVKAAYKELKVVFKGSGVNLPERIAQLIEFAIIARRDGLLALESRTNEIE
FT                   NEFLKNAMMMLVDGKSFEEIHESMEIQTEQLEEHYKECAEYWIVFGETCPTMGLVGAVF
FT                   GLILALKLLDNPQAMAAGISGAFTATVTGIFGAYALFAPWGKKLKANGMDLVKEQIVIT
FT                   EAIKGIAEGANPRDLEAKLFNFLSHDDPRISQFDKG"
FT   gene            complement(309749..312388)
FT                   /gene="polA"
FT                   /locus_tag="CJJ81176_0360"
FT   CDS_pept        complement(309749..312388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="CJJ81176_0360"
FT                   /product="DNA polymerase type I"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00476;
FT                   match to protein family HMM PF01367; match to protein
FT                   family HMM PF01612; match to protein family HMM PF02739;
FT                   match to protein family HMM TIGR00593"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0360"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73211"
FT                   /db_xref="GOA:A0A0H3PEP2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEP2"
FT                   /protein_id="EAQ73211.1"
FT                   /translation="MKTLTIIDTFGFFFRLYYALKGFKNSQGQASGMISGFANFIYSLK
FT                   NEYKSDYIVFALDSKGKTFRSEIDPNYKQNRTPPPPELLEQIPICIKMIEKMGFISVSQ
FT                   EGYEADDIIASFVKTCENRDIFVRIITQDKDLYQLIKDGKTSIYSPISKNDYDEAACLE
FT                   KYGVKPNQIRDFLALCGDSSDNIPGVKGIGAKGAKTLLDEFGSIEGIYENLTLVRNERS
FT                   RNLLLEGKENAFLSKKLASLYDNLEVQNLIEKATYPDEEPLLKILEILEHYELNTLLKK
FT                   LRQNPDNKDKNLGFKATLVQDENKLFEILNTLDKESIIAFDTETTGLDTKEAKIVGFSF
FT                   CMNENEAFYVPLTHNYLGVGEQISLQSAKKAIEAIFNHFVIGHNLKYDFKIIQNNFDLN
FT                   LPQKYADTMILAWLKNPSLRVNMDDLALRLFNYETLHFESLVKKGENFASVELEKACKY
FT                   AAEDAYITLRFYLYFLKNLETPLLELAKNCEFDFIKIIMMMEENGIKLDTNALEILMKK
FT                   FENEIKNLSEEIYTLCEDRFNLNSPKQMGDILFEKLKLPSGKKGKTGYSTDEKVLNILL
FT                   DKHPVIAKILDYRELAKLYSTYCEPLLKLALKDKNSRIYSSFLQTGTATGRLSSKDPNL
FT                   QNIPAHGQYAKDYKSCFVAKDGFSFISLDYSQIELRILAHFSEDEKLLNAFANDEDIHA
FT                   RTAIMIFGESNYETRSVAKSINFGLIYGMGYKTLSQNLKIEANLAKSYIEKYFENFTSI
FT                   KKYFEKVKNEAKQNGFIVTLSGRKRYFDFENAKPMQIAMYERESINSILQGSAADVIKL
FT                   AMLEINKELNEDKKLILQIHDELIFEVKDDLCENFVKKTRDIMENIVKLKVKLKTSSSI
FT                   AKNWGDLK"
FT   gene            312552..312764
FT                   /locus_tag="CJJ81176_0361"
FT   CDS_pept        312552..312764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0361"
FT                   /product="major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0361"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73343"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJD4"
FT                   /protein_id="EAQ73343.1"
FT                   /translation="MTNQQIDGIADKNFNTPEGRKVFKKAVFSCWLGTAMEYADFALYG
FT                   LAAATIFSEVFFPEQTPVIALFLVL"
FT   gene            312848..312964
FT                   /locus_tag="CJJ81176_0362"
FT   CDS_pept        312848..312964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0362"
FT                   /product="inner membrane metabolite transport protein YdfJ"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0362"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73240"
FT                   /db_xref="GOA:A0A0H3PAK9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAK9"
FT                   /protein_id="EAQ73240.1"
FT                   /translation="MMATIALMGISTTLIGFIPSYAVIGVWAPICLVALRFM"
FT   gene            313004..313912
FT                   /locus_tag="CJJ81176_0363"
FT   CDS_pept        313004..313912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0363"
FT                   /product="inner membrane metabolite transport protein YdfJ"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0363"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73432"
FT                   /db_xref="GOA:A0A0H3PF22"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF22"
FT                   /protein_id="EAQ73432.1"
FT                   /translation="MLGEYAPSKRRGLVSSVIALGSNSGTLLASFVWLLMVQMDEASFK
FT                   EWGWRVPFMGSILIALFAVYIRFHVKETPVFEKQKNEMMKLRLNNEKHMKKDERSFWQR
FT                   SRAFWTMVGLRIGENGPSYLAQGFIVGYVTKILLLDKSVATTAVMIASLVGFLVIPLAG
FT                   YLSDKFGRCITYRMFCLLLMIYAFPAFMLLDSKNEIIVILTIIVGMSLASLGIFGVQAA
FT                   WGVELFGVKNRYTKMAFAKELGSILSGGTAPMVASALLAYYGTWWPIATYFVLTAGIGF
FT                   VTTFFAPETRGRDLNKIEDAI"
FT   gene            313909..314916
FT                   /locus_tag="CJJ81176_0364"
FT   CDS_pept        313909..314916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0364"
FT                   /product="inosine-uridine preferring nucleoside hydrolase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01156"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0364"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73464"
FT                   /db_xref="GOA:A0A0H3PAX5"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAX5"
FT                   /protein_id="EAQ73464.1"
FT                   /translation="MRLILDTDIGNAIAGANTDDGLALALILSSKEIKLEMLSTVCGNV
FT                   PSLVAYSVAKDLFKRLNLNIPVYLGANEALKEPSKAWRQRLDESVKNFKLEYLWENIKS
FT                   PEILENINPDAIFKMGELVSKNPKEISICAIGPLTNIAMTMKIFKDFDINLKELFIMGG
FT                   SFDMPYYTKDTNFGFDPEAASIVLNSRAKITLIPYNATMQTLLTHEDLKELQGKNILCD
FT                   FIVETLGVWIDYASKTRGTKGTWMHDALTIAYALDSSIADFDECYADVICDSSLARGMS
FT                   WRCFKEPKMSMGVDLSTKNCVKILKNVDNAKLLKLIKERFLKGVCYENYESITT"
FT   gene            complement(314872..315315)
FT                   /locus_tag="CJJ81176_0365"
FT   CDS_pept        complement(314872..315315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0365"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0365"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73371"
FT                   /db_xref="GOA:A0A0H3PEY8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEY8"
FT                   /protein_id="EAQ73371.1"
FT                   /translation="MFDFLYNDISYLGLFMVCFLSSTLLPLASEAFVLGFIKLDFNPNL
FT                   VLIVATLGNTLGSLSTYALAYFGKEKILEKYFSKSLKKLENFNANFAKFGSIFAFFTFL
FT                   PLVGDLFALGLGFAKYSFLKTIFFILLGKLSRYAFIIFIANSF"
FT   gene            complement(315320..318145)
FT                   /gene="uvrA"
FT                   /locus_tag="CJJ81176_0366"
FT   CDS_pept        complement(315320..318145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="CJJ81176_0366"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00630"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0366"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73403"
FT                   /db_xref="GOA:A0A0H3PAT9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAT9"
FT                   /protein_id="EAQ73403.1"
FT                   /translation="MNDTIKIIGARENNLKNIHLEIPKNKLIVFTGLSGSGKSTLAFGT
FT                   LYAEGQRRYIESLSAYARQFLDKVGKPDVDKIEGLTPAIAIDQKTTSKNPRSTVGTITE
FT                   IYDYLRLLYARVGIQHCHQCGQKISSMSASDIVSEILKFPKGAKIIIYAPLIREKKGTY
FT                   ADLLENLRNKGYVRAQIDGVLVRLDEEIELAKTKKHTIKLVIDRLEIQEDLLSRLASDI
FT                   EKGLQESFGEIEIEVLNHEEINLNKHYHFSEHSACFDCKISFVPLEPLSFSFNSPKGAC
FT                   EACDGLGIRYTLDMKKIIDENLSLENGAVKIMYGFNKSYYYKFLIAFCEQNEIPIKIPF
FT                   MQLSEEQKRLVLYGNAKTIEFLWKRNRLKRTFEGVVKMAYEMLKDEKDLAEYMSEKICK
FT                   DCGGHRLKPESLAVKVAKKGLGEILDMSIEDSTAFFADEKNFSYLSEQQKLISKPILKE
FT                   INERLFFLYDVGLGYLSLGRDARTISGGEAQRIRIASQIGSGLSGVMYVLDEPSIGLHE
FT                   RDTAKLIKTLRNLQQKGNTLIVVEHDKMTIEEADFIVDIGPKAGKFGGEVVFSGTYKEL
FT                   LKSKSETALYMNGKKQISQLQNRTQKEWLELKNVNINNIQDLSVKFPLQNLVAITGVSG
FT                   SGKSSLILQTLLPFAQEELNRAKKVKKLGGVQIEGLEKLDKVIYLDQSPIGRTPRSNPA
FT                   TYTGAMDEIRNLFAATKEAKMRGYKAGRFSFNVKGGRCEKCSGDGEIKIEMHFLPDVMV
FT                   VCDTCEGKRYNDATLEIKYKGKNISEILNMSVLEASEFFTAVPKIKQKLDTLVKVGLDY
FT                   LTLGQNATTLSGGEAQRIKLAKELSRSDTGKTLYILDEPTTGLHFEDVNKLILVLQHLV
FT                   DLKNSVFVIEHNLDVIKNADYIIDMGPEGGIKGGKVISTGSVEKVAKEHKKTRSYTGYY
FT                   LDLELKNTQKS"
FT   gene            complement(318218..319003)
FT                   /locus_tag="CJJ81176_0367"
FT   CDS_pept        complement(318218..319003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0367"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01925"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0367"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73081"
FT                   /db_xref="GOA:A0A0H3PBP4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBP4"
FT                   /protein_id="EAQ73081.1"
FT                   /translation="MEITDLPYLIIGIISGIASGLFGIGGGMIIVPSMFALGASAHHAI
FT                   GISVLQMIFAAVFGSYINYKKKNLNLKDGIMIGFGGLIGASFSGMLLKALSDVALTSVF
FT                   LAVSCIFFIKYAFGIKENIVQNQRSVWVKNVILFIAGAFTGIFAISLGIGGGLLIAPIL
FT                   AYFLGYDSKKVVSLSLFFVIFASVSGIISFSNSGVIDSEVIHKGILVGIASMVGVFIGI
FT                   KIIEKMHISAHRKILLCVYALSILGTTHSLLNKLNFINF"
FT   gene            319126..319251
FT                   /locus_tag="CJJ81176_0368"
FT   CDS_pept        319126..319251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0368"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEL9"
FT                   /protein_id="EAQ73171.1"
FT                   /translation="MFQNIIKYKDFIIFILNLKQNLYLLIKINLDFKNFHKSLNF"
FT   gene            319416..320666
FT                   /gene="trpE"
FT                   /locus_tag="CJJ81176_0369"
FT   CDS_pept        319416..320666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="CJJ81176_0369"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0369"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73199"
FT                   /db_xref="GOA:A0A0H3PBB6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBB6"
FT                   /protein_id="EAQ73199.1"
FT                   /translation="MFVKNVNFYYRQILEKFENSYFAEDLTKVIIGIDCDYLDANELSF
FT                   SEFKAKYYEALSKNKICDFAGFFGVFSANFVSLFEKIPLSSKKNYDFPLFLFANAKAYL
FT                   IYEKNSKMFFKFGASKYFEYLKDDIEPMKKKQKNDFEILNSLEDEKNDFLKMCEKAKEY
FT                   LLSGDIFQVVLSKQLCIKHQVNAFDYYESLSALNPSAYMFYFPSKYGVVLGSSPEFLLK
FT                   IKKREIYLAPIAGTRNLENNCDLLALEKDLLSDEKELSEHKMLVDLARNDASKFGTQTR
FT                   VENLFSIIKNKFVMHIVSEVYANMKEDASIFDVIEAVFPAGTLSGAPKIRALEITSELE
FT                   DCDRGIYGGAVGFLNFNEDITLAILIRCAFFTQDKAYLASGAGIVLQSESQKEYAEICA
FT                   KRKALLVAFENLKKENQ"
FT   gene            320663..322264
FT                   /gene="trpD"
FT                   /locus_tag="CJJ81176_0370"
FT   CDS_pept        320663..322264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="CJJ81176_0370"
FT                   /product="anthranilate synthase component II"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00591; match to protein
FT                   family HMM TIGR00566; match to protein family HMM
FT                   TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0370"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73274"
FT                   /db_xref="GOA:A0A0H3PET1"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PET1"
FT                   /protein_id="EAQ73274.1"
FT                   /translation="MILLIDNYDSFVFNVKSMLEQLSNDEILVRRNDAISLSEIKNLNP
FT                   THIILSPGPKHPSQSGICLEIFKARLNIPVLGICLGHQALALAFDSLVVKMQEPMHAKN
FT                   SLIKQCRENELFSNLPSNFSVMRYHSLEVKQLSDELEILALDEKGVIMALGHKNLPYYG
FT                   VQFHPESYFSEYGLQLFSNFLKQDIKKPQKQENPLSFYLQKMSENHFLQSDDFEQICKI
FT                   IMSKDYEILQVAALLILITEKSLNEKSLSAFVRQILRYSQTFSDESEMIDICGTGGDGF
FT                   KSINVSTTSAFILAALGVKVAKHGNRAISSSSGSTDVLEALNITTPNTLESVLKQLNNQ
FT                   GLSFLHAPFFHPLVGELKEIRSRLGVRTVFNVLGPLLHPNLKLKYQLMGNYHAPVHRLL
FT                   IEVLKNLGRKKALVVRGNDGMDELSICDESKIYELCEGEILEYSICPEQFGFKRAFHSE
FT                   IIGSSAYDNAKDLKDILSGRMQGAKFDLVVLNAMFALYTANKASSPLVAKDMILEAIYS
FT                   GKVIEYFKEYQAYAKA"
FT   gene            322251..322850
FT                   /gene="trpF"
FT                   /locus_tag="CJJ81176_0371"
FT   CDS_pept        322251..322850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="CJJ81176_0371"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by match to protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0371"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73450"
FT                   /db_xref="GOA:A0A0H3PJK7"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJK7"
FT                   /protein_id="EAQ73450.1"
FT                   /translation="MLKLKICGIKDEKNAKDLAFLNIDFFGLIFAKSPRRVSLEQARNL
FT                   SAIFHEKDKKVVGVFVDENLEQILRCIKEAKLDGIQIYRTITKEEFEILKVQNVFVWQV
FT                   ISVENSLDLKSEIFANLVLFDAKGILKGGNGISFDWTLLGSYTKDFALAGGIGLDNIHK
FT                   AVQTGAKILDLNSKLEDEKGLKDINKIKQILKELKK"
FT   gene            322847..324025
FT                   /gene="trpB"
FT                   /locus_tag="CJJ81176_0372"
FT   CDS_pept        322847..324025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="CJJ81176_0372"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0372"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73016"
FT                   /db_xref="GOA:A1VY69"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY69"
FT                   /protein_id="EAQ73016.1"
FT                   /translation="MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNEL
FT                   LKTYVGRPTPLYFARNLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKII
FT                   AETGAGQHGLATATAAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTL
FT                   KEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLNKKVDY
FT                   IIAAVGGGSNAAGIFYDFIKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTK
FT                   VLQDDLGNILPVHSVSAGLDYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEG
FT                   IIAAIESSHALAFLEKLCPTLKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG"
FT   gene            324018..324767
FT                   /gene="trpA"
FT                   /locus_tag="CJJ81176_0373"
FT   CDS_pept        324018..324767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="CJJ81176_0373"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0373"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73318"
FT                   /db_xref="GOA:A1VY70"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY70"
FT                   /protein_id="EAQ73318.1"
FT                   /translation="MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELG
FT                   VAYSDPIADGEIIADAAKIALDQGMDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEK
FT                   FVKKAKSLGICALIVPELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKG
FT                   FIYLLASIGITGTKSVEEAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVI
FT                   VGTSIVKCFKQGNLDIIMKDIEEIFKK"
FT   gene            324838..325260
FT                   /locus_tag="CJJ81176_0374"
FT   CDS_pept        324838..325260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0374"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0374"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73376"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC13"
FT                   /protein_id="EAQ73376.1"
FT                   /translation="MLKILEYSITHFCEHILRLRIEAAQDISGELYGASIPIMGKSEGE
FT                   CNFYLFFPKEFLKKIAEILINDEKFKEDDWCDLTKECANQIIGYAKNLLNDAKGDDEYK
FT                   LGIPEYLGKVDFSEIVLDEALTYKFENCYFRIGYCK"
FT   gene            325260..325568
FT                   /gene="fliN"
FT                   /locus_tag="CJJ81176_0375"
FT   CDS_pept        325260..325568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="CJJ81176_0375"
FT                   /product="flagellar switch protein FliN"
FT                   /note="identified by match to protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0375"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73197"
FT                   /db_xref="GOA:A0A0H3PAJ0"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAJ0"
FT                   /protein_id="EAQ73197.1"
FT                   /translation="MSDDIEFNIHHGLLQSYEDILDITVDFVSELGTTNMSVAELLKLE
FT                   VGSVIDLEKPAGESVELYINKRIFGKGEVMVYEKNLAIRINEILDSKTVLQYFKKEI"
FT   gene            325569..326366
FT                   /locus_tag="CJJ81176_0376"
FT   CDS_pept        325569..326366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0376"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73072"
FT                   /db_xref="GOA:A0A0H3PEG3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEG3"
FT                   /protein_id="EAQ73072.1"
FT                   /translation="MRLLVLFFLILPLYSVELISYNIYDRNDRVDLMLSFDNAYNGKIS
FT                   QKKEKNLTLLTFSDLTYSKDELKELNSQLVDKISISSKNNNTYIMLQNKQNINLELSSI
FT                   NDKFGVRIRAIEQGKANIESVPTTTANNSQELMPKPKSTSLEGYDYTNYILVMLILVIL
FT                   LIVLWWFKKTMVYKNNNVSRDFTMIFQRFLDKNNQLVVFDHANKRYTMIIGNSNVLLES
FT                   VEIPEEQTIKHTEKTEKNFDSFFEENKKRIQNLIEQRQKGKKS"
FT   gene            complement(326363..327823)
FT                   /locus_tag="CJJ81176_0377"
FT   CDS_pept        complement(326363..327823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0377"
FT                   /product="phosphatase, Ppx/GppA family"
FT                   /note="identified by match to protein family HMM PF02541"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0377"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73260"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PES2"
FT                   /protein_id="EAQ73260.1"
FT                   /translation="MAKKTAVVDLGSNSIRMVIFEKTSRYGFYTTCEYKRKVRLGENAY
FT                   NNGKILQEEAMQRAEDALAFFKQCALKHKCKKIFIVGTSALRDAPNSKNFIKRIKDNLS
FT                   LNIRCIDGKSESYLGGLAALNLLSPFKDGTTLDIGGGSSELCLIKNNRIISCISLDIGT
FT                   VRLKELFYDTGKMDSLEEFIKPILEQIPKEFCNQNLIAIGGSLRAISNSIMQKNSYPLK
FT                   NLHDFRYMLDEEKGHILKIFNSNLDSLINFGIKKDRFDTIKEGIFIFLKIAEKIKAKQV
FT                   ITSGVGIREGVYLQDLLRPKITFPPNFNPSLKCLQDKFLQSKQKNKTPHFALQIFTTLK
FT                   NLHKLNDNYKHTLLNAAKLCHIGEYLNFYFANEHSAHFVLGGLNYGFSHKEKALIASII
FT                   KLNGKKVNPYNLEPYKQLLPNIHTISWLNFILCLAKTLSTNEDKIDFAFANNTLYIYQE
FT                   NKILNLPKDELKKIAKPATIALAINQKI"
FT   gene            complement(327823..328068)
FT                   /locus_tag="CJJ81176_0378"
FT   CDS_pept        complement(327823..328068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0378"
FT                   /product="ferredoxin, 4Fe-4S"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0378"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73098"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEH5"
FT                   /protein_id="EAQ73098.1"
FT                   /translation="MSLLITKDCVCCDACREECPDEAIYENSPIYVIDPDLCSECVNDF
FT                   SEPACIVACPYECIIPDPDNVETIEELKLKHRDREF"
FT   gene            complement(328181..328852)
FT                   /locus_tag="CJJ81176_0379"
FT   CDS_pept        complement(328181..328852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0379"
FT                   /product="DNA-binding response regulator"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0379"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73460"
FT                   /db_xref="GOA:A0A0H3PBN1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN1"
FT                   /protein_id="EAQ73460.1"
FT                   /translation="MRILVIEDEISLNKTIIDNLNEFGYQTDSSENFKDGEYFIGIRHY
FT                   DLVLANWTLPDGDGAELVNTIKHKSPRTSVMIMSSKTDKETEIKALKAGADDFVKKPLD
FT                   FDILLARIEARLRLGGTNVIKIEDLVIDPDEEKITYKGQDIELKGKPFEVLTHLARHSD
FT                   QIVSKEQLLDAIWEEPELVTPNVIEVAINQIRQKMDKPLNISTIETVRRRGYRFCFPKK
FT                   S"
FT   gene            complement(328931..329248)
FT                   /locus_tag="CJJ81176_0380"
FT   CDS_pept        complement(328931..329248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0380"
FT                   /product="folB domain protein"
FT                   /note="identified by match to protein family HMM PF02152"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0380"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73221"
FT                   /db_xref="GOA:A0A0H3PEQ0"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEQ0"
FT                   /protein_id="EAQ73221.1"
FT                   /translation="MQSHIKIKFHFKCIIGILDFERRKKQKIIIKLKAKANEFLNYAEV
FT                   ITKIKKWYKKEEFYTLEESLDFVSLNLKKDFPNLTNLNIKIFKPHIIKNATVGVKLKKK
FT                   Y"
FT   gene            complement(329233..329841)
FT                   /locus_tag="CJJ81176_0381"
FT   CDS_pept        complement(329233..329841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0381"
FT                   /product="conserved hypothetical protein TIGR00023"
FT                   /note="identified by match to protein family HMM PF02660;
FT                   match to protein family HMM TIGR00023"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0381"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73235"
FT                   /db_xref="GOA:A1VY78"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY78"
FT                   /protein_id="EAQ73235.1"
FT                   /translation="MENLIIYAFIYLLGSIPFGLILAKFFAKTDIKKEGSKSIGATNVL
FT                   RVVKEKNPKLAKKLAIATIILDFAKAAIPLLILKFLHYDQALLWSVAVLAIFGHCFSIY
FT                   LLFEGGKGIATGAGAMIVLLPLEVLTAFIVWVVIGKIFKISSLASLAALLAFVISSFIF
FT                   NYDLEIHTHAPVFIIAFIIIYKHLPNIKRLIFKEECKVI"
FT   gene            330036..331061
FT                   /gene="ccpA-2"
FT                   /locus_tag="CJJ81176_0382"
FT   CDS_pept        330036..331061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA-2"
FT                   /locus_tag="CJJ81176_0382"
FT                   /product="cytochrome c551 peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="identified by match to protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0382"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73161"
FT                   /db_xref="GOA:A0A0H3PBR9"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBR9"
FT                   /protein_id="EAQ73161.1"
FT                   /translation="MKVKSLLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEIL
FT                   KQNGVKASEFTLEKAELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGISTAIGHKWTA
FT                   NPHHLNSPTVYNAVLNNTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEY
FT                   VSEFKKIYGKSGVNFDNIADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFID
FT                   KGCVACHNGVNLGGNMQAFEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNG
FT                   AIWNLKDAIKEMGSVQLGIKISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPE
FT                   L"
FT   gene            331137..332492
FT                   /gene="glmM"
FT                   /locus_tag="CJJ81176_0383"
FT   CDS_pept        331137..332492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="CJJ81176_0383"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF00408;
FT                   match to protein family HMM PF02878; match to protein
FT                   family HMM PF02879; match to protein family HMM PF02880;
FT                   match to protein family HMM TIGR01455"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0383"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73397"
FT                   /db_xref="GOA:A1VY80"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY80"
FT                   /protein_id="EAQ73397.2"
FT                   /translation="MLERFAMKLFGTDGVRGKAGEFLDSFLAMRLAMAAGIYFKDKSIT
FT                   NNILVGKDTRRSGYMIENAIVSGLTSIGYNVIQIGPMPTPAIAFLTEDMRCDAGIMISA
FT                   SHNPYYDNGIKFFDAHGNKLSEDIEKKIEEIYFDDKLIQASKVDMEKIGQAKRIDDVIG
FT                   RYIVSIKNSFPKDLTLKSLRVVLDVAHGAAYKVAPTVFKELGAEVIVMSDKPNGLNINE
FT                   NCGALHPANLAAEVKRLRADVGFAFDGDADRLVVVDEKGEVANGDSLLGVLALYLKEQG
FT                   KLQSSVVATIMSNGALKEFLNKHGIELDTCNVGDKYVLEKLKANGGNFGGEQSGHIIFS
FT                   DYAKTGDGLIAALQFSALMLSKKKSASSILGQVKPYPQLLTNLKIAEKKDLDKIKGLKE
FT                   LKKDLENKNINTLFRYSGTENLIRLLLEAKDIKLLEKEMKNVVEFFKKALNG"
FT   gene            332485..332955
FT                   /gene="lspA"
FT                   /locus_tag="CJJ81176_0384"
FT   CDS_pept        332485..332955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="CJJ81176_0384"
FT                   /product="signal peptidase II"
FT                   /EC_number="3.4.23.36"
FT                   /note="identified by match to protein family HMM PF01252;
FT                   match to protein family HMM TIGR00077"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0384"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73308"
FT                   /db_xref="GOA:A1VY81"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY81"
FT                   /protein_id="EAQ73308.1"
FT                   /translation="MAKTFKFIFYFWGAFVLVFALDQWVKSLTLAGLRWQSEYLDLTYA
FT                   LNTGVAFSMLSFLEHNLKYLHLALIVVLFIYLFWQKTLLKTHSIAFGMMLGAGVSNLLD
FT                   RFIHGGVVDMFFWHKWFNFAIFNVADVMINISVALILIQEIFKKRKKDDRMD"
FT   gene            332939..333391
FT                   /locus_tag="CJJ81176_0385"
FT   CDS_pept        332939..333391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0385"
FT                   /product="conserved hypothetical protein TIGR00701"
FT                   /note="identified by match to protein family HMM PF03653;
FT                   match to protein family HMM TIGR00701"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0385"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73479"
FT                   /db_xref="GOA:A0A0H3PJP9"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJP9"
FT                   /protein_id="EAQ73479.1"
FT                   /translation="MTEWINDYYFWIKWVHYLAFVSWMAGLFYLPRLFVYHAEHKDNKG
FT                   FVEIVKIQERKLYFYIQTPAMIVTLITGSLMLHAHKEVLMVGAGFMHVKLTCVTLLIIF
FT                   HIHNYYCLKALANDTSTKSGKYFRIYNEFPTIMFIIIALMMVVRPF"
FT   gene            complement(333388..334734)
FT                   /locus_tag="CJJ81176_0386"
FT   CDS_pept        complement(333388..334734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0386"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0386"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73007"
FT                   /db_xref="GOA:A0A0H3PAY9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY9"
FT                   /protein_id="EAQ73007.1"
FT                   /translation="MNLFQNLALKYSHTMMEKSLQKGFNVELLKQPEEKIPKQDKSYML
FT                   YAHVPFCHTFCPYCSFHKYYYDENLAKVYFQNLREEIKIMKDKGFDFTSMYVGGGTTLI
FT                   NEEELLKTLELCKKLFNIKEISCESDPNHIDPNKLSMFKGIIDRLSCGIQSFDDETLKK
FT                   VARYNKFGSSKELQEKISKALGILPIFSIDLIFNLPGQSEKQLLNDLEIAKNLAPQQIT
FT                   TYPLMKSNLTKDNIAKSLGVSIKDNEFAYYQIICEFFKDYTQNNGWSFSLEKNKLNDEY
FT                   VSSHHEYLGVGSGAFSFLDGELLINAFNLNDYAKFIQEKQNANIAKACFDKKEIIKYVF
FT                   LTEIFSGKIEIDKFNKTLNCNLEKELFIELLGLKTSGAIIKDQNALIATEFGQYLFVVL
FT                   MKDFYTGMDLVRAVFRDDKRLKNKDYIDIMKENIDPLNSASMEFKAETN"
FT   gene            334863..335114
FT                   /locus_tag="CJJ81176_0387"
FT   CDS_pept        334863..335114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0387"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0387"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBJ6"
FT                   /protein_id="EAQ72966.1"
FT                   /translation="MDKAKIVQNLNALFKQRAEFYSYFDENIAKINNTEVFDFKNAKNL
FT                   NPEEVYKQFYHFDYAIRKLLPAIYKAYEITDADLDKDF"
FT   gene            complement(335137..336615)
FT                   /gene="cmeC"
FT                   /locus_tag="CJJ81176_0388"
FT   CDS_pept        complement(335137..336615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmeC"
FT                   /locus_tag="CJJ81176_0388"
FT                   /product="RND efflux system, outer membrane lipoprotein
FT                   CmeC"
FT                   /note="identified by match to protein family HMM PF02321;
FT                   match to protein family HMM TIGR01845"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0388"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73082"
FT                   /db_xref="GOA:A0A0H3PAE4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAE4"
FT                   /protein_id="EAQ73082.1"
FT                   /translation="MNKIISISAIASFTLLISACSLSPNLNIPEANYSIDNKLGALSWE
FT                   KENNSSITKNWWKDFDDENLNKVVDLALKNNNDLKLAFIHMEQAAAQLGIDFSSLLPKF
FT                   DGSASGSRAKTAINAPSNRTGEVSYGNDFKMGLNLSYEIDLWGKYRDTYRASKSGFKAS
FT                   EYDYEAARLSVISNTVQTYFNLVNAYENENALKEAYESAKEIYRINDEKFQVGAVGEYE
FT                   LAQARANLESMALQYNEAKLNKENYLKALKILTSNDLNDILYKNQSYQVFNLKEFDIPT
FT                   GISSTILLQRPDIGSSLEKLTQQNYLVGVARTAFLPSLSLTGLLGFESGDLDTLVKGGS
FT                   KTWNIGGNFTLPIFHWGEIYQNVNLAKLNKDEAFVNYQNTLITAFGEIRYALVARKTIR
FT                   LQYDNAQASEQSYKRIYEIAKERYDIGEMSLQDYLEARQNWLNAAVAFNNIKYSYANSI
FT                   VDVIKAFGGGFEQSEDTSKNIKEESKNLDMSFRE"
FT   gene            complement(336608..339730)
FT                   /gene="cmeB"
FT                   /locus_tag="CJJ81176_0389"
FT   CDS_pept        complement(336608..339730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmeB"
FT                   /locus_tag="CJJ81176_0389"
FT                   /product="RND efflux system, inner membrane transporter
FT                   CmeB"
FT                   /note="identified by match to protein family HMM PF00873;
FT                   match to protein family HMM TIGR00915"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0389"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73146"
FT                   /db_xref="GOA:A0A0H3PB79"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB79"
FT                   /protein_id="EAQ73146.1"
FT                   /translation="MFSKFFIERPVFASVVAIIISLAGAIGLTNLPIEQYPSLTPPTVK
FT                   VSATYTGADAQTIASTVASPIEDAINGADNMIYMDSTSSSSGTMSLTVYFDIGTDPDQA
FT                   TIDVNNRISAATAKMPDAVKKLGVTVRKTSSTTLAAISMYSSDGSMSAVDVYNYITLNV
FT                   LDELKRVPGVGDANAIGNRNYSLRIWLKPDLLNKFGITATDVISAVNDQNAQYATGKIG
FT                   EEPVTQKSPYVYSITMQGRLQNPSEFENIILRTNNDGSFLRLKDVADVEIGSQQYSSQG
FT                   RLNGNDAVPIMINLQSGANALHTAELVQAKMQELSKNFPKGLTYKIPYDTTKFVIESIK
FT                   EVVKTFVEALILVIIVMYMFLKNFRATLIPMIAVPVSLLGTFAGLYVLGFSINLLTLFA
FT                   LILAIGIVVDDAIIVVENIDRILHENEQISVKDAAIQAMQEVSSPVISIVLVLCAVFVP
FT                   VSFISGFVGEIQRQFALTLAISVTISGFVALTLTPSLCALFLRRNEGEPFKFVKKFNDF
FT                   FDWSTSVFSAGVAYILKRTIRFVLIFCIMLGAIFYLYKAVPNSLVPEEDQGLMISIINL
FT                   PSASALHRTISEVDHISQEVLKTNGVKDAMAMIGFDLFTSSLKENAAAMFIGLQDWKDR
FT                   NVSADQIIAELNKKFAFDRNASSVFIGLPPIPGLSITGGFEMYVQNKSGKSYDEIQKDV
FT                   NKLVAAANQRKELSRVRTTLDTTFPQYKLIIDRDKLKHYNLNMQDVFNTMNATIGTYYV
FT                   NDFSMLGKNFQVNIRAKGDFRNTQDALKNIFVRSNDGKMIPLDSFLTLQRSSGPDDVKR
FT                   FNLFPAAQVQGQPAPGYTSGQAIEAIAQVAKETLGDDYSIAWSGSAYQEVSSKGTASYA
FT                   FALGMIFVFLILAAQYERWLIPLAVVTAVPFAVFGSFLLVYLRGFSNDIYFQTGLLLLI
FT                   GLSAKNAILIVEFAMEERFKKGKGVFEAAVAAAKLRFRPIIMTSLAFTFGVLPMIFATG
FT                   AGSASRHSLGTGLIGGMIAASTLAIFFVPLFFYLLENFNEWLDKKRGKVHE"
FT   gene            complement(339730..340833)
FT                   /gene="cmeA"
FT                   /locus_tag="CJJ81176_0390"
FT   CDS_pept        complement(339730..340833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmeA"
FT                   /locus_tag="CJJ81176_0390"
FT                   /product="RND efflux system, membrane fusion protein CmeA"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0390"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72976"
FT                   /db_xref="GOA:A0A0H3PIS5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIS5"
FT                   /protein_id="EAQ72976.1"
FT                   /translation="MKLFQKNTILALGVVLLLAACSKEEAPKIQMPPQPVTTMSAKSED
FT                   LPLSFTYPAKLVSDYDVIIKPQVSGVIVNKLFKAGDKVKKGQTLFIIEQDKFKASVDSA
FT                   YGQALMAKATFENASKDFNRSKALFSKSAISQKEYDSSLATFNNSKASLASARAQLANA
FT                   RIDLDHTEIKAPFDGTIGDALVNIGDYVSASTTELVRVTNLNPIYADFFISDTDKLNLV
FT                   RNTQSGKWDLDSIHANLNLNGETVQGKLYFIDSVIDANSGTVKAKAVFDNNNSTLLPGA
FT                   FATITSEGFIQKNGFKVPQIGVKQDQNDVYVLLVKNGKVEKSSVHISYQNNEYAIIDKG
FT                   LQNGDKIILDNFKKIQVGSEVKEIGAQ"
FT   gene            complement(340928..341560)
FT                   /locus_tag="CJJ81176_0391"
FT   CDS_pept        complement(340928..341560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0391"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0391"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73011"
FT                   /db_xref="GOA:A0A0H3PED0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PED0"
FT                   /protein_id="EAQ73011.1"
FT                   /translation="MNSNRTPSQKVLARQEKIKAVALELFLTKGYQETSLSDIIKLSGG
FT                   SYSNIYDGFKSKEGLFFEILDDICKKHFHLIYSKTQEIKNGTLKEILTSFGLAFIEIFN
FT                   QPEAVAFGKIIYSQVYDKDRHLANWIENNQQNFSYNILMGFFKQQNNSYMKKNAEKLAV
FT                   LFCTMLKEPYHHLNVLINAPLKNKKEQKEHVEFVVNVFLNGINSSKA"
FT   gene            complement(341547..342923)
FT                   /locus_tag="CJJ81176_0392"
FT   CDS_pept        complement(341547..342923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0392"
FT                   /product="iron-sulfur cluster-binding domain protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM TIGR02745"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0392"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73224"
FT                   /db_xref="GOA:A0A0H3PBU4"
FT                   /db_xref="InterPro:IPR014116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR032879"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBU4"
FT                   /protein_id="EAQ73224.1"
FT                   /translation="MQGHITNYTKKRYFVYLIASIIIFALPFIRINENHFFLLSFDHSK
FT                   LNLFFISFLTQEFYLMPFVLIFLFLFIFFITTLGGRIWCAWSCPQTIFRVIYRDIIQTK
FT                   FLKIRKNINNKQKEYEGQYFKKFLGVIIFYFISLVAVSNLLWYFIPPEDFFNYIQNPGE
FT                   HLLLLGILFCASLLFTLDITYLQEKFCVYICPYARIQSVMFDHDTMQVIYDEKRGGLIY
FT                   DGHTKLHKKPPEGECIGCEACVSICPTHIDIRKGMQLECINCLECADACSKVQSKFNRP
FT                   SLINWTSAKAIETRSKVHYLRFRTIAYFIVLLIALLALIIMGSKKESMLLNINRSSELY
FT                   NISNVKGELVISNAYTFLFQNTDSKPHEYYFTANLEGINDGIEIIRPNKPFKLKAGEQV
FT                   KKIVVIRATKNLANNDKKDVIFPLHIKAYAKDNEKISVFRKSIFVYPKSTLIKDKNELK
FT                   "
FT   gene            343082..343294
FT                   /gene="rpsU"
FT                   /locus_tag="CJJ81176_0393"
FT   CDS_pept        343082..343294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="CJJ81176_0393"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0393"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73342"
FT                   /db_xref="GOA:A1VY90"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY90"
FT                   /protein_id="EAQ73342.1"
FT                   /translation="MPGIKVHPNESFDEAYRKFKKQVDRNLVVTEVRARRFFEPMTEIR
FT                   KKQKISARKKMLKRLYMLRRYESRL"
FT   gene            complement(343291..343437)
FT                   /locus_tag="CJJ81176_0394"
FT   CDS_pept        complement(343291..343437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0394"
FT                   /product="colicin E1 immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0394"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBR5"
FT                   /protein_id="EAQ73150.1"
FT                   /translation="MNDFFDFFHKFILKTENLNLEILTKNNKYFLIPNEVCRYKKSPFG
FT                   LLG"
FT   gene            343411..344016
FT                   /locus_tag="CJJ81176_0395"
FT   CDS_pept        343411..344016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0395"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0395"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73335"
FT                   /db_xref="GOA:A1VY92"
FT                   /db_xref="InterPro:IPR020913"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY92"
FT                   /protein_id="EAQ73335.1"
FT                   /translation="MKKIKKIIQIGMIGGLAAVAGGALAGCGSNNDNADTLNQAANAQG
FT                   AFVIIEETAPGQYKIKDQYPSDETRVVLKDLNGTERILSKEEMDALIKEEAAKIDNGTS
FT                   NLTKDNGQISSGGLSLGETLLASAAGAILGSWIGSKLFNNQNFANQQRGAFSNQSAYQR
FT                   SVNSFNKAGTTSSASSAKKSGFFGGGSKATSSSSSFGS"
FT   gene            344026..345195
FT                   /locus_tag="CJJ81176_0396"
FT   CDS_pept        344026..345195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0396"
FT                   /product="glutathionylspermidine synthase family protein"
FT                   /note="identified by match to protein family HMM PF03738"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0396"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73278"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBW5"
FT                   /protein_id="EAQ73278.1"
FT                   /translation="MQLLQVDKLQKDYLENIGFSWHTDEDGSDYISNKLVCVKESEANA
FT                   YYEAVNELYDMFIAAAQEVIDNDRFDELGIPFNLIDAIKMSWENEVHWHLYGRFDLAGG
FT                   LDGKPIKLIEFNADTPTALFESAILQWALLKQNGMDESAQFNSIYESLMDNFKRLITLD
FT                   ESVEGFEEHYQGWKILFSSVAGSKEEEITTKLLSHIANEAGFQTNFSFVDEVEFSEEGI
FT                   FKEGENYEYWFKLIPWEDIAIEEGELAMLLTQIMRNQRAIILNPAYTLLFQSKGILKIL
FT                   WELYPNHPLLLETKDTPLEGKNYVKKPVFGREGANISIIKDGKTLHENVGPYGNNKAIY
FT                   QEYVEFNSCENEYYQAGVFFAYEGCGLGFRKGGLVLDNYSKFVGHIIKD"
FT   gene            345198..346133
FT                   /locus_tag="CJJ81176_0397"
FT   CDS_pept        345198..346133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0397"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00389;
FT                   match to protein family HMM PF02826"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0397"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73085"
FT                   /db_xref="GOA:A0A0H3PB14"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB14"
FT                   /protein_id="EAQ73085.1"
FT                   /translation="MKIVCLDAATLGDYDLSVFEKFGSLQIYTTTNKEQTIERLKDANV
FT                   AMTNKVVIDKDVIDACKNLKLILETATGVNNIDIEYAKEKGIIVKNAAGYSTMSVVQHT
FT                   FAFMFAFLNQVLYYDKWSKEGKWCESPIFTDYSRILNTLSGKKHGIIGLGTIGKEVVKI
FT                   SKAFGAEIYYYSTSGANKNADFVHLELKDLLKTCDIISIHAPLNEKTKNLLTFEELKLL
FT                   KDNAILINVGRGGIINENDLAKIIDEKNIRVGLDVLEIEPMMKNHPLLSIKNKENLIIT
FT                   PHVAWASKEALNALMDIVYNNLKEWIENGK"
FT   gene            346123..346614
FT                   /locus_tag="CJJ81176_0398"
FT   CDS_pept        346123..346614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0398"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04461"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0398"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73383"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VY95"
FT                   /protein_id="EAQ73383.1"
FT                   /translation="MASEHSFDISAALDKQELKNAFEQAKKELDSRYDLKGIKCEIDLS
FT                   EKENIFKLSSSSEGKLDVLKDIVISKLIKRGINPNAIKELSRESGAMFRLNLKANDAID
FT                   SENAKKINKAIKDSKLKVNSSIRGEEIRVVAKQIDDLQAVMKLVKELDLELNVSFKNLK
FT                   "
FT   gene            346623..347099
FT                   /locus_tag="CJJ81176_0399"
FT   CDS_pept        346623..347099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0399"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0399"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73000"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIT7"
FT                   /protein_id="EAQ73000.1"
FT                   /translation="MKHCLALCFIFFLCACSAKNQNFSSQSLMVLIASPMIKINDAAFL
FT                   KKENNALNLEVYKLGQAFFELKIKDKICINAVCYDKQVFNQKFFKNVYYDDILNDILKA
FT                   NPLWQGRNLEKTDCGFEQNLKAKNYEIFYYVCDNKVSFFDKISHTKIILTHIQN"
FT   gene            347110..347934
FT                   /locus_tag="CJJ81176_0400"
FT   CDS_pept        347110..347934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0400"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0400"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73360"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC06"
FT                   /protein_id="EAQ73360.1"
FT                   /translation="MKFFLLVFCFVNLALAQVYKGELYFYHLQDKEIFAIVYDNTPMTP
FT                   LFDRDKNQTSSSFLIVDDINGNLEIPLFKTNDFWQDEHKKYKINSSKMLTYDNKNFQGE
FT                   NLGTTTLELVETQDGIRIKRSLDFIGFKDDFKEFHPVHKGVFSFEQIRQKPIFLQDGKI
FT                   SFEEWYYFYEDGMSRAILELNNFVYDINAHAFVKLNDLYNTKNQKFQNLLHEKLKNTCD
FT                   ECFEDLQNLQFNNNFLLNNGKLKICYLPFEGHFLDENICVEFNEDELKEFKK"
FT   gene            347934..349646
FT                   /locus_tag="CJJ81176_0401"
FT   CDS_pept        347934..349646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0401"
FT                   /product="ATPase, AAA family protein"
FT                   /note="identified by match to protein family HMM PF00004"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0401"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73245"
FT                   /db_xref="GOA:A0A0H3PJ78"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ78"
FT                   /protein_id="EAQ73245.1"
FT                   /translation="MEKLKNFLSLKNIEDTQIYKELKCAKNEALILRELCRNYVVSISS
FT                   INAFTLLSTIFGNDKYLYLDALEDLKKLIERGFVNQNSSFFKSLENNKTQTLTLALLQS
FT                   ELSLSEYFLEFLEAKPRLNFEKQEAYADYLEYLKDEFARIQLYERLSFIQKSAYNSEIK
FT                   NQIKLYEKHIKERLKKSKFYNVLADIFKEYNLEHKEQIIFLALLKEEYALSNESSISRE
FT                   MNSLLSLISENDLERHKNKKLLQENAPLLNLIEYDEYLNAFGDISKSFFIIDEILQRII
FT                   NFEPKQSKKIKIESVLKDQDIFELIEPSTDINDIIMPENTKELLENILKQQDKKVLERL
FT                   HSWGIKSNKNIEAKIIFYGPAGTGKTMSALAMAKSMKKSVLSFDCSKILSKWVGESEQN
FT                   VRKIFDTYKNIVQTCKQSPILLLNEADQFLSTRVDGSSGSDKMHNQMQNIFLEQIERFS
FT                   GVIIATTNFLESLDSAFSRRFDYKIEFQKPDFKDRLKIWEKFLPKKALFEKDFDINILS
FT                   NYELSGAQILMVVKNTALKVAVSKDGVFKMQDFIESIQKELNSSFDKSKIVGF"
FT   gene            complement(349611..350183)
FT                   /locus_tag="CJJ81176_0402"
FT   CDS_pept        complement(349611..350183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0402"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF01794"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0402"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73392"
FT                   /db_xref="GOA:A0A0H3PJG5"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJG5"
FT                   /protein_id="EAQ73392.1"
FT                   /translation="MQTKYFKFLAYFSFIISLIYGFYHIIKAFDFVKEAYIYTGIFALI
FT                   FLNLSLLFSLLKFKKTKNYPKILGIFAAFWAILHFLNYFIFDRNAQILRLFDDISHRLL
FT                   EASGFIAFLIIFLMLLSSFKIFKKLSKIRKLGYLCLVLASYHYFLTPKIPMFWEWSALI
FT                   IALFYFIVRYTKTLKKLKSNNLTFIKT"
FT   gene            complement(350183..351076)
FT                   /locus_tag="CJJ81176_0403"
FT   CDS_pept        complement(350183..351076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0403"
FT                   /product="oxidoreductase, molybdopterin binding, putative"
FT                   /note="identified by match to protein family HMM PF00174"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0403"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73300"
FT                   /db_xref="GOA:A0A0H3PJB0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJB0"
FT                   /protein_id="EAQ73300.1"
FT                   /translation="MIITPENLYKKRRDFLKLGAGALISSSVLASKLSALNFTSDTNPN
FT                   KLEISDEELATNYVNFYEFSTDKKKAVSLAQNFNTQNWKIDISGEIEKPLTLSMEDILK
FT                   FPLEERIYRFRCVETWSMVVPWVGFELRRLIEMAKPTSEAKFVKFTTLLDKSQFPDQDA
FT                   LFPTIDYPYVEGLRMDEAMHPLTLLAVGMYKKALKPQNGAPIRLVVPWKYGFKSIKSIV
FT                   KIEFTKEQPKSTWESYAPSEYGFYANVNPNVSHPRWSQANERALGDFFTKPTLMFNGYE
FT                   KEVASLYKNMDLKVNF"
FT   gene            complement(351131..351811)
FT                   /gene="pyrF"
FT                   /locus_tag="CJJ81176_0404"
FT   CDS_pept        complement(351131..351811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="CJJ81176_0404"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM TIGR01740"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0404"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73091"
FT                   /db_xref="GOA:A1VYA1"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA1"
FT                   /protein_id="EAQ73091.1"
FT                   /translation="MKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIE
FT                   ELKKVDDFKIFLDLKIHDIPNTMADACEEISKLGVDMINIHASAGKIAMQEVMTRLSKF
FT                   SKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKIIKE
FT                   HTQRNFLTLTPGIRPFGEKNDDQKRVANLTMARENLSDFIVVGRPIYKDNNPRKICEKI
FT                   LQEI"
FT   gene            complement(351808..352206)
FT                   /gene="nusB"
FT                   /locus_tag="CJJ81176_0405"
FT   CDS_pept        complement(351808..352206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="CJJ81176_0405"
FT                   /product="transcription antitermination factor NusB"
FT                   /note="identified by match to protein family HMM PF01029;
FT                   match to protein family HMM TIGR01951"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0405"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73138"
FT                   /db_xref="GOA:A1VYA2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA2"
FT                   /protein_id="EAQ73138.1"
FT                   /translation="MATRHQVRQSVISLLYAFELNSQNNVFVDEILDEKKIRNEQKNFT
FT                   LNLYHGILDNLNNIDETLNSFLNDNQITALGHVERAILRLGAYELLFTDTPSAIVINEA
FT                   IELAKELANDNSPKFINGVLDALIKAKK"
FT   gene            complement(352206..352670)
FT                   /gene="ribE"
FT                   /locus_tag="CJJ81176_0406"
FT   CDS_pept        complement(352206..352670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="CJJ81176_0406"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0406"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73329"
FT                   /db_xref="GOA:A1VYA3"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA3"
FT                   /protein_id="EAQ73329.1"
FT                   /translation="MNIIEGKLNLDSNTKIAIINARFNHIITDRLVEGAKDAFLRHGGK
FT                   EENLSLILVPGAFELPYALKKAIESKKFDAICCVGAVIRGSTPHFDYVSAETTKGIANV
FT                   SLNHNIPVSFGVLTTDTIEQAIERAGSKAGNKGFEAMTTVIEMLNLSKEL"
FT   gene            complement(352667..353482)
FT                   /gene="kdsA"
FT                   /locus_tag="CJJ81176_0407"
FT   CDS_pept        complement(352667..353482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="CJJ81176_0407"
FT                   /product="3-deoxy-8-phosphooctulonate synthase"
FT                   /EC_number="2.5.1.55"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR01362"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0407"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73259"
FT                   /db_xref="GOA:A1VYA4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA4"
FT                   /protein_id="EAQ73259.1"
FT                   /translation="MKKMILIAGPCVIESKDLIFKVAEQLKNFNENPNIEFYFKSSFDK
FT                   ANRTSINSFRGPGLEEGLKILQSVKDEFGMKILTDIHESNQANPVSEVADVLQIPAFLC
FT                   RQTDLLVAAAKTKAKVNIKKGQFLNPSDIKYSVKKALQTRGIEDEGYEAAQKNGVFVAE
FT                   RGSSFGYGNLVVDMRSLVIMREFAPVIFDATHSVQMPGAAGGSSGGKSEFVEPLARAAA
FT                   AVGIDGFFFETHINPCEALCDGPNMLNLTRLKNCVNTLLEIQNIIKENK"
FT   gene            complement(353479..354411)
FT                   /locus_tag="CJJ81176_0408"
FT   CDS_pept        complement(353479..354411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0408"
FT                   /product="integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0408"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73458"
FT                   /db_xref="GOA:A0A0H3PF38"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF38"
FT                   /protein_id="EAQ73458.1"
FT                   /translation="MLKVIKHNLGIYFMILACLDFALMGACAKILSKEMSSIEIMFFRN
FT                   IIGIFFIVYLLKRSKAHKEGGHFWLLVFRGVVGTLSLYMFFYNVSNITLGGAFAFQKTA
FT                   PIFITLIAFVVFKENIGIKGWIGILIAFGGVLLIAQPWAHNLNHSGFDLKNSVIGITSG
FT                   FLAALALTSVRELRKSYTTEQIAFSFILLGTLMPLISMISAEFFEPQHLDSLHLDFILA
FT                   PFVMPSLTAWLIIAIMGTLGTIYQIHVTKAYGIAKQAGVVAGVSYLDVVFSMIVGIILG
FT                   DSLPSAMVFLGIIGIIFGGLILVKNKGKK"
FT   gene            354512..355894
FT                   /locus_tag="CJJ81176_0409"
FT   CDS_pept        354512..355894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0409"
FT                   /product="GTPase family protein"
FT                   /note="identified by match to protein family HMM PF01926;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00650"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0409"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73463"
FT                   /db_xref="GOA:A1VYA6"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA6"
FT                   /protein_id="EAQ73463.1"
FT                   /translation="MQSIILIGKPNVGKSSLFNRMARQRIAITSDISGTTRDTNKTQIH
FT                   IHSKKAMLIDSGGLDESDELFKNVKKNTLKVAKESDIILYLVDGKLAPDDEDRQFFYSL
FT                   KKLGKPIALVVNKVDNKKDEERAWEFANFGVKEIFNLSVTHNVGLDELYEWLEKFLHEE
FT                   FLIPDEEENLEDFLEHYEEGKEFQFKEVDQNHIRVGIVGRVNVGKSSLLNALVKQERSV
FT                   VSSIAGTTIDPVNESVVHKDKVIEFVDTAGIRKRGKIQGLERFALNRTEKILSHSQIAL
FT                   LVLDAHEGFNELDERIAGLVAKHYLGVIIVLNKWDKSEMDFDKTVKELRLDRFKFLAYA
FT                   PVISVSALSGKRVHVLLDKILQIFENFTQKIQTSKLNTLIENATRAHPLPHDYGKLVKI
FT                   YYAVQYDLAPPKIALIMNRPKALHFSYKRYLQNQIRKEFNFEGVPLVIASRKKGSKEND
FT                   ES"
FT   gene            355881..356378
FT                   /gene="aroK"
FT                   /locus_tag="CJJ81176_0410"
FT   CDS_pept        355881..356378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="CJJ81176_0410"
FT                   /product="shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="identified by match to protein family HMM PF01202"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0410"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73427"
FT                   /db_xref="GOA:A0A0H3PBL5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL5"
FT                   /protein_id="EAQ73427.2"
FT                   /translation="MMKAKNIVFIGFMGSGKSTLARALAKDLDLVFLDSDFLIEQKFNQ
FT                   KVSEIFEQKGENFFREQEQKMSDFFSSCEKTCIATGGGFVNVSNLEKAGFCIYLKASFE
FT                   YLKKRLDKDEISKRPLFYDEIKAKKLYNERLSKYEQKANFILNIENKNIDELLSEIKKV
FT                   IK"
FT   gene            356375..357334
FT                   /gene="trpS"
FT                   /locus_tag="CJJ81176_0411"
FT   CDS_pept        356375..357334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CJJ81176_0411"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="identified by match to protein family HMM PF00579;
FT                   match to protein family HMM TIGR00233"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0411"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73130"
FT                   /db_xref="GOA:A0A0H3PB64"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB64"
FT                   /protein_id="EAQ73130.1"
FT                   /translation="MRVLTGLQPSGDLHIGNYFGAIKQMVDAQEKSQMFMFIANYHAMT
FT                   SSQDGEKLKQNSLKAAAAFLSLGIDPQKSVFWLQSDVKEVMELYWILSQFTPMGLLERA
FT                   HSYKDKVAKGLSASHGLFSYPVLMAADILLFDTQIVPVGKDQIQHVEIARDIALKVNNE
FT                   WGEIFTLPEAKVNEEVAVVVGTDGAKMSKSYQNTIDIFSSEKTLKKQISSIVTDSTALE
FT                   DPKDFKNCNVFKIAKLFLDEAGQKELQIRYEKGGEGYGHFKMYLNELANAYFKEAREKY
FT                   NELLEKPSHLKEILDFGATKARKIAQEKMQKIYEKIGL"
FT   gene            357345..358580
FT                   /gene="serS"
FT                   /locus_tag="CJJ81176_0412"
FT   CDS_pept        357345..358580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CJJ81176_0412"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF02403; match to protein
FT                   family HMM TIGR00414"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0412"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73047"
FT                   /db_xref="GOA:A1VYA9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYA9"
FT                   /protein_id="EAQ73047.1"
FT                   /translation="MLDLKNLQNNFDEVAKKLKNKKVDENILKKLAELFASLKKEKTAL
FT                   EEFQAFQNKFSKELATAEDKESLKAKLSENKSKINEQSAKVNALENELEEIAHAIPNIP
FT                   DECVPVGEDEDENVELKKVLNPSSFDFTPKEHFELGESLNWLDFVRGVKISQSRFCVLK
FT                   NEGALLSRALVNYMIDFNRSRGFEFVNVPFLVNGATMFGTGQLPKFKEDMYKVDDEDLY
FT                   LISTSEIPVTNLYSGEILASETLPIKMTCYSACFRKEAGSAGRDTRGIIRQHQFEKVEL
FT                   VSITKPEQSDSVFNEMLECASDLLSSLGLAHRHLMLCTGDLGFSAAKTVDLEVWLPGQN
FT                   KYREISSVSNCRDFQARRAKIRYKNEQGKNELVHTLNGSSLAVGRTLVAIMENYQDKEG
FT                   KIHIPDVLKKYF"
FT   gene            358590..361052
FT                   /locus_tag="CJJ81176_0413"
FT   CDS_pept        358590..361052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0413"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0413"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73256"
FT                   /db_xref="GOA:A0A0H3PJ87"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ87"
FT                   /protein_id="EAQ73256.1"
FT                   /translation="MAEQEDIILEKPEDGLNQPRLDESLEGFKGQEGQAPEDEEFASLP
FT                   EELPQENSESGFKFTRESAPEDVSTFEEVESQEPTPWYKDRKFMSLVGLSLGIICILVF
FT                   TLFYLTFSEGKIKPDIIASKPLEQPVVMPDESYKYNDMQRIDGMIQKANALYLKGEVEQ
FT                   ALKVYEQVAVYNESLSNYNLGVSQMNENKFQEAFESFKKAIANGENQSVAAINAAVCAL
FT                   KLNDKEKFRYYIDLAQVYLPKEGKSKLYDYYLSLINYYKGYYPEALQMLQRTDMEPYSD
FT                   VAKYLSAKIYAKMDFDSKAIQQLNSQGNFESSLSLGLLYARIGEYAKAKVALSTAMKIE
FT                   RDFNQSLAALTLVDIKTGNYQDMLARLQNSYDNDKDRYKILDAYKIQVRLNKDLFNIAV
FT                   AQNSFSKDLLKKQKDQFDLLFYFAPYQVFDSKQAALYIKKANVTDFVDDSADAGVYLNT
FT                   SKALSSTNVKIANIINYALNQKLRLANQEFQKLIKDYPEHSILHYNLALTYAQMQNYEL
FT                   AYKHFSSSYHLNPKNYLAGAFAMFCAKLIDIDTTKLYNEILDNIAADSNFKANMQKSML
FT                   FLVNNNYISMLPYLDETKKDTPLSLIFEAIVAKNNNLNNQVDVKIAKLRSELPEDILAN
FT                   ILYFNSLNSNLNIKEYAQNAQIHFKNLKLDYRSVFGGPNIAREFYVNLMHIAGLLNLER
FT                   QKIKELINVSGAKDEGILQTLAYLDIFAQQYEEAYALYNSLIDDYGAKDTKTLFLAAVA
FT                   AIGANNPNSAIALLQLSKLTDKNNKESKAALGMLYQEVKNYEAAISQYKTLPNNFKSEF
FT                   FTFDINNN"
FT   gene            complement(361083..361718)
FT                   /locus_tag="CJJ81176_0414"
FT   CDS_pept        complement(361083..361718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0414"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBZ1"
FT                   /protein_id="EAQ73328.1"
FT                   /translation="MQVNTFSNIASMAQTQVSNKKADDAKENTKDKNVQSANSSKDVDK
FT                   NTLEKLNALGGKGITQIYLVQFQQQTMNAVIGSSNAQTGLDSLLNGANLDTAKSILTNI
FT                   DFASLGYSGKNPLDMNTDELQQLVSEDGFFGVENTANRIADFVIKGGGDDVEKLKKGLE
FT                   GMKKGFEQAEKMWGGELPQISQNTIDAALKKVSDRIDELGGKTLDLQA"
FT   gene            complement(361816..363258)
FT                   /gene="pyk"
FT                   /locus_tag="CJJ81176_0415"
FT   CDS_pept        complement(361816..363258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="CJJ81176_0415"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="identified by match to protein family HMM PF00224;
FT                   match to protein family HMM PF02887; match to protein
FT                   family HMM TIGR01064"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0415"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73106"
FT                   /db_xref="GOA:A0A0H3PIY7"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIY7"
FT                   /protein_id="EAQ73106.1"
FT                   /translation="MLKKTKIVATVGPASEKEEILRQMIINGVNVFRLNFSHGTHEYHK
FT                   KNLDTIRKVAKELHIRIGILQDISGPKIRTGELKEPFELKKGDRLDFYRETILGEKIAQ
FT                   NHYKISINQKSILDMLKIDEYIYLYDGSIRAKVVNIDDQKIETIIENDGFLNSNKGINF
FT                   PNTKINIDVITQKDKNDLLWGIKNEVDFLAISFVQNAHDIDEVREILAQNNAKISIFAK
FT                   IEKFDAVENIDEIIKSSDGIMVARGDLGIEVPYYKVPNIQKEIIQKANNASKPVITATQ
FT                   MLFSLAKSKTATRAEISDVANAVLDGTDAVMLSEESAVGIDPANAVGIMCQTIIETEKR
FT                   YPYNKFNDFNDLDNTDKIMRSSAHLATDLNADAIFSLTSSGKSAIKIARYRPNIEIIAV
FT                   GHSEKTLNSLSIVWGVNPAILVNKSNELTELLKDSVRSSVEKGFMDEDKCYLLTAGFPT
FT                   GVEGTSNLIRILNKEQIAYYLQ"
FT   gene            complement(363307..364653)
FT                   /locus_tag="CJJ81176_0416"
FT   CDS_pept        complement(363307..364653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0416"
FT                   /product="malate:quinone oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF06039"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0416"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73258"
FT                   /db_xref="GOA:A0A0H3PAL7"
FT                   /db_xref="InterPro:IPR006231"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAL7"
FT                   /protein_id="EAQ73258.1"
FT                   /translation="MSQQEFDVLVIGAGISGAALFYELARYTNIKNIALIEKYNTAATL
FT                   NSKGTSNSQTIHCGDIETNYTLEKARKVKRTADMIVKYGLMQNAQNNFMFSHQKMALAV
FT                   GDIECDYMKKRYEEFKELYPYVKFFDKAKIKQIEPKVVLGEDCNQDRPENICAMGVESG
FT                   EVFTTVDFGKMSINLIEQAQKQNKNTFVAFNQEIIHIEKKDDIFILKTSNHQEYHAKSV
FT                   VVNAGAHSLYLAHKMNLGMDKSCWPVAGSFYLTKQKLLNGKVYMVQNPKLPFAALHGDP
FT                   DLLADMNTRFGPTALVIPKLERYHGLKSVPEFFEALKLDKTVLKVTFNMFKDATIRNYI
FT                   FYNYLFELPFVDKSLFVKDAKKIVPSLKASDIYYAKGFGGVRPQVIDKTKGELMLGEAS
FT                   ITETPGIIFNMTPSPGATSCLGNAERDAKLVCNYLGMEFNEDKFSSELL"
FT   gene            complement(364772..365401)
FT                   /locus_tag="CJJ81176_0417"
FT   CDS_pept        complement(364772..365401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0417"
FT                   /product="transcriptional activator, putative, Baf family"
FT                   /note="identified by match to protein family HMM PF03309;
FT                   match to protein family HMM TIGR00671"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0417"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73381"
FT                   /db_xref="GOA:A0A0H3PJF7"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJF7"
FT                   /protein_id="EAQ73381.1"
FT                   /translation="MLLCDIGNSNANFLDDNKYFTLSIDQFLEFKNEQKIFYINVNEHL
FT                   KEHLKNQKNFINLEPYFLFDTIYQGLGIDRIAACYTIEDGVVVDAGSAITIDIISNSIH
FT                   LGGFILPGIANYKKIYSHISPRLKSEFNTQVSLDAFPQKTMDALSYGVFKGIYLLIKDA
FT                   AQNKKLYFTGGDGQFLANYFDHAIYDKLLIFRGMKKIIKENPNLLY"
FT   gene            complement(365388..365678)
FT                   /locus_tag="CJJ81176_0418"
FT   CDS_pept        complement(365388..365678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0418"
FT                   /product="tram-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0418"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73347"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBH8"
FT                   /protein_id="EAQ73347.1"
FT                   /translation="MIKILEQTIKALKLNLKPYDLSMLTRKKSYICAKDQNNILFMYTG
FT                   KTKFLMKDALFLENLAQQININNKYFFSMTSLCSKAKNHLEMKGFNIYAAL"
FT   gene            complement(365675..366673)
FT                   /locus_tag="CJJ81176_0419"
FT   CDS_pept        complement(365675..366673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0419"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0419"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72997"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAA5"
FT                   /protein_id="EAQ72997.1"
FT                   /translation="MKKIFLTLFCLIFLCACGTKRQYFEPKQTDGDLSHNSNLKSKIVD
FT                   WNLVSAKLSNNTAILKNNISIDKFKLPKNYMLLAYQDGEYFTADNNGNLKIFDNSYNEI
FT                   YNFQFDASVVGVASNGDDLALVLANNTIVLANRSLGIKFSQTLTSAPAQDSRTANPIFL
FT                   DNIIVYPTLDGKILILSRNNLQIIKDVVISAENFFNNAIHLSVIGDKLIAATAKKIIVV
FT                   SPARTLYLDADIKDVALSDDGIFILEKDGTIIKTDYNLRKIAEKKFEFAIFVKSNIYNN
FT                   YLYIFEKTGYLIKMNLNLDNTQVFKLSEAVDKISFMGNGKFYYGNKILDLL"
FT   gene            complement(366670..367248)
FT                   /locus_tag="CJJ81176_0420"
FT   CDS_pept        complement(366670..367248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0420"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73156"
FT                   /db_xref="GOA:A0A0H3PBR7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBR7"
FT                   /protein_id="EAQ73156.1"
FT                   /translation="MGLKDNLKAVKNELNTEEQFIENFIKGERFIRKYKFYISAVVIIL
FT                   VAWFAGNFIISKINDYKTKEANEIYANLIQDPSNKNLLEQLKNKNTNLYAIFLLKENIN
FT                   DFNNTALQNELKQIYSNTQTNTLLKNIIALSLGDKSIFLKNYDKLLEAYKFLEQNKIEE
FT                   ANVLLSQIKENSSLNQITKNLKHYQGITQ"
FT   gene            367392..367676
FT                   /gene="gatC"
FT                   /locus_tag="CJJ81176_0421"
FT   CDS_pept        367392..367676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="CJJ81176_0421"
FT                   /product="aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase,
FT                   C subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF02686;
FT                   match to protein family HMM TIGR00135"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0421"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73439"
FT                   /db_xref="GOA:A1VYB8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYB8"
FT                   /protein_id="EAQ73439.1"
FT                   /translation="MQIDEKLLSKLEKLSALQITKNRNETIVQLSEIVNFVEKLNELDL
FT                   DSQEITVSTIKGGAPLRIDEIRNSNVIDEVLDCAPKKQEHFFVVPKIIE"
FT   gene            367745..368308
FT                   /locus_tag="CJJ81176_0422"
FT   CDS_pept        367745..368308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0422"
FT                   /product="cvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0422"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73236"
FT                   /db_xref="GOA:A0A0H3PBD3"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBD3"
FT                   /protein_id="EAQ73236.1"
FT                   /translation="MNFYWFDAFILGFTLLLGLKGIINGLIKEIFGLLGIIGGVFIASK
FT                   YATQAAEFIQSTFYKIENQSLAGFAGFLAILIIFWIVCLLAGNFLSKLIKLSGLGFLDR
FT                   IGGFIFGGAKIFLIFAILVFCVARIDFLNDKLDNFAKNSYTLNLLKETGSFIMNQPLTE
FT                   NSLDHANEKLQDIVSDLNNTQKGE"
FT   gene            368310..368783
FT                   /gene="fur"
FT                   /locus_tag="CJJ81176_0423"
FT   CDS_pept        368310..368783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="CJJ81176_0423"
FT                   /product="ferric uptake regulation protein"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0423"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73017"
FT                   /db_xref="GOA:A0A0H3PBL7"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL7"
FT                   /protein_id="EAQ73017.1"
FT                   /translation="MLIENVEYDVLLERFKKILRQGGLKYTKQREVLLKTLYHSDTHYT
FT                   PESLYMEIKQAEPDLNVGIATVYRTLNLLEEAEMVTSISFGSAGKKYELANKPHHDHMI
FT                   CKNCGKIIEFENPIIERQQALIAKEHGFKLTGHLMQLYGVCGDCNNQKAKVKI"
FT   gene            368784..370289
FT                   /gene="lysS"
FT                   /locus_tag="CJJ81176_0424"
FT   CDS_pept        368784..370289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="CJJ81176_0424"
FT                   /product="lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF01336; match to protein
FT                   family HMM TIGR00499"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0424"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73080"
FT                   /db_xref="GOA:A1VYC1"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYC1"
FT                   /protein_id="EAQ73080.1"
FT                   /translation="MFDNILEQQRIEKAKELKNLGINPYPHFLEKEMSLKTFKDKFSYI
FT                   LEQVEKRDESVNAVVAGRLKLLRIAGKSIFANIEDEDTNLQIYFSKDSVGEELYTILKK
FT                   NLEVGDIVLVKGFPFVTKTGEFSLHASEVKLATKAIVPLPEKYHGLTDIEQRYRKRYVD
FT                   MIMNVEVRKDFLVRSKVVSLIRHFFENKGFLEVETPMMHPIAGGANAKPFVTFHNSLGV
FT                   ERFLRIAPELYLKRLIVGGFEAVFEINRCFRNEGMDLTHNPEFTTIEFYWAYHNYKDLM
FT                   DLTEELFALLLDKLNLGKTIEFDGKMINFSKPFERITYKDALCKYGGLDRDLIEDKEKI
FT                   LTKLKADGFEANEKLELGHLQAELFDNYVEEKLINPTFVIDFPISISPLSRRSDEDSQI
FT                   AERFELFICGRELANGFNELNDPLDQYERFLKQIEAKNAGDEEACEMDEDFVNALGYGM
FT                   PPTAGQGIGIDRLVMLLTNKKSIRDVILFPAMRPLKSELKEKE"
FT   gene            370286..371530
FT                   /gene="glyA"
FT                   /locus_tag="CJJ81176_0425"
FT   CDS_pept        370286..371530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="CJJ81176_0425"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="identified by match to protein family HMM PF00464;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0425"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73109"
FT                   /db_xref="GOA:A1VYC2"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYC2"
FT                   /protein_id="EAQ73109.2"
FT                   /translation="MSLEMFDKEIFDLTNKELERQCEGLEMIASENFTLPEVMEVMGSI
FT                   LTNKYAEGYPGKRYYGGCEFVDEIETLAIQRCKKLFNCKFANVQPNSGSQANQGVYAAL
FT                   INPGDKILGMDLSHGGHLTHGAKVSSSGKMYESCFYGVELDGRIDYEKVREIAKKEKPK
FT                   LIVCGASAYARVIDFAKFREIADEIGAYLFADIAHIAGLVVAGEHPSPFPYAHVVSSTT
FT                   HKTLRGPRGGIIMTNDEEFAKKINSAIFPGIQGGPLMHVIAAKAVGFKFNLSDEWKIYA
FT                   KQVRTNAQVLANVLMDRKFKLVSDGTDNHLVLMSFLDREFSGKDADLALGNAGITANKN
FT                   TVPGEIRSPFITSGLRLGTPALTARGFKEKEMEIVSNYIADILDDINNEKLQENIKQEL
FT                   KKLASNFIIYERAMF"
FT   gene            371527..372306
FT                   /locus_tag="CJJ81176_0427"
FT   CDS_pept        371527..372306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0427"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73448"
FT                   /db_xref="InterPro:IPR015061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF31"
FT                   /protein_id="EAQ73448.1"
FT                   /translation="MISPMDMSLIKIIGDHYYIRRDKIVNKITHRGRLFFDKFERVDAP
FT                   LNLNVMREHAAKKIVVAHDLITKDNKVENIVFDYNGFNAERFYHRAQLILREEGFINFT
FT                   AYKTKTPGHLHLYIHKGHTALNEGYSLASKLSMMFASKMPVEWKVFPSMDVPREFNILI
FT                   LPYEVYQKERGSSWSKHFTAYKTKTPGHLHLYIHKGHTALNEGYSLASKLSMMFASKMP
FT                   VEWKVFPSMDVPREFNILILPYEVYQKERGSSWSKHM"
FT   gene            372320..373156
FT                   /locus_tag="CJJ81176_0428"
FT   CDS_pept        372320..373156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0428"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05036"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0428"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73388"
FT                   /db_xref="GOA:A0A0H3PC19"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC19"
FT                   /protein_id="EAQ73388.1"
FT                   /translation="MENQKNEFDDIILEKSNKSEKVKKILLRVIALVILFLAIMIVMKL
FT                   INGSGDENTQNQSVLPSEPIATQDNNNDTSFESMPITDNTSAEDQFEALRKQFQDEQNT
FT                   TQNTTASSSNNNDSTNFAMPDQEVPAEPTAATSENTAPQASAPKQEVKQTVKPKEEAKK
FT                   QTAVKKEKESTKQTPKKEQNANDLFKNVDAKPVHPSGLASGIYVQIFSVSNLDQKSKEL
FT                   ASVKQKGYDYKLYKTTVGGKEITKVLIGPFEKADIAAELAKIRKDIAKDAFSFTLK"
FT   gene            373153..373941
FT                   /gene="aroE"
FT                   /locus_tag="CJJ81176_0429"
FT   CDS_pept        373153..373941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="CJJ81176_0429"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="identified by match to protein family HMM PF01488;
FT                   match to protein family HMM TIGR00507"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0429"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73100"
FT                   /db_xref="GOA:A0A0H3PIY4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIY4"
FT                   /protein_id="EAQ73100.1"
FT                   /translation="MKFLAVIGDPISHSKSPRMHNNAIKALGLDSIYTRYHLRNANCLR
FT                   EDFFKLGLSGANITLPFKEKALDIADVKDDFARNIGSANTLCLKEDKIYAYNTDALGFL
FT                   EVIKDFDNIKKALILGAGGTALALAYVLKQKGVEVHIANRSKERFKDFLAYRAYLYKDL
FT                   QDFDFDLVVNSTSAGLKDENLPCDRELLDRILPKAKFAFEVIYGRETPFYRLCKEYHLK
FT                   IKDGLDMLLWQGVFAFELFFEIRDKREMIKNAMQQALILK"
FT   gene            complement(374015..374914)
FT                   /locus_tag="CJJ81176_0430"
FT   CDS_pept        complement(374015..374914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0430"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0430"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73276"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBE5"
FT                   /protein_id="EAQ73276.1"
FT                   /translation="MKKYILLASSMLILAACGGTSSNFVNVSMPNFKPQVPTKVEPIDS
FT                   GVSIALEPINIEQNNNYSDYFENSVLKIRIEKEIDLLKQNLEEQIKTIARLKGYKIVTA
FT                   NPDYTLKNSISIYTEEKNAQKTSNFMSGDYIKSNLGINFKGKIDFIDAHNPQNSTNLSS
FT                   STKLDSLVALNYPIKNDDGVNMFKTTISTVPTQLNKGLEQPAFEIDKSFLAFYKNTLNT
FT                   LYNNLPKATDIGKTIPNTNSGFNSFDGDATFEESLPQTNSNQNNTIESTPTQNIPTNPS
FT                   SINQNNKSKNQDGVEIFE"
FT   gene            375004..375819
FT                   /gene="lgt"
FT                   /locus_tag="CJJ81176_0431"
FT   CDS_pept        375004..375819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="CJJ81176_0431"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="identified by match to protein family HMM PF01790;
FT                   match to protein family HMM TIGR00544"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0431"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73200"
FT                   /db_xref="GOA:A1VYC7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYC7"
FT                   /protein_id="EAQ73200.1"
FT                   /translation="MEFWQHIYSNFNVIAFSIFGLKVHWYGIMYVIALLLALLLAKFFV
FT                   KKFQLDINEKHLDSYFIWVEIGVILGARLGYILIYDANTMYYITHPWQIFNPYINGEFV
FT                   GIRGMSYHGAIIGFLIATLLFCKKYKTNPWIFLDLVALSVPLAYVFGRIGNFLNQELFG
FT                   RITNVPWGIYVDGILRHPSQLYEAFLEGIVVFIIVYLARFKQSFQGELILVYAGAYSLA
FT                   RFICEFYREPDFGIGFVLWGMSMGQILSFIMFITALLVYICIKFKKVNI"
FT   gene            375889..376671
FT                   /gene="frdC"
FT                   /locus_tag="CJJ81176_0432"
FT   CDS_pept        375889..376671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdC"
FT                   /locus_tag="CJJ81176_0432"
FT                   /product="fumarate reductase, cytochrome b subunit"
FT                   /note="identified by match to protein family HMM PF02967"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0432"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73136"
FT                   /db_xref="GOA:A0A0H3PEJ9"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR004224"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEJ9"
FT                   /protein_id="EAQ73136.1"
FT                   /translation="MRELIEGYLGKSIEGKKSKMPAKLDFIQSASGLFLGLFMWVHMLF
FT                   VSTILVSEDFFNSVVHFLELKFVYDNPVMSYLTSFLAACVLVVFFVHALLAMRKFPINY
FT                   RQYQILRTHSKKMNHSDTSLWWVQAFTGFIMFFLGSAHLIFIVTNADKISGDMSGDRVV
FT                   SHFMWLFYAVLLVCVELHGSIGLYRLCVKWGWFEGKNVKESRKKLKTAKWIISIFFLVL
FT                   GVLSLAAFIKIGYENYQNQTQTTAMIKNYNGANYEYTI"
FT   gene            376655..378646
FT                   /gene="frdA"
FT                   /locus_tag="CJJ81176_0433"
FT   CDS_pept        376655..378646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdA"
FT                   /locus_tag="CJJ81176_0433"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF02910; match to protein
FT                   family HMM PF07992; match to protein family HMM TIGR01812"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0433"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73056"
FT                   /db_xref="GOA:A0A0H3PEF4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEF4"
FT                   /protein_id="EAQ73056.1"
FT                   /translation="MNIQYSDALVIGGGLAGLRAAIEVAKSGQSVTLLSICPVKRSHSA
FT                   AVQGGMQASLANGAKGEGDNEDLHFADTVKGSDWGCDQEVARMFAQTAPKAVRELAAWG
FT                   VPWTRVTKGPRTVVINAQKTVIEEKEEAHGLINARDFGGTKKWRTCYIADATGHCMLYG
FT                   VANEAIKHQVKIIDRMEAVRIIHDGKKCLGVIARDLTNGQLIAYIARGTMIATGGYGRI
FT                   YKQTTNAVICEGTGAAIALETGLCRLSNMEAVQFHPTPIVPSGILLTEGCRGDGGILRD
FT                   VDGYRFMPDYEPEKKELASRDVVSRRMMEHIRKGKGVKSPYGDHLWLDISILGRAHVEK
FT                   NLRDVQDICKTFNGIDPADEGPKGWAPVLPMQHYSMGGIRTKPTGESQWLNGLFACGEA
FT                   ACWDMHGFNRLGGNSCAETVVAGMIVGDYFADYCKNNGEVIDTNVVKDFLTKEYQYLKS
FT                   LVDKEGKHNVFEIKNRMKEIMWDKVAIFRTGEGLKEAVDELEKLYKDSQDVKVHCKELD
FT                   CANPELEEAYRVPRMLKIALCVAYGALLRTESRGAHYREDYPKRDDLNWMKRTNTFWVE
FT                   GETLPRIEYEELDIMKMEIPPAFRGYGAKGNIIENPLSEKRQAEVDAIREKMEAEGKGR
FT                   YEIQNALMPYELQAKYKAPNQRIGVDYE"
FT   gene            378639..379364
FT                   /gene="frdB"
FT                   /locus_tag="CJJ81176_0434"
FT   CDS_pept        378639..379364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frdB"
FT                   /locus_tag="CJJ81176_0434"
FT                   /product="fumarate reductase, iron-sulfur protein subunit"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF00111; match to protein
FT                   family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0434"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73378"
FT                   /db_xref="GOA:A0A0H3PEZ1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEZ1"
FT                   /protein_id="EAQ73378.1"
FT                   /translation="MSRKLTIKAFKYNPLSKISKPHFVTYELEETPFMTVFVCLTLIRE
FT                   KMDADLSFDFVCRAGICGSCAMMINGVPKLACKTLTKDYPDGVIELMPMPAFRHIKDLS
FT                   VNTGEWFEDMCKRVESWVHNEKETDISKLEERIEPEVADETFELDRCIECGICVASCAT
FT                   KLMRPNFIAATGLLRTARYLQDPHDHRSVEDFYELVGDDDGVFGCMSLLACEDNCPKEL
FT                   PLQSKIAYMRRQLVAQRNK"
FT   gene            379392..381578
FT                   /locus_tag="CJJ81176_0435"
FT   CDS_pept        379392..381578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0435"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF00350;
FT                   match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0435"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73461"
FT                   /db_xref="GOA:A0A0H3PJL7"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJL7"
FT                   /protein_id="EAQ73461.1"
FT                   /translation="MKELFQKIWQNELQFLNFDAKFQDKSKLDTAECAIILSVNKDNYE
FT                   RYFLLKEFQELCKKIDLRVDIFSMQNAQICILNLFKSGFISKQDLLKALKILEKISKNT
FT                   EIFDFILQEKVQSIDQKALFQNDFKELNTINLELQKLSFDENLKSRLQKTLEKFQNLEF
FT                   NIAITGVMNAGKSSLLNALLKEDFLGVSNIPETANLTVLSYGKSEEAKIYFWDKKEWQN
FT                   ILESSHFNADLKEFIDKLDKSVNIEDFIKDKPLIQNIALCELKNFSSAKNKISALIKKI
FT                   EIKSHLEFLKNNISIVDTPGLDDVVVQREIVTNEYLRESDFLIHLMNASQSLTQKDADF
FT                   LVHCLLNSRLSKFLIVLTKADLLSKKDLEEVIVYTKESLKSRLVDLDENLVEKIDFLCV
FT                   SAKMASDFYKGLASKESLQKSGMQEFENYLFNELYAGEKSKIALRAYKKELHLELKNIL
FT                   SEYEMQNRLIKENKQGVSEENQKLLLELQKQNTLLKEAQDEISNSIAKLKNIDSGIDNL
FT                   VLLLAKKLKERLIDEFKYLKNNAQKLNLSRILNIVDITTKDGINDILREIKFENIKKIE
FT                   ELKTNLSLKYDFLKDDFDNGFEGFKDGISKNIDSIFQSEKFALLRLKIEKLSNLKSDLY
FT                   ELETNLDTVIFDTFKEFKMSEILNSLNINGAFFEFLNDKLKHYEKNQKSKLESLEKVLQ
FT                   SLKNQDANILNSFEENLEKIEKLKQLEMGLLNAD"
FT   gene            381688..383397
FT                   /locus_tag="CJJ81176_0436"
FT   CDS_pept        381688..383397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0436"
FT                   /product="GTP-binding protein"
FT                   /note="identified by match to protein family HMM PF00350;
FT                   match to protein family HMM PF01926"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0436"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73444"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJK4"
FT                   /protein_id="EAQ73444.2"
FT                   /translation="MHASYALENELKELVFSLDKNVNIAIIGQFSSGKSSLLNLILGRD
FT                   CLPTGVVPVTFKPTFLRYAKEYFLRVEFEDGSDIITNIEKLAFYTDQRNEVKQAKSLHI
FT                   FAPIPLLEKITLVDTPGLNANENDTLTTLDELKNIHGAIWLSLIDNAGKKSEEDAIKAN
FT                   LELLGENSICVLNQKDKLSAEELDNVLNYAKSVFLKYFNELIAISCKEAKDEQSYEKSN
FT                   FQSLLDFLTQLDTTVLKEKFVKRKILNLCEILEDENQLFVGIFDRLLNQFQSYEKHLLL
FT                   AYENFLKEIEILNHQILEQLKSISERISSEIFASVKEKDAYFYKESKGFLKKDLYTRYD
FT                   YKAPYISSDDAFLAMFYNSDVMSKEFKKIKNELYKSFEEIKMKLKDFINILEREILLFK
FT                   AEFSNIQKDHIFQSDKNFSELRAFCNASDEYFLKDFKELLFKSILELDLFFEKLNLKAF
FT                   TNYENATKLSLAFFSRKINESRVLYELDSSEFVLFYPKKSEIYERVLNELNVYEFETLL
FT                   INKPILTKIAKNFLEQSQNLIQEKNKFLDLKKAELQKRRAQILNVRESIKED"
FT   gene            383397..384101
FT                   /locus_tag="CJJ81176_0437"
FT   CDS_pept        383397..384101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0437"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73065"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040239"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN8"
FT                   /protein_id="EAQ73065.1"
FT                   /translation="MRIFLTLFLFFNSLFALSELEEGLKLYEANKFDKAYEIFKSLCEK
FT                   DISKACFSLAFMHESARGVSKDLNQAYKFYDKACKLGLANACSNMALLLQNQGYENEAL
FT                   LAFNKACTLGESLSCNNIALFYEKEKDGQMASSFYKRSCDLKNARACYQLGSLYDKGEL
FT                   VKASVKSALAFYSKSCTLGFGDACYLLGRYNQLEKQDLTKAKRYFGMACDQKHQEACAA
FT                   YKELNSKDIELY"
FT   gene            384237..384965
FT                   /locus_tag="CJJ81176_0438"
FT   CDS_pept        384237..384965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0438"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73351"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEX7"
FT                   /protein_id="EAQ73351.1"
FT                   /translation="MQDNIIDRRSFFKLGLLGGSVVAASTIGGGAVLKAAELTHSHQAS
FT                   QGKSNKIRGRMFFQTQTEFDTLSAACERIYPKDEQGEGAIGLGVPYFIDNQLASAYGYN
FT                   DREYMQGPFMEGKAEQGYQTPMQRKDIFLEGVHALEENAQKRYKKSFSLLKGGDQDKIL
FT                   SDFEKGKIQTTGFKSSYFFTLLRDMTVAGVLADPIYGGNDNKNGWRMMQYPGAQMSYVD
FT                   KIASDEFFNIEPMGLADMES"
FT   gene            384967..386688
FT                   /locus_tag="CJJ81176_0439"
FT   CDS_pept        384967..386688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0439"
FT                   /product="oxidoreductase, putative"
FT                   /note="identified by match to protein family HMM PF00732"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0439"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73314"
FT                   /db_xref="GOA:A0A0H3PAP4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAP4"
FT                   /protein_id="EAQ73314.1"
FT                   /translation="MAEVLKKVDVVTVGAGWTGGIVAAELTKAGLNVLSLERGHMQSTE
FT                   NFNYIHDEWRYGINYGLMQDCSKDTVTFRHDPSGLALPYRKMGSFLLGNNVGGAGVHWN
FT                   GWTFRFMPYDFEIQTLSKQRYGNKLGNDYTLQDWGVTYKDMEPYYDRFEKTCGVSGEPN
FT                   PLAEKMGAFRSSPYPQEPLENTKMLKRFESAAKSSNLHTYRLPASNSKGGYTNPDGQDL
FT                   APCQYCAYCERFGCEYGAKASPLNTVIPKAMSTGKYTIRTYSNVTQILKKDGKVTGVKF
FT                   VDTRTMKEYIQPADIVVLTSYMFNNAKLLMVSSIGEQYDPKTGKGTLGRNYCYQMNMGT
FT                   TAFFDEQFNTFMGSGALGTTSDDFNGDNFDHSKEKFLHGAMIYSVQLGTRPIQSAPLPA
FT                   GAPTWGAEFKKALNYNFTRAITVGGQGASLPHKNNYLSLDPTYKDAFGMPLLRLTYNFT
FT                   DQDRALHKFITDKTAEVAKRMQGVKSIKKGAYLKDYSVVPYQSTHNTGGTTMGADRETS
FT                   VVNTYLQHWDADNLFVVGAGNFQHNSGYNPTDTVGALAYRCAEGILKYHKSGKSLA"
FT   gene            386977..387168
FT                   /locus_tag="CJJ81176_0440"
FT   CDS_pept        386977..387168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0440"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73231"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W33"
FT                   /protein_id="EAQ73231.1"
FT                   /translation="MLNILHANSSHRFHKCMPKEVHQIYDTLKLMEQQEGTKKVEAKKE
FT                   EQSNSTNTDKVDNKKINF"
FT   gene            complement(387247..387972)
FT                   /locus_tag="CJJ81176_0441"
FT   CDS_pept        complement(387247..387972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0441"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73297"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W32"
FT                   /protein_id="EAQ73297.1"
FT                   /translation="MQISSSYNSYDYYSSKPSFDKTNQSDSTQKDEKNLSENKDDKEKN
FT                   GEQTQMVNGVELSQKEVAQVRELQSIDRNVKAHEAAHQAAGGGLAGAASFTYTRGPDNQ
FT                   MYATAGEVPISMQKGNTPEETIANARQIAAAAMAPADPSPQDYKVAANATKMEFEARAE
FT                   AMKLKAEEAKEKEEENKEKDEENKEKDDKNSENSLEKTDKDSKNNDKNSNFDKDFKNLV
FT                   TRTYQQNSQNNDIKFSIAS"
FT   gene            388079..388441
FT                   /locus_tag="CJJ81176_0442"
FT   CDS_pept        388079..388441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0442"
FT                   /product="HIT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0442"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73070"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBP0"
FT                   /protein_id="EAQ73070.1"
FT                   /translation="MIYENDLIYIEKEEAQVPWLKIFTKEIYKEFSDCPLELQKELFEK
FT                   ILLCEKAMIEFYKPEKINIASFANYVPRVHFHVMARFKEDAFFPECMWGKQQREAIKLD
FT                   LPKFEEFVKFLNSKIF"
FT   gene            388515..389087
FT                   /locus_tag="CJJ81176_0443"
FT   CDS_pept        388515..389087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0443"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04264"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0443"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73127"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W30"
FT                   /protein_id="EAQ73127.1"
FT                   /translation="MKKVLLSSLVAVSLLSTGLFAKEYTLDKAHTDVGFKIKHLQISNV
FT                   KGNFKDYSAVIDFDPASAEFKKLDATIKIASVNTENQTRDNHLQQDDFFKAKKYPDMTF
FT                   TMKKYEKIDNEKGKMTGTLTIAGVSKDIVLDTEIGGVAKGKDGKEKIGFSLNGKIKRSD
FT                   FKFAASTSTITLSDDINLNIEVEANEK"
FT   gene            complement(389091..390047)
FT                   /locus_tag="CJJ81176_0444"
FT   CDS_pept        complement(389091..390047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0444"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0444"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73421"
FT                   /db_xref="GOA:Q29W29"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="UniProtKB/TrEMBL:Q29W29"
FT                   /protein_id="EAQ73421.1"
FT                   /translation="MFLLDFLISLSFIFEISALVLSFYFKNSRIFFLTLVLLGAKLPYF
FT                   YASFFQANLFVALFLPMIFTLFCLGKHHALILSKKNIASITTLIFIGVLSIILPRNTTF
FT                   NSAGLEFHFIALDFFKPVSELGFLFFLVGLILIFIKTFKTKEYYLIIAFFAAYFQFLFQ
FT                   EGAGIRYFEFASLVFCFYLLNHAYKLAFFDILTKLPNEKSLTRFTKGKNNYIIALLHFN
FT                   ELKDTKESYAKLILKQIAKILKRFRAKIFIVDNDFILIFNDKNQALNHLAFLESTLKNT
FT                   EFNLENENFKPDFKLIWQESEENLDKSLQSLRIKLLG"
FT   gene            390020..390169
FT                   /locus_tag="CJJ81176_0445"
FT   CDS_pept        390020..390169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0445"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0445"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAX3"
FT                   /protein_id="EAQ72961.1"
FT                   /translation="MILKNLIKTFQILDFNKSDNCIEKNLKAGFIYFNYEILDYQSQLF
FT                   SSFF"
FT   gene            390215..391792
FT                   /locus_tag="CJJ81176_0446"
FT   CDS_pept        390215..391792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0446"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0446"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73426"
FT                   /db_xref="GOA:A0A0H3PF18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF18"
FT                   /protein_id="EAQ73426.1"
FT                   /translation="MVEVKNLTMRFANQLLFENVNLKLVRGQRYGLIGANGAGKSTFLK
FT                   ILSGEIESSSGEIVFDEGLKIAVLGQDQFAFENYTIKDAVMCANKRLYEALKEKEKLYM
FT                   SEEFTDEINERLGELEIITAEEDPNYDCETRCEKILSSLKIKDFDALMSTLQSADKFKV
FT                   LLAQVLFLGADVLFLDEPTNNLDLEAISWLENELLRHEGTLVVISHDRHFLNKICTRIL
FT                   DVDFKQIRDFAGNYDDWYMASTLLAKQAELKRDKTLKEREELENFIRRFSANASKAKQA
FT                   TSRAKALEKLELEEIKISSRRDPSIVFRTNREIGNEVLEFKGIGKAYDKQLFSNLELKI
FT                   EKNDKIALIGANGVGKSTLAKIIAHAISPDTGSMHLGATIELGYFPQDTSNLICENLKL
FT                   YEWLMSEKFKDLDEIRKCLGRMLFSGSDQEKMAASLSGGEKHRLMLSRLMLERPNFLLL
FT                   DEPDNHLDLESIIALGEALYNFKGVVLCISHDRELVSAFANRIWHLENGKLTDFRGTYQ
FT                   EFLGENDG"
FT   gene            391785..392117
FT                   /locus_tag="CJJ81176_0447"
FT   CDS_pept        391785..392117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0447"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0447"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73332"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEW6"
FT                   /protein_id="EAQ73332.1"
FT                   /translation="MAKFRIQYSAGFGHYTQNHKGFGPTIYIEEVVEFDNGKDYFDYID
FT                   FYKTYSKSDDTYFHISFLEDRPLSDKEITIRNEYRKMRDENCKKAKEEFIANNELDVEH
FT                   LPTHHD"
FT   gene            392193..392576
FT                   /locus_tag="CJJ81176_0448"
FT   CDS_pept        392193..392576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0448"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0448"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73182"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBS8"
FT                   /protein_id="EAQ73182.1"
FT                   /translation="MQVNYRTISSYEYDAISGQYKQVDKQVEDYSSSGKSDFMDILNKA
FT                   DEKSSGDALNSSNSFQSNAQNSNSNLSNYAQMSNVYAYRFRQNEGELSMRAQSASVHND
FT                   LVQQGANEQSKNNTLLNDLLNAI"
FT   gene            complement(392620..393204)
FT                   /locus_tag="CJJ81176_0449"
FT   CDS_pept        complement(392620..393204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0449"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01205"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0449"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73251"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ82"
FT                   /protein_id="EAQ73251.1"
FT                   /translation="MQTINQIFQTQIDIKKSIFLSFLCPFKDFKFLIETLKKEHPKAVH
FT                   FVYAYRVLNDFNQIVEDKSDDGEPKGTSGMPTLNVLRGYDLINAALITVRYFGGIKLGT
FT                   GGLARAYSDAANAVINNSSLLSFELKKNISIAIDLKNLNRFEYFLKTYSFNFTKDFKDC
FT                   KAILHIKLNEKEDQEFEIFCKNFAPFEIEKL"
FT   gene            393331..394557
FT                   /locus_tag="CJJ81176_0450"
FT   CDS_pept        393331..394557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0450"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0450"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73222"
FT                   /db_xref="GOA:A0A0H3PBC7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBC7"
FT                   /protein_id="EAQ73222.1"
FT                   /translation="MEKIKNYKLIIILLSLDLLALLYGISTLSISADEADIYFGEQGKS
FT                   LIFSHSLLYYISHFGTFIFGQNDFGLRLPFLFFHFLSCLLLYLLALKYTKTKIDAFFSL
FT                   LLFVLLPGTVASALLVNAASLVIFLTLAILCAYEYEKKWLFYILLIIVLFVDKSFNILF
FT                   LTFFFFGIYKRNAILFTLSLVLFGASISFYGFDTGGRPRGYFLDTLGIFAACFSPLVFV
FT                   YFFYTIYHLTFQKYKNLLWFLMSVTFVFCLLLSLRQKLFLDDFLPFCVICTPLLIKTLM
FT                   QSYRVRLPVFRLRYKIFIECSIIFLIFCYFLIVANQLLYYFINNSNRHFANNYHFAKEL
FT                   ALELKKQDVLELATAPSLQKRLRFYGIKNSNKFYLKALKQADKHDMDKKIVKVKLGKYE
FT                   KVYQILNYD"
FT   gene            394550..395287
FT                   /locus_tag="CJJ81176_0451"
FT   CDS_pept        394550..395287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0451"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0451"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73005"
FT                   /db_xref="GOA:A0A0H3PEC6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEC6"
FT                   /protein_id="EAQ73005.1"
FT                   /translation="MIKAFSLLEFVFIILILGIVFNLGSLYLKKDNLLEGAIQILNDIQ
FT                   YTQSLAMMQEGIRVDELAIAKREWFKSKWQIYFIKSAATGYDQTYTIFLDKNGDGNANL
FT                   GKTEINIDREIAVDVINHNKLMNSGQSGVISKDDEKTTQRFNLTKRFGIEKVEFKGSCS
FT                   GFTRLVFDEMGRVYSPLKNANYAYEKTLAKNNSDCIIRLLSKKHALCIVIDTLSGYVYI
FT                   PDFKTLKSQFVNIKNKNYECSKI"
FT   gene            395765..397275
FT                   /gene="rrsB"
FT                   /locus_tag="CJJ81176_1711"
FT   rRNA            395765..397275
FT                   /gene="rrsB"
FT                   /locus_tag="CJJ81176_1711"
FT                   /product="16S ribosomal RNA"
FT   gene            397380..397455
FT                   /locus_tag="CJJ81176_1712"
FT   tRNA            397380..397455
FT                   /locus_tag="CJJ81176_1712"
FT                   /product="tRNA-Ala"
FT   gene            397464..397540
FT                   /locus_tag="CJJ81176_1713"
FT   tRNA            397464..397540
FT                   /locus_tag="CJJ81176_1713"
FT                   /product="tRNA-Ile"
FT   gene            398121..400915
FT                   /gene="rrlB"
FT                   /locus_tag="CJJ81176_1714"
FT   rRNA            398121..400915
FT                   /gene="rrlB"
FT                   /locus_tag="CJJ81176_1714"
FT                   /product="23S ribosomal RNA"
FT   gene            complement(401151..401303)
FT                   /locus_tag="CJJ81176_0456"
FT   CDS_pept        complement(401151..401303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0456"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73026"
FT                   /db_xref="GOA:A0A0H3PGM7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PGM7"
FT                   /protein_id="EAQ73026.1"
FT                   /translation="MNLRIKLNLFISLLFSLFSFFFCFSLFFSYLLSLISFYIEYLKNN
FT                   VKSKF"
FT   gene            401329..401448
FT                   /gene="rrfB"
FT                   /locus_tag="CJJ81176_1715"
FT   rRNA            401329..401448
FT                   /gene="rrfB"
FT                   /locus_tag="CJJ81176_1715"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(401632..402840)
FT                   /gene="murD"
FT                   /locus_tag="CJJ81176_0458"
FT   CDS_pept        complement(401632..402840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="CJJ81176_0458"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0458"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73380"
FT                   /db_xref="GOA:A1VYE9"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYE9"
FT                   /protein_id="EAQ73380.1"
FT                   /translation="MKISLFGYGKTTRAIAENLVDKFGPFDIYDDHFIETKKDTLGNLL
FT                   LNPNDFDDNLSDIEIPSPGFPPKHKLIQKAKNLQSEYDFFYDIMPKSVWISGTNGKTTT
FT                   TQMATHLLSHIGAVMGGNVGTPLAELDPYAKLWILETSSFTLHYTHKAKPEIYALLPIS
FT                   PDHLSWHGSFDNYVQDKLSVLKRMNECDVAILPKIYANTPTKAHKISYEDEKDLAVKFG
FT                   IDTEKISFKSPFLLDAIMALAIEKILLDTLSYELLNSFVMEKNKLEELKDSQNRLWVND
FT                   TKATNESAVMAALNRYKDKKIHLIIGGDDKGVDLSNLFDFMKNFNIELYAIGISTEKML
FT                   DYAKKANLKAYKCEVLSKAVNEISNHLRVNEVALLSPACASLDQFNSYAERGKVFKECV
FT                   NKI"
FT   gene            complement(402840..403901)
FT                   /gene="mraY"
FT                   /locus_tag="CJJ81176_0459"
FT   CDS_pept        complement(402840..403901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="CJJ81176_0459"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0459"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73459"
FT                   /db_xref="GOA:A1VYF0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYF0"
FT                   /protein_id="EAQ73459.1"
FT                   /translation="MYYLSDLSHYAFFTYISVRAGFAFFIALCLSLFLMPKFITWAKNK
FT                   NASQPIYEYAPETHKTKCHTPTMGGLIFISSAVIASLSCIKFDNIFAISALLCLILFCL
FT                   IGLIDDLGKVLKKDNHSGLSPRMKLLTQIIAGLICILPLYFSSELSTELFIPFYKHPLF
FT                   DMEIFAIAFWILVLISSSNAVNLTDGLDGLATVPSIFSLSTLGIFLYLSGNLNYSEYLL
FT                   LPKIQGLGEVVIICAALIGALMGFLWYNCYPAQVFMGDSGSLALGGFIGFLAIISKNEI
FT                   LLLLIGFVFVLETVSVILQVGSFKIFNKRVFKMAPIHHHFEKVGWVENKIIVRFWMIAL
FT                   LSNLLALASIKLR"
FT   gene            403981..405459
FT                   /gene="pgm"
FT                   /locus_tag="CJJ81176_0460"
FT   CDS_pept        403981..405459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="CJJ81176_0460"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0460"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73275"
FT                   /db_xref="GOA:A1VYF1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYF1"
FT                   /protein_id="EAQ73275.1"
FT                   /translation="MKQKCVLIITDGIGYNKNSKFNAFEAAKKPSYEKLFKEVPNSLLK
FT                   TSGLAVGLPEGQMGNSEVGHMCIGSGRIIYQNLVRINKAIENKELEKNENLQKLLAKCK
FT                   RVHIIGLYSDGGVHSMDTHFKAMLEICAKNGNEVFAHAITDGRDVNPKSGLNFIKDLKE
FT                   FCENLGVHFATLCGRFYAMDRDKRWDRVKECYECLLGKAYKVPNLLEYLQKSYDENVTD
FT                   EFIKAVQNENYKGMREEDGIIFINFRNDRMKQLVEVLNSKDFKEFEREKIFENLLTMSV
FT                   YDDKFKLPVLFEKEKIENTLAQVISKAGLSQLHTAETEKYAHVTFFFNGGKEELLENET
FT                   RVLIPSPKVKTYDEKPQMSAFEVCDAVKKGIEKGEDFIVVNFANGDMVGHTGDFNAAIK
FT                   AVEAVDTCLGEIVECAKKHDYAFIITSDHGNCEAMQDEKGNLLTNHTTFDVFVFVQAKG
FT                   VSKIKDNMGLSNIAASVLKILDLEIPKEMNEALF"
FT   gene            405531..406274
FT                   /gene="fabG"
FT                   /locus_tag="CJJ81176_0461"
FT   CDS_pept        405531..406274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="CJJ81176_0461"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM TIGR01830"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0461"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73169"
FT                   /db_xref="GOA:A0A0H3PBS3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBS3"
FT                   /protein_id="EAQ73169.1"
FT                   /translation="MKFSGKNVLITGASKGIGASIAKTLAGFGLKVWINYRSKPELADA
FT                   LKDEIIASGGVAAVIKFDASKEDEFENGVKIIVESDGELSYLVNNAGVTNDKLALRMKL
FT                   EDFSGVVDTNLSSAFLGCREALKTMSKKRFGAVVNIASIVGEMGNAGQVNYSASKGGMI
FT                   AMTKSFAKEGASRNLRFNCVTPGFIKSDMTEVLSDEIKQTYQDNIPLKRFAEPEEVANC
FT                   VAFLLSDYASYVTGDVLKINGGLYM"
FT   gene            406284..406691
FT                   /locus_tag="CJJ81176_0462"
FT   CDS_pept        406284..406691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0462"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01243"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0462"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73101"
FT                   /db_xref="GOA:A0A0H3PBP8"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBP8"
FT                   /protein_id="EAQ73101.1"
FT                   /translation="MDLKEIAQFLDDNAPAFLATLGTCGNPRVRPIQSPLLVRDKIYFC
FT                   TANTKGLFKHIKNYNGIEFCSCAKDGTFLRLRANAVFEPNLEVKKMMFEKYPYLVNLYE
FT                   TPQNPKFEVFYLDHLSARMQFMNGEFKLFKA"
FT   gene            407028..408863
FT                   /gene="sdhA"
FT                   /locus_tag="CJJ81176_0463"
FT   CDS_pept        407028..408863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="CJJ81176_0463"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0463"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73114"
FT                   /db_xref="GOA:A0A0H3PBQ2"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBQ2"
FT                   /protein_id="EAQ73114.1"
FT                   /translation="MGEFSRRDFIKTACISVGALAASSSGVYALDDSSKMDKDTNLPSC
FT                   DVLVIGSGGAGLRAAAAVRKENPKLSVVVATKMMPSRNATCMAEGGINGVTDFSNGDSY
FT                   KLHAYDTIKGGAYLVDQDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQRLMGGASK
FT                   KRCNYSADKTGHILMHSCLDDAISSGVKFLMDHELLDIGVVDGKCEGVVLRDIQSGGIY
FT                   PVLCKALVIATGGYTRIFYNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHPTGVANG
FT                   GTLITEAARGEGGYLLNNRGERFMKNYHEKMELAPRDVVARAIETEIREGRGYGEGLGA
FT                   YVLCDVRHLGKEKILKDLPKIRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAKFEDM
FT                   STKIAGIYVGGEASCISIHGANRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGAKTH
FT                   ELAQKWQARFKEITNNGGNGQEMYELREELGSQNWDNMGIFRTQEKLDLLAKNLEDIQA
FT                   RYEKIRIPNPNEVMNTAFTDYVELGNLILLSRCACLAARNRLESRGAHTREDYPKRDDK
FT                   NFLKHSIVNLENDELKLSYKDVVVTEFSLDGRRVQ"
FT   gene            408860..409825
FT                   /gene="sdhB"
FT                   /locus_tag="CJJ81176_0464"
FT   CDS_pept        408860..409825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="CJJ81176_0464"
FT                   /product="succinate dehydrogenase, iron-sulfur protein
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0464"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73312"
FT                   /db_xref="GOA:A0A0H3PJB7"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJB7"
FT                   /protein_id="EAQ73312.1"
FT                   /translation="MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITL
FT                   NFTASCQSAICGACAVRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIV
FT                   DWEPSIENLRKIRPAMVAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEA
FT                   DSSDYMQPFVFTHAWRAAADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVS
FT                   DIANLRVMAIKKGLNEGLGPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIA
FT                   FKLMRAGKMNPMHVFGEDEIEGHKDLVKMIKAAQEAAVKE"
FT   gene            409829..410686
FT                   /gene="sdhC"
FT                   /locus_tag="CJJ81176_0465"
FT   CDS_pept        409829..410686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="CJJ81176_0465"
FT                   /product="succinate dehydrogenase, C subunit"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0465"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73128"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAG3"
FT                   /protein_id="EAQ73128.1"
FT                   /translation="MQKEYAFFPGCVLSQAAKESKISLEAIAPILGWKLNEIKGWSCCG
FT                   ASQAQCVDPIATLVANARNIALAEEMKMPMLTTCSTCMLTLTKAKNTLDKGAKERINTF
FT                   LAKGGMKYQGSTPITSLLWELYEDLDNLKSKVKKPLSNLKVALFYGCHSLRPEDTFGKK
FT                   ESSTNPKSFESVVEVLGAKIVPFEKRLDCCGFHASYPAEKSVKKMSSQIVNNASENQAD
FT                   CVVTPCPLCQMQLDIYQERFQDYTNSKARLPIIHLSQLVGLALGLSKEMVGLDYNIIDA
FT                   SKIA"
FT   gene            complement(410710..411375)
FT                   /locus_tag="CJJ81176_0466"
FT   CDS_pept        complement(410710..411375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0466"
FT                   /product="TenA/Thi-4 family protein"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0466"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73055"
FT                   /db_xref="GOA:A0A0H3PAD1"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAD1"
FT                   /protein_id="EAQ73055.1"
FT                   /translation="MLFSNLIKENQKIWNAYLHHDFVKKLEDKSLKQENFLFYLKQDYI
FT                   YLLNYAKCYARLALNSNTAKELRFAMKFQNYIVEGEMELHRAILSLGINADELDAKDES
FT                   LVNIAYSRYMLSVGENGDFLDMLVALSACAIGYAKIGAEIINRLKNENLKDHPYKEWIL
FT                   TYGSENFQNEAKEFEDFVNSYTSSVSAQKFQKLSEIFHTVTRLEVAFWEHSLRMELNL"
FT   gene            411353..411469
FT                   /locus_tag="CJJ81176_0467"
FT   CDS_pept        411353..411469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0467"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0467"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAW1"
FT                   /protein_id="EAQ73440.1"
FT                   /translation="MIKLEKSIIFPLCFNILFSSIMKNYKYFKLFIVKYALF"
FT   gene            411488..411721
FT                   /gene="acpP"
FT                   /locus_tag="CJJ81176_0468"
FT   CDS_pept        411488..411721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="CJJ81176_0468"
FT                   /product="acyl carrier protein"
FT                   /note="identified by match to protein family HMM PF00550;
FT                   match to protein family HMM TIGR00517"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0468"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73375"
FT                   /db_xref="GOA:A1VYF9"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYF9"
FT                   /protein_id="EAQ73375.1"
FT                   /translation="MATFDDVKAVVVEQLSIDADAVKMESKIIEDLGADSLDVVELIMA
FT                   LEEKFEVEIPDSDAEKLIKIEDVVNYIDNLKK"
FT   gene            411747..412961
FT                   /gene="fabF"
FT                   /locus_tag="CJJ81176_0469"
FT   CDS_pept        411747..412961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="CJJ81176_0469"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /EC_number="2.3.1.41"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0469"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73398"
FT                   /db_xref="GOA:A0A0H3PF03"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF03"
FT                   /protein_id="EAQ73398.1"
FT                   /translation="MKRVVVTGIGMINALGLDKESSFKAICNGESGVNKITLFDATDFP
FT                   VQIAAEVKNFDPLEVVDGKEVKKIDRFIQLGIKAAREAMQDAGFNEELDKEEFGIVSAA
FT                   GIGGLPNIEKNSIICSERGPRKISPFFIPSALVNMLGGLISIEHGLKGPNISCVTACAA
FT                   GTHAIGEAYKSIALGNAKKMLVIGAEAAICPVGIGGFASMKALSTRNEDPQHASRPFDK
FT                   ERDGFVMGEGAGALVFEEYEEAKKRGATIYAELIGFGESADAHHITSPTLDGPLRAMKK
FT                   ALNMAGNPKVDYINAHGTSTPVNDKNETAAIKELFGNNIPLISSTKGQTGHCLGAAGAI
FT                   EAVVSVMALRDGVVPPTINQLVKDDECDLDYVPNISRKVDLKVVMSNSFGFGGTNGCVV
FT                   FKKVD"
FT   gene            412963..413901
FT                   /gene="accA"
FT                   /locus_tag="CJJ81176_0470"
FT   CDS_pept        412963..413901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="CJJ81176_0470"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   alpha subunit"
FT                   /EC_number="6.4.1.2"
FT                   /note="identified by match to protein family HMM PF03255;
FT                   match to protein family HMM TIGR00513"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0470"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73334"
FT                   /db_xref="GOA:A1VYG1"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYG1"
FT                   /protein_id="EAQ73334.1"
FT                   /translation="MASYLDFEKNIQQIDEDIINAQIKGDTEAVSILKKNLEKEISKTY
FT                   KNLSDFQRLQLARHPDRPYALDYIELILNDAHEIHGDRAFRDDPAIVCFMGYLGEKKII
FT                   VIGEQKGRGTKDKIARNFGMPHPEGYRKALRVARLAEKFQIPILFLIDTPGAYPGIGAE
FT                   ERGQSEAIARNLYELSDLKIPTIAIVIGEGGSGGALAIGVADRLAMMKNSVFSVISPEG
FT                   CAAILWNDPAKSEAATKVMKVTADDLKSQGLIDDVIDEPTNGAHRNKEAAAVAIADYVK
FT                   KSLNELENIDVRELSANRMQKILKLGAYQEA"
FT   gene            413993..416107
FT                   /locus_tag="CJJ81176_0471"
FT   CDS_pept        413993..416107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0471"
FT                   /product="TonB-dependent receptor, putative, degenerate"
FT                   /note="identified by match to protein family HMM PF00593;
FT                   match to protein family HMM PF07715"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0471"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73281"
FT                   /db_xref="GOA:A0A0H3PET5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PET5"
FT                   /protein_id="EAQ73281.2"
FT                   /translation="MILNIKIIIFKGINLTQIKNMKFKKSLLCFLILSGALLKAEEKYQ
FT                   LNDVVVSASGFEQDLVDAPASISIITKEELEKKPIKDIGEAIGDIPGVDVTMNKTGTYD
FT                   FSIRGFGSSYTLVLIDGKRQSVANGFYDNGFSGSESGYLPPLSMIERIEVIRGPASTLY
FT                   GSDAVGGVINIITKKNPDKTEANIEFNTLLQQHSNHYGNAGGFNAYVATPLIEDILSIS
FT                   ARLKYYDKAASDLKWPTPVWNNGNQRPDNYQIASHSPGAFTSLGFGSRLNWTVDDKNNI
FT                   YFDIERYINEISVNSTSSRAIKSERQLFKDNIVLNHDGNYDFGSTNSYLQYGSTKDKEL
FT                   HSQIWVGEGKVVLPWNLGQYGNLVNTFGARIDYEILKNDQASAGSQIRGKNLDQTTVAL
FT                   YGENEYFIADDLIFTTGLRYIYSDLFDSEFTPRVYLVYHLNDNIALKGGVSKGYKTPAA
FT                   KQLTNGYYNYANNNAYFGNPDLKPEESINYELGVDFMVFDFAHYSITGFITDFTNQISS
FT                   EDLTGMQNDINCSNGIVCKRPINLGKTQTKGIEFAFNTKTYNGFSLNSSYTFMDNRYKD
FT                   GQKNWFGGDRIENLPRHIAMLKLNYERGKFSSYIKTRARLDAIAKAKGGGNGSLPWQKY
FT                   KPFYIVDLGINYKINKQSSLSFAVQNLFDKNFFNPQVTRWDGANPAGYANRYQDYTEGR
FT                   SFWLSYKYDF"
FT   gene            416190..416786
FT                   /locus_tag="CJJ81176_0472"
FT   CDS_pept        416190..416786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0472"
FT                   /product="NUDIX domain protein"
FT                   /note="identified by match to protein family HMM PF00293;
FT                   match to protein family HMM TIGR00052"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0472"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73207"
FT                   /db_xref="GOA:A0A0H3PBB8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBB8"
FT                   /protein_id="EAQ73207.1"
FT                   /translation="MAFKNLKELSFEKSNYIKPKRFAYESNGRLCTWDFIESKDSVSVL
FT                   LYHKELESFIFVRQFRIPLWYHQMHDKDYVKDDDMGYTIELCSGLVDKKLSLEEIAKEE
FT                   CIEELGYAPKNLEKIGDFYTGFGSGVSKQSFYFVEVDEKDKISSGGGVDDEEIEAVYVK
FT                   VQDFEKKCKNMIRTPLLDFAYMWFLKEKWGKLKII"
FT   gene            complement(416818..417915)
FT                   /locus_tag="CJJ81176_0473"
FT   CDS_pept        complement(416818..417915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0473"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0473"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73068"
FT                   /db_xref="GOA:A0A0H3PB06"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB06"
FT                   /protein_id="EAQ73068.1"
FT                   /translation="MFGSKINHSDLQKLEEENKNLAHKIEKFQSENLELKNKITSLEQA
FT                   ALESKLKTDLLNVLLTGVLKNITIVQGDMLENVNKAEVISSYSKTSLAEMDELNHIANS
FT                   INASLGDITESANKTRDVAGTLHRSVDEITNVINLIKDVSDQTNLLALNAAIEAARAGE
FT                   HGRGFAVVADEVRKLAEKTQKATTEVEMNINLLKQNANEMYTQSEQVEKISIDSNAHIM
FT                   SFSEKFTHLVNEAHSTNSNAVGIASEAFVSLAKLDHIAFKLNGYKEIFSKSGKQLADHT
FT                   SCRLGKWLASTGKERFGQNKSFLKINEPHEKVHENMNNAITIANTEDISKDITQHSIIN
FT                   KCEVAENASLDLFNVFKEMLDESDH"
FT   gene            complement(417925..418140)
FT                   /locus_tag="CJJ81176_0474"
FT   CDS_pept        complement(417925..418140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0474"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04325"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0474"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73112"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB55"
FT                   /protein_id="EAQ73112.1"
FT                   /translation="MLHEYRELMSELKGKDAHFDKLFDRHNELDDMIKDAEEGRTSLSS
FT                   MEISTLKKEKLHVKDELSQYLANYKK"
FT   gene            complement(418323..418517)
FT                   /gene="rpmB"
FT                   /locus_tag="CJJ81176_0475"
FT   CDS_pept        complement(418323..418517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="CJJ81176_0475"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0475"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73141"
FT                   /db_xref="GOA:A1VYG6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYG6"
FT                   /protein_id="EAQ73141.1"
FT                   /translation="MARVCQITGKGPMVGNNVSHANNKTKRRFLPNLRTVRVTLEDGTT
FT                   RKMRIAASTLRTLKKQNSK"
FT   gene            418657..419304
FT                   /gene="rpe"
FT                   /locus_tag="CJJ81176_0476"
FT   CDS_pept        418657..419304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="CJJ81176_0476"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0476"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73305"
FT                   /db_xref="GOA:A0A0H3PBF9"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBF9"
FT                   /protein_id="EAQ73305.1"
FT                   /translation="MYVAPSLLSANFLKLEEEVKAIEAAGADLLHIDVMDGHFVPNLTF
FT                   GPCVIEKISTISKLPLDVHLMVKDVSKFIDLFIPLKPKFISFHIESEVHPIRLCEYIRS
FT                   QGIHPAIVLNPHTSIDSIKHMLEFVDMVLLMSVNPGFGGQKFLPLVHEKIKELRQMIDK
FT                   KNAKVFIEVDGGVNGLNASDLEESGADILVAGSYIFSSNDYKTAISSLKLEF"
FT   gene            419301..420062
FT                   /locus_tag="CJJ81176_0477"
FT   CDS_pept        419301..420062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0477"
FT                   /product="DNA polymerase III subunit epsilon"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0477"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73025"
FT                   /db_xref="GOA:A0A0H3PED7"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PED7"
FT                   /protein_id="EAQ73025.1"
FT                   /translation="MSLQQIDQIISILNKQSKPYDWVMQEFAKVEELKNFDLDLETFEL
FT                   LGLGLTLNKDNIFTLKTRTTKIKDEIFCIVDIESTGGVSKGEILEIGAVKIQNSKEIAR
FT                   FQSFVKVKEIPENITELTGITYEMVENAPSLAKVLSDFRLFLKDSIFVAHNVRFDYSFI
FT                   SRALNECGFGILLNRRICTIEFAQCCIESPKYKLEVLKEFLGVENTHHRALDDALAAAE
FT                   IFKYCLGKLPYHIKTTEELINFTKTARIKQK"
FT   gene            420245..421537
FT                   /gene="thiC"
FT                   /locus_tag="CJJ81176_0478"
FT   CDS_pept        420245..421537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiC"
FT                   /locus_tag="CJJ81176_0478"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="identified by match to protein family HMM PF01964;
FT                   match to protein family HMM TIGR00190"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0478"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73394"
FT                   /db_xref="GOA:A1VYG9"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYG9"
FT                   /protein_id="EAQ73394.1"
FT                   /translation="MKTQMNYAKEGIFTKEMQIVAQKENLSKDFLLENIACGKIIIPAN
FT                   INHKSLDPNGIGFGLRTKVNVNLGVSNDCVDYSEEMKKVELAHKFGIEAIMDLSNYGKT
FT                   SRFRDELVNVSKAMIGTVPVYDAVGFLEKDLKQINAKDFLDVVYHHAKSGVDFMTIHAG
FT                   INSRAAHIFKQSKRLTNIVSRGGSVLYAWMMMKDAENPFFEYYDDLLDICLKYDVTLSL
FT                   GDALRPGSTHDASDGAQISELIELSLLTQRAWDVGIQVMIEGPGHMAINEIEANMQLEK
FT                   RLCKGAPFYVLGPLVIDIGAGYDHISGAIGGAVAAASGADMLCYVTPAEHLRLPNLEDV
FT                   REGIVATKIAAHAGDIAKLPKERARDDEMSKARQEIDWEKMFKLAIDGEKAKKMFNERR
FT                   PDDLNSCSMCGKMCAMNTMNQILKGEDVSLA"
FT   gene            complement(421529..422047)
FT                   /locus_tag="CJJ81176_0479"
FT   CDS_pept        complement(421529..422047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0479"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0479"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73210"
FT                   /db_xref="GOA:A0A0H3PAJ6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAJ6"
FT                   /protein_id="EAQ73210.1"
FT                   /translation="MKDKSLEEIDLLKLIICALSFISVCTALILFLLLPTLKNYKQANL
FT                   RENSQLAILKAAKLKFDFSEDKISTLRSENNKSLEQFEQNFNIGNFDIFLQKYFQNVKI
FT                   QETKPEKQEKYLKNRLAIKATMNNPRRLYDFIDALKNYNNLIKLDYPLNLKAGEQGISI
FT                   DLTLKVYSS"
FT   gene            complement(422037..422564)
FT                   /locus_tag="CJJ81176_0480"
FT   CDS_pept        complement(422037..422564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0480"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73079"
FT                   /db_xref="GOA:A0A0H3PIX5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIX5"
FT                   /protein_id="EAQ73079.1"
FT                   /translation="MTYSFIQPRKKPIFTLFDKIWLGLFGFSISFILLVYFTYTIKIAL
FT                   INSSINNEKQQVIVLQNQTKQNEMLYEILFDQSQIAKNFNTQNQIVKESLRNLFDIIVK
FT                   TDNITLESVEQDEYSLKLIGVTPTREMFTLLLETPLKSIFDQSYTTYYRLDNGWYRFVS
FT                   ISKQIPGVADER"
FT   gene            complement(422561..423520)
FT                   /locus_tag="CJJ81176_0481"
FT   CDS_pept        complement(422561..423520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0481"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73266"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PES6"
FT                   /protein_id="EAQ73266.1"
FT                   /translation="MLFLLKKIFPQLFISIILEDKKNIVKASIYRGNKLISSNEKTFDK
FT                   SENLLEYVKNLSKHFLFYHTALFLDAKEQGLIPSTNIQDCEHFNIGKISLQHILFNNAL
FT                   VYTATEHVEYYSELFEEYRGLDFLYSPFALLYYNMQKEKQPDDQILLYGFKQGHLLAII
FT                   VAKGNTILYGDFKIFEQELGLELELPSEDNQEIENNNDDTEVTLDNFNEALNNKFDLLD
FT                   QENNLETLDNNDNFNLDELNQFSNDMELCRYIITSIEKFYNDDKYAGVFINGILLYSES
FT                   DINISAIDFLESETFLEIKTKQINTLDLMIELMQKELK"
FT   gene            complement(423522..424172)
FT                   /locus_tag="CJJ81176_0482"
FT   CDS_pept        complement(423522..424172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0482"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04028"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0482"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73466"
FT                   /db_xref="GOA:A0A0H3PBN4"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN4"
FT                   /protein_id="EAQ73466.2"
FT                   /translation="MQSVWFYMGKSFKIHCLTYIIFILQWLIFLSCKKHYKGEKVDRKA
FT                   GVILFWHGKLALMPFAFRHYRQKNKKAYVMISHHKDGEQIAKIIKLFGLDTVRGSTSRG
FT                   ASSALRAAFKVLEQNDDIVITPDGPRGPYHSISDGSIILAQKKELKIRILNYEANRFWE
FT                   FKSWDKMIMPKPFSRITYSLSEPLDILSLDKEKAKEFLMEQFDKISLADQFKE"
FT   gene            complement(424135..425436)
FT                   /gene="miaB"
FT                   /locus_tag="CJJ81176_0483"
FT   CDS_pept        complement(424135..425436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="CJJ81176_0483"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF01938; match to protein
FT                   family HMM PF04055; match to protein family HMM TIGR00089;
FT                   match to protein family HMM TIGR01574"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0483"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73006"
FT                   /db_xref="GOA:A1VYH4"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYH4"
FT                   /protein_id="EAQ73006.1"
FT                   /translation="MSAKKLFIQTLGCAMNVRDSEHMIAELTQKENYALTEDIKEADLI
FT                   LINTCSVREKPVHKLFSEVGGFEKVKKEGAKIGVCGCTASHLGNEIFKRAPYVDFVLGA
FT                   RNISKITQAIKTPKFMGVDIDYDESEFAFADFRNSIYKSYINISIGCDKHCTYCIVPHT
FT                   RGDEISIPFNIIYKEAQKAIEKGAKEIFLLGQNVNNYGKRFRNEHKKMDFSDLLEELST
FT                   IEGLERIRFTSPHPLHMDDKFLEVFANNPKVCKSMHMPLQSGSSEILKAMKRGYTKEWY
FT                   LNRALKLRELCPNVSISTDIIVAFPGESEKDFEETVDVLEKVRFEQIFSFKYSKRPLTK
FT                   AATMPNQIDEEIASRRLSTLQNRHSEILDKIVKKQENKTFKVLFEELRAGNSIAGRTDN
FT                   NFLVQVEGSEELLGQFKEVKITNAKRMVLYGEIV"
FT   gene            complement(425433..425675)
FT                   /locus_tag="CJJ81176_0484"
FT   CDS_pept        complement(425433..425675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0484"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73198"
FT                   /db_xref="InterPro:IPR040748"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEN5"
FT                   /protein_id="EAQ73198.1"
FT                   /translation="MELKLARTLINEKPKNISLEKIEEAIEKEGQKFFYFDKDNTHKQL
FT                   IALVNHFEKKGVSIYHRTVKYGLDDNDFMYEVHIL"
FT   gene            425803..426891
FT                   /gene="nusA"
FT                   /locus_tag="CJJ81176_0485"
FT   CDS_pept        425803..426891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="CJJ81176_0485"
FT                   /product="transcription termination factor NusA"
FT                   /note="identified by match to protein family HMM TIGR01953"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0485"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73123"
FT                   /db_xref="GOA:A0A0H3PB61"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB61"
FT                   /protein_id="EAQ73123.1"
FT                   /translation="MEKIADIIESIANEKNLNLENVREKVATALINTAKRIYGQEYEFF
FT                   VDPKNLNLYQKITIVADNDERLQNKSESFIALSKAKSEAPDVEIGDELTYECSLENLGR
FT                   TAVNTLHKELEYHIQKLLEQTIFEKYKNKVGQMVFGTVVRVDNEENTFIEIDELRAFLP
FT                   RKNRIKGEKFKIGDVVKAVIRRVYTDKGIKIELSRTSPKFLECLLEAEVPEIKDGYVNI
FT                   IGCARIPGERAKIILQANGTNIDPVGATVGVKGVRINAVSKELHNENIDCIEFTNESEI
FT                   LISRALAPAIVNSVKIEDKKAIVSLNSEQKSKAIGKNGINIRLASMLSGYEIELNELSS
FT                   SQLNNAISNEEAMKNLQDLFKI"
FT   gene            complement(426907..428094)
FT                   /locus_tag="CJJ81176_0486"
FT   CDS_pept        complement(426907..428094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0486"
FT                   /product="transporter, putative"
FT                   /note="identified by match to protein family HMM PF04332;
FT                   match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0486"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73219"
FT                   /db_xref="GOA:A0A0H3PBU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBU2"
FT                   /protein_id="EAQ73219.1"
FT                   /translation="MNYIELLKNNKNIRILASVQFIVYFGAWFSQTGVFTLLVELNAPT
FT                   WATATSAMLAFLPGVLLAPINGVIVEKNKPKKLLLSMISIELISIFCLIFVTSLSMLWL
FT                   LFILIFIRLCVASIYFQAEMSLLAKILTPQELKLANEMHSVIWAISYTAGMASAGIFIY
FT                   FLGVKTTFLFDCILILIGISFLVRLSIPDFHQKTQSRFFTMIKEGFFYVLNNKIIFHLI
FT                   LLHAFIGLTAYETLVTLLAQHQYKEVLSAALVIGFLNAVRACSLAIGPMVLSKFINDKN
FT                   LFYMYLGQGLGIILWALTQFNFYISFLGLIGAGFFTSALWAYTYTMIQKNADKEYHGRV
FT                   IAYTDMIYLSFSAIISMLMGFLFEIGLSLELITGLLGMIFIFAAFYWKWFYKKYL"
FT   gene            428168..429214
FT                   /locus_tag="CJJ81176_0487"
FT   CDS_pept        428168..429214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0487"
FT                   /product="radical SAM domain protein"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00423"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0487"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73140"
FT                   /db_xref="GOA:A0A0H3PJ06"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020050"
FT                   /db_xref="InterPro:IPR022431"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ06"
FT                   /protein_id="EAQ73140.1"
FT                   /translation="MKRLDKKEALDLLHHASLTELGEMAYKRKLELHPEKITTFVVDRN
FT                   INYTNVCCIDCSFCAFYRHHKEDDAYILSFEEIGKKIEELEAIGGTQILFQGGVHPKLK
FT                   IEWYEELVSWIKEHYPNITVHGFSAVEIAYIAKASKISITEVLKRLQAKGLFSIPGAGA
FT                   EVLSDRVRDIIAPNKCDTATWLEVHRQAHKIGMKSTATMMFGTVENDEEIIDHFEHLRK
FT                   LQDETGGFRAFILWSFQSDNTALIQKHPEIMKQSSNKYLRLLALARLYLDNFKNLQSSW
FT                   VTQGSLIGQLALKFGANDLGSTMMEENVVSAAGASYRMNQDEMIRLIRSLGENPAKRNT
FT                   AYEILERF"
FT   gene            429214..430434
FT                   /locus_tag="CJJ81176_0488"
FT   CDS_pept        429214..430434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0488"
FT                   /product="peptidase, putative"
FT                   /note="identified by match to protein family HMM PF05193"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0488"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72972"
FT                   /db_xref="GOA:A0A0H3PA94"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA94"
FT                   /protein_id="EAQ72972.1"
FT                   /translation="MQYLESRGIKIPFIFEKNSDFPIVVLKLVFRNCARSYDEIAGLAK
FT                   MFSRILNEGVDDKFFKDLEFRAINLEASSGFESLEINLSCLKENFDFALKSLEKLLLKP
FT                   RIEEKTLQKLKINALGELASKNSDFDYLAKNLLNAQIFKCKEFQSPNDGDEKSIETLSL
FT                   KDLQNFYKNFIHLSDLVVILGGDLEEKQAKEDLLKLLSKLQIGKKNTPKKYELGKNIKD
FT                   EILVRPESEQAYIYFATPFFADFKDKDLYLAKIALFVLGQGGFGSRIMEEIRVKRGLAY
FT                   SAYAMLDMNMSFSRVFGYLQTKNESAKEAKKIVKELFEDFIKNGMTQNELDQAKNFLIG
FT                   STPLRYESLSKRLSMSFNEFYQGLNLGYYKEELKLMEKVKLETINAYIKKHQELLNISF
FT                   ASIQNEN"
FT   gene            430424..432247
FT                   /gene="recG"
FT                   /locus_tag="CJJ81176_0489"
FT   CDS_pept        430424..432247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="CJJ81176_0489"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF04851"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0489"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73451"
FT                   /db_xref="GOA:A0A0H3PC40"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC40"
FT                   /protein_id="EAQ73451.1"
FT                   /translation="MKIKESDFEFFKKLKIRSAIDLALLLPKKIENLNPSKNPKENEIC
FT                   TQKITIKSVSSRKNQLFGLGFCEEWQENISFVFFHPRAWHFGICKVGKELIFNAKLSHF
FT                   NHTWQFNNPKILTSFEGFSPKYQILGLKDTKIAAFIHKYLNYVNLKESGIEDKYIHFLL
FT                   NLHAYDEKSFFMFENLQNFSKDLKYIEIYNFLKRLKAKKTHFKAHQINVFNIANWLKDL
FT                   PFSLTKDQLNALKDIEKDLHSKEAKRRVIMGDVGCGKTLVLLGAALMVYPKQAILMAPT
FT                   SILAYQLYEEAKKFLPDFMNILFIKGGKKEKDLEQNIQKANLVIGTHALIHLESHNAVL
FT                   VMIDEQHRFGSAQREKIHSLNKQEFTPHFIQFSATPIPRTLSMIQSELLNFSFIKQMPF
FT                   EKDITTYCIQNEGFSKLSEKIKEEIVKNHQIIIIYPLVSASDKIPYLSLEQAKEYWQSH
FT                   YEKVFVTHGKDKQKDEILERFRDEGNILLSTTVVEVGISLPRLSMIVIVGAERLGLATL
FT                   HQLRGRVGRVGLKSTCYLYTKLKEIPSRLKEFASTLDGFKIAELDLKNRLSGDLLDGFM
FT                   QHGNEFKFFDFSKDEEILQKVKKDLAKKLPN"
FT   gene            complement(432244..432627)
FT                   /locus_tag="CJJ81176_0490"
FT   CDS_pept        complement(432244..432627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0490"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72971"
FT                   /db_xref="GOA:A0A0H3PBJ9"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBJ9"
FT                   /protein_id="EAQ72971.1"
FT                   /translation="MKFETINQESIAKLMEIFYEKVRKDKDLGPIFNNAIGTSDEEWKD
FT                   HKAKIGNFWAGMLLGEGDYNGQPLKKHLDLPPFPQEFFEIWLKLFEESLNIVYNEEMKN
FT                   VILQRAQMIASHFQNMLYKYGGH"
FT   gene            432713..433318
FT                   /locus_tag="CJJ81176_0491"
FT   CDS_pept        432713..433318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0491"
FT                   /product="transcriptional regulator, putative"
FT                   /note="identified by match to protein family HMM PF00027"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0491"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73447"
FT                   /db_xref="GOA:A0A0H3PAW4"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAW4"
FT                   /protein_id="EAQ73447.2"
FT                   /translation="MYIMKDYLELLSSVGKLKKFQKNSILFYEGEEAKKFFILLKGKIR
FT                   IYKSTASDKEITLHYFNPPNFIAEMPAFKKLNYPANAIFEEDGEILEIDFINFQNLCSE
FT                   NKEFNFLLISSLFDKIKILEKKLSQNALDLRTRLLKYLLENEKNLDTISQKQIAIDLNV
FT                   RAQSLSRVLKELKISELIDTKKGRIEILNKDMIMKELW"
FT   gene            433335..434036
FT                   /locus_tag="CJJ81176_0492"
FT   CDS_pept        433335..434036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0492"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0492"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73226"
FT                   /db_xref="GOA:A0A0H3PAK4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAK4"
FT                   /protein_id="EAQ73226.1"
FT                   /translation="MDFDFILVQAPAFLTAAWLTIKLSFFGIIFSLIIGLFCILMSYFK
FT                   IKILENICKLYIEFSRNTPLLIQLFFLYYALPKFNIHLEQIPPLDLICLSVEETLRPSF
FT                   ACAIAGLSFLGGSYMAESLRAGFEAIRKQQFEAGLSLGFSKFGNLRYVILPQALAISMP
FT                   SISANIIFLIKETSVVSIIALPDLVNLMKSLNSLTYKTDELLFLLFMGYLCIILPLSFI
FT                   LLKFEKRLLHA"
FT   gene            434029..434685
FT                   /locus_tag="CJJ81176_0493"
FT   CDS_pept        434029..434685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0493"
FT                   /product="amino acid ABC transporter, permease protein,
FT                   His/Glu/Gln/Arg/opine family"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR01726"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0493"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73416"
FT                   /db_xref="GOA:A0A0H3PBL0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL0"
FT                   /protein_id="EAQ73416.1"
FT                   /translation="MLEFLNTDTLLRLWQGLFVTLEISFISIIITSIGGLFLGILMSFK
FT                   NTYIYAFCRLGLEFVRVMPLLVWLFVVYFGFPRWFGWDLSSVSAAIIVFSIWGCFEMMD
FT                   LVRVSLQSIPKHQYESASSLGLNTVQSFVYIIIPQAMRRLTPMSMNLLTRMIKSTTFAY
FT                   LIGAVELVKVGQQIIEFHNRNDFAPFIIYGLIFFIFFILCYPITLYSRKLEKKWS"
FT   gene            434687..435424
FT                   /locus_tag="CJJ81176_0494"
FT   CDS_pept        434687..435424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0494"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0494"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73330"
FT                   /db_xref="GOA:A0A0H3PAQ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAQ2"
FT                   /protein_id="EAQ73330.1"
FT                   /translation="MSILKIENLQKYYGSHHALKDINLEVKAKEVVVILGPSGCGKSTL
FT                   LRCINGLEEIASGNIYIDNEKIDKDFKEWPRMRQKVGMVFQSYELFEHLSVEENILLGP
FT                   MKVQKRKKDEVLKEAKIWLEKVGLLHKIHAYPRELSGGQKQRIAIVRSLCMNPELMLFD
FT                   EVTAALDPEIVREVLEVMLNLAKEGMTMLIVTHEMGFAKAVADKIIFMDEGKIIEENDP
FT                   KSFFENPKSERAKKFLNLFDYHK"
FT   gene            435539..435614
FT                   /locus_tag="CJJ81176_1716"
FT   tRNA            435539..435614
FT                   /locus_tag="CJJ81176_1716"
FT                   /product="tRNA-Thr"
FT   gene            435664..435749
FT                   /locus_tag="CJJ81176_1717"
FT   tRNA            435664..435749
FT                   /locus_tag="CJJ81176_1717"
FT                   /product="tRNA-Tyr"
FT   gene            435756..435832
FT                   /locus_tag="CJJ81176_1718"
FT   tRNA            435756..435832
FT                   /locus_tag="CJJ81176_1718"
FT                   /product="tRNA-Gly"
FT   gene            435937..436011
FT                   /locus_tag="CJJ81176_1719"
FT   tRNA            435937..436011
FT                   /locus_tag="CJJ81176_1719"
FT                   /product="tRNA-Thr"
FT   gene            436080..437279
FT                   /gene="tuf"
FT                   /locus_tag="CJJ81176_0499"
FT   CDS_pept        436080..437279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="CJJ81176_0499"
FT                   /product="translation elongation factor Tu"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03143; match to protein
FT                   family HMM PF03144; match to protein family HMM TIGR00231;
FT                   match to protein family HMM TIGR00485"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0499"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73030"
FT                   /db_xref="GOA:A1VYI6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYI6"
FT                   /protein_id="EAQ73030.1"
FT                   /translation="MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELK
FT                   DYDNIDNAPEEKERGITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDF
FT                   PGDDTPIISGSALKALEEAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIED
FT                   VFSISGRGTVVTGRIEKGVVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVG
FT                   VLLRGTKKEEVIRGMVLAKPKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRT
FT                   TDVTGSIKLADGVEMVMPGENVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK
FT                   "
FT   gene            437332..437490
FT                   /gene="rpmG"
FT                   /locus_tag="CJJ81176_0500"
FT   CDS_pept        437332..437490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="CJJ81176_0500"
FT                   /product="ribosomal protein L33"
FT                   /note="identified by match to protein family HMM PF00471;
FT                   match to protein family HMM TIGR01023"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0500"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72964"
FT                   /db_xref="GOA:A1VYI7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYI7"
FT                   /protein_id="EAQ72964.1"
FT                   /translation="MRIKVGLKCEECGDINYSTYKNSKNTTEKLELKKYCPRLKKHTLH
FT                   KEVKLKS"
FT   gene            437503..437578
FT                   /locus_tag="CJJ81176_1720"
FT   tRNA            437503..437578
FT                   /locus_tag="CJJ81176_1720"
FT                   /product="tRNA-Trp"
FT   gene            437597..437776
FT                   /gene="secE"
FT                   /locus_tag="CJJ81176_0502"
FT   CDS_pept        437597..437776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="CJJ81176_0502"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="identified by match to protein family HMM PF00584;
FT                   match to protein family HMM TIGR00964"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0502"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73430"
FT                   /db_xref="GOA:A0A0H3PC33"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC33"
FT                   /protein_id="EAQ73430.1"
FT                   /translation="MEKLITYFKLSKAELRKVIFPLKEQVRNAYITVFVVVAVISLFLA
FT                   LVDWLMSSIVSAIV"
FT   gene            437786..438319
FT                   /gene="nusG"
FT                   /locus_tag="CJJ81176_0503"
FT   CDS_pept        437786..438319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="CJJ81176_0503"
FT                   /product="transcription antitermination protein NusG"
FT                   /note="identified by match to protein family HMM PF00467;
FT                   match to protein family HMM PF02357; match to protein
FT                   family HMM TIGR00922"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0503"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73248"
FT                   /db_xref="GOA:A0A0H3PER6"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PER6"
FT                   /protein_id="EAQ73248.2"
FT                   /translation="MSTHKWYAIQTYAGSEMAVKRAIENLVKDNGIEEQLKEIVVPTED
FT                   VIEFKNGKEKISERSLYSGYVFALLDLNTELWHRIQSLPKVGRFIGESKKPTPLTEKDI
FT                   NLILEKVHNRAAPKPKISFEEGENVRITEGPFANFTAIVEEYDMVRGLLKLNVSIFGRS
FT                   TPVEILYSQVEKII"
FT   gene            438345..438770
FT                   /gene="rplK"
FT                   /locus_tag="CJJ81176_0505"
FT   CDS_pept        438345..438770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="CJJ81176_0505"
FT                   /product="ribosomal protein L11"
FT                   /note="identified by match to protein family HMM PF00298;
FT                   match to protein family HMM PF03946; match to protein
FT                   family HMM TIGR01632"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0505"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73126"
FT                   /db_xref="GOA:A1VYJ0"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ0"
FT                   /protein_id="EAQ73126.1"
FT                   /translation="MAKKVVGEIKLQIAATKANPSPPVGPALGQQGVNIMEFCKAFNER
FT                   TKDMAGFNIPVVITVYADKSFTFITKQPPATDLIKKAAGISKGTDNPLKNKVGKLTRAQ
FT                   VLEIVDKKIADLNTKDRDQAAKIIAGSARSMGVEIVD"
FT   gene            438825..439526
FT                   /gene="rplA"
FT                   /locus_tag="CJJ81176_0506"
FT   CDS_pept        438825..439526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="CJJ81176_0506"
FT                   /product="ribosomal protein L1"
FT                   /note="identified by match to protein family HMM PF00687;
FT                   match to protein family HMM TIGR01169"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0506"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73175"
FT                   /db_xref="GOA:A1VYJ1"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ1"
FT                   /protein_id="EAQ73175.1"
FT                   /translation="MAKIAKRLKELSQKIDSNKEYALSDAIDTIKTLKSAKFDETVEIA
FT                   LKLNVDPRHADQMVRGSVVLPAGTGKKVRVAVIAKDAKADEAKNAGADIVGSDDLVEEI
FT                   QKGNMNFDVLIATPNLMGLVGKVGRILGPKGLMPNPKTGTVTMDVAQAVNNAKSGQVNF
FT                   RVDKQGNIHAGLGKVSFSKEQLWDNVSTFVKAINKHKPAAAKGRYIKNAALSLTMSPSV
FT                   KLETQELLDMK"
FT   gene            439678..440157
FT                   /gene="rplJ"
FT                   /locus_tag="CJJ81176_0507"
FT   CDS_pept        439678..440157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="CJJ81176_0507"
FT                   /product="ribosomal protein L10"
FT                   /note="identified by match to protein family HMM PF00466"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0507"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72990"
FT                   /db_xref="GOA:A1VYJ2"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ2"
FT                   /protein_id="EAQ72990.1"
FT                   /translation="MTRSEKVEIIAKLEEGFKASEAIVVCNYRGLSTKKLEELRNNARE
FT                   NNVKVQIVKNTLANIALNNSGKTGLVLKDTNIYLWGEDQLSVSKVAAKFEENNDKFEIK
FT                   TAHIEGEVADVAKVKALAKMPSRNELLAMLLQVWNAPITNFTIGLNALKNKKESE"
FT   gene            440178..440555
FT                   /gene="rplL"
FT                   /locus_tag="CJJ81176_0508"
FT   CDS_pept        440178..440555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="CJJ81176_0508"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="identified by match to protein family HMM PF00542;
FT                   match to protein family HMM TIGR00855"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0508"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72965"
FT                   /db_xref="GOA:A1VYJ3"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ3"
FT                   /protein_id="EAQ72965.1"
FT                   /translation="MAISKEDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAA
FT                   AGGAAAAAEEKTEFDIVLTDGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVA
FT                   KAEAEEAKKQLEEAGAKVELK"
FT   gene            440665..444801
FT                   /gene="rpoB"
FT                   /locus_tag="CJJ81176_0509"
FT   CDS_pept        440665..444801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="CJJ81176_0509"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00562;
FT                   match to protein family HMM PF04560; match to protein
FT                   family HMM PF04561; match to protein family HMM PF04563;
FT                   match to protein family HMM PF04565; match to protein
FT                   family HMM TIGR02013"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0509"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73187"
FT                   /db_xref="GOA:A1VYJ4"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ4"
FT                   /protein_id="EAQ73187.2"
FT                   /translation="MCDMLDNKLGNRLRVDFSNISKQIEIPNLLQLQKKSFDYFLNLDN
FT                   GESGIEKVFKSIFPIHDPQNRLSLEYVSSEIGKPKYTIRECMERGLTYSVNLKMKIRLT
FT                   LHEKDEKTGEKVGVKDIKEQEIYIREIPLMTDRVSFIINGVERVVVNQLHRSPGVIFKE
FT                   EESSTVANKLVYTAQIIPDRGSWLYFEYDAKDVLYVRINKRRKVPVTMLFRALGYKKQD
FT                   IIKLFYPIQTIHVKKDKFLTEFNPNDFMDRIEYDIKDEKGKIVHQAGKRLTKKKAEQLI
FT                   KDGLKWIEYPVEILLNRYLANPIIDKESGEVLFDSLTLLDESKLAKIKEQKSFDIANDL
FT                   ANGVDAAIINSFAQDGETLKLLKQSENIDDENDLAAIRIYKVMRPGEPVVKDAAKAFVN
FT                   DLFFNPERYDLTKVGRMKMNHKLGLEVPEYVTVLTNEDIIKTAKYLIKVKNGKGHIDDR
FT                   DHLGNRRIRSIGELLANELHLGLAKMQKAIRDKFTSLNADLDKVMPYDLINPKMITTTI
FT                   IEFFTGGQLSQFMDQTNPLSEVTHKRRLSALGEGGLVKERAGFEVRDVHATHYGRICPV
FT                   ETPEGQNIGLINTLSTYAKVNELGFVEAPYRKVVNGKVTNEVVYLTATQEEGLFIAPAS
FT                   TKVDAKGNIVEEFVEARQDGETILARREEVQLIDLCSGMVVGVAASLIPFLEHDDANRA
FT                   LMGSNMQRQAVPLLTASAPIVGTGMEQIIARDAWEAVKAKRGGVVEKVDNKSIFILGED
FT                   DKGPFIDHYTMEKNLRTNQNTNYIQHPIVKKGDIVKAGQIIADGPSMDQGELAIGKNAL
FT                   IAFMPWNGYNYEDAIVVSERIIREDTFTSVHIYEKEIEARELKDGIEEITKDIPNVKEE
FT                   DVAHLDESGIAKIGTHIKPGMILVGKVSPKGEVKPTPEERLLRAIFGEKAGHVVNKSLY
FT                   ATASLEGVVVDVKIFTKKGYEKDDRAIKSYDKEKMALEKEHHDRLLMMDREEMLRVCAL
FT                   LSKAPLNSDQKIGDKNYKKGQTADISELEKINRFTLTTLIKAYSKEIQKEYDDLKNHFQ
FT                   NEKKKLKAEHDEKLEILEKDDILPSGVIKLVKVYIATKRKLKVGDKMAGRHGNKGIVST
FT                   IVPEVDMPYLPNGKSVDIALNPLGVPSRMNIGQILESHLGLIGLRLGDQIQEIFDRRQK
FT                   DFLKELRAKMLEICSIPRLASEKEFIKSLSDEELLNYARDWSKGVKFATPVFEGVNIEE
FT                   FSKLFEMAKIDMDGKTELYDGRTGEKIAERVHVGCMYMLKLHHLVDEKVHARSTGPYSL
FT                   VTQQPVGGKALFGGQRFGEMEVWALEAYGAAHTLREMLTIKSDDVEGRFSAYKALTKGE
FT                   NVPATGIPETFFVLTNELKSLALDVEIFDKDEDNE"
FT   gene            444794..449347
FT                   /gene="rpoC"
FT                   /locus_tag="CJJ81176_0510"
FT   CDS_pept        444794..449347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="CJJ81176_0510"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="identified by match to protein family HMM PF00623;
FT                   match to protein family HMM PF04983; match to protein
FT                   family HMM PF04997; match to protein family HMM PF04998;
FT                   match to protein family HMM PF05000; match to protein
FT                   family HMM TIGR02386"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0510"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73134"
FT                   /db_xref="GOA:A1VYJ5"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ5"
FT                   /protein_id="EAQ73134.1"
FT                   /translation="MSKFKVIEIKEDARPRDFEAFQLRLASPEKIKSWSYGEVKKPETI
FT                   NYRTLKPERDGLFCAKIFGPIRDYECLCGKYKKMRFKGVKCEKCGVEVANSKVRRSRMG
FT                   HIELVTPVAHIWYVNSLPSRIGTLLGVKMKDLERVLYYEAYIVENPGDAFYDNESTKKV
FT                   EYCDVLNEEQYQNLMQRYENSGFKARMGGEVVRDLLANLDLVALLNQLKEEMAATNSEA
FT                   KKKTIIKRLKVVENFLNSNLNANTDSDEAVPNRPEWMMITNLPVLPPDLRPLVALDGGK
FT                   FAVSDVNDLYRRVINRNTRLKKLMELDAPEIIIRNEKRMLQEAVDALFDNGRRANAVKG
FT                   ANKRPLKSLSEIIKGKQGRFRQNLLGKRVDFSGRSVIVVGPKLRMDQCGLPKKMALELF
FT                   KPHLLAKLEEKGYATTVKQAKKMIENKTNEVWECLEEVVKGHPVMLNRAPTLHKLSIQA
FT                   FHPVLVEGKAIQLHPLVCAAFNADFDGDQMAVHVPLSQEAIAECKVLMLSSMNILLPAS
FT                   GKSVTVPSQDMVLGIYYLSLEKAGAKGSHKICTGIDEVMMALESKCLDIHASIQTMVDG
FT                   RKITTTAGRLIIKSILPDFVPENSWNKVLKKKDIAALVDYVYKQGGLEITASFLDRLKN
FT                   LGFEYATKAGISISIADIIVPNDKQKAIDEAKKQVREIQNSYNLGLITSGERYNKIIDI
FT                   WKSTNNVLSKEMMKLVEKDKEGFNSIYMMADSGARGSAAQISQLAAMRGLMTKPDGSII
FT                   ETPIISNFREGLNVLEYFISTHGARKGLADTALKTANAGYLTRKLIDVAQNVKITIEDC
FT                   GTHEGVEINEITADSSIIETLEERILGRVLAEDVIDPITNSVLFAEGTLMDEEKAKILG
FT                   ESGIKSVNIRTPITCKAKKGICAKCYGINLGEGKLVKPGEAVGIVSAQSIGEPGTQLTL
FT                   RTFHSGGTASTDLQDRQVSAQKEGFIRFYNLKTYKNKEGKNIVANRRNAAILLVEPKIK
FT                   TPFKGVINIENIHEDVIVSIKDKKQEVKYILRKYDLAKPNELAGVSGSIDGKLYLPYQS
FT                   GMQVEENESIVEVIKEGWNVLNRIPFASEILVEDGEPVVQNIKAGEKGTLKFYILKGDG
FT                   LDRVKNVKKGDIVKEKGFFVVIADENDREAKRHYIPRESKIEFNDSEKIDDANTIIASA
FT                   PKKERKVIAEWDAYNNTIIAEIDGVVSFEDIEAGYSADEQIDEATGKRSLVINEYLPSG
FT                   VRPTLVIAGKGDKAVRYQLEPKTVIFVHDGDKIAQADILAKTPKAAAKSKDITGGLPRV
FT                   SELFEARKPKNAAVIAEIDGVVRFDKPLRSKERIIIQAEDGTSAEYLIDKSKHIQVRDG
FT                   EFIHAGEKLTDGVVSSHDVLKILGEKALHYYLISEIQQVYRGQGVVISDKHIEVIVSQM
FT                   LRQVKVVDSGHTKFIEGDLVSRRKFREENERIIRMGGEPAIAEPVLLGVTRAAIGSDSV
FT                   ISAASFQETTKVLTEASIAGKFDYLEDLKENVILGRMIPVGTGLYGEQNLKLKEQE"
FT   gene            449467..449853
FT                   /gene="rpsL"
FT                   /locus_tag="CJJ81176_0511"
FT   CDS_pept        449467..449853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="CJJ81176_0511"
FT                   /product="ribosomal protein S12"
FT                   /note="identified by match to protein family HMM PF00164;
FT                   match to protein family HMM TIGR00981"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0511"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73201"
FT                   /db_xref="GOA:A1VYJ6"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ6"
FT                   /protein_id="EAQ73201.1"
FT                   /translation="MPTINQLVRKERKKVLEKSKSPALKNCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTSGFEVISYIGGEGHNLQEHSIVLVRGGRVKDLPGVKYHIVRGALDT
FT                   AGVAKRTVSRSKYGAKRPKAGAAK"
FT   gene            449923..450393
FT                   /gene="rpsG"
FT                   /locus_tag="CJJ81176_0512"
FT   CDS_pept        449923..450393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="CJJ81176_0512"
FT                   /product="ribosomal protein S7"
FT                   /note="identified by match to protein family HMM PF00177;
FT                   match to protein family HMM TIGR01029"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0512"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73024"
FT                   /db_xref="GOA:A1VYJ7"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ7"
FT                   /protein_id="EAQ73024.1"
FT                   /translation="MRRRKAPVREVLPDPIYGNKVITKFINSLMYDGKKSTATTIMYGA
FT                   LEAIDKKGGEKKGIDIFNDAIENIKPLLEVKSRRVGGATYQVPVEVRPARQQALAIRWI
FT                   ISFARKRSERTMIDKLAAELLDAANSKGASFKKKEDTYKMAEANKAFAHYRW"
FT   gene            450406..452481
FT                   /gene="fusA"
FT                   /locus_tag="CJJ81176_0513"
FT   CDS_pept        450406..452481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="CJJ81176_0513"
FT                   /product="translation elongation factor G"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF00679; match to protein
FT                   family HMM PF03144; match to protein family HMM PF03764;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00484"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0513"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73060"
FT                   /db_xref="GOA:A1VYJ8"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYJ8"
FT                   /protein_id="EAQ73060.1"
FT                   /translation="MSRSTPLKKVRNIGIAAHIDAGKTTTSERILFFTGMSHKIGEVHD
FT                   GAATMDWMEQEKERGITITSAATTCFWKDHQINLIDTPGHVDFTIEVERSMRVLDGAVA
FT                   VFCSVGGVQPQSETVWRQANKYGVPRIVFVNKMDRIGANFYNVEDQIRNRLKANPVPLQ
FT                   IPIGAEDNFKGVIDLVTMKALVWEDDTKPTDYVEKEIPAELKEKAEEYRTKMIEAVSET
FT                   SDELMEKYLGGEELSLEEIKTGIKAGCLSLSIVPMLCGTAFKNKGVQPLLDAVVAYLPA
FT                   PDEVPNIKGEYEDGTEVSVKSTDDGEFAGLAFKIMTDPFVGQLTFVRVYRGCLESGSYA
FT                   YNSTKDKKERIGRLLKMHSNKREEIKVLYAGEIGAVVGLKDTLTGDTLASEKDKVILER
FT                   MDFPDPVISVAVEPKTKADQEKMSIALNKLAQEDPSFRVSTDEESGQTIISGMGELHLE
FT                   IIVDRMLREFKVEAEVGQPQVAYRETIRKTVEQEYKYAKQSGGRGQYGHVFLRLEPLEP
FT                   GSGYEFVNDIKGGVIPKEYIPAVDKGVQEALQNGVLAGYPVEDVKVTVYDGSYHEVDSS
FT                   EMAFKLAASMGFKEGARKAGAVILEPMMKVEVETPEDYMGDVIGDLNKRRGQVNSMDER
FT                   GGNKIITAFCPLAEMFGYSTDLRSQTQGRATYSMEFDHYDEVPKNVADEIIKKRNG"
FT   gene            452510..452586
FT                   /locus_tag="CJJ81176_1721"
FT   tRNA            452510..452586
FT                   /locus_tag="CJJ81176_1721"
FT                   /product="tRNA-Arg"
FT   gene            452604..452753
FT                   /locus_tag="CJJ81176_0515"
FT   CDS_pept        452604..452753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0515"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0515"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73252"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBV3"
FT                   /protein_id="EAQ73252.1"
FT                   /translation="MIKIAFFIIFVISFLTAQSPVNFKEDNNITKEQNIFKEQPPKRIK
FT                   IPTH"
FT   gene            452759..453460
FT                   /locus_tag="CJJ81176_0516"
FT   CDS_pept        452759..453460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0516"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0516"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73475"
FT                   /db_xref="GOA:A0A0H3PAY3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY3"
FT                   /protein_id="EAQ73475.1"
FT                   /translation="MSDLITLAQLSQGYRYNSDSLILADFILKQGIKGAVFDVGAGCGI
FT                   IGILLKKNIANLSLSLIDIQKENIKLIEKNLKSNQIQGDIFYDDFNQFQSIKKFDFIVC
FT                   NPPFYRQGAYKSEDQHKAISKFQEFLPLHSFLTKANSMLKPNGTLYFCYEALALDEICF
FT                   ILKDMKMKITKLCFVHTHQNKKARLVLIQVKKGSKSPCEILPPFFVYENEILSKQMQEI
FT                   HLRFRLKSYDI"
FT   gene            453450..453824
FT                   /locus_tag="CJJ81176_0517"
FT   CDS_pept        453450..453824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0517"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03692"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0517"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73096"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBP7"
FT                   /protein_id="EAQ73096.1"
FT                   /translation="MIFDKNFSYAFDENACEKCGGKCCTGESGNIFASKEELEALRKHL
FT                   KLESKEFAEKYLRKVGFKMSFKEVEFEDGFACIFFDTQKRNCSIYDFRPKQCRTFPFWE
FT                   YFKTHQKELEKECIGICYLS"
FT   gene            453836..455074
FT                   /locus_tag="CJJ81176_0518"
FT   CDS_pept        453836..455074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0518"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0518"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73336"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJC9"
FT                   /protein_id="EAQ73336.2"
FT                   /translation="MVACGSSKINVVYPDYTKYKSNDFDLRVMKAYNYEYYKQYKEARD
FT                   EFLSLYQDYNNTNFLENAFLLTLANNLDRQAELNNLAKPYLNQNDNLKRLSALYALNSN
FT                   DINNAQKLMKELLVKKDSDPRNLELYGDILVKKNDLKNATKYYRSAYNQVQNEEILFKL
FT                   IGIYAILNDTLNIKNVLEFSRKTNGCTLKTCVLLAKIYFDEKNIEALKSIYKELYQLTK
FT                   NKSFALALVELLNSQGKTEEALKISLQYDLDDDIKFALYQNLKRFDDAKKMSLALYHKT
FT                   KNKEYLLRAAVFEFEAANEAKKITPKVIDSVKEKFEQAIDKDSNALYLNYYGYLLIDYD
FT                   LDVKKGIELVKLALEKDPQNLYYLDSLAWGYYKLGDCRQAWEILKQTLDDKEFANSDES
FT                   KAHIKAIKACVKP"
FT   gene            455071..455847
FT                   /gene="trpC"
FT                   /locus_tag="CJJ81176_0519"
FT   CDS_pept        455071..455847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="CJJ81176_0519"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="identified by match to protein family HMM PF00218"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0519"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73195"
FT                   /db_xref="GOA:A1VYK3"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYK3"
FT                   /protein_id="EAQ73195.1"
FT                   /translation="MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALK
FT                   RVEKEVKIIAEVKKASPSKGVIREDFDPLSIALNYEKNKATAISVLTEPHFFKGSLEYL
FT                   SLIRRYTQIPLLRKDFIFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLE
FT                   ALVEIHDKEDLSKAIFAGADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLE
FT                   NKEFLEHLQNLGVDAFLIGEYFMREEDEGKALKALL"
FT   gene            455857..456342
FT                   /locus_tag="CJJ81176_0520"
FT   CDS_pept        455857..456342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0520"
FT                   /product="Hit family protein"
FT                   /note="identified by match to protein family HMM PF01230"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0520"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73289"
FT                   /db_xref="GOA:A0A0H3PJA2"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="InterPro:IPR039383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJA2"
FT                   /protein_id="EAQ73289.1"
FT                   /translation="MQYLYAPWRSEYFEKEKSVCPFCDCANKIKSDEDLGVIFRAKHCF
FT                   GVMNRYPYSAGHFMVIPYVHEEHIENLSDEIWQEMSHFVRLGVKILKEQIHANGVNIGM
FT                   NLSKDAGAGIAFHCHYHLVPRWAGDTNFITTIGETRVCGTNIEQVYQKLVLAFKNAQ"
FT   gene            456332..457336
FT                   /gene="ybbB"
FT                   /locus_tag="CJJ81176_0521"
FT   CDS_pept        456332..457336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbB"
FT                   /locus_tag="CJJ81176_0521"
FT                   /product="tRNA 2-selenouridine synthase"
FT                   /EC_number="2.9.1.-"
FT                   /note="identified by match to protein family HMM TIGR03167"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0521"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73442"
FT                   /db_xref="GOA:A0A0H3PF26"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR017582"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF26"
FT                   /protein_id="EAQ73442.1"
FT                   /translation="MLSEVEFAEFQKENFSLLIDARSPREFLHSHLIGALNFYALNDEE
FT                   YQEIGTIYKKNQALAKARGASYICQNTAKHILKITQNFRIGEKVGIYCSRGGLRSKSIA
FT                   VILSELGFRVVRLKGGFKAYRTFVTHYFENEINFDFFTLCGNTGCGKTELLEQLPQAIN
FT                   LEKIANHLGSSFGDILGKQPTQKAFEAELFHNMQNLENFAFIESESRKIGDIILPLKFY
FT                   EKMQKAFKIYCFCSLENRVKRIQKIYQEKMTPLKFQQCVQKISPYISLNLRQDLLQSYE
FT                   RKEWQKLIVMLLEYYDKTYKKPDKIDLELNTDDILKAKEEILRYFKLKNYILI"
FT   gene            complement(457709..457825)
FT                   /locus_tag="CJJ81176_0522"
FT   CDS_pept        complement(457709..457825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0522"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0522"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73183"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAI6"
FT                   /protein_id="EAQ73183.1"
FT                   /translation="MLKKVTMESLKQNFSIPPPSEVKKLNSWHRCPWKIKLK"
FT   gene            457960..458142
FT                   /locus_tag="CJJ81176_0523"
FT   CDS_pept        457960..458142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0523"
FT                   /product="conserved hypothetical protein, degenerate"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0523"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3P978"
FT                   /protein_id="EAQ72984.1"
FT                   /translation="MLRVLNNILTIFNNHKPNITNINDLNFKHYLLTPDMREDEFLSFK
FT                   ARHGVNTADRSIKNS"
FT   gene            458144..458299
FT                   /locus_tag="CJJ81176_0524"
FT   CDS_pept        458144..458299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0524"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0524"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73284"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ98"
FT                   /protein_id="EAQ73284.1"
FT                   /translation="MLPFLITVKTDHADASYNKLILEQGELSSVFYLKPKDTHIKTLVI
FT                   LKAINA"
FT   gene            458296..458739
FT                   /locus_tag="CJJ81176_0525"
FT   CDS_pept        458296..458739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0525"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0525"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCF6"
FT                   /protein_id="EAQ73338.1"
FT                   /translation="MNFLMSSTFTHYSNASYNQTILQKDAHISMGVENTYDLALNGSPY
FT                   LIGAITTYGDSTNNSLNIKASSSVEFFTSLPKKDKNGNNTFDERITHLVGGLAYQGNVK
FT                   NNKIFIKDANMIIHGPSKAYASLAAAHISAGYIIKTFKPVKTF"
FT   gene            458769..458885
FT                   /locus_tag="CJJ81176_0526"
FT   CDS_pept        458769..458885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0526"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0526"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73395"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PCE8"
FT                   /protein_id="EAQ73395.1"
FT                   /translation="MNHDKQPLAYNSVLFADFLGGKTEQGQALDNTINIKRY"
FT   gene            458930..459799
FT                   /locus_tag="CJJ81176_0527"
FT   CDS_pept        458930..459799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0527"
FT                   /product="putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0527"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM1"
FT                   /protein_id="EAQ73443.1"
FT                   /translation="MFNFYAGAYNNGEVNYNTLNIELKHPLEIANNFLGYNQHSFYGDF
FT                   ATKGVNHNTINIKNDLTTTDLSQSYKDALNIVAARTLEGSADYNKVYINNSMSTLPVYI
FT                   YTAKKNILNNQDFYPSSANNNKVSIKDFASFRNLTVLTEAKEASYNTINYNNVQSITDA
FT                   SNTDKGSKIIIRALDKANHNIIDIKNYSSNAADNAYLIMAYNEAAYNKIIINDTLFGVA
FT                   SDKREGILSIIAGLSNNGHDNTLIINNLNLDEYKNNNSVFIAPSAITGLSEAKSYNNTL
FT                   YRREFKYI"
FT   gene            460185..460313
FT                   /locus_tag="CJJ81176_0528"
FT   CDS_pept        460185..460313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0528"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIU7"
FT                   /protein_id="EAQ73021.1"
FT                   /translation="MQKNKEDFKLSSIDRLKKMNLQKLSYEVRISQDGKSIYAKIK"
FT   gene            460410..462071
FT                   /locus_tag="CJJ81176_0529"
FT   CDS_pept        460410..462071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0529"
FT                   /product="putative periplasmic protein"
FT                   /note="identified by match to protein family HMM PF05860;
FT                   match to protein family HMM TIGR01901"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0529"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73077"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ACI2"
FT                   /protein_id="EAQ73077.1"
FT                   /translation="MKKLNKLSLSLVVGSLLFTQSYALPSGGKFTHGTSGSISSSNGTM
FT                   NISGSKTNSVIQWGGGFNIASGETVNFKGSGYNYLNIVYGSKSSHIDGKLEGGSNNIFL
FT                   INPNGIVVGKGGSINANRVYLSTSSVSNEDMQRFANGVSDTDAIFGLGLSLSPVIAKLN
FT                   GNVINLGVIEGKSDVTLIGNEVAHHDENKNVGLFISDNPISFRANLLYFILKSNYSIAS
FT                   GSMNYGIQKGSPVEQFVANNQVVYETNDKITSTDIDANVMNSIFNDLKFNSSVNIEDLS
FT                   KFYKDGKLLTADDLASINQSMDFITALYGQTQDSNNATFANALKEVLGNSYGNLGKANQ
FT                   AIIKTKEILSQIPKITEQQKNIQKAYDQAVDAYNEAVKKYNAALSGVTGSNASETITAL
FT                   KTVLDKAYNDLKNAEANLESTTASNNSSLKSSNETLASVSIDGYKLTVNGEYLADYKTV
FT                   NKPNDNNSGSNNGNDGTDSGDINNGNNNVSNNNPNDTIGQQEPDIATALLMQTTDEDPN
FT                   INEDDKQASIDEASTQLSGNTCIVSDNFKAGNPCSR"
FT   gene            462333..463988
FT                   /locus_tag="CJJ81176_0530"
FT   CDS_pept        462333..463988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0530"
FT                   /product="putative outer-membrane protein"
FT                   /note="identified by match to protein family HMM PF01103"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0530"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73358"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3ABW9"
FT                   /protein_id="EAQ73358.1"
FT                   /translation="MIIIDHSNTSDDNNSKTINTKKNTQKDNNNTQKNQPNLSNDNTLK
FT                   TKTPNSNTPSLKNTSKEESIHKVSFSFHITNKNINFKDLGLDEQVLQEALNDYKKESIS
FT                   VQDLQDIANIISYYVQVSGYPAATAYIPQQELKDQIQINITLGVLGKYVVQNNSSVRDY
FT                   AIESKLPNHKGEIITTKLVEDAVYKVNEMYGIQTLASLKAGDNPGETDVVIETTPSDSF
FT                   VSVLFYGDNYGIKESGRYRGGASMSFNNIAHQGDSLNAYLQRSDEAQTNYGISYTTFLG
FT                   NLKITPSYSKGNYALGGIWREFDFIGTSENLGVDLKYPLWITTYNSFYLTSSYYHKKLS
FT                   DSKFDILTFDKSSDTISFGIEGVYNGISNDSFSYSANVSYGNVKDEGMTIVGIGTSKVG
FT                   GVEFGKFAKLNVNLNNAYFFNDTFTHLFSLNYQQVINGATLDSSETISLGGPYGVRAYN
FT                   NGDGEGDNAVVASFGLRMATPLKDFYITPFYDIGYSWYENDSYTNYMDAYGLQLLYNKT
FT                   GNFYVKLDLARALKKYKLDDDYSSKAYVSFGKYF"
FT   gene            complement(463992..464921)
FT                   /gene="hemH"
FT                   /locus_tag="CJJ81176_0531"
FT   CDS_pept        complement(463992..464921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="CJJ81176_0531"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0531"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73002"
FT                   /db_xref="GOA:A1VYL5"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYL5"
FT                   /protein_id="EAQ73002.1"
FT                   /translation="MKLVLFLNMGGATNLQDCEVFLKNMFNDPYILGIKNRFLRKFVAW
FT                   IITKARVKAMQENYKKMGGKSPLNELTQSLCNKLNLKQDEFKFDFVNLYVPPFATEILQ
FT                   KYTLNESDEIILFPLYPHHSCTTVTSSLEVLQNEISKQKIQAKVKTIDIFYKNELYNEM
FT                   IVSHILDKKSKFDAKILIFSAHSLPQSIIDKGDLYEKHVNDHVEILKEKLKDHFDEFIL
FT                   AYQSKLGPVKWLEPNTSDVLANLNDKALIYPISFCIDCSETIFELGMEYKHLAKCDYDL
FT                   ISCPNDSDEFMEFILNSINSPLARKTSC"
FT   gene            complement(464918..465784)
FT                   /locus_tag="CJJ81176_0532"
FT   CDS_pept        complement(464918..465784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0532"
FT                   /product="oxidoreductase, Gfo/Idh/MocA family"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0532"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73092"
FT                   /db_xref="GOA:A0A0H3PEH2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEH2"
FT                   /protein_id="EAQ73092.1"
FT                   /translation="MKIGIIGLGKMGQNHLNELSKNSHFKLNALFDLCKNPNLNIFDDI
FT                   FYDDLDKFLNRNNDIIIIATPTNSHLAIAKKVFKQCKCVLIEKPLALNLKEIDEISNLA
FT                   KEYSVKVGVGFCERFNPAVLALKKELENEEIISINIQRFSLYPQRISDVGILQDLAVHD
FT                   LDLLCFLSKQEITKTNLLKKYTQDQTRESESIILCELEKCIASIHQSWNSTQKLRKIHL
FT                   ITKNHFYEANLNDFSLLKDGNFIELTQQSPLFSEHEALLKLIDNQPNHLASTSDAYKVQ
FT                   EILERFA"
FT   gene            complement(465789..466862)
FT                   /locus_tag="CJJ81176_0533"
FT   CDS_pept        complement(465789..466862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0533"
FT                   /product="DegT/DnrJ/EryC1/StrS aminotransferase family"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00266; match to protein
FT                   family HMM PF01041; match to protein family HMM PF01053;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0533"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73004"
FT                   /db_xref="GOA:A0A0H3PAA8"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAA8"
FT                   /protein_id="EAQ73004.1"
FT                   /translation="MNFINLQAQYLAYKDEINAEIESVLSSSSFIGGAKLNEFEQNLAH
FT                   FLGVKHAIGCSSGTSALYLALRALDIGKDDEVIVPSFTFIATAEVVALVGAKPVFVDIN
FT                   LSNYNLDFEAVQKAITPKTKAVIAVSMFGQMSDLRALEEILKNKNITLIEDGAQSFGAS
FT                   FKGEKSCSIAKISCTSFFPSKPLGAYGDGGAIFCHDDEIAKKIRILLNHGQTQRYKHEF
FT                   IGINGRLDTLQAAILNVKLKYLEKELDKRQKLAQTYNANLKNCQIPQIDPNAFSAYAQY
FT                   SVLVEDRASVLQKFEKANIPYAIHYPTPLHKQPCFSEFSNLELKNSEYASEHILSLPFS
FT                   PFLSEEEQEQVICIFKD"
FT   gene            466977..469505
FT                   /gene="alaS"
FT                   /locus_tag="CJJ81176_0534"
FT   CDS_pept        466977..469505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alaS"
FT                   /locus_tag="CJJ81176_0534"
FT                   /product="alanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.7"
FT                   /note="identified by match to protein family HMM PF01411;
FT                   match to protein family HMM PF02272; match to protein
FT                   family HMM PF07973; match to protein family HMM TIGR00344"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0534"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73249"
FT                   /db_xref="GOA:A1VYL8"
FT                   /db_xref="InterPro:IPR002318"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018162"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR018164"
FT                   /db_xref="InterPro:IPR018165"
FT                   /db_xref="InterPro:IPR023033"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYL8"
FT                   /protein_id="EAQ73249.1"
FT                   /translation="MDIRKAYLDFFASKGHEITPSSPLVPDDATLLFANAGMVPFKSIF
FT                   TGEIPRPNPPRKTSCQTCIRAGGKHNDLDNVGYTARHHTFFEMLGNFSFGDYFKEQAIA
FT                   YAWEFVTEVLKLPKDRLYVTVHENDDEAFNLWQKHIQKERIYKFGDKDNFWQMGDTGPC
FT                   GPCSEIFYDQGEEHFNSSEDYMGGDGDRFLEIWNLVFMQYERSADGVLSPLPKPSIDTG
FT                   MGLERVTAIKEGKFSNFDSSLFMPIINEISKLCNKTYIYESGASFRVIADHIRSSVFLL
FT                   AQGVSFDKEGRGYVLRRILRRALRHGYLLGFKQAFMYKLVDIVCDLMGGHYTYLNEKKD
FT                   FIKEQIRLEEERFLSTIENGIEIFNEELKNTKEIFSGEVAFKLYDTYGFPLDLTADMLR
FT                   EKNLKVDEEKFELLMNEQKARAKASWKGSGDKTASGDFKNLLEKFGENHFVGYEKAECE
FT                   SKILALLDEDFKEVSTLKDAGWVMLENTPFYATSGGQSADSGFIAKREVLDTQKFFNLN
FT                   LSFVKAGEELKVGDIVHARIDTEKREQIARHHSATHLLHHALREILGSHVSQAGSLVES
FT                   NKLRFDFTHHKALNKEELESIEKRVNEMIINSSEAILENMPLEEAKKSGAIALFNEKYQ
FT                   GNVRVLTLGESKELCGGTHVKNTAQIGSFYIVKESGVSAGVRRIEAVVSKAALEFVKNQ
FT                   LEELSKVKDELKNNDILNGVKKLKNEILSLKNELKNSSKTELDSKNIQGVEICVKRIDN
FT                   GDIKAMIDDFKNKFAKAVILLIQVKDEKITLAAGVKDAPLKAGALVKEAAQILGGNGGG
FT                   RDDFATAGGKDLSKINEALKQSLETIEKAL"
FT   gene            469505..470056
FT                   /locus_tag="CJJ81176_0535"
FT   CDS_pept        469505..470056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0535"
FT                   /product="maf protein, putative"
FT                   /note="identified by match to protein family HMM PF02545"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0535"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73122"
FT                   /db_xref="GOA:A1VYL9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYL9"
FT                   /protein_id="EAQ73122.1"
FT                   /translation="MLILASSSISRANLLKTAKIDFRQVSFDYDENLNKNISPFLYVQK
FT                   IVLEKERQFLSTLGKDFQNQNLLFADSIVCIDEKILTKAKDKKEAYEMLALQNGKYASI
FT                   LSAFLLVKPEKRVFSLSKTTLYFKNFDENALRDYVENDLYKGKAGCIMCEGFHQNFITQ
FT                   QVGNLSTALGLDIQTLKAYL"
FT   gene            470053..471984
FT                   /gene="pbpA"
FT                   /locus_tag="CJJ81176_0536"
FT   CDS_pept        470053..471984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpA"
FT                   /locus_tag="CJJ81176_0536"
FT                   /product="penicillin-binding protein 1A"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF00912; match to protein
FT                   family HMM TIGR02074"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0536"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73315"
FT                   /db_xref="GOA:A0A0H3PEV8"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEV8"
FT                   /protein_id="EAQ73315.1"
FT                   /translation="MKILKYIFSFFTLLFIAGFIYVAYLFTSADTEGYTFKEYKPPLTT
FT                   QIYDRNGKLVANIFEQHRFYAPYEELPPRLIEALVAIEDTSFFEHNGVNIDAIFRAAVK
FT                   IIKSGGKTMEGASTLTQQFIKNTELTPERTITRKIREALLAYKMETILTKEQILERYLN
FT                   FIFFGHGYYGVKTAALGYFHKNLNELSLKEIAMLVGMPKAPSSYDPTKHLDLSISRANN
FT                   VISRMYNLGWISKADYDTAIKEIPQVYDDTLTQNAAPYVVDEVIKQLSPNIKDLKTGGY
FT                   KIILNIDLDVQNMAQNALKFGYDEIVKRDKDANLSTLNGAMVVVNHQSGDVLALVGGVD
FT                   YEKSNYNRATQSMRQPGSSFKPFVYQVAINLGYSPMSEIADISRIFEGGAGNNEDWKPK
FT                   NEGGKFLGLITLKEALTRSRNLATINLALDMGLDVLYSKLMEFGFKDIPPNLSIVLGSF
FT                   GISPLEYSKFYTMFGNYGTIKDPQIIRQVQDKTGKTIMEFNSNERKVSDEAQSFLVLDM
FT                   MRNVVEKGTGRNARVKDIEIAGKTGTTNKSVDAWFCGLTPEIEAIIWYGNDNNKPMRYT
FT                   EGGARTAAPVFREFLTQYIEKFPDTTRKFSIPNGVYRGNYKGESAYYTTKSPLPKANMK
FT                   FNESEIIF"
FT   gene            complement(472012..474585)
FT                   /gene="clpB"
FT                   /locus_tag="CJJ81176_0537"
FT   CDS_pept        complement(472012..474585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="CJJ81176_0537"
FT                   /product="ATP-dependent chaperone protein ClpB"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0537"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73285"
FT                   /db_xref="GOA:A0A0H3PBW9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBW9"
FT                   /protein_id="EAQ73285.1"
FT                   /translation="MANIQDFLTDNMLSNLESAASLAIHSKNTEVVPLHLLWALSVDST
FT                   SILNQILNKLNISKEALELEIKSRISKLATSSNVNRENIRFSNELINSLENAKGLMSAN
FT                   GDSYLSVDTWLISESQKSPIKEILAQFLDLREFQKELESLRAGRKMDSKTSDETLDSLN
FT                   KFGIDLTLKASEGKLDPVIGREEEIERLMQILIRKTKNNPILLGEPGVGKTAIVEALAQ
FT                   RIIKKDVPKSLQNKKVIALDMSALIAGAKYRGEFEDRLKAVVNEVIKSENIILFIDEIH
FT                   TIVGAGATEGSMDAANILKPALARGELHTIGATTLKEYRKYFEKDAALQRRFQPVNVGE
FT                   PSVNEALAMLRGIKEKLEIHHNVTINDSALVAAAKLSKRYITDRFLPDKAIDLIDEAAA
FT                   ELKMQIESEPSSLRKVRKDIETLEVENEALKMENDEKNQKRLDEIAKELANLKEKQNAL
FT                   NSQFENEKSVFDGISAKKKEIDLLKNEASLAKARGEFQKAAELEYGKIPSLEKEVEILE
FT                   DKWKKMSENGVLLKNQVDEDLVAGILSKWTGISVQKMLTSEKQKFLEVEKHLKESVIGQ
FT                   DKALSALARAIKRNKAGLNADNKPIGSFLFLGPTGVGKTQSAKALAKFLFDDEKAMIRF
FT                   DMSEFMEKHSVSRLLGAPPGYIGHEEGGELTEAVRRKPYSVLLFDEVEKAHKDVFNVLL
FT                   GILDDGRATDSKGVTVDFKNTIIILTSNIASSAIMNLSGKEQEDAVKNELKNFFKPEFL
FT                   NRLDDIITFNPLGKDEAYEIVKLLFKDLQMSLENKGIKASLSENAALLIAKDGFDPDFG
FT                   ARPLRRAIYDLIEDKLSDMILADELHENDSIIIDAKDDEIIIKKA"
FT   gene            complement(474697..474987)
FT                   /locus_tag="CJJ81176_0538"
FT   CDS_pept        complement(474697..474987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0538"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02583"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0538"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73454"
FT                   /db_xref="GOA:A0A0H3PBM7"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM7"
FT                   /protein_id="EAQ73454.1"
FT                   /translation="MCQEKHTHTHSQKHLKAVCNRLSRTIGHLSAIKRMVENDKDCSEI
FT                   LIQLAAVKAEVNNTAKVVLKEHLAHCMVHAIEENDIQSIEELNKAIDMFMK"
FT   gene            475105..476439
FT                   /gene="ctpA"
FT                   /locus_tag="CJJ81176_0539"
FT   CDS_pept        475105..476439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="CJJ81176_0539"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0539"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73412"
FT                   /db_xref="GOA:A0A0H3PJH9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJH9"
FT                   /protein_id="EAQ73412.1"
FT                   /translation="MMELILKTKRFFAGLAGFATTFILCLFLTSHLQAKVDQKEEQVQK
FT                   RLEALDKLTKTLAIIEQYYVDDQNISDLVDKSLSGLLSNLDAHSSFLNEKDFNDMKIQT
FT                   NGEFGGLGITVGMKDGALTVVSPIEGTPADKAGIKSGDIILKINDEATLGINLNDAVDK
FT                   MRGKPKTQITLTIFRKGATKPFDVTLTREIIKIESVYAKMIENENILYLRVTNFDKNVV
FT                   DVASKELKKYPNVRGVILDLRNNPGGLLNQAIGLVNLFVDKGVIVSQKGRITSENQEYK
FT                   ADPKNKISDVSLAVLVNGGSASASEIVSGALQDLKRGVIVGENTFGKGSVQQIIPINKT
FT                   EALRLTIARYYLPSGRTIQAVGVKPDIEVFPGKVNTQEDGFSIKESDLKQHLESELEKI
FT                   DKNKKEDKQENKDNKNLISQKQINDDAQLKSAIDTIKILNIKQGQ"
FT   gene            476441..477151
FT                   /gene="purC"
FT                   /locus_tag="CJJ81176_0540"
FT   CDS_pept        476441..477151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="CJJ81176_0540"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="identified by match to protein family HMM PF01259;
FT                   match to protein family HMM TIGR00081"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0540"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73331"
FT                   /db_xref="GOA:A1VYM4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYM4"
FT                   /protein_id="EAQ73331.1"
FT                   /translation="MTKKEMLYEGKGKKLFKTDDENLLISEFKDDLTAFNAEKRGNESG
FT                   KGALNCKISTEIFHLLEKNGIKTHLVETISDTEQVVKKCKIVPIEVIVRNVATGSLTKR
FT                   LGIKDGTVLPFALVEFCLKDDALGDPFINDEHCLILNLVQNEAQISEIKNMARKINSIL
FT                   TPFFDNKNLRLIDFKIELGLTKDNELVLADEISPDSCRFWDKFSNEKLDKDRFRQDLGN
FT                   VKMAYEEVLKRILN"
FT   gene            477160..477405
FT                   /gene="purS"
FT                   /locus_tag="CJJ81176_0541"
FT   CDS_pept        477160..477405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="CJJ81176_0541"
FT                   /product="phosphoribosylformylglycinamidine synthase, purS
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02700;
FT                   match to protein family HMM TIGR00302"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0541"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73405"
FT                   /db_xref="GOA:A0A0H3PBK5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK5"
FT                   /protein_id="EAQ73405.1"
FT                   /translation="MEVIVNISLKNGVLDPQGKAVEKALHSLNFNSVKEVKIAKQIKIS
FT                   LDEKDEKLAKEQVKKMCEELLVNSVIEDYELVIEKE"
FT   gene            477407..478054
FT                   /gene="purQ"
FT                   /locus_tag="CJJ81176_0542"
FT   CDS_pept        477407..478054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="CJJ81176_0542"
FT                   /product="phosphoribosylformylglycinamidine synthetase I"
FT                   /EC_number="6.3.5.3"
FT                   /note="identified by match to protein family HMM PF07685;
FT                   match to protein family HMM TIGR01737"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0542"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73462"
FT                   /db_xref="GOA:A0A0H3PC48"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC48"
FT                   /protein_id="EAQ73462.1"
FT                   /translation="MKVAIIRFPGTNCEIDTAYAFEKLGVKTQIVWHEEKEFDADLVVL
FT                   PGGFSYGDYLRCAAIAKLAPAMQGVFNHAKKGGYILGICNGFQILLESGLLKGAMKHNN
FT                   NLSFISKNQSLRVVSNDNAFLKNFKKDEIISLPIAHGEGNYYADETTLKELQDKDLITL
FT                   KYEPNPNGSVFDIAGICDENKKIFGLMPHPERACEKILGNDVGLKMLKGFLF"
FT   gene            478138..479247
FT                   /locus_tag="CJJ81176_0543"
FT   CDS_pept        478138..479247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0543"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73261"
FT                   /db_xref="GOA:A0A0H3PBE2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBE2"
FT                   /protein_id="EAQ73261.2"
FT                   /translation="MQKELQKLPQEEQKIYQNIPPSDENNDFESNVDDPFVAKGSLVLT
FT                   NDEYPSKVYVGEVFPITIYARTTENTKFDFNISVEKTNLSFLNPDAKWEFINNEYKTTL
FT                   WFEAKNSNASLSKISIKLLRNNEAFQEADINLNPIKFENTLFNKDFSHLVASSLEIKKV
FT                   KASYFDDANIIMMVELNATNTNLKSFFIEGIQKQGIENLKGDFNASSAFYYAILPLSKT
FT                   NFEFSYFNKDSKKLENINLKLKISDDEISTQSDLNPVNKDLNIYKQYALWFLAVLFGVL
FT                   FVWRKNYIILALAVVCFALSFLVDTNTQNAIIKAGSRAKILPTEPSTYFYTANADEKVE
FT                   VLGKRQNYIKVLFSDGKIGWVNKDDLQKN"
FT   gene            479228..479920
FT                   /locus_tag="CJJ81176_0544"
FT   CDS_pept        479228..479920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0544"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0544"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73346"
FT                   /db_xref="GOA:A0A0H3PEX3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEX3"
FT                   /protein_id="EAQ73346.1"
FT                   /translation="MIYKKIKALYFWIFFVLSVALVIFCFCFTKSQNTLWKIRKIWAKF
FT                   QRYTISYKQEIIGTFNPQAQMILMNHQSALDIIALEELYPKNLCWIAKKELGEIPIFKV
FT                   AMKKPKLLCIDRKNPRDLVRVLKEAKERISEDRVLAIFPEGTRSKNEKMLKFQSGAKIL
FT                   SEKLNLKVQPILIVDSAKILDTKSFSASSGVLKIICMDLVDTNDEKWLENTRKKMQELL
FT                   DQERAKLC"
FT   gene            479914..480282
FT                   /locus_tag="CJJ81176_0545"
FT   CDS_pept        479914..480282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0545"
FT                   /product="crcB protein"
FT                   /note="identified by match to protein family HMM PF02537;
FT                   match to protein family HMM TIGR00494"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0545"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73135"
FT                   /db_xref="GOA:A1VYM9"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYM9"
FT                   /protein_id="EAQ73135.1"
FT                   /translation="MLNTLLVVGFGGFIGAILRMLSINLVNKFFPYSISFGTLFVNVLG
FT                   SFIIGLLFSYAQNKGLSPLLKSFISTGFLGAFTTFSTFSYQNLLLLQSGNYLHFALNII
FT                   LNVFLCLFAAWLGFLIFK"
FT   gene            480354..482180
FT                   /gene="htpG"
FT                   /locus_tag="CJJ81176_0546"
FT   CDS_pept        480354..482180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpG"
FT                   /locus_tag="CJJ81176_0546"
FT                   /product="heat shock protein HtpG"
FT                   /note="identified by match to protein family HMM PF00183;
FT                   match to protein family HMM PF02518"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0546"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73192"
FT                   /db_xref="GOA:A1VYN0"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYN0"
FT                   /protein_id="EAQ73192.1"
FT                   /translation="MQFQTEVNQLLQLMIHSLYSNKEIFLRELISNASDALDKLNFLSV
FT                   SDDKYKSLKFEPKIEIKIDKDKKTLSISDNGIGMDKDDLINNLGTIAKSGTKSFLENLS
FT                   GDAKKDSQLIGQFGVGFYSAFMVASKIEVLSKKALDDKAYLWSSDANGYEIDDANKEEQ
FT                   GTSITLYLKDDEFANAYKIESIIEKYSNHIQFPIFMEKEEFTPAKEGEEEGKTELKISQ
FT                   INKANALWRMQKSSLKAEDYERFYEQNFHDSNKPLLYLHTKSEGKLEYNSLFFIPQNAP
FT                   FDLFRVDYQSGLKLYVKRVFISDDDKELLPTYLRFVRGIIDVEDLPLNVSREILQENQI
FT                   LKGVKEASVKKILGELEKLKNNDKEKYLSFFKTFGKVLKEGLYGFGGEKDSLLKLMLYK
FT                   STKGENLRSLEEYKNDLQGEQKEIFYIAGNNESLLRTSPLLEEYKQKNIEVLLMDDEID
FT                   SLVTPMLEFEGLKFVAINQVEDKNELSDEEKNTFAPLVAKFKELLKDQVEDVRLTSRLK
FT                   DSPSCIVYDKNKPDFAMQQLLKQMGQEQNFKPILEINPKHAIFTGLKNNESFSADIATL
FT                   VLNMAKLSEGMGVDNPAEFNASLTKIINKAFS"
FT   gene            482177..482494
FT                   /locus_tag="CJJ81176_0547"
FT   CDS_pept        482177..482494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0547"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73064"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIW6"
FT                   /protein_id="EAQ73064.1"
FT                   /translation="MIENIPASLWTKQDLNAYQIFDVRTPLEWEEGVLPNAQCVALYDN
FT                   QGLLNAKFLDEFQSKRDENKKLAFICRSGHRSMVAAEFIAEKLGLESINLDGGMLALKG
FT                   Y"
FT   gene            482494..482928
FT                   /locus_tag="CJJ81176_0548"
FT   CDS_pept        482494..482928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0548"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0548"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAC2"
FT                   /protein_id="EAQ73037.1"
FT                   /translation="MLGIYLLIAALSFLALYFAVKKLTLNIDERTLLEPIKMDIYPKFC
FT                   DLIDEKIREFKENVQNANLALKISDQKDEFLEKLGDLSRELTFIQTMNLSNKNDSIWQN
FT                   ELFSFLKELENLLLEYLEKGEEEAEILREFLMNEFEKLKG"
FT   gene            482932..484701
FT                   /locus_tag="CJJ81176_0549"
FT   CDS_pept        482932..484701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0549"
FT                   /product="Na/Pi-cotransporter, putative"
FT                   /note="identified by match to protein family HMM PF02690"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0549"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72995"
FT                   /db_xref="GOA:A0A0H3PIT5"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIT5"
FT                   /protein_id="EAQ72995.1"
FT                   /translation="MQEERNSLKYFKFISWSIFTLVLIFILIRYDELANLLAGVAILLI
FT                   GMTNLGIGFKAFSGGLLEKILAKSTDTKIKSILFGTLSTLIMQSSTLVSIITISFLSAG
FT                   LISLGAGIGIIFGANLGNTASSWLIVGLTNIKISMLAIPLLIIGVLFFFQKDSVLKGLG
FT                   NIFIGIGFFFLGVDYIKSGFENFKHIIDLSRFDFAGFKGVFVFLGLGALLTGVIQSSTA
FT                   TMAIIVAALLAGQISLENSLAATLGTSVGGVVTAVLASLSTNIEGKKLAFANCIFNFGI
FT                   AFLIVLIFPYFIHFLNFLSIVLNIEDIALKVALFHTLFNLIGVVLFSFFTPQIVLFLNK
FT                   IVKAPKDKNKDKPLYLDSSLVKFSDTAIESLRKESEHLYNNTYAIVAHAIGFSRKDIQS
FT                   DKSFKEILENKKWFSKNVDLDYLYQTRIKVLFEAIIDFSTKAQVYINDETKNHKIFTFK
FT                   MAAKNLAETTKNLKIIQANIKKYSSSSNEFLALEYNKIRSNLGELLRSIEELRVVEDRE
FT                   KLYLIIKNLQKGKEILKEIDTLTLSNVEHLISVRKITTAEGISILNDTTFAAKIAEELI
FT                   GAVEVIFSKDISN"
FT   gene            complement(484698..486506)
FT                   /locus_tag="CJJ81176_0550"
FT   CDS_pept        complement(484698..486506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0550"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0550"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73465"
FT                   /db_xref="GOA:A0A0H3PF42"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF42"
FT                   /protein_id="EAQ73465.1"
FT                   /translation="MQEYKKNRVSKVAFAYCMALLFMIIFISSTFFLTSKRHIPNTEKD
FT                   QYALALRGSIITKDNFTITSSKQIYRAEIDLRSINKDKFDLFLKLFQIYSGISNDQVAD
FT                   IKKRMQNQKKRSYNFVLLQNLDSKQASYLKDLAKKLYIQGFFKAFTNNSGRVETRGLNI
FT                   IEHEEDRIYMSKDSFTPIIGYTKMILDPESGILKNIGVKGLEKYYDECLSPVQNEKIQG
FT                   LKDIGGNIILNLNSLQQKKINGCDLYLNLSLKLQKSIEKAIDQRNEDLKANEIIVGVME
FT                   SKTGRILALASSRRYDPQNRGKDLSVLNASAIEYGYEAGSVIKPFIFTTALRLGKIKMD
FT                   EVINTYGGSYKLGRFTIKDDHKMDKMTMEEVIRYSSNIGMIQIAKRLNNIEIVSGLKIF
FT                   KFGEKSGIDLPYEQKGEIPNPKRLRDIEKSVLSYGYGLKTTFMQLLAAYNVFNNDGFYI
FT                   TPRLAEKFYQNGRFTNLDDDVKKEKILSSEAAKTMQNVLINVIEKGTGKKAITQGIIAG
FT                   GKTGTARIAERQGYTSNRYNASFFGFANDLNHAYTIGVLVRHPTKPYSYYAAQSALPMF
FT                   KDVVDILINEEFLTPIQDNNQTSTNN"
FT   gene            complement(486513..486809)
FT                   /gene="fliE"
FT                   /locus_tag="CJJ81176_0551"
FT   CDS_pept        complement(486513..486809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="CJJ81176_0551"
FT                   /product="flagellar hook-basal body complex protein FliE"
FT                   /note="identified by match to protein family HMM PF02049;
FT                   match to protein family HMM TIGR00205"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0551"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73125"
FT                   /db_xref="GOA:A0A0H3PIZ8"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIZ8"
FT                   /protein_id="EAQ73125.1"
FT                   /translation="MNNINDLRLNNNISNTNKSQNSTGIGDEFAKMLKNEIDDLNKAQE
FT                   SGEAAMTDIATGQVKDLHQAAIAITKAESSMKFMLEVRNKAISAYKEITRTQI"
FT   gene            complement(486816..487310)
FT                   /gene="flgC"
FT                   /locus_tag="CJJ81176_0552"
FT   CDS_pept        complement(486816..487310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="CJJ81176_0552"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by match to protein family HMM PF00460;
FT                   match to protein family HMM PF06429; match to protein
FT                   family HMM TIGR01395"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0552"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72987"
FT                   /db_xref="GOA:A0A0H3PAY4"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY4"
FT                   /protein_id="EAQ72987.1"
FT                   /translation="MAYLSDFDISGYGLSAQRFRMNVISSNIANANTTRTAEGGPYRRR
FT                   EVIFKATDFDKLLNEQINKDNNFLKYENPLNDPSSPEEAKPPIQSVVVDKVVRDDKDFR
FT                   MKYDPSHPDANAEGYVAYPNVNPVIEMADLIEATRAYQANVSAFTSAKTIAQSAIDLLR
FT                   G"
FT   gene            complement(487320..487751)
FT                   /gene="flgB"
FT                   /locus_tag="CJJ81176_0553"
FT   CDS_pept        complement(487320..487751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="CJJ81176_0553"
FT                   /product="flagellar basal-body rod protein FlgB"
FT                   /note="identified by match to protein family HMM TIGR01396"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0553"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73425"
FT                   /db_xref="GOA:A0A0H3PAV4"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAV4"
FT                   /protein_id="EAQ73425.1"
FT                   /translation="MINPFKSKELVTGALAGRNLRNQLINANLANVDTPFYKARDIEFE
FT                   TALVNRANEIFKKNDNKELQLAVTEEGHQKPWKFPDPSKSTIYLRDGHLARNDANTVDL
FT                   DVETTEMSKNTVMITALDGVLRRQSNIFSSILDASSKLS"
FT   gene            complement(487831..488919)
FT                   /locus_tag="CJJ81176_0554"
FT   CDS_pept        complement(487831..488919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0554"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF02618"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0554"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73356"
FT                   /db_xref="GOA:A0A0H3PAR8"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAR8"
FT                   /protein_id="EAQ73356.2"
FT                   /translation="MIFFARTINFLSNLIYNCSNFKKSNWILEMTIPFLSTINKANIST
FT                   TKNTTIYKIFFFIRNFFLIFILGIFYYLTQPLKSNSVVFIPQGSISQIITYLKQNKYQM
FT                   SSIDKYILFFLGHPQSGWINIGTKDLNRAEFLHKLTIAKAALQTITLIPGETSVIFLEQ
FT                   AAKQLELDKDMLLKEFQAQAPYDEGVFLPETYKIPKGITENLLIQMLLNHAEISNKKTS
FT                   EKIFGDYNPKKWHQYIIIASVIQKEAANDNEMPIVASVIYNRLKKGMKLQMDGTLNYGI
FT                   YSHVKVTPQRIRQDNSSYNTYKFTGLPKEAVCNVSLAAIRAAIFPLKTDYLYFVRDKNT
FT                   GVHIFSTNIDDHNKAINLQKGK"
FT   gene            488786..491317
FT                   /locus_tag="CJJ81176_0555"
FT   CDS_pept        488786..491317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0555"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0555"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73254"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR039441"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PER9"
FT                   /protein_id="EAQ73254.2"
FT                   /translation="MLILALFIVLKNGIVISSIQFDFLKLEQLYIKLDKKLIVRAKNIT
FT                   INETQNSEISSQTHSSDNASTEILKITKNLKYLYTFVEEIDIQNLNIKDNHVRILFKDN
FT                   EFFIDNDLLFLKLTLQRQNKELIADIKKLLLKDYDLNIDGNLSINTKSEFYYFQGRASG
FT                   ELFDFNASISYKDKNLAYKIEDLNIRNITEIFKRVNKRIELPQSLNLWVAYRAKGEFYH
FT                   LDYLQGFIDFTKDNYYLDNISASGYVNNVKVRLDDKMNAIEIPKLDLNLNKQKLDFVFN
FT                   KAFYNGADLSSSKVYLYDLFDEKKAGIYLRIKSDNLKFDEKLAKALEDYHFSLPFYQKS
FT                   GKIKSDLELKIDFHDKGEISYSGILALENASISLADFNITKAFVKLNQNDLNIENASVK
FT                   NGFLEADFNAKFDLQKQQGNFNTQISRLYFDNGELLDLKNQNAEVKLDYSQNVNISIPQ
FT                   WNLILNFKDGLEANLNNPKILFSFSPLLKKFGFIDAKNVYYKTLNFEDFNASVNDAYFK
FT                   NNLLINGQTPYENDSFDIVKNKGIMEIHTQSDTASAKISSDNKEIHLKNLSYIYKKDSN
FT                   SSNSTFDISTNTQNISFGGANVALILPDSNKTLAFDRVEADLKGNALDLKGSRGNAKFD
FT                   LYYSSNDLNLNVSNIDDNYLNEFLQKQAVQDGVFNLSIKGSGLEYFDGQIDFKNTYVKD
FT                   LRGINQLISFIDTVPSLLMFKSPTFNQKGLSLHDGKIIFNRKKDLLSVLAINLNGDSVD
FT                   IYGLGSANLRLNTVDFSLELKTLKSASEAISKVPILNYVILGKNQEISTNLKIDGSIDD
FT                   PKFHTEILTDTLKTPFNLIKNIIQLPANLLN"
FT   gene            491335..493638
FT                   /gene="icd"
FT                   /locus_tag="CJJ81176_0556"
FT   CDS_pept        491335..493638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="icd"
FT                   /locus_tag="CJJ81176_0556"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by match to protein family HMM PF03971;
FT                   match to protein family HMM TIGR00178"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0556"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73167"
FT                   /db_xref="GOA:A0A0H3PJ24"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ24"
FT                   /protein_id="EAQ73167.2"
FT                   /translation="MKTKTNFKLTLAFFFICNILKNENKNKYFKGLKMQITYTLTDESP
FT                   ALATYSFLPIVKAFLSRAHIGVKTSDISLSGRILATFSEYLKEEQRCEDALELLGELVK
FT                   RSDANLIKTPNISASIPQLKAAIKELQDKGYMLPNYPDEPKNDEELQIKTKYQKVLGSA
FT                   VNPVLRQGNSDRRSTKAVKDYAKNNPYRVVEFNPNSKTRVSYMKEGDFFSNEKAVLIDQ
FT                   DCVANIEFTSVDGKNEILKEGLKLEKNEILDATFMDVQKLQEFYAKEIKASKDDDVLFS
FT                   LHLKATMMKVSDPILFGYAVKVFFKELFIEFQDEFEKLGINPNNGLSELLSKIENSSKK
FT                   DEILKKYNEILAKSADISMVNSDKGITNLHVPSDVIVDASMPAMLKNGARLWDKEGKEK
FT                   DTNAVIPDQTYATIYEAVIEDLHKNGTLNPSKLGSVSNVGLMAKKAQEYGSHDKTFVAK
FT                   EEGTFKIVSNGKVLLEHKVRKGDIYRANQAKFDAVLNWIDLGIERSELSGAEAIFWLDS
FT                   KRASNKIMITLVQNRLKEKGKNIAILTPKEACLRSLELIREGKDVISITGNVLRDYLTD
FT                   LFPILELGTSAKMLSVVPMLKGGAMFETGAGGSAPKQVEQLVEENHLRWDSLGEFLALQ
FT                   ASLEFYANKCSNHKAKVLAECLDEAIGEWLENNKAPSRKVKEDDNRTSHFYLAMYFANH
FT                   LARQASDMELQSFFKDIALELSSNEEKIRAEFNNAQGVKVDLGGYYKFDDEKANKIMRP
FT                   SATFNAILEKIGQR"
FT   gene            493635..494537
FT                   /gene="mdh"
FT                   /locus_tag="CJJ81176_0557"
FT   CDS_pept        493635..494537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="CJJ81176_0557"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by match to protein family HMM PF00056;
FT                   match to protein family HMM PF02866"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0557"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73132"
FT                   /db_xref="GOA:A0A0H3PBR0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBR0"
FT                   /protein_id="EAQ73132.1"
FT                   /translation="MKITVIGAGNVGSSVAYALILREIANEIVLVDINEDLLYAKELEL
FT                   TQSIAALNLNIDLLCAKDYTHTKNSDIVLFSAGFARKDGQSREELLQLNTSIMLDCAKK
FT                   IKDFTEDPLFIILTNPVDFLLNTLYESGIFSSKKIIAMAGVLDNARFKYELAKKLNVKM
FT                   SSVDTRLIGFHNDDMVLVKSYASVKNKNISEFLNEEEFDDLENEVKTGGAKVIKHLKTS
FT                   AYLAPASACIRMLESIRSGEFLPMSVILHGEFGVQNKALGVMARLGLEGVIEIMKMDLS
FT                   LQEKDKLEKSLIKYQYKGE"
FT   gene            494538..495701
FT                   /gene="sucC"
FT                   /locus_tag="CJJ81176_0558"
FT   CDS_pept        494538..495701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucC"
FT                   /locus_tag="CJJ81176_0558"
FT                   /product="succinyl-CoA synthase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by match to protein family HMM PF00549;
FT                   match to protein family HMM TIGR01016"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0558"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73087"
FT                   /db_xref="GOA:A1VYP2"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYP2"
FT                   /protein_id="EAQ73087.1"
FT                   /translation="MNIHEYQAKAIFADNSIPTLKGKVAFSVDEAVANAKELGGSVWAV
FT                   KAQIHAGGRGLGGGVKIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANI
FT                   VKEYYLAILFNRMAEQITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEV
FT                   AKVLGLDKDESKKLISMIAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSA
FT                   LYRHPEIAELRDITEENPAEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGA
FT                   KPANFLDVGGGASAETVAKAFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVE
FT                   VNIPIVVRLDGTNAAEAKTILDNSNLKNIKAATNLKNGAELVKSLVG"
FT   gene            495711..496580
FT                   /gene="sucD"
FT                   /locus_tag="CJJ81176_0559"
FT   CDS_pept        495711..496580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="CJJ81176_0559"
FT                   /product="succinyl-CoA synthase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="identified by match to protein family HMM PF00549;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM TIGR01019"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0559"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72982"
FT                   /db_xref="GOA:A0A0H3PAY1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY1"
FT                   /protein_id="EAQ72982.1"
FT                   /translation="MSILVNKNTKVIVQGFTGKEATFHAEQCMAYGTNIVGGVTPHKGG
FT                   QTHLGKPVFDTVADAVKATKADVSLIFVPAFAVGDSVIEAADAGIKLAVVITEHTPVKD
FT                   MMFAKQYANKKGMKIIGPNCPGIITSEECKLGIMPGFIFKKGCVGLISKSGTLTYEAAN
FT                   QVVQGGYGISTAVGIGGDPIIGLAYKELLSEFQKDDETKAIVMIGEIGGSLEVEAAKFI
FT                   KENISKPVVAFIAGATAPKGKRMGHAGAIVGSADESAAAKKEALKSYGIHVVDSPALIG
FT                   EEIQKILG"
FT   gene            496594..496905
FT                   /gene="oorD"
FT                   /locus_tag="CJJ81176_0560"
FT   CDS_pept        496594..496905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorD"
FT                   /locus_tag="CJJ81176_0560"
FT                   /product="2-oxoglutarate:acceptor oxidoreductase, delta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0560"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73264"
FT                   /db_xref="GOA:A0A0H3PBV9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBV9"
FT                   /protein_id="EAQ73264.1"
FT                   /translation="MSMTAPKDTPVWVDEHRCKACNICVSYCPAGVLAMRDDVHAVLGQ
FT                   MIEVVHPESCIGCTECETHCPDFAIMVAKRDEFKFAKLTAEAKDRAVAVKNNKYKKLA"
FT   gene            496914..498038
FT                   /gene="oorA"
FT                   /locus_tag="CJJ81176_0561"
FT   CDS_pept        496914..498038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorA"
FT                   /locus_tag="CJJ81176_0561"
FT                   /product="2-oxoglutarate:acceptor oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="identified by match to protein family HMM PF01855"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0561"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73163"
FT                   /db_xref="GOA:A0A0H3PAH7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAH7"
FT                   /protein_id="EAQ73163.1"
FT                   /translation="MREVIATGNVLIAKAAIDCGCKFFGGYPITPSSEIAHELSHMLPA
FT                   NDGTFIQMEDEISGISVAIGAAMSGVKSMTASSGPGISLKAEQIGLAFIAEIPLVIVNV
FT                   MRGGPSTGLPTRVAQGDLFQAKAPTHGDFASVAIAPASLEEAYTETIRAFNLAEKYMTP
FT                   VFLLMDETVGHMNGKAVLPDLKDIEIINRKKFTGDKKDYKPYAAGENEPATLNPFFTGY
FT                   RYHVTGLHHGDIGFPTEDGAIVKKNMERLIGKIKNNQDDICTYEEYMLDDAEFLIIAYG
FT                   SVSRSAKEAINRLREEGIKVGLFRPITLYPVAEKKIAEVVNKFKKVMVSELNMGQYLEE
FT                   IERVSSRRDFISLHRANGRPITPSEIIAKVKENI"
FT   gene            498040..498885
FT                   /gene="oorB"
FT                   /locus_tag="CJJ81176_0562"
FT   CDS_pept        498040..498885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorB"
FT                   /locus_tag="CJJ81176_0562"
FT                   /product="2-oxoglutarate:acceptor oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="identified by match to protein family HMM PF02775"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0562"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72974"
FT                   /db_xref="GOA:A0A0H3PEA7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEA7"
FT                   /protein_id="EAQ72974.1"
FT                   /translation="MAFNYDEYLRTDKLPTQWCWGCGDGVVLKCIIRAIEKLGWNMDDV
FT                   CLVSGIGCSGRMSSYVNCNTVHTTHGRAIAYATGIKLANPSKHVIVVSGDGDTLAIGGN
FT                   HTIHGCRRNIDLTHIVINNFIYGLTNSQTSPTTPKGFYTVTAQFGNIDPNFDACELTKA
FT                   AGASFVARGNVIEANKLENLIYKALAHKGYSFVDVFSNCHINLGRKNKMGEAVAMLDWI
FT                   KNRVVDKSKFESMDFEERKDKFPTGILHEDNSQPEYCHAYEEVRRAAKEKRMVDLGALK
FT                   "
FT   gene            498882..499439
FT                   /gene="oorC"
FT                   /locus_tag="CJJ81176_0563"
FT   CDS_pept        498882..499439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oorC"
FT                   /locus_tag="CJJ81176_0563"
FT                   /product="2-oxoglutarate:acceptor oxidoreductase, gamma
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="identified by match to protein family HMM PF01558"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0563"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73044"
FT                   /db_xref="GOA:A0A0H3PEE7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEE7"
FT                   /protein_id="EAQ73044.1"
FT                   /translation="MKYQLRFGGEGGQGVITAGEILAEAAIKEGRQAFKASTYTSQVRG
FT                   GPTKVDIIIDDKEILFPYAVEGEVDFMLSTADKGYKGFRGGVKEGGIIVVEPNLVHPES
FT                   EDYKKWQIFEIPIITIAKDEVGNVATQSVVALAIAAYMSKCIDLDVLKDTMLHMVPAKT
FT                   RDANAKAFDLGVKYATQAKPHS"
FT   gene            499578..499841
FT                   /locus_tag="CJJ81176_0564"
FT   CDS_pept        499578..499841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0564"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0564"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73094"
FT                   /db_xref="InterPro:IPR018563"
FT                   /db_xref="InterPro:IPR023126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIY1"
FT                   /protein_id="EAQ73094.1"
FT                   /translation="MDFFDEMFNKTPKEKFIEIIQNGNLGALEKVFEEFFADHIAMVEL
FT                   LEKQGLTEMDVKNFILENGDFIEERQNDIYIELGAKILGHEG"
FT   gene            499844..500380
FT                   /locus_tag="CJJ81176_0565"
FT   CDS_pept        499844..500380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0565"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAH4"
FT                   /protein_id="EAQ73157.1"
FT                   /translation="MFKISPYLICIFFIFSNVLASEPTFDYTYKFILKKDERASVQIKE
FT                   IGYEDKVQNFDFYWTLFDNTNIIVHSKFRKYPRQFVMSLRRNLDWVTQTLIPDYTNPHI
FT                   DRARLILEFSGYNKGLATFTVYIEDKESRLMVEFLDPRKKALQNPPQNNQVVPMINFNE
FT                   PQVKPLTSKENNNSN"
FT   gene            500394..501287
FT                   /locus_tag="CJJ81176_0566"
FT   CDS_pept        500394..501287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0566"
FT                   /product="polyprenyl synthetase family protein"
FT                   /note="identified by match to protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0566"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73288"
FT                   /db_xref="GOA:A0A0H3PBF1"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBF1"
FT                   /protein_id="EAQ73288.1"
FT                   /translation="MQKIDELIKQFLQELGYEPILNMLSNVKSGKKLRSKLLLAIADES
FT                   EIAFKICAAIELIHLASLLHDDIIDESELRRGARSVNAEFGTKNALMLGDILYSKAFYE
FT                   LSKMDARFASIISDAVVKLAIGELMDVDLGEKFNINKEAYLKMIYNKTAVLIEASARCG
FT                   AILAGLYEKDFAEYGKNLGLAFQMIDDILDIKSDEKILGKPAMNDFKEGKTTLPYIYLY
FT                   ENLQEQDRIYLQTLFKKDLNENEKEWLKTKFEEQKALEKAILEAKTYAKKARKAIEKYD
FT                   NNKLNDIIKAMIDREF"
FT   gene            501287..502585
FT                   /gene="hemA"
FT                   /locus_tag="CJJ81176_0567"
FT   CDS_pept        501287..502585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="CJJ81176_0567"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.-"
FT                   /note="identified by match to protein family HMM PF00745;
FT                   match to protein family HMM PF01488; match to protein
FT                   family HMM PF05201; match to protein family HMM TIGR01035"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0567"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73434"
FT                   /db_xref="GOA:A1VYQ1"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYQ1"
FT                   /protein_id="EAQ73434.1"
FT                   /translation="MYYCISFTHKNTDIALREKLSFSNEAKKSEFLKIISTHENIEECL
FT                   VISTCNRVEIVAFVKMACAEFIVKSLALLCDVDKDILLEKADIFEDSGAIHHLFSVASS
FT                   LDSLVVGETQIAGQLKDAFAFAVKNNFCGVHLSRAVHSAFKCAAKVRNETQISKNSISV
FT                   ASVAVAKAKELADLTQKKAVVIGAGEMGELAAKHLIAAGAKVIILNRDLQKAKDLCERL
FT                   GVLSEYDSLENLKKYLNQYEFFFSATNAPNAIITNSLVEELSYKRYFFDIAVPRDIDIN
FT                   ENENISVFAVDDLEIVVQKNLALREQEARMAYGIIGRETSEFFRYLNDLALMPIIKAIR
FT                   LQAKEYADKQLEIALKKGYLKKSDKEEARKLIHQVFKAFLHTPTVNLKHLQGKMQSDTV
FT                   INAMRYVFDLQNNLEGLNQYKCEFDMENNDEIY"
FT   gene            502569..504278
FT                   /gene="proS"
FT                   /locus_tag="CJJ81176_0568"
FT   CDS_pept        502569..504278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="CJJ81176_0568"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF04073; match to protein family HMM TIGR00409"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0568"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73370"
FT                   /db_xref="GOA:A1VYQ2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYQ2"
FT                   /protein_id="EAQ73370.1"
FT                   /translation="MMRFTKFYAPSLKEAPKDASLPSHIFLTRAGFVEQIGSGLYNFLP
FT                   LGKRVLDKIKNIVKEEMDKAGAQEVNLSFITPASLWQESGRYNVFGKELLRFKDRKKNE
FT                   FVLGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEARPRFGLLRCREFLMKDGYS
FT                   FHANEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSKEFMVLAKNGEDDI
FT                   LICENCDYAANVEAAKRAKKTCQDERPEANYASKFHTPNIKTIDSLAQFFKINAFYTIK
FT                   AVVKKAIYENESKLVVFFIRGSDDLQEIKAQNACSALELVDASEEELEKAGLVAGFIGF
FT                   VGLKDIDFYIDFELENEKQMIMGANEKDYHLIGIDVVNLNKDRFKDLIEVKEGDCCVKC
FT                   GAKLKQSKGIEVGHIFKLGQKYSKAMNANFLDENGKSQPFYMGCYGIGVSRLLAVAIEA
FT                   NHDEKGCIWNKTLAPFVLEIIVSNLKDEKALEFANKLYEDLTNLGLEVLLDDRNERFGV
FT                   KMNDFELMGFPYALVIGKGLENNEIELIQREDLVKELIKTDELMEILKKKVL"
FT   gene            504275..504664
FT                   /locus_tag="CJJ81176_0569"
FT   CDS_pept        504275..504664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0569"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0569"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73040"
FT                   /db_xref="GOA:A0A0H3PIV4"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIV4"
FT                   /protein_id="EAQ73040.1"
FT                   /translation="MNYKLSLSPLFVLEIIASILFIVFFGFGNFLFFILLSMIFGAVLL
FT                   GIFWKNMLEFQMGGLKDMLTQFSFVIAGFLLVFPGIITSVFGIFVFFFGIALKLITKSK
FT                   YQYTKQEYQNSNEEIIDVEIIEDRK"
FT   gene            504661..505584
FT                   /gene="hemC"
FT                   /locus_tag="CJJ81176_0570"
FT   CDS_pept        504661..505584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="CJJ81176_0570"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="identified by match to protein family HMM PF01379;
FT                   match to protein family HMM PF03900; match to protein
FT                   family HMM TIGR00212"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0570"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72963"
FT                   /db_xref="GOA:A1VYQ4"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYQ4"
FT                   /protein_id="EAQ72963.1"
FT                   /translation="MKLIIATRKSQLALWQSEHVAQILKNTHQIEVLLEGFKTKGDVLL
FT                   DSPLAKIGGKGLFTKELEESMLRKEAHLAVHSLKDVPSFFPQGLVLAAVSKREQSNDAM
FT                   LSQNYKDFLSLPKGAKIGTTSLRRKMQLLLLRPDLDIISLRGNVNSRIEKLKNNDFDAI
FT                   ILAMAGIKRLNLDKQVNFVYEFSKDELIPAASQGALGIESINDEKILELLKCLNDENAL
FT                   IETSIEREFIATLEGGCQVPIGINAELLGDEICVRAVLGLPDGSEILKDKRMIKKNDFK
FT                   GFGESLAKEFIAKGAKELLKKAESMI"
FT   gene            505581..507383
FT                   /locus_tag="CJJ81176_0571"
FT   CDS_pept        505581..507383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0571"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01977;
FT                   match to protein family HMM TIGR00148"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0571"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72958"
FT                   /db_xref="GOA:A0A0H3PA90"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="InterPro:IPR022390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA90"
FT                   /protein_id="EAQ72958.1"
FT                   /translation="MKEFIQILKENDLLRVIEEPVDVDLEIAHLAYIEAKKGEKGKALL
FT                   FKNPIDKKLNKQYKFPVLMNTFCNEKALNLAFGRDYEEVAEEISKLTKLHIPTSFKAKM
FT                   DFFMNLLSFKNIPPKRLKKNKALYDYEILNSLEELPILKTWEDDAGKFITMGQVYTQNL
FT                   DKTQNNLGMYRLQMSDKNELLIHWQIHKDGANFYHEYKNVGFKKMPVSIAIGGDPLYIW
FT                   CSQAPLPKGIFELLLYGFIKKTPAKLTPCENGIFVPYDSDVVIEGYVDLEEFKIEGPFG
FT                   DHTGFYTPAELFPVMKVEKIYAKKDAIYQATVVGKPPLEDKIMGLGTERIFLPLLQTSV
FT                   PDLIDYNMPENGVFHNLILAKIDAKYPAHAQQIMHAFWGVGQMSFVKHAIFVDKNAPSL
FT                   KDYDALIPYMLDRFNTKKILISEGICDQLDHASPNSCFGGKAGLDACEEIQVEELEILE
FT                   DEKLLELFKTKVELLNLKQFYKESKSPIVCILLDKKEKIEQSFDKLLEFKKHFRILVFL
FT                   DVENKLENSYMLVWRVVNNIDAKRDIFIKEERLGVDASAKGEAEGYLRAWPKQTDCTKS
FT                   VIEDLILRNILENNPDLFNKFEIF"
FT   gene            507540..507905
FT                   /gene="flaG"
FT                   /locus_tag="CJJ81176_0572"
FT   CDS_pept        507540..507905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaG"
FT                   /locus_tag="CJJ81176_0572"
FT                   /product="flagellar protein FlaG"
FT                   /note="identified by match to protein family HMM PF03646"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0572"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72996"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK9"
FT                   /protein_id="EAQ72996.2"
FT                   /translation="MEISKANGQMDTALANISQRTSETQASLNIQTDRSQGQEGDDGQQ
FT                   RGVSEKLADITKKLNEQMDSLDTNVRFGYSDKIGSMYISVTEKSTGREIRQIPSEEAMR
FT                   LAEYFRDVIGMIFDKES"
FT   gene            507908..509836
FT                   /gene="fliD"
FT                   /locus_tag="CJJ81176_0573"
FT   CDS_pept        507908..509836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="CJJ81176_0573"
FT                   /product="flagellar hook-associated protein FliD"
FT                   /note="identified by match to protein family HMM PF02465;
FT                   match to protein family HMM PF07195; match to protein
FT                   family HMM PF07196"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0573"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73028"
FT                   /db_xref="GOA:A0A0H3PIU8"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR010810"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIU8"
FT                   /protein_id="EAQ73028.1"
FT                   /translation="MAFGSLSSLGFGSGVLTQDTIDKLKEAEQKARIDPYTKKIEENTT
FT                   KQKDLTEIKTKLLSFQTAVSSLADATVFAKRKVVGSISDNPPASLTVNSGVALQSMNIN
FT                   VTQLAQKDVYQSKGLANDSGFINANLTGTTDLTFFSNGKEYTVTVDKNTTYRELADKIN
FT                   EASGGEIVAKIVNTGEKGTPYRLTLTSKETGEDSAISFYAGKKDSNGKYTSDSEAETIF
FT                   KNLGWELDTTSSIDPAKDKKGYGIKDASLHIQTAQNAEFTLDGIKMFRSSNTVTDLGVG
FT                   MTLTLNKTGEINFDVQQDFEGVTKAMQDLVDAYNDLVTNLNAATDYNSETGTKGTLQGI
FT                   SEVNSIRSSILADLFDSQVVDGTTEDANGNKVNTKVMLSMQDFGLSLNDAGTLSFDSSK
FT                   FEQKVKEDPDSTESFFSNITKYEDINHTGEVIKQGSLNQYLDSSGTGNKGLDFKPGDFT
FT                   IVFNNQTYDLSKNSDGTNFKLTGKTEEELLQNLANHINSKGIEGLKVKVESYDQNGVKG
FT                   FKLNFSGDGSSDFSIKGNATILKELGLSDVNITSKPIEGKGIFSKLKATLQEMTGKDGS
FT                   ITKYDESLTNNIKSLNTSKDSTQAMIDTRYDTMANQWLQYESILNKLNQQLNTVTNMIN
FT                   AANNSNN"
FT   gene            509848..510234
FT                   /gene="fliS"
FT                   /locus_tag="CJJ81176_0574"
FT   CDS_pept        509848..510234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="CJJ81176_0574"
FT                   /product="flagellar protein FliS"
FT                   /note="identified by match to protein family HMM PF02561;
FT                   match to protein family HMM TIGR00208"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0574"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73362"
FT                   /db_xref="GOA:A0A0H3PEY5"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEY5"
FT                   /protein_id="EAQ73362.1"
FT                   /translation="MQNNLAYNAYSQNQAGIESPQKLIEMLYEGILRFCARAKVAIRNE
FT                   DIEQRVYFVKRTTAIFIELINTLNYEKGGEVAHYLSGLYTREIQLLSLANLENNEDRIN
FT                   EVINVTKGLLEAWREVHNNETVAQ"
FT   gene            510299..510490
FT                   /locus_tag="CJJ81176_0575"
FT   CDS_pept        510299..510490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0575"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73428"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJJ4"
FT                   /protein_id="EAQ73428.2"
FT                   /translation="MKAFIKNLAKESPSEDFLKENANDVFYQVQALLQEAVILIEQKKK
FT                   TKAVEIQKFQKALTYFKS"
FT   gene            510922..511491
FT                   /gene="efp"
FT                   /locus_tag="CJJ81176_0576"
FT   CDS_pept        510922..511491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="CJJ81176_0576"
FT                   /product="translation elongation factor P"
FT                   /note="identified by match to protein family HMM PF01132;
FT                   match to protein family HMM PF08207; match to protein
FT                   family HMM TIGR00038"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0576"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73320"
FT                   /db_xref="GOA:A1VYR0"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYR0"
FT                   /protein_id="EAQ73320.1"
FT                   /translation="MASYSMGDLKKGLKIEIDGIPFKIVEYQHVKPGKGPAFVRIKIKS
FT                   FIDGKVLEKTFHAGDKCEAPNLEDKTMQYLYDDGENCQFMDTQTYEQVAISDDDVGEAK
FT                   KWMLDGMMVDVLFHNGKAIGVEVPQVVELKIIETAPNFKGDTQGSNKKPATLETGAVVQ
FT                   IPFHVLEGEVIRVDTVRGEYIERANK"
FT   gene            511650..512342
FT                   /locus_tag="CJJ81176_0577"
FT   CDS_pept        511650..512342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0577"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06149"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0577"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73218"
FT                   /db_xref="GOA:A0A0H3PJ60"
FT                   /db_xref="InterPro:IPR010374"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ60"
FT                   /protein_id="EAQ73218.1"
FT                   /translation="MEWLLLASIPLIVLGFALKINPFLVVTSVGIYAGLVSGFDFVKVV
FT                   SDIGKSFVDNRYVAIIWLILPLLAVLERKGLREQAKNLISKIKVASTGRILMCYFVFRQ
FT                   VTAALGLLSLGGHAQMIRPLIAPMAEAAAKLKFKNLTHKDSQKIKAFSAGTDNVAVFFG
FT                   EDIFIAVHSILFIKAFYESNGIIVEPLHLSVWAIPTGILALIIHCSRLYLFDKRLEKTY
FT                   KGLSDDKS"
FT   gene            512329..513282
FT                   /locus_tag="CJJ81176_0578"
FT   CDS_pept        512329..513282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0578"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF06166"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0578"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73365"
FT                   /db_xref="GOA:A0A0H3PJE8"
FT                   /db_xref="InterPro:IPR009323"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJE8"
FT                   /protein_id="EAQ73365.1"
FT                   /translation="MISLDLLYYIVGILFLVFGILSFSNQAKDIKSRISGGVFWISYSF
FT                   TFLLAGVLPHFVMGCIVILLALIAGFNLLKPAKIEVSKEEKEYEIKHANIYKNKLFIPA
FT                   LMVPLITLIGTFLFPHLSFFENKNATLMALIIGIIISSVVACFMFKASPKRAVKDAVHT
FT                   MDHISWAALLPQILATLGVVFVSTGMGDQVSKLLSSYISLDNAFIAVAVYCIAMALFTI
FT                   VMGNAFAAFPVITAAIALPILIIQMHANPAIIGAIGMLSGFCGTLMTPMAANFNIVPAA
FT                   LLNLDDKNGVIKAQFMSGLVLLVANIFLMYFLAFRF"
FT   gene            513292..514296
FT                   /locus_tag="CJJ81176_0579"
FT   CDS_pept        513292..514296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0579"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73310"
FT                   /db_xref="InterPro:IPR021365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEV5"
FT                   /protein_id="EAQ73310.1"
FT                   /translation="MEKFIKQFSFIALENIFRELPNKITHSFNDINDIKPPKLMYPIFY
FT                   GSYDWHSSVHSHWLLVKILKDFSHFAPKDEIIKALDSQFSKEKAEGELKYLQNPAHKGF
FT                   ERPYGWGWFLKLTLEINLLAKENDKAEIWAKNLEGIADFFVKEFKEFLPKMDYPIRVGT
FT                   HFNSSFALYFALEYARFKKDQELEYCIIQSAKKWFLNDKNMQALEPCGDEFLSPVLMEA
FT                   VLLSAVLHKNDFVKFFKAYLPNLEAKEPVTLFTPVSVSDRSDGKIAHLDGLNLSRAWCF
FT                   KILSNFCDENLKILLRNNATEHFDKAIAHIEDDYLGSHWLGSFALLALDVDIL"
FT   gene            514411..515697
FT                   /locus_tag="CJJ81176_0580"
FT   CDS_pept        514411..515697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0580"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03600;
FT                   match to protein family HMM PF07158"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0580"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73061"
FT                   /db_xref="GOA:A0A0H3PAD4"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAD4"
FT                   /protein_id="EAQ73061.1"
FT                   /translation="MVFLIISSIIVAIILGYITRHNVGIFAMIFAYIIGAFFMDLAPKK
FT                   IIAFWPISIFFVIFAVSLFYNFATVNGTLEKLAGHLMYRFANHPYLLPFVIFVVSAIIA
FT                   ALGAGFYTVLAFMAPLTFLLCDKIGLSKIAGAMAINYGALGGANFMTSQSGIIFRGLME
FT                   NSGIEANEAFANSSIIFAFTIILPIVVLSFFVFNAFKNNIKISVISKPDPFDYKQKTTL
FT                   ILMFMMIVVVLIFPVLNIIFPHNEIISYFNKKIDIAMIAMIFVAIALFLKLADEKQVVA
FT                   LIPWGTLIMICGVGMLISIAVEAGAIKLFSDLVENEINVIFIPLIMCAIAALMSLFSST
FT                   LGVVTPALFPIVPSIAASSGLSEALLFSCIVVGAQASAISPFSSGGSLILGSCPDKYKE
FT                   KLFKDLLIKAVPIGFIAAILATIIMSFIL"
FT   gene            515708..516505
FT                   /locus_tag="CJJ81176_0581"
FT   CDS_pept        515708..516505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0581"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0581"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73018"
FT                   /db_xref="GOA:A0A0H3PAB4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAB4"
FT                   /protein_id="EAQ73018.1"
FT                   /translation="MKIDTHAHIFLKKLNTVANTRYKPDYDASFKDYKANLDHYDFNKG
FT                   VLVQPSFLGIDNEFLLQSIEKDENIKAIVVVDENIKFDELKKLKERKACGVRLNLIGKE
FT                   LPNFKSMVWTQFFENLSKLKMQIEIQRDLDNNLVDIVENLIPYGCNIVIDHLARANANL
FT                   TNLEDLICLKNSRIFFKISGFYRAKIDYANNEQAVKFAKKIYEILKEHFPLSNFVFGSD
FT                   WPHTNFEANINFSSALVAFNEVVVSKKEQEQILGDNACALFGF"
FT   gene            complement(516502..517587)
FT                   /locus_tag="CJJ81176_0582"
FT   CDS_pept        complement(516502..517587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0582"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0582"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73282"
FT                   /db_xref="GOA:A0A0H3PBE8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBE8"
FT                   /protein_id="EAQ73282.1"
FT                   /translation="MNKIEILKQYLKEIAKLNSSEQVWQMPFFAALGVGIVLGLSVFFG
FT                   KLNYGLIAMIGALSFLYVPNTPLYHRMAVVMCCSFGIVSSFFLGILTHFLPAIFAFIPI
FT                   GIMAMGSSILIRYYNIGAPGYFFFVFSCVLGAYSPFEAKDFIFLVGLVFLGAMVANLMA
FT                   LLYSIVVIYGFKNALPSEIPPREYIGFDAVFVDSLIMGSFVAFSIFIGTFLELERSYWI
FT                   AISCTAIMQGVTLNSIWIKQIQRIIGTALGVCFAWWLLSKQFHDIELILLMMSLFFIGQ
FT                   FLVNRNYALAMIFFTPYATYLSEAANFMSENADKLILARLIDVVIGSILGLLGGFVIYK
FT                   PYLRVYFERIAKYIFRIKQKA"
FT   gene            complement(517584..518816)
FT                   /gene="proA"
FT                   /locus_tag="CJJ81176_0583"
FT   CDS_pept        complement(517584..518816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="CJJ81176_0583"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /note="identified by match to protein family HMM TIGR00407"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0583"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73086"
FT                   /db_xref="GOA:A1VYR7"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYR7"
FT                   /protein_id="EAQ73086.1"
FT                   /translation="MRNLLENIKKNSQKLLNLTPKDKEKIILKLAQILRENFKIILEAN
FT                   KKDMANFTKSGAMKDRLLLDEKRILALCEGLEKIAYIEDPIGKISKGWKNYAGLSIQKM
FT                   SIPLGLICVIYEARPSLSAEIAALMIKSSNACVFKGGSEAKFTNEAIFTLVNKVLKEFD
FT                   LQDCFAMFTQRDEILQILAFDDLIDVIIPRGSSNMIQEIANNTKIPLIKQNKGLCHAFV
FT                   DQSANLDMALKIILNAKCQRVSVCNALETLLIHEKIAKNFISLLIPEFKKFKVKIHAHE
FT                   NALAYFNNSNLKIFKANENTFDTEWLDFALSVKLVKDCDEAIEHINKHSSLHSETIISN
FT                   DASNIAKFQRLINSSCIYANASTRFSDGGEFGFGGEVGISTSKLHARGPMGIEDICTYK
FT                   YIINGEGQIRE"
FT   gene            518887..519822
FT                   /locus_tag="CJJ81176_0584"
FT   CDS_pept        518887..519822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0584"
FT                   /product="pyridine nucleotide-disulfide oxidoreductase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF03486; match to protein
FT                   family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0584"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73120"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAG1"
FT                   /protein_id="EAQ73120.1"
FT                   /translation="MKKIDLIVVGAGPTGIGCAVEAKLKNKEVLILEKSNNICQTLMQF
FT                   YKDGKRVDKAYKGCEGTNHGHVPFEDGTKESTIETFQNALKEHNIEVEFGSEVESVKNE
FT                   NGVFLVSTAKGVYECKNIIVAIGRMGKPNKPDYKLPMTLTKIINFNANSVLGNEKILVV
FT                   GGGNSAAEYAVDLANSNQVSLCYRKKEFTRLNDINLKDIHEARNSGKVELKLGIDINEV
FT                   EDDNGKAKVNFTDGTSDIYDRIIYAIGGSTPLDFLQKCGINVDDKGVPLMDENKQSNVK
FT                   GIFVAGDIATKNGASIVTGLNDAVKILSVL"
FT   gene            520003..521331
FT                   /locus_tag="CJJ81176_0585"
FT   CDS_pept        520003..521331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0585"
FT                   /product="MATE efflux family protein, authentic frameshift"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0585"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73184"
FT                   /db_xref="GOA:A0A0H3PEM7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEM7"
FT                   /protein_id="EAQ73184.1"
FT                   /translation="MSSIFSTLSPFRLFVKCAVPNVISMAFISFYYIVDGIFVGKYLGS
FT                   DALAALALIIPFIMMSFALADMIAIGSAVQISMHLGLGKKNLTRKIFSSSMLIIFIISC
FT                   FIGILEYFLGPVLIDCLNVSDEIKTMTKECMFVFALFAPFTMLSFALDNYLRICGKTAY
FT                   SMVMNVIIALSNIVLDYIFIVELGWGLFSAALATCLGLVLGGIFGIFPFLFQNLELKIS
FT                   SLYMNLKIFKNILYNGSSEFFGNISGSLYSIFANFVLLKISDTQAVAAFSIVLYIDSFI
FT                   IMLIIAIGDAMQPALSYNYAKKDFSRIKAIIKVVFFAGGFLSLFSIVLILIFGENLITL
FT                   FTKENNQEFKTFAYTALMLFAFNYFFAWFNVLSGSFLTAFNKASFSLVLSLAQNLFIPL
FT                   FFLLFLSCFMGLNGVWLSPFFAEFCVLILAWIFLKRIFKDLSL"
FT   gene            complement(521379..522308)
FT                   /locus_tag="CJJ81176_0586"
FT   CDS_pept        complement(521379..522308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0586"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73177"
FT                   /db_xref="InterPro:IPR016896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAI3"
FT                   /protein_id="EAQ73177.1"
FT                   /translation="MKKYLFSCVLASILTQSATAVEFQEGFSGNLSIGVGARDIKSNIS
FT                   TLANSDYLSSYNADNSDSSFIPFIGAELYYGNLIDNDRIFIKNYNGRDISGIALGYERA
FT                   YLERFSTSFSVISSLREKAYANPYAIGNREETDVDRYGFKISQLYESDFGKFTTSYLFS
FT                   KNKYDKDTIAQSSLKREGYYHEIELNYNYSLLNLGLNYDYNDADGKAQSYSRYGFSIGT
FT                   NLAFANDYIFTPNLNLSKYEAVGTDPIFHKKQDGNIVKLNLKVVKNQFLGYNGLYGFAN
FT                   YGIEKRNSDIGFYDETYQIILTGIGYKF"
FT   gene            522462..523838
FT                   /gene="dnaB"
FT                   /locus_tag="CJJ81176_0587"
FT   CDS_pept        522462..523838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="CJJ81176_0587"
FT                   /product="replicative DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00772;
FT                   match to protein family HMM PF03796; match to protein
FT                   family HMM TIGR00665"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0587"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73243"
FT                   /db_xref="GOA:A0A0H3PER2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PER2"
FT                   /protein_id="EAQ73243.1"
FT                   /translation="MQQEYYDLDLERAILSSCIMSEEAYASIAGDISPKDFSLKAHQDI
FT                   FKAVIACSNNKEPISVSFLRKHKKIDEQILAEILATPSMIDLPAYVNELHEKSVKRQLL
FT                   SFAHLLPTRINEDRAVSEIADEIGKEIFSITNRVNSRDIKDVDIVISELFEEFKKQKTL
FT                   ENKGIIGLDTGFEGLNKMTKGFKGGELIIIAARPGMGKTTLCLNFIDKVLRQKKGVALF
FT                   SLEMPATQIMQRMLSSKTSIPLQKILTADLNDDEWERLGDACNDYSQKKLYIYDSGYAT
FT                   IADVRAILRRLKSQDESIGLCVIDYIGLMMSNSNFNDRHLQVSEISRGLKLLARELDMP
FT                   IIALSQLNRGLEQRANKRPLMSDLRESGAIEQDADAILFVYRDEVYREQEEKERENKAK
FT                   AEGKAYQRLFIPNPMQENAEIIVGKNRNGPVGTIEVVFLKEKSCFVDKPIGYETTEFTG
FT                   "
FT   gene            523943..524503
FT                   /locus_tag="CJJ81176_0588"
FT   CDS_pept        523943..524503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0588"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73349"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC00"
FT                   /protein_id="EAQ73349.1"
FT                   /translation="MLKQIAFGSIALTATGYGIKKLYEKLSKPERKFDTHAIVPSCKDM
FT                   INIEEYKLKRELEVEQKKNQIQEFLCECMECYSGFSKYFNSKEFLEFEQNFTSKNNHKT
FT                   EFLLSSYKDQMIKVIDYAKKFECLSAFLETQSEKNDLAVVKMISESMERKTQRFYLQTK
FT                   FQTFPQYIFPSVWSSPMWGKQWE"
FT   gene            524494..524700
FT                   /locus_tag="CJJ81176_0589"
FT   CDS_pept        524494..524700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0589"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0589"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73348"
FT                   /db_xref="GOA:Q0Q7L6"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q7L6"
FT                   /protein_id="EAQ73348.2"
FT                   /translation="MGIMLGILSLIAGFVAIVLMCSLYFIVFMVFVGIAILIFLSMQPY
FT                   PYNIIFCAIYLITILALVLWRKT"
FT   gene            524842..525519
FT                   /locus_tag="CJJ81176_0590"
FT   CDS_pept        524842..525519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0590"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73471"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN7"
FT                   /protein_id="EAQ73471.1"
FT                   /translation="MENLSKKECLRIEIDKGLENSLKELEDLMEKLPEQQTQTLFEQCT
FT                   KNAMDAVTGHFGLASTILNAKDGGNVTTLHNFEKGIVATEEDLQKLTKYQQGYKRDSNY
FT                   DKIKDNIRDNFPKIVRSEYTGEEMERGAGKNKAQLDHVISLKEIDRDPNMHLFLDDAIR
FT                   AEIANHPDNLKWLDASANASKGDRDLMEWGKEIDLKTGKTNFEKYGIDEKKLKKFTIQP
FT                   NQT"
FT   gene            525591..526457
FT                   /locus_tag="CJJ81176_0591"
FT   CDS_pept        525591..526457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0591"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73299"
FT                   /db_xref="GOA:Q0Q7L4"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q7L4"
FT                   /protein_id="EAQ73299.1"
FT                   /translation="MKIFVYSAFGVVLKDFIEAVVIELKTTFREFGKENIKEIFKRFAR
FT                   RMEKVWEKIKAKWKDIFKGSLEAGIQAFFSNLLVFIINTIFTTLKKIVQIIRAGFTSLY
FT                   QAVKIIINPPKNIPKDEIYFEASKIFVSGMISAISMLGSEMIHKFLLSIPGFNVFLSLP
FT                   IPFTDETIGDALSLCISAAGGAVLSTIAIFYMDKWRSNSKIGNLQIQIVTQKNLIAQYK
FT                   IAKTWFALNDAYHIVKNETLATIQQIKKDNQMREQSSQEVETAIEEFENCNITKKLYKK
FT                   LNQTKEN"
FT   gene            526457..527239
FT                   /locus_tag="CJJ81176_0592"
FT   CDS_pept        526457..527239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0592"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73089"
FT                   /db_xref="GOA:Q0Q7L3"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q7L3"
FT                   /protein_id="EAQ73089.1"
FT                   /translation="MLELITQKDQDFLQNIENLDEEYIQKFINKKISEIAIAIETAAEN
FT                   ADKAKDRTQKAKNLNTDSDWQTYIPIFGRWLGETSEEKKEIKSNMILEVAELQNESMNQ
FT                   MTTILKEVVIFFTSSFCIATRMNQALSLIIAQGFVKSDGKVIRLSKAAKEQFQQIQKFT
FT                   LSFIEDHEKHKDTINNIQVELDKKNQIDDEQYKLIEKHYQEFIQYKNYNDKIVQEQECK
FT                   INELKDILNKRKNVFTNSISILALIVSVASIVLYFIGR"
FT   gene            527243..527707
FT                   /locus_tag="CJJ81176_0593"
FT   CDS_pept        527243..527707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0593"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0593"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73290"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q7L2"
FT                   /protein_id="EAQ73290.1"
FT                   /translation="MNFLSSLKDKAVNASEAIKDKTIKTAEVVKDIGMEVKCGIGWHAG
FT                   EYQNEKDKPKCFFSKICPDCGKYLTKNQHDFEAPEILNPDNCYGYRRCTLCSIQVFDNF
FT                   HNYYEIKKDAKCRMHEKCNLCGHERLGQTRHNWKYDENGQKICLDCKETV"
FT   gene            527714..528019
FT                   /locus_tag="CJJ81176_0594"
FT   CDS_pept        527714..528019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0594"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0594"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73341"
FT                   /db_xref="UniProtKB/TrEMBL:Q0Q7L1"
FT                   /protein_id="EAQ73341.1"
FT                   /translation="MFSKIFSSLSLANAFKGFLFKRISSPMQSARIISMVLDIKNAFND
FT                   NKDQTSSICKTLDLIVNFKKEHPQDFNELFEILKDLIQEYEQNPNEIKQNLKEILK"
FT   gene            528028..528237
FT                   /locus_tag="CJJ81176_0595"
FT   CDS_pept        528028..528237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0595"
FT                   /product="hypothetical protein"
FT                   /note="putative ATP"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0595"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73410"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PF09"
FT                   /protein_id="EAQ73410.1"
FT                   /translation="MNHLLILYNPYYQEDVIKQHLSILQEKSQVAFGKIKSKLNDQEKQ
FT                   NSLEEIYQSTNEENFLQLFFKRLC"
FT   gene            528194..529096
FT                   /locus_tag="CJJ81176_0596"
FT   CDS_pept        528194..529096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0596"
FT                   /product="conserved hypothetical protein, authentic
FT                   frameshift"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0596"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73413"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC27"
FT                   /protein_id="EAQ73413.1"
FT                   /translation="MKKISCNFFLSDYANLFVAKVVKISKNVDESLIPSYYKEKNLEVE
FT                   DFFIISDLRELVREDFSLLRDKFLANFITPNDHTYAIYGNNYTYPLPVRLKEECSYFLG
FT                   DEKHYLSVYKSKEYLAMQENFIRFVFGKRIFYLLHPDSISNIIHAELELLQSENDLLND
FT                   FTSIVVKYSKTLEYEIYAFAKKVLLKACMKDPSLYDLTYNVQGKSFILKDFFTQKPNLG
FT                   SIKFLLRHENIQCHLGKSLTQFINYPFSKSLTLIQEIRNEAVHAKAPSLNEVKKLRNEI
FT                   LGIEGVSLLKSILTHKEIS"
FT   gene            529241..529963
FT                   /locus_tag="CJJ81176_0597"
FT   CDS_pept        529241..529963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0597"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0597"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73455"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJL2"
FT                   /protein_id="EAQ73455.1"
FT                   /translation="MPIKKENGRYVLESFALGKLSFKDIQNFATLSGIAELYPKLDQGF
FT                   IVDLLSHRVNKVLMVKNEGFQKVDYELFKDLSVAILKHNVLNFFYKEKERQIKPYKLVN
FT                   YKGIWYLLGDESDKLKHFNLDKISKLRTKNENFIPNEKLEKQIQNDPNIWLGESKEVIL
FT                   KLDKNAKEYFFRKEILSNYQIIDEDETSYTLSTQVSYEDEILHLVKQWIPYMKILAPIE
FT                   LKTRLEDILKSYLNNLSK"
FT   gene            complement(529985..530060)
FT                   /locus_tag="CJJ81176_1722"
FT   tRNA            complement(529985..530060)
FT                   /locus_tag="CJJ81176_1722"
FT                   /product="tRNA-Met"
FT   gene            complement(530095..530169)
FT                   /locus_tag="CJJ81176_1723"
FT   tRNA            complement(530095..530169)
FT                   /locus_tag="CJJ81176_1723"
FT                   /product="tRNA-Gln"
FT   gene            530214..531281
FT                   /gene="ribB"
FT                   /locus_tag="CJJ81176_0600"
FT   CDS_pept        530214..531281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribB"
FT                   /locus_tag="CJJ81176_0600"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00926;
FT                   match to protein family HMM TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0600"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73046"
FT                   /db_xref="GOA:A0A0H3PIV6"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIV6"
FT                   /protein_id="EAQ73046.2"
FT                   /translation="MSSNLSYNFKNFKEIKMKFVSVEQAIKDLQAGKMLVMVDAEDREN
FT                   EGDLIFPAQFSTQEKVNFMIKEARGVVCVALDETLAKKFELPLMVPKNTSNHETAFTIT
FT                   VDAKDATTGVSAYERNMTIQIFADDNAKASDFVRPGHINPLIAKKGGVLERTGHTEGTV
FT                   DLCKLAGLKGACVICEIVKDNGDMARREDLEIFCQKYDLNMIAVSDLIEYRLKHESLIK
FT                   LEEKSQSVLAGFKAEKFIFSDHNQTQHIAFCFKDIKKCENVKFHISGSDFELLTSDKFS
FT                   KLLEQIKFLSENGGVIVFMQGEKSSTIQYKNYGIGAQILRYFGIEEIKLLSQSCDKDYI
FT                   GLEGFGLNLKACNFN"
FT   gene            531293..531736
FT                   /locus_tag="CJJ81176_0601"
FT   CDS_pept        531293..531736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0601"
FT                   /product="GatB/Yqey family protein"
FT                   /note="identified by match to protein family HMM PF02637"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0601"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73113"
FT                   /db_xref="GOA:A0A0H3PIZ2"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIZ2"
FT                   /protein_id="EAQ73113.1"
FT                   /translation="MTLKEQILNDIKEAMKQKDDFKRDSLRTLNAAFKQIEVDERIELD
FT                   NERIYKIIASEIKKRKDAIELYLKANREDLAQKEQNEISLFEIYLPKQLSDEELTLALK
FT                   QLIEELGVSSLKEQGLIMKEAKIKLGASVDGKRLNLALKELLQ"
FT   gene            531754..533454
FT                   /gene="ilvB"
FT                   /locus_tag="CJJ81176_0602"
FT   CDS_pept        531754..533454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="CJJ81176_0602"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0602"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73121"
FT                   /db_xref="GOA:A0A0H3PEJ1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEJ1"
FT                   /protein_id="EAQ73121.1"
FT                   /translation="MKELSGSAMICEALKEENIKIVFGYPGGAALNIYDEIYNQKYFKH
FT                   ILVRHEQAALHAADAYARMSGEVGVAIVTSGPGFTNTITGLATAYSDSIPLVLISGQVA
FT                   NSLIGTDAFQEIDAVGISRPCVKHNYLVTCIEEFPCILKEAFYIARSGRPGPVHIDVPK
FT                   DVSATLGLWEYPKEISMKTYKPVYKGNSKQIKKFAELLKEAKRPLFYLGGGCISSNASE
FT                   QIRELVKFTKIPAVETLMALGTLRSDDVFNLKMAGMHGSYAANMALSECDLLVSVGARF
FT                   DDRITGKTSEFAKHATIVHVDIDPSSISKIINAHYPIVGDIKEVLKELLEELKKENSNT
FT                   TFKEWHETLKRYNELYPLSYEDSNEILKPQWVIEECAKMAPDARIITDVGQHQMWVAQF
FT                   YPFNYPRQLATSGGQGTMGYSLPAALGAKLAVGEEVVINFVGDGSVLMNIQELMTAYEY
FT                   GIKTINIILNNAFLGMVRQWQSMFYKEHFSQTDLSTQPDFIKIAQGFGCEGYEISNKEE
FT                   FIQAFSQALKSDKTSLLNVKIDRFEDVLPMVPAGGAIYNMILPKAKDRQ"
FT   gene            533451..533915
FT                   /gene="ilvH"
FT                   /locus_tag="CJJ81176_0603"
FT   CDS_pept        533451..533915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="CJJ81176_0603"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0603"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73246"
FT                   /db_xref="GOA:A0A0H3PBV0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBV0"
FT                   /protein_id="EAQ73246.1"
FT                   /translation="MRRVLSVIVLNEHGVLSRIVGLFSGRGYNIDSLTVAPLENKEFSR
FT                   INIVTSGNERTFEQIVKQLHKLIPTYKVIESEEFIDKEMALVKIPLNENLGGLDAVLKA
FT                   YNGTIANSNENFLFLMVADDANRIDNFLKTIKKYNPSDIVRSGSVLMEIK"
FT   gene            533912..534877
FT                   /gene="lpxD"
FT                   /locus_tag="CJJ81176_0604"
FT   CDS_pept        533912..534877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="CJJ81176_0604"
FT                   /product="UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="identified by match to protein family HMM PF00132;
FT                   match to protein family HMM PF04613; match to protein
FT                   family HMM TIGR01853"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0604"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73066"
FT                   /db_xref="GOA:A0A0H3PAD5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR007691"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020573"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAD5"
FT                   /protein_id="EAQ73066.1"
FT                   /translation="MKLSEIAEFLSLEYKGEDIEISALNSLLKANFTELTYCDGEKNTK
FT                   DIPHTGAAAILVSKEYENLVPKDTKALITQSPHLSFAFLSKLFAKPLISTAKEKVQNIA
FT                   KSARIMPNVYIGDNVNIGENVIIMAGAYIGDNVSIGDESIIHPNVVIYNDTKIGKKCHL
FT                   LANCVIGSDGFGYAHNKNGEHYKIYHNGNVILEDFVEVGACTTIDRAVFDSTIIKAGTK
FT                   VDNLVQIGHNCNIGQNCIIVAQTGISGSSELGRNVIMGGQSATSGHLKIGDFSTIAARG
FT                   GVSKNLEGGRVYGGFPIMLQKDWLKLQAKIAINFKEKSQD"
FT   gene            complement(534866..535894)
FT                   /gene="queA"
FT                   /locus_tag="CJJ81176_0605"
FT   CDS_pept        complement(534866..535894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="CJJ81176_0605"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="5.-.-.-"
FT                   /note="identified by match to protein family HMM PF02547;
FT                   match to protein family HMM TIGR00113"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0605"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72973"
FT                   /db_xref="GOA:A1VYT7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYT7"
FT                   /protein_id="EAQ72973.1"
FT                   /translation="MNKDLLLSSYDYTLANELIANYPANPKEDARLLVFDRKNKEIFHT
FT                   TFKNLKDFLPDCAIFFNDTKVIKARIYGNKASGGKIELFLHQPFLNSHNPLFLAQIKGR
FT                   VKKDEILYFKEDLKARVVELLDDGLRKVQFFQNDKTLDTSNLYNLLDKIGHIPLPPYIK
FT                   REDEKSDLKDYQSIFAKNLGAVAAPTASLHFSETMFENLRKKHKIYHLTLHVGAGTFKG
FT                   VECENIQEHKMHSEFFNIPQQACEIIDSKQAILGVGTTVTRTIEYYARTKTKSGFCDLF
FT                   LHPQNPPIRQNHLLTNFHLPKSTLIMLVSAFIGREQCLKLYKLAIKEKYRFYSYGDAML
FT                   IL"
FT   gene            complement(535887..536624)
FT                   /gene="tatC"
FT                   /locus_tag="CJJ81176_0606"
FT   CDS_pept        complement(535887..536624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="CJJ81176_0606"
FT                   /product="Sec-independent protein translocase TatC"
FT                   /note="identified by match to protein family HMM PF00902;
FT                   match to protein family HMM TIGR00945"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0606"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73384"
FT                   /db_xref="GOA:A0A0H3PAS9"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAS9"
FT                   /protein_id="EAQ73384.1"
FT                   /translation="MFEELRPHLIELRKRLFISVACIVVMFIVCFALRSYILDILKAPL
FT                   IAVLPEVAKHVNVIEVQEALFTAMKVSFFAAFIFSLPVIFWQFWKFVAPGLYDNEKRLV
FT                   VPFVSFASIMFALGACFCYFVVVPLAFKFLINFGLNEDFNPVITIGTYVDFFTKVVVAF
FT                   GLAFEMPVIAFFFAKIGLIDDSFLKRHFRIAVLVIFVFSAFMTPPDVLSQFLMAGPLCG
FT                   LYGLSILIVQKVNPAPKDKESDE"
FT   gene            complement(536625..537032)
FT                   /gene="tatB"
FT                   /locus_tag="CJJ81176_0607"
FT   CDS_pept        complement(536625..537032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="CJJ81176_0607"
FT                   /product="twin-arginine translocation protein TatB"
FT                   /note="identified by match to protein family HMM PF02416;
FT                   match to protein family HMM TIGR01410"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0607"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73469"
FT                   /db_xref="GOA:A0A0H3PAY0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAY0"
FT                   /protein_id="EAQ73469.1"
FT                   /translation="MSFGEIIVILVVAILVLGPDKLPEAIVQIAKILKAVKRNIDDAKS
FT                   SIEKEIRINDLKEEAKKYKDEFSSTNENIRKKLSFEEFDDLKRDILDKTKVDLTFDSRD
FT                   DNTKNNLSGQNLNTEEKPNLSKLETQDKTEK"
FT   gene            complement(537091..538158)
FT                   /locus_tag="CJJ81176_0608"
FT   CDS_pept        complement(537091..538158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0608"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase, putative"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM PF06969; match to protein
FT                   family HMM TIGR00539"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0608"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73474"
FT                   /db_xref="GOA:A0A0H3PC54"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC54"
FT                   /protein_id="EAQ73474.1"
FT                   /translation="MHFYIHIPFCESKCNYCAFTSLKKNDYEKAYFQALKEDIVFQLKQ
FT                   FNIQSNQIKTLFIGGGTPSCVDAYNYEDIFKILYPLLDKNVEISCEANPNSATLNWLKN
FT                   MKNLGVNRISFGAQSFHPKKLHFLGRIHNQEMIIKALENANKVGFKNINLDLIYDTKLD
FT                   NKKMLEFELLHLKQIKALITHLSAYNLTIESNTAFAKKEHFKKNAPNLMKFFIKQLLEL
FT                   NFFQYEISNFSKTKAQICKHNLAYWQGKNYLACGLSAVGFYENKRFYTAKNLKNYIENP
FT                   TFRSIEQLSSKDLNLEHLFLGLRSIVGIDETKLNQWQKDKINILLKEKKLFYKNKRYFN
FT                   PNFLISDELALYLSS"
FT   gene            538259..538729
FT                   /gene="nidH"
FT                   /locus_tag="CJJ81176_0609"
FT   CDS_pept        538259..538729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nidH"
FT                   /locus_tag="CJJ81176_0609"
FT                   /product="(di)nucleoside polyphosphate hydrolase"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0609"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73270"
FT                   /db_xref="GOA:A1VYU1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYU1"
FT                   /protein_id="EAQ73270.1"
FT                   /translation="MENEKNYRPNVAAIVLSSSYPFECKIFIAKRSDMDNIWQFPQGGI
FT                   DKGESVKNALFRELKEEIGTDEVEIIAEYPEWLSYDFPSKIVKKMYPYDGQIQKYFLVR
FT                   LKHGATININTKHPEFDDYQFVSVKQIFEMINHFKKNIYVKVIKYFEEKGYI"
FT   gene            538731..539933
FT                   /locus_tag="CJJ81176_0610"
FT   CDS_pept        538731..539933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0610"
FT                   /product="aspartate kinase, monofunctional class"
FT                   /EC_number="2.7.2.4"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM PF01842; match to protein
FT                   family HMM TIGR00656; match to protein family HMM
FT                   TIGR00657"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0610"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73117"
FT                   /db_xref="GOA:A0A0H3PB58"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB58"
FT                   /protein_id="EAQ73117.1"
FT                   /translation="MLIVQKYGGTSVGTLERIEAVANRVIQSAQQGNQLVVVVSAMSGV
FT                   TNTLIEQAEYFSKTPNGKDMDMLLSSGERVTSALLSIALNEKGYPAISFSGRKAGIITD
FT                   SVFTKARIHHIDTKAIKSELQNGKIVVIAGFQGVDEEGNVTTLGRGGSDLSAVAVAGAL
FT                   NADLCEIYTDVDGVYTTDPRIEPKAKKLDKISYEEMLELASLGAKVLQNRSVELAKKLN
FT                   VNLVTRSSFNNNEGTMITKEDGMEQALVSGIALDKNQARVTLRNVEDKPGIAAEIFSVL
FT                   ANENINVDMIIQNVGVDGATNLGFTVPQNELELAKNAMQKILSSKTTIESDSAVVKVSI
FT                   VGVGMKSHSGVASKAFKALADEGINIGMISTSEIKISMIVHEKYGELAVRALHECYGLD
FT                   K"
FT   gene            539934..540470
FT                   /locus_tag="CJJ81176_0611"
FT   CDS_pept        539934..540470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0611"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0611"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73179"
FT                   /db_xref="InterPro:IPR021011"
FT                   /db_xref="InterPro:IPR038381"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB96"
FT                   /protein_id="EAQ73179.1"
FT                   /translation="MSDFLSFTLENIRNGGAFMAWLESRRLEWAPLMAARLKYLLEGRT
FT                   FVLMCDEQRSWYEEYFLKNINSKAARPMLPFVSLNSLCKKKVQSSEDIALLNDLLDISF
FT                   PNGYVYFYIGSASDNKSLIAKSRDDSLLWLFDEQLQDSFYLNSKDKDLDIKLISLYQLF
FT                   DVSLDAILFSRVQLG"
FT   gene            540476..541075
FT                   /locus_tag="CJJ81176_0612"
FT   CDS_pept        540476..541075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0612"
FT                   /product="DNA polymerase III, delta prime subunit, homolog"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0612"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73391"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBJ8"
FT                   /protein_id="EAQ73391.1"
FT                   /translation="MFISKIIISEDFLGIKEEMINNFGIKKLRFFMPQNEFLLDDARAV
FT                   EKESYIAETEEKIIVLMADSYRIEAQNFLLKLLEEPPKNIKFLIVIPSKNLLLPTIKSR
FT                   LICEKRKVEKEVKKLDLDLKRMDLRMLFDFLQKNENLDKNELMDQIALLAKECVKYKDF
FT                   NAEELEFFYESYELAKLNSKSGVLLATLLLNYYTKK"
FT   gene            541077..542219
FT                   /gene="folP"
FT                   /locus_tag="CJJ81176_0613"
FT   CDS_pept        541077..542219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="CJJ81176_0613"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="identified by match to protein family HMM PF00809;
FT                   match to protein family HMM TIGR01496"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0613"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73116"
FT                   /db_xref="GOA:A0A0H3PEI7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEI7"
FT                   /protein_id="EAQ73116.1"
FT                   /translation="MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDIST
FT                   PAANILKQDALRVGAELITHKEVITAKITHSNALLMASKEQIQKLIAKEKLQDFGLKNL
FT                   ALFLQKDFLKPKKAELMAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVS
FT                   SRPGSEYCGKEEEFKRLKKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDI
FT                   TSLRNLNLAKLASKYGAKYCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFG
FT                   VKESILDVGIGFGKSAGHNMILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLA
FT                   GTLYLHLKAFENGASIIRVHDLYEHKQLFALAQAMDNIGV"
FT   gene            542220..544163
FT                   /gene="ligA"
FT                   /locus_tag="CJJ81176_0614"
FT   CDS_pept        542220..544163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="CJJ81176_0614"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF01653; match to protein
FT                   family HMM PF03120; match to protein family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0614"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73015"
FT                   /db_xref="GOA:A1VYU6"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYU6"
FT                   /protein_id="EAQ73015.1"
FT                   /translation="MKKEEYLEKVALANLWMRAYYEKDEPLASDEEYDVLIRELRVFEE
FT                   QNKDEISKDSPTQKIAPTIQSEFKKIAHLKRMWSMEDVFDESELRAWAKRAKCEKNFFI
FT                   EPKFDGASLNLLYENGKLVSGATRGDGEVGEDITLNVFEIENIPKNIAYKERIEIRGEV
FT                   VILKDDFEKINEKRALLNQSLFANPRNAASGSLRQLDTSITKERNLKFYPWGVGENTLN
FT                   FTKHSEVMQFIRELGFLKDDFIKLCANLDEVLKAYDELLALREKKPMMMDGMVVRIDDL
FT                   ALCEELGYTVKFPKFMAAFKFPALEKTTRLIGVNLQVGRSGVITPVAVLEPVNLDGVVV
FT                   KSATLHNFDEIARLDVKINDFVSVIRSGDVIPKITKVFKDRREGLEMEISRPKLCPTCQ
FT                   SELLDEGTLIKCQNIDCEDRLVNSIIHFVSKKCLNIDGLGENIVELLYKHKKITTLESI
FT                   FHLKFSDFEGLEGFKEKKINNLLNAIEQARECELFRFITALGIEHIGEVAAKKLSLSFG
FT                   KEWHKQSFEAYANLEGFGEQMALSLCEFTRVNHVRIDEFYKLLNLKIEKLEIKSDGVIF
FT                   GKTFVITGTLSRPRDEFKALIEKLGGKVSSSVSKKTDYVLFGEEAGSKLIKAKELEVKC
FT                   IDESAFNELVKE"
FT   gene            544201..545148
FT                   /locus_tag="CJJ81176_0615"
FT   CDS_pept        544201..545148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0615"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0615"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73042"
FT                   /db_xref="GOA:A0A0H3PBM8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBM8"
FT                   /protein_id="EAQ73042.2"
FT                   /translation="MLTWQRTVFSLFFLIPIFLTLFWEFFLFLKLRKNIIKEATLIKGS
FT                   LFYRISIGDFYLYIFSFFLAIFGLISLFLNFLNLEKIDFVFIFIILPLLMIFLKKELHL
FT                   QFVDNAYNDFRIVVIASFFTALFYAFYGLFFTYNEILNLELFSRKIIAYKSASFVYFDF
FT                   LSEFLHFISNLKFFIFSYFGYLGFRALNFIFDFFNFFMFCSLLAFVFNFVLKIKIKIIV
FT                   LFLCFIMVLASYFLKEQRNNALKSEQEQILLWMNNFDFLKDHNLSLIQKEKDLFEKDLK
FT                   DLREIFKKNAFEIGIWWFSKEKEDLEKRINESLK"
FT   gene            545145..545906
FT                   /gene="tlyA"
FT                   /locus_tag="CJJ81176_0616"
FT   CDS_pept        545145..545906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tlyA"
FT                   /locus_tag="CJJ81176_0616"
FT                   /product="hemolysin A"
FT                   /note="identified by match to protein family HMM PF01479;
FT                   match to protein family HMM PF01728"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0616"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73153"
FT                   /db_xref="GOA:A0A0H3PEK7"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEK7"
FT                   /protein_id="EAQ73153.1"
FT                   /translation="MRFDFFVSKRLNISRNKALELIENEEVLLNGKSFKASFDVKNFLE
FT                   NLKKTQDLNPEDILLTDGLKLDLLSEIYVSRAALKLKNFLEENGIEIKHKNCLDIGSST
FT                   GGFVQILLENQALKITALDVGNNQLHLSLRTNEKIILHENTDLRTFKSEEKFELITCDV
FT                   SFISLINLLYYIDNLALKEIILLFKPQFEVGKNIKRDKKGVLKDDKAILKARMDFEKAC
FT                   AKLGWLLKNTQKSSIKGKEGNVEYFYYYIKN"
FT   gene            545872..546726
FT                   /locus_tag="CJJ81176_0617"
FT   CDS_pept        545872..546726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0617"
FT                   /product="riboflavin biosynthesis protein RibF, putative"
FT                   /note="identified by match to protein family HMM PF01687;
FT                   match to protein family HMM PF06574"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0617"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73217"
FT                   /db_xref="GOA:A0A0H3PBC4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBC4"
FT                   /protein_id="EAQ73217.1"
FT                   /translation="MLNIFTTISKINITSLAIGCFDGMHLGHLKLVKCLDENGALLVIN
FT                   KFKGQFLCSNRQKEEISGKKVIEVDFENIKSLDGKDFLSFLKKEFVNLKFIVVGYDFSF
FT                   GKNRAYDAKDIESLSGIKTIIVDEFSIGGVGVHASLIKDFLSKANLQKAKEFLGRDYSI
FT                   KGKMIKGQGLGSKELFATINLDCEGYFLPQNGVYATLLKSQRKIYKSVSFLGIRSSDEN
FT                   FAIESHILEELGEKFTQGEFFELEFISFLRENQKFQDLKKLKNQIAKDIEQARELLRKN
FT                   DER"
FT   gene            546716..547423
FT                   /locus_tag="CJJ81176_0618"
FT   CDS_pept        546716..547423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0618"
FT                   /product="methyltransferase, putative"
FT                   /note="identified by match to protein family HMM TIGR00740"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0618"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73152"
FT                   /db_xref="GOA:A1VYV0"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYV0"
FT                   /protein_id="EAQ73152.1"
FT                   /translation="MKDELFKQSPKKQFEFDKSVASVFDDMINRSVPFYRENLELCGNL
FT                   LAKILSTNASVCDLGCSSANFLIFLANLRKDFKLFGVDNSASMLEVAKSKAKAYGLDIS
FT                   FFEANLCEFDFFVCDVFVANYTMQFIRPPKRQELLDKIYKNLNSKGILIMSEKILYEDA
FT                   FLSKNIIELYADYKEKQGYSKFEIAAKREALENVLIPYSQKENLNMLEKAGFKKIESIF
FT                   KWANFETFIAFKD"
FT   gene            complement(547413..547628)
FT                   /locus_tag="CJJ81176_0619"
FT   CDS_pept        complement(547413..547628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0619"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0619"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73247"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAL2"
FT                   /protein_id="EAQ73247.1"
FT                   /translation="MKITLFLSLIGIFFAACEQTKSVEYYQNHPEEAKKRSLECRHKAI
FT                   ISQDCVNAYKVGFPKDEWEDENISNP"
FT   gene            complement(547625..548065)
FT                   /locus_tag="CJJ81176_0620"
FT   CDS_pept        complement(547625..548065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0620"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0620"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73368"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAS4"
FT                   /protein_id="EAQ73368.1"
FT                   /translation="MRRLSILLTILIVINITACDSKTENYYKNHPSEAKEKAKECKESG
FT                   TLSEDCINALKVGVKPTNEESKYSPNTPKKSDNQILETLKQNDLKKEKTTKDINQSSEN
FT                   NESIIIPPITETPSEIYPSKTTENNQSSIFSDDVNITQEKLP"
FT   gene            complement(548123..548755)
FT                   /locus_tag="CJJ81176_0621"
FT   CDS_pept        complement(548123..548755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0621"
FT                   /product="membrane protein, putative"
FT                   /note="identified by match to protein family HMM PF03458"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0621"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73436"
FT                   /db_xref="GOA:A0A0H3PC35"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC35"
FT                   /protein_id="EAQ73436.1"
FT                   /translation="MEINALTITTLYIIGISAEGMTGALAAGRHKMDLFGVIFIALVTA
FT                   IGGGSIRDVLLGHYPLTWVKHPEYIILICFCALVATKIPRVVTKLETLFLTLDAIGLVV
FT                   FSILGAQIAIDQNHGFIIAVAAAVITGVFGGILRDILCMRIPLVFQKEIYAGIAIIAGA
FT                   IYYSLIIWLELNALVCTLLTLFIGVFARLLAIKYQWSLPIFSYNEEK"
FT   gene            complement(548766..549416)
FT                   /locus_tag="CJJ81176_0622"
FT   CDS_pept        complement(548766..549416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0622"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="identified by match to protein family HMM PF01223"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0622"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73359"
FT                   /db_xref="GOA:A0A0H3PJE6"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJE6"
FT                   /protein_id="EAQ73359.1"
FT                   /translation="MKIFIFLLAISLNIFALEPYKPSADFSSYFNNINCSQILDKFFYL
FT                   NCYDYKLKGTKAVAYKVEASNLKDKQIKKRPRFEDDTNIPKKYRTTWSDYKNSSYTRGH
FT                   TAPNASFSFSKAAQNSVFLMSNITPQIAQINNKIWNEIEQRERNLAFKFQSIEVLNLVL
FT                   YDKEPQYIKNRIAIPSFYVKIIKTPKFKECYQVPNHEVNNENIKQYQINCDKF"
FT   gene            complement(549413..550039)
FT                   /gene="nth"
FT                   /locus_tag="CJJ81176_0623"
FT   CDS_pept        complement(549413..550039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="CJJ81176_0623"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="identified by match to protein family HMM PF00730;
FT                   match to protein family HMM TIGR01083"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0623"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72986"
FT                   /db_xref="GOA:A0A0H3PEB4"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEB4"
FT                   /protein_id="EAQ72986.1"
FT                   /translation="MKRNLEIKELFLKHFDKPVTELKFSNLYELLVCVMLSAQCTDKRV
FT                   NLITPDLFKAYPDIKSLANANLSSLKTYIQTCSFFNNKAQNLIKMAKAVCENFGGEIPL
FT                   DEQNLKSLAGVGQKTAHVVLIEWCGANFMAVDTHVFRVSHRLGLSKAKTPEATEEDLTG
FT                   IFKDNLNYLHQAMVLFGRYTCKAKKPLCKECFLNHLCKSKDKELK"
FT   gene            550120..550941
FT                   /locus_tag="CJJ81176_0624"
FT   CDS_pept        550120..550941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0624"
FT                   /product="major antigenic peptide PEB4"
FT                   /note="identified by match to protein family HMM PF00639"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0624"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73401"
FT                   /db_xref="GOA:A1VYV6"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYV6"
FT                   /protein_id="EAQ73401.1"
FT                   /translation="MKKFSLVAAALIAGVALNVNAATVATVNGKSISDAEVSEFFAPML
FT                   RGQDFKTLPDNQKKALIQQYIMQDLILQDAKKQNLEKDPLYTKELDRAKDAILVNVYQE
FT                   KILNTIKIDAAKVKAFYDQNKDKYVKPARVQAKHILVATEKEAKDIINELKGLKGKELD
FT                   AKFSELAKEKSIDPGSKNQGGELGWFDQSTMVKPFTDAAFALKNGTITTTPVKTNFGYH
FT                   VILKENSQAKGQIKFDEVKQGIENGLKFEEFKKVINQKGQDLLNSAKVEYK"
FT   gene            550941..552005
FT                   /gene="fbaA"
FT                   /locus_tag="CJJ81176_0625"
FT   CDS_pept        550941..552005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="CJJ81176_0625"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /note="identified by match to protein family HMM PF01116;
FT                   match to protein family HMM TIGR00167; match to protein
FT                   family HMM TIGR01520"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0625"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73283"
FT                   /db_xref="GOA:A1VYV7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYV7"
FT                   /protein_id="EAQ73283.1"
FT                   /translation="MGVLDIVKAGVISGDELNKVYDYAKAEGFAIPAVNVVGTDSINAV
FT                   LEAAKKVNSPVIIQFSNGGAKFYAGKNCPNGEVLGAISGAKHVHLLAKAYGVPVILHTD
FT                   HAARKLLPWIDGLIEANAQYKKTHGQALFSSHMLDLSEESLEENLSTCEVYLQKLDALG
FT                   VALEIELGCTGGEEDGVDNTGIDNSKLYTQPEDVALAYERLGKISDKFSIAASFGNVHG
FT                   VYKPGNVSLQPEILKNSQKFVKDKFALNSDKPINFVFHGGSGSELKDIKNAVSYGVIKM
FT                   NIDTDTQWAFWDGVREYELKNRAYLQGQIGNPEGDDKPNKKYYDPRVWLRSGEESMIKR
FT                   LEIAFEDLNCINKN"
FT   gene            552100..553542
FT                   /locus_tag="CJJ81176_0626"
FT   CDS_pept        552100..553542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0626"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0626"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73190"
FT                   /db_xref="GOA:A0A0H3PAI8"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAI8"
FT                   /protein_id="EAQ73190.1"
FT                   /translation="MDIKSDEISELVLPEGKDARGSLVYFKIIFIPAFLYILILLGYFN
FT                   VIDFKVELHTVIMTGVIFFTALIFARHSAEYAYSIFEQQKDEFKQALKRHIMRHFLAIG
FT                   KDTKSNANFDDFAYTYIKGARNENFASIGSAIFPMMGILGTFISIAFSMPNFSSSDTAA
FT                   LEQEIADLLSGVGTAFYVSIYGIFLALWWMFFEKYGKSKIDRLLNRQKNATSGFFWTKE
FT                   ELDQRYLTESLQHFEKIGAIFKQVSNDDFFAELDHAIDRKFGIFQDMLNIEEKAIRLSG
FT                   EHIKQTMGELSKAQRDQRDLGKLYSEMLNGIGLLNQNLKEINTRMSEQYNRLLDISSDK
FT                   IHHLDKTLSAFDEKVERFGKNFELYEKAMLESQEKVFEGFKASLFEGMHKFKEVYEEEK
FT                   SIDAKIKMMDELKKEMKALDEETSQMMSKLSGDENQNKGNETKQIEDFSESKTEENQDE
FT                   IQAEISKQESNDELKNEDKENK"
FT   gene            553539..554492
FT                   /locus_tag="CJJ81176_0627"
FT   CDS_pept        553539..554492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0627"
FT                   /product="chemotaxis protein MotB, putative"
FT                   /note="identified by match to protein family HMM PF00691"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0627"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73326"
FT                   /db_xref="GOA:A0A0H3PJC4"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJC4"
FT                   /protein_id="EAQ73326.1"
FT                   /translation="MKNESKEDSNFWIAYADLMAGLLFVFILLIGAIVVKYVLTQSDLK
FT                   EIKDNLNKQEARLEESKEELRNKEAIVFKLSSDLNNASSALNLANSQKAELEANITNYK
FT                   QLSKDLNSTLDNKDKQILILLGQLEKKDEELKNLQEDFQKAKEKVQNLGFIRENLSKEL
FT                   QSKLDNNITIDEKTGSISLPAEVLFDKDSYVLKNEAKASLRKILSEYFDAILEDPKIFS
FT                   NIENIIIEGHTDSDGSYIYNLDLSQKRAYEVMNFIYTFYKSDKLQKLLMASGRSFSDPV
FT                   FVNGVEDKDKSRRIEIKFSIKNDNALKDVEKFFEFH"
FT   gene            554479..555354
FT                   /locus_tag="CJJ81176_0628"
FT   CDS_pept        554479..555354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0628"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73033"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ4"
FT                   /protein_id="EAQ73033.1"
FT                   /translation="MNFIKTISPIQKINFNGFEFYIKRDDLLGEINGNKARKLAFYIHQ
FT                   RYPKNQSFVSYGGSQSNALAALSIFAKQRSYKLVFACEKISTFLKNNPCGNYALALENG
FT                   VDFVENIHSLSLKQFALSLCKKDDIFIEQGIANLEAQYGYMELAQEIQMQSQSLKLDFD
FT                   IFLPSGTGTSAAFLAKYSKFKVFTCACVGDIKYLKKQILTLDPSYDFSNLEFLTSDKKY
FT                   HFAKPYKEFYELYMDLKLKCNIEFDLLYDILGLSIALKQEWKKPLLYIHQGGILGNSTM
FT                   LERYKFKKLV"
FT   gene            complement(555346..556689)
FT                   /locus_tag="CJJ81176_0629"
FT   CDS_pept        complement(555346..556689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0629"
FT                   /product="sodium-dependent transporter, putative"
FT                   /note="identified by match to protein family HMM PF00209"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0629"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73411"
FT                   /db_xref="GOA:A0A0H3PBK7"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK7"
FT                   /protein_id="EAQ73411.1"
FT                   /translation="MQRQTWSSTLTYILTVAGATIGFGATWRFPYLVGENGGGAYVLVF
FT                   CIAMIIIGIPVILVENVIGRKAMTNSVDAFKQKWQSIGYMGLLGSFGIMAYYMVLGGWV
FT                   LVYIWELTLGNFSLANVVSKEFTHQFFNDKIAFNPLGVGIFTTVFVIINYIILKRGIID
FT                   GIEKSVKFLMPLLFICLIIVVGRNLTLDGAMAGVKFYLEPDFSKILSPKLLIDVLGQVF
FT                   FALSLGFGVMITLSSHLNKNENMAKTAIYTGVLNTIIAVLAGFMIFPALFSAGLAPDSG
FT                   PSLVFETLPIAFSHIHFGTIVCILFFVLLLIAALTTSLPIYQVIISVLEEKFKYSKNLS
FT                   INLTLGFIFILGNLPCILTYGPWRDIVIIKGKNIFDSFDFISGNILFVLTAFFCCIYVG
FT                   WILGKQESLKELSNNNTLKSSWFGIWFYYVKYIVPLIILIIFIYGILN"
FT   gene            complement(556740..557408)
FT                   /locus_tag="CJJ81176_0630"
FT   CDS_pept        complement(556740..557408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0630"
FT                   /product="MOSC domain protein"
FT                   /note="identified by match to protein family HMM PF03473;
FT                   match to protein family HMM PF03475"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0630"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73071"
FT                   /db_xref="GOA:A0A0H3PAD8"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAD8"
FT                   /protein_id="EAQ73071.1"
FT                   /translation="MKIQSLQIGKIKNYKNFQSAFIKDTYLEETQIDFLGILDDQIADK
FT                   IHHGGYHKAIFANSCQNYPIWERFLNKKLNFGSMGENLSIDGLCEQNVCIGDIHQISNA
FT                   ILQVSEPRKPCVKISKIHNNSNFTHEIFKTGLSGWYYKVLQVGQIRKYENIKILEKNST
FT                   SLSVFELNQLFYSPHQALRQNPILLDKLEKLNSLISQNWHETIHKRLKNTYDISYMDSL
FT                   "
FT   gene            complement(557405..559108)
FT                   /gene="dsbD"
FT                   /locus_tag="CJJ81176_0631"
FT   CDS_pept        complement(557405..559108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dsbD"
FT                   /locus_tag="CJJ81176_0631"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /EC_number="1.8.1.8"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM PF02683"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0631"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73386"
FT                   /db_xref="GOA:A0A0H3PBJ5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBJ5"
FT                   /protein_id="EAQ73386.1"
FT                   /translation="MRIFGIILLSFCLCFASILSLNEAFNVKSNSYNNSISIDIELGKD
FT                   IYLYSNKLKLYINEKDISSLINLPQSSTRGNENVYYQKLNLALPNLLLEHFAKNTTNLI
FT                   KLEFQGCSEQGLCYNPQTWYFDLISKKDAFEISKPYKTQKTDKKTKIESEESSIANFLA
FT                   TDNFFWILLSFFGYGLLLSLTPCILPMIPILSSLIVAKSNAKFSKKYSFFLSFIYVFFM
FT                   SLAYAIAGVIASFLGASIQGILQKPIILILFALIFIAFAFAMFGAFRFELPLRFQTFIH
FT                   KKSEKGKGVLGIAIMGFLSALIVGPCVAAPLAGALIYIANTGNALLGGSALFIMSFGMG
FT                   IPLLFIGLGLGFIKPGFWMEKVKIFFGFVMLAMAIWILSRIIEENYILIAYGILGVFFS
FT                   VFMGIFEKSFTIISKIKKSILILILAYSLSIFLGGLFGAKNFLNPLNFNTISASKSALS
FT                   YDYINNFEQLKQEIQTNTKPIMLDFTASWCENCKLLDELTFSDERIIQKMQNYKLIKVD
FT                   VSENNNEQIKTMKEFNVFGPPVLIFFENGKEKLKITGFISADDLLKKLEP"
FT   gene            559203..559691
FT                   /locus_tag="CJJ81176_0632"
FT   CDS_pept        559203..559691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0632"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0632"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73457"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAX2"
FT                   /protein_id="EAQ73457.1"
FT                   /translation="MQENNSPKTQAVVKKNEIYVSVKRKKSTIEYEKDLKNLQIELLKF
FT                   QNHVKAKGLKVLILIEGRDAAGKGGAIKRLIEHLNPRGCRVVALEKPSDVEKTQWYFQR
FT                   YIAHLPSAGEIVIFDRSWYNRAGVEPVMGFCTPQQHKDFLREVPLFENMISNSDIIFF"
FT   gene            559672..560085
FT                   /locus_tag="CJJ81176_0633"
FT   CDS_pept        559672..560085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0633"
FT                   /product="polyphosphate kinase 2"
FT                   /note="identified by match to protein family HMM PF03976"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0633"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73119"
FT                   /db_xref="GOA:A0A0H3PBQ5"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBQ5"
FT                   /protein_id="EAQ73119.1"
FT                   /translation="MILFFFKFYFSVSKDEQKKRFEKRRSDPLKQYKLSPVDQKSQELW
FT                   DKYTLAKYSMLLASNTPTCPWTIISSDDKKKARLNLLRFILSKVEYPNKKTGDFSKIDA
FT                   KLVRSGEEEIRKMEANLEKLDSKKADEKIKDLD"
FT   gene            560094..561284
FT                   /locus_tag="CJJ81176_0634"
FT   CDS_pept        560094..561284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0634"
FT                   /product="carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687; match to protein
FT                   family HMM TIGR01891"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0634"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73048"
FT                   /db_xref="GOA:A0A0H3PBN0"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN0"
FT                   /protein_id="EAQ73048.1"
FT                   /translation="MQKLVENLALKYYDKVVDLRHQIHMHPELEFEEENTARLVCKILD
FT                   EFGIKYQKNIAKTGILATIEGKKKSQKKPKCVLLRADMDALPVQEKTNLSYASKIDGKM
FT                   HACGHDGHTAGLLGAALILNELKDEFCGTIKFMFQPAEEGSGGAKPMIESGVLENPYVD
FT                   AVFGCHLWGSLLENTAQIVSGEMMAGTDIFDLEFIGRGGHGAHPHTCIDPIIMATQFVN
FT                   NIQSVVSRRLAPYEAGVITVGQICAGTTYNVIPINAYLKGTVRFLNDKTQDILKSSLEE
FT                   VAAATAKSNGGDYKLKYTKEFPPLINDEKAALIARKAFAKVLGEENIIVSSKPDMGAED
FT                   FAFLTRERMGAYVFVGISKDLNHPALHHSSTFCWDDENLKVLMQGDVMMALEFLNL"
FT   gene            561363..562535
FT                   /locus_tag="CJJ81176_0635"
FT   CDS_pept        561363..562535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0635"
FT                   /product="macrolide-specific efflux protein macA"
FT                   /note="identified by match to protein family HMM PF00529;
FT                   match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0635"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72968"
FT                   /db_xref="GOA:A0A0H3PEA5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEA5"
FT                   /protein_id="EAQ72968.1"
FT                   /translation="MKKKVILIVLIAILGSVGAYFIFFNNDEKISYLTQKIQKKDISQT
FT                   IEAVGKVYAKDQVDVGAQVSGQIIKLYVDVGTHVKQGDLIAQIDKDKQQNDLDITKAQL
FT                   ESAKANLESKKVALEIASKQYQREQKLYAAKASSLENLETQKNNYYTLKANVAELNAQV
FT                   VQLEITLKNAQKDLGYTTITAPMDGVVINVAVDEGQTVNANQNTPTIVRIANLDEMEVR
FT                   MEIAEADVSKIKVGTELDFSLLNDPQKTYHAKIASIDPADTEVSDSSTSSSSSSSSSSS
FT                   SSSSNAIYYYAKFYVPNKDDFLRIGMSIQNEIVVASAKAVLAVPTYAIKSDPKGYYVEI
FT                   LENQKAVKKYVKLGIKDSINTQILEGVNENEELIVSSSADGLAPKMKLRF"
FT   gene            562535..564460
FT                   /locus_tag="CJJ81176_0636"
FT   CDS_pept        562535..564460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0636"
FT                   /product="macrolide-specific efflux protein macB"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0636"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73027"
FT                   /db_xref="GOA:A1VYW8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017911"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYW8"
FT                   /protein_id="EAQ73027.1"
FT                   /translation="MIFLKNICKNIGENAILKNVSLSIEKGEFVAIIGQSGSGKTSLLN
FT                   IIGTLDTPSSGTYVFDEYEVTKLNNDEKARLRREKIGFIFQRYNLLSLLSAKENVSLPA
FT                   VYAGKKLQERSQNAKKLLNDLELAHKLDSKPNELSGGQQQRVSIARALMNGGELILADE
FT                   PTGALDSKSGIMVLEILQKLNAQGHTIVLVTHDPKIAAQAKRVIEIKDGEILSDTKKEK
FT                   AQEKLTLKTMSKEKKTLTLLKNQAFECFKIAYSSILAHKLRSILTMLGIIIGIASVVCV
FT                   VALGLGSQAKVLESIARLGTNTIEIRPGRGFGDLRSGKTRLNFSDLETLRSLEYLEAVD
FT                   AHSNTSGVATYTNISLSARAEGVGVNNFAIEGLRIDAGRILNNDDVKNSTNVAVLDFNA
FT                   KKNLFPDEKSENILGRVVLFNSQPFKIIGVLQKDTDKPIEDNVVRLYIPYTTLMNKLTG
FT                   DRNLREIIVKVKDDVSSTLAENAIIRILEIKRGQKDFFTFNSDTFKQAITANKRTTTIL
FT                   TACVAVIALIVGGIGVMNIMLVSVSERTREIGIRMAIGARREDIMMQFLIEAVMICTIG
FT                   AILGVILSIFVIFAFNTLSTDFPMILNAYSVLLGLLSSMFIGVVFGFFPARNAANLNPI
FT                   SALSKE"
FT   gene            564462..565832
FT                   /locus_tag="CJJ81176_0637"
FT   CDS_pept        564462..565832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0637"
FT                   /product="outer membrane efflux protein"
FT                   /note="identified by match to protein family HMM PF02321"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0637"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73105"
FT                   /db_xref="GOA:A0A0H3PB43"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB43"
FT                   /protein_id="EAQ73105.1"
FT                   /translation="MRVIFSIFLAFFLSACGAKLSLPKEVDLTQEQMKDLNLTYDWYRS
FT                   YDNAKLNEFLNFVLLNNSDINIARKTLLSALTRADLIDYDLYPTLSGNLGFGGDKDLNS
FT                   GKQSKNFNNSLNLSYELDIYGKLRDSASASEFSAKASAYDLENLKISMINTALNDVFEL
FT                   AYFNDVDKLLRAYLSNLEQMKELYSYKYKLGKIEELDLLNIEQSLLRAKQNLLSNDQNR
FT                   NLLIKNLQDLLAKQEGFAYIEYFKTLSLNDFKTLSPDFNIPLKALAYRADVRSKLNSLK
FT                   SAFKDYSSMQKSILPSISLGGALSGSDKKIDDSFKFEILSGNVKISLPFLDYGRVKQNI
FT                   KISQFTYEQLLISYEQALQSAMNEFALNYKDYQSNTLLLQNLQSINIKQELITKAYYEK
FT                   YILGKSELKDYLDANNTLNSTQQEFLRARFNLLKTINSYYQITALSFNDENLEFLKY"
FT   gene            complement(565834..567012)
FT                   /locus_tag="CJJ81176_0638"
FT   CDS_pept        complement(565834..567012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0638"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0638"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73208"
FT                   /db_xref="GOA:A0A0H3PJ52"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ52"
FT                   /protein_id="EAQ73208.1"
FT                   /translation="MLVNKFKVILLFFIIFTSSYAQNLNTNDTIDSILNQNKNHSALTS
FT                   YVSKKDLKNLEKKLEKNQNIGIRIYGDSHMAADFFPRVIRGYLIRSNSIGFAYPLQPKY
FT                   QQNLNLVYSYKNFEILNSRNPANAGHNFPLGGIIAKAKTKGAKINLDTTLDKKNFKIGF
FT                   LFKAKQNTNAFSIKDAKNQSYELRTTQINKWSYKELELDLPLQISALQKDAELGGYFIT
FT                   NKDNNVFLDTIAINGAKSDLWLSWNQTVVKKELGLLHNDLIILAYGSNDALFKGFEKQK
FT                   FKNNLKKWISILKTYNKNAVIMLISPPTVVQKQGKNYKLAPDFFTIRKALYEVAKEEKT
FT                   LIFDMHQFMQDSGGKNKWIEQKLSLNDVHLTIKGYELMAKKLLEDLKNIIDY"
FT   gene            complement(566999..568009)
FT                   /locus_tag="CJJ81176_0639"
FT   CDS_pept        complement(566999..568009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0639"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04311"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0639"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73321"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJC1"
FT                   /protein_id="EAQ73321.1"
FT                   /translation="MSVVRFFFILIIVLGLVVVVMNQSISSYIEQKYHFAFYPHNDLLK
FT                   EANGFKIKLEQIRAILSNEPLPQTNEETTNQENKSIDENLSKIDKVLNTLENDENTSHK
FT                   ETNPTLIQDANISFIDNTKLELQNGDEFLFIGDSLMQGVAIALNRDLRNLNLKVTDLSK
FT                   QNTGLSYKSYFDWSKATNEAFIKNSNIKYLVVLLGANDPWDIKKGGNYHRFGSLSWIDI
FT                   YTSRVDEIIKIAKKHKAKVFWFEIPPVKKEDLNKKIQVLNKIYSDEILKNKEIFINTKL
FT                   FFSVNDEYSAYIKDENNRSIKVRTDDGVHFTPSGAREMSKLLLEHIKLKEENASK"
FT   gene            complement(568010..569386)
FT                   /gene="algI"
FT                   /locus_tag="CJJ81176_0640"
FT   CDS_pept        complement(568010..569386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="CJJ81176_0640"
FT                   /product="alginate O-acetyltransferase AlgI"
FT                   /note="identified by match to protein family HMM PF03062"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0640"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73379"
FT                   /db_xref="GOA:A0A0H3PBJ2"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBJ2"
FT                   /protein_id="EAQ73379.1"
FT                   /translation="MTYFSLEFSILMIAFFAIYWTFKNDYKIQNILILIFSYIIYILIN
FT                   PYFALVLFIYTFFIHYFALLIFVRRKRYIFATCMAFIILNLCFFKYFPSIKGSVDEILN
FT                   FFGLEFLNIDLVLPIGISFYTFTSITYLVEVYQKRRLESFLNLATFLSFFPTLLSGPIM
FT                   RSSFFFEQAYQKREFKHANLIIILLVFGIVKKVLIANYLGIYAKSILDFPQSYNFIQLL
FT                   SAIYAYAIQIYCDFSGYVDLVCAFALMLGFTLPPNFNMPYLAKNLKDFWARWHISLSTF
FT                   IRDYIYIPLGGNRKGIPRTVANILIAFILSGMWHGNTLAFIVWGLLHGIGIVFIHLLTL
FT                   SKFSLQKIPALGRFLTFQFVCFTWIFFYYSKNLEDAIEYFKACYYNFFQIPSYNDIYML
FT                   VAFGVLFMIYPLFINFKEYCIKILNLTPFLLKPFIIAFILLLVFAFMPDGIPDFIYSSF
FT                   "
FT   gene            complement(569429..569932)
FT                   /gene="ftn"
FT                   /locus_tag="CJJ81176_0641"
FT   CDS_pept        complement(569429..569932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftn"
FT                   /locus_tag="CJJ81176_0641"
FT                   /product="nonheme iron-containing ferritin"
FT                   /note="identified by match to protein family HMM PF00210"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0641"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72988"
FT                   /db_xref="GOA:A0A0H3PIT1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIT1"
FT                   /protein_id="EAQ72988.1"
FT                   /translation="MLSKEVVKLLNEQINKEMYAANLYLSMSSWCYENSLDGAGAFLFA
FT                   HASEESDHAKKLITYLNETDSHVELQEVKQPEQNFKSLLDVFEKTYEHEQFITKSINTL
FT                   VEHMLTHKDYSTFNFLQWYVSEQHEEEALFRGIVDKIKLIGEHGNGLYLADQYIKNIAL
FT                   SRKK"
FT   gene            570112..571107
FT                   /locus_tag="CJJ81176_0642"
FT   CDS_pept        570112..571107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0642"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0642"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73084"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEG8"
FT                   /protein_id="EAQ73084.1"
FT                   /translation="MKKILSLSVTSLALCGALNAVDLKIAGSSTVYPFTSFVAEEYASI
FT                   KNTKTPIVESLGTGGGFKVFCEGTTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDG
FT                   IVLAQNKTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPP
FT                   SSSGTRDTIEELVMSDVSKKIPEYKGEYKTIRQDGAYIPSGENDNLIVSKLTIDKDAFG
FT                   IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYINAKKNPKEAFDFAKI
FT                   YMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRKILNDELVKAGKVF"
FT   gene            571117..572031
FT                   /locus_tag="CJJ81176_0643"
FT   CDS_pept        571117..572031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0643"
FT                   /product="phosphate ABC transporter, permease protein PstC,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR02138"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0643"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73422"
FT                   /db_xref="GOA:A0A0H3PBL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL3"
FT                   /protein_id="EAQ73422.1"
FT                   /translation="MLKEKIIKFALFLCAFVSVIVSFAIMLTILIEALKFFQKESVVTF
FT                   LFSSQWAADAAFMNADGTSKQGVFGALSLFWGTFYISLIAMLTALPLGVMCAIYLGVFA
FT                   GKKSKNYLKPILEIIAGIPTVVFGFFAAIVVAPFIVWFFSLFGIQASFQSALGAGFIMG
FT                   IMIVPIVASLSQDCIEAVSEKRINGAYALGMTKKEVVFAVILPEAIPGIVAACLLGLSR
FT                   ALGETMIVVMAASLRPNLTLNFLEDMTTVTVKIVEALSGDQAFDSSLALSAFSLGLVLF
FT                   VITLIINMFSVYLINRFHKRKNL"
FT   gene            572028..573116
FT                   /locus_tag="CJJ81176_0644"
FT   CDS_pept        572028..573116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0644"
FT                   /product="phosphate ABC transporter, permease protein PstA,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF00528;
FT                   match to protein family HMM TIGR00974"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0644"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73355"
FT                   /db_xref="GOA:A0A0H3PC03"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC03"
FT                   /protein_id="EAQ73355.1"
FT                   /translation="MKKLFKKRQKASKSFKRLCKMGLYINLIFLCIFLGSVAYLGFPAF
FT                   KQTYIFVEANRNSPSYDLLSRAEQRKIRTGQIAEKSWLLANSEVDQYMKQKYNRLSEKQ
FT                   RTLVDDLVQKGEIELKFNSNFFLNGDSKSPENSGILSSVIGTLLVMLVCMVVSVPIGVA
FT                   AAIYLEEFAPQNILTHFIEVCINNLASIPSILFGLLGLGVFINLFGMPRSSALVGGLTL
FT                   AIMSLPIIIVSTKAALKSVDINMKNAAYALGMTKVQMVKGIMLPLAMPMILTGSILTLA
FT                   GAIGETAPLMIIGMIAFIPDVASSIFDPTSVLPAQIYSWSAMPERAFLERTAAGIIVLL
FT                   GLLVVLNLSAILLRKYFQGKLK"
FT   gene            573113..573853
FT                   /gene="pstB"
FT                   /locus_tag="CJJ81176_0645"
FT   CDS_pept        573113..573853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="CJJ81176_0645"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR00972"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0645"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73478"
FT                   /db_xref="GOA:A0A0H3PBN9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBN9"
FT                   /protein_id="EAQ73478.1"
FT                   /translation="MIAKTTNLNLFYGKKQALFDINMQIEQNKITALIGASGCGKSTFL
FT                   RCFNRMNDKIAKIDGLVEIEGKDVKNQDVVALRKNVGMVFQQPNVFVKSIYENISYAPK
FT                   LHGMIKNKDEEEALVVDCLQKVGLFEEVKDKLKQNALALSGGQQQRLCIARALAIKPKL
FT                   LLLDEPTSALDPISSGVIEELLKELSHNLSMIMVTHNMQQGKRVADYTAFFHLGELIEF
FT                   GESKEFFENPKQEKTKAYLSGAFG"
FT   gene            573915..574526
FT                   /locus_tag="CJJ81176_0646"
FT   CDS_pept        573915..574526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0646"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0646"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73301"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBX9"
FT                   /protein_id="EAQ73301.1"
FT                   /translation="MIINQIYSIDSCDDVELNIKRGSKLEFRLTYDDSKEIEAIICIIP
FT                   GGAEDMNSYIYIDDYLTRNYKVAVININYHCIGNRPHLGSSFYLDDIDKFILDTSLKAI
FT                   NLKCINVYGINSYENLNNAFIRIDQEIQKLKLNQQLHQNYKLKTHVSFLPFKNEYQNFG
FT                   IMQAMDILNAIFYIKENSPFKLMRGGVLERFCLEIHMVDI"
FT   gene            574496..575143
FT                   /locus_tag="CJJ81176_0647"
FT   CDS_pept        574496..575143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0647"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73250"
FT                   /db_xref="InterPro:IPR022605"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBD8"
FT                   /protein_id="EAQ73250.1"
FT                   /translation="MFGNSYGGYLANLCAKIAPWSIDFILDNSSFVNLFGNIFRLIGFG
FT                   KEIDFTRYHGTYDDTLFKNIFLYLSDKTYWNNNKFSKNYFSNARKIIREPLNKEHLIIQ
FT                   SLYPNPKYILYHSIFDERSPFKNKENFVHILKELNFKVEFFAISQVDNKFIKNLNHGMG
FT                   LSTKLFFKKHLLQILKEPLQDKICKKEVSYKCDELVYTFKEENHQIILNITN"
FT   gene            575233..576549
FT                   /locus_tag="CJJ81176_0648"
FT   CDS_pept        575233..576549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0648"
FT                   /product="MATE efflux family protein"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0648"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73159"
FT                   /db_xref="GOA:A0A0H3PB88"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB88"
FT                   /protein_id="EAQ73159.1"
FT                   /translation="MAKKQLSLTRLSFPIFWDLLSKYLTVIINTAMVSHYSNFLVGAMG
FT                   AGNQILDLFITIFSFLSVGCSVLIAQAIGAKDHVLARKVIHQSLFLNALLGFVCGVLIL
FT                   WHGEYLLYLLKIPQELLKDSEIYLHMLAICLFFDAIGIVLAAIVRVYNMAYWVMFIGFL
FT                   MDIVVICGNYYVLHYTKSELFGVGLSNIFARIVAIVALFAILFYKLKIHLKIKEMIKLE
FT                   KEVLKKVLNIGGFSAGENLLWIVQYTIAFAFVASLGEASLSVQTIYFQISMLIMLIGQA
FT                   TSIANEIIVGKLVGARYENIAYKHAWRALYFSVIASALVAFLNYLCQDFTMQILGLKEE
FT                   LKNLMIPLFALSIFLEISRTFNIVMVNSLRASGDAKFPFFSGLVFMMGVSLPVGYVLCF
FT                   HFNLGILGVWIGFCADEFLRGMVNSYRWKSKKWQGKALV"
FT   gene            576525..577172
FT                   /locus_tag="CJJ81176_0649"
FT   CDS_pept        576525..577172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0649"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01863"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0649"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72989"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK6"
FT                   /protein_id="EAQ72989.1"
FT                   /translation="MARQSSSLKSFIYKDECYFYSKKCIKTLRLRLNEKGEFVLSIPYF
FT                   CTFKSVYEFLDKSSSWMNEAKKRFEKKALKDDELIFLAKKYQIIFDENVKKTYFNKDKI
FT                   LCQNKAKLDLFLRQNAKKIFTFYLKKWSQKTGLFYTHLSIKNMKTRWGSCNHNKAYVNL
FT                   NLKLIQKSLRAIEYVILHEISHLKFPNHSKEFYTFIEHFMSDFRQREKEFLS"
FT   gene            577214..578734
FT                   /locus_tag="CJJ81176_0650"
FT   CDS_pept        577214..578734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0650"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0650"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73074"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PIX1"
FT                   /protein_id="EAQ73074.1"
FT                   /translation="MTLDFDFIYNADNDIFEYLLRFYAKNYNYILSKEENTYHFSIDAD
FT                   EENLKTFCDSLNFMSHSVFLKKFDVKAGQGFNPCIPEDKEFSRFSYITHLNSNAYQEKK
FT                   LLNKNEWGVFCECEFSSNLSEFEKINEENFNTFLNLAFDLLSQEKKIYLKDKNGIYEFS
FT                   LFKNEFIGDFLLPCDIKAINSVFVCSNENLKLLASLEKPLMKLRLNAMFRKNHNLDFSD
FT                   FKIRLARDLFCFALGLKLFENEYKFLSVKKIEEYQKDFYISALDEQVVVLEGFEFINAK
FT                   ARELIFSKEDKNMARISYLVSRYKEKAFILELSKDYEDILLINKELNLLKLCLPKHSKE
FT                   LYEEIKKDEIGARLLENFSKEFPLLDESFELQNNFYSLFGLVGRVLNLGKNLQESVSEL
FT                   LKIADESKMPRGVKIDYRLKEDKSFDYTRTLRSAMSFMLAGVDSVNIAYGAVESLAYFL
FT                   RDTYDELREKKQSDLALISGSLFEHKSLLKNTLKHLKNCQLSDVPLRV"
FT   gene            578715..580901
FT                   /gene="hypF"
FT                   /locus_tag="CJJ81176_0651"
FT   CDS_pept        578715..580901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="CJJ81176_0651"
FT                   /product="[NiFe] hydrogenase maturation protein HypF"
FT                   /note="identified by match to protein family HMM PF00708;
FT                   match to protein family HMM PF01300; match to protein
FT                   family HMM PF07503; match to protein family HMM TIGR00143"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0651"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73361"
FT                   /db_xref="GOA:A0A0H3PAS2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAS2"
FT                   /protein_id="EAQ73361.1"
FT                   /translation="MYHLGYKIKISGLVQGVGFRPLVYELALKSKLFGEVRNDGFGIEI
FT                   ILACTQKECENFIENLKNHLPPLARIDQLIITQISILNYENFSITPSLENTKSTPMLSD
FT                   FALCKECKKEFFDEKNPRFLYPFITCTHCGPRFSIIKSLPYDRFNTSMQELLMCEFCKS
FT                   EYEDPKNRRFHAQPISCPKCKINVFLKNPKGEILAKDQEAFIQSAKFLKEGKILAIKGM
FT                   GGFHLMCDAFNEEALKTLRLRKNRPKKPFALMCKDLQSTKELAFIDEKEEALLGGVLAP
FT                   IVILKAKKAFSLIAPDVDKIGIMLAYTPLHLLLFEYFKGNLVATSANLSGESIIKDEFN
FT                   LRQKLDKVFDFYLDYDREIINASDDSIAQVVNGKTMFLRTSRGLNPFYLERNFNKKGTF
FT                   LALGAELKNEFVIFYENKLLISPYIGDLKSLDVHERFFKLLEFFKQNYDLKFDAILCDK
FT                   HPHFSYAKEFEERIKISHHYAHFCAAYFEYEENFAKDEKALAFICDGTGYGEDGKIWGG
FT                   EVFVGNLKEYERIAHFENFTLINSDIKNIQNLALSLIFHYDLEDKAKEFLAKIPKIELE
FT                   NLKKIYSHSNLQTSSLGRIIDAFGSIVFNLEKSSYEAQVGLMCEAFYDKNLDFSYKLFV
FT                   EKGQVNFKNLILGALQDEKTKAITGMFNALANFIIDFSKDYDLKVLLSGGVFQNKTLLE
FT                   ILKAKNFDFFIPLKYPCNDSSIALGQMVHFLKKE"
FT   gene            580974..581717
FT                   /gene="hypB"
FT                   /locus_tag="CJJ81176_0652"
FT   CDS_pept        580974..581717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypB"
FT                   /locus_tag="CJJ81176_0652"
FT                   /product="hydrogenase accessory protein HypB"
FT                   /note="identified by match to protein family HMM PF02492;
FT                   match to protein family HMM TIGR00073"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0652"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73481"
FT                   /db_xref="GOA:A0A0H3PAZ6"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAZ6"
FT                   /protein_id="EAQ73481.1"
FT                   /translation="MCKDCGCSINSSHTHDHHHDHHHENPSLKESKTIEVISKILSKND
FT                   EEAKHNRAHFNEANTLCINLMSSPGSGKTTLLESTIKALKNELKIAVIEGDLETNNDAI
FT                   RVKNAGALAYQITTGQSCHLDAFMVHEALHHLAIDDVDLLFIENVGNLVCPASYDLGEH
FT                   LNVVLLSVTEGSDKPQKYPVMFKKADIVLITKADLAHHFDFDVKEATRLIKELNPRADI
FT                   ITLDAKNGTNMELWYKVLKLKKELF"
FT   gene            581717..581998
FT                   /gene="hypC"
FT                   /locus_tag="CJJ81176_0653"
FT   CDS_pept        581717..581998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypC"
FT                   /locus_tag="CJJ81176_0653"
FT                   /product="hydrogenase assembly chaperone HypC/HupF"
FT                   /note="identified by match to protein family HMM PF01455;
FT                   match to protein family HMM TIGR00074"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0653"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73366"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC09"
FT                   /protein_id="EAQ73366.1"
FT                   /translation="MCLSIPSEILEIDELNNALVQTLGVKRKVNLDLIDEPLKQGDYVL
FT                   IHVGVAMEKIDKEAALESIKTYQEIVEKMNSGEIKSDEGDLGLNEFHR"
FT   gene            581982..583073
FT                   /gene="hypD"
FT                   /locus_tag="CJJ81176_0654"
FT   CDS_pept        581982..583073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="CJJ81176_0654"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="identified by match to protein family HMM PF01924;
FT                   match to protein family HMM TIGR00075"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0654"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73311"
FT                   /db_xref="GOA:A0A0H3PBG3"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBG3"
FT                   /protein_id="EAQ73311.1"
FT                   /translation="MNFIDEFRDKESILALKKLIEQELKNPINIMEICGGHTHSIMKYA
FT                   LPSILPKEINFIHGPGCPVCVMPRVRIDTAIKLASMKDTIFCTLGDLLRVPGSEISLLD
FT                   LRAKGADVRALYSPLEVLEIAKQNLNKNIIFFAIGFETTTPMSALLLQKIIEEKINNVF
FT                   FHINHITVPAPVEAIMNDENVKINAFLGPSHVSVITGYGIYEPLAAKFKTPIAVSGFEP
FT                   VDILESVLNIIKQSNEGTFKVYNQYKRAVSKEGNIKAQNLVKKYFRVCDFEFRGLGLIK
FT                   DGGLELKEEFSAYDASKKFDCTVQSKNESKACICGQILRGLAKPYDCKVFGKACTPRSP
FT                   IGSCMVSGEGACAAYYKYSKVNV"
FT   gene            583070..584044
FT                   /gene="hypE"
FT                   /locus_tag="CJJ81176_0655"
FT   CDS_pept        583070..584044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypE"
FT                   /locus_tag="CJJ81176_0655"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR02124"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0655"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73009"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBL4"
FT                   /protein_id="EAQ73009.1"
FT                   /translation="MKNISLAHGGGGEEMNELLTKLFKIFDNEILNANNDAAILGNLAL
FT                   STDSFVLSPIFLDEEVNIGKLCVCGSINDVLMVGAKPKYLSLGLILEEGFELEKLERIL
FT                   KSIKEECEKCGVMLVCGDTKVVPKGKADEIYINTTALGEIISKKESKNIKAGLSILLSG
FT                   DIGRHGASVLIKRNELEADVKSDCKALDKEVLELLEKDIKVVAMRDATRGGLSAVLNEW
FT                   AKQSGNDLLIFEEKIIVQDEVLGLCELFGYEAYELANEGTFILCVEKEDELKALEILKK
FT                   YNVNASIIGEVLEEKKARVILQNAYGAKRFLESPKGELLPRIC"
FT   gene            584044..584388
FT                   /gene="hypA"
FT                   /locus_tag="CJJ81176_0656"
FT   CDS_pept        584044..584388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypA"
FT                   /locus_tag="CJJ81176_0656"
FT                   /product="hydrogenase nickel insertion protein HypA"
FT                   /note="identified by match to protein family HMM PF01155;
FT                   match to protein family HMM TIGR00100"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0656"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73213"
FT                   /db_xref="GOA:A0A0H3PJ56"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ56"
FT                   /protein_id="EAQ73213.1"
FT                   /translation="MHELSIVESLIELCEENALNNKAYNVQEIYVKIGRLSGIEADLFK
FT                   RCFETFKENSNICKNAKLFIELAPLEILCLKCDQTSILEENVFKCPKCQSIEYKITQGE
FT                   DLHLMRLVME"
FT   gene            complement(584630..585367)
FT                   /locus_tag="CJJ81176_0657"
FT   CDS_pept        complement(584630..585367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0657"
FT                   /product="prophage Lp2 protein 6"
FT                   /note="identified by match to protein family HMM PF04313"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0657"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73172"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PB94"
FT                   /protein_id="EAQ73172.1"
FT                   /translation="MTFIMPFLKTLGYDVFNPSIVVPEYTADIGTKKGEKVDYAIFKDS
FT                   KPFILIEAKNHTENLDNHNNQLVRYFNTNPSIKFAILTNGIEYRFFTDIEQQNLMDKIP
FT                   FLVVNLEKLKPRDIKDLKRFICTDLNLDEILSIAMEKKYYRSIQEIFKSEIENPSDEFT
FT                   SFFAKQMTEKRMTSAVLEEFKNYIKKSFKEIINDLAYEKITSIKNNLQNINDDENDEQI
FT                   DEKRYCHNRRRITRFLYSKINSC"
FT   gene            complement(585430..586398)
FT                   /locus_tag="CJJ81176_0658"
FT   CDS_pept        complement(585430..586398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0658"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06144"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0658"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72985"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAA0"
FT                   /protein_id="EAQ72985.1"
FT                   /translation="MYRKELQTLLSKDSIPNFFFLYGADNFQSELYAEFIKEKYKPDET
FT                   LKLFFEEYNFTRASDFLSAGSLFSEKKLLEIKTSKKNPTKDLKILVELCKNNTNNFFLL
FT                   ELYDENSKQSDIEKIFSPHFARFFKANGAKEGVELLSIKAKQLGVEITQNALFTLFTSF
FT                   DENLYLAASELNKFSGLRVDEKTIEQYCYSLNTGSFESFFEKILKKQDFKSELEKILDN
FT                   FNEIALINSLYNSFYRLFKIALYAKVNGKIDFKDLLGYTPPPQVGQNLSSQAFSLKIEQ
FT                   YKEIFTLLLKCEYELKTNSKLVKKEFLISNLLKLARILKIN"
FT   gene            complement(586391..588325)
FT                   /locus_tag="CJJ81176_0659"
FT   CDS_pept        complement(586391..588325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0659"
FT                   /product="RNB-like protein"
FT                   /note="identified by match to protein family HMM PF00773;
FT                   match to protein family HMM PF08206"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0659"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73339"
FT                   /db_xref="GOA:A0A0H3PEW9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEW9"
FT                   /protein_id="EAQ73339.1"
FT                   /translation="MKEFLNSLSYGISSHEVSNEFKQILRELLANHIIKEHKSKYYLNN
FT                   GFAFGVLDISSKGTGFLQCFDESFKKDLLIENKNLKGANYKDIVAVKLLPLKKKRPSAK
FT                   VILVLKRANETSLVITKRYGEAVLGMNIKTGLSTALKASQKSLKALPLGTILKIENENN
FT                   NIIEVLGHIDDESVDEKISLALFNKNNEFSDACIKEALANGDSVDASMYENRMDLRALP
FT                   FCTIDPIHAKDFDDAIYFDIQKREIYVAIADVSEYVYAYSAIDKEARNRGFSIYFPHIA
FT                   IPMLPRPLSENICSLKPHLDRLAYCFKIALDHENKVIKEELFEGIINSKRRFNYDEVDE
FT                   ILIQKPDLKELSWLYELFEITKNLRKMRLKNAFEFRTEELRMNLDENLSLKSTVFEKDT
FT                   PSHNLIEDCMLLANKAAAKLIDIGVFRNHLSADARKIDKLLNELRELGIDVNFKPNLPE
FT                   LIRDIQALSDELNLRAEVDKLIIKAQKKAEYSSINAGHFGLGFDKYSHFTSPIRRYSDL
FT                   ILHRLLKAKQKNDEKLFNYLLLNIESTCESLSTLEREADKVAFDFMDRKFARWAAKNIG
FT                   KKFKALVVQNDGVCIAKLDDEIKGADIILYDTRVNLLESVEVQIMEADIVMAKIYAKIT
FT                   QRLIKEENV"
FT   gene            588444..589466
FT                   /gene="ilvC"
FT                   /locus_tag="CJJ81176_0660"
FT   CDS_pept        588444..589466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="CJJ81176_0660"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF02629; match to protein
FT                   family HMM PF07991; match to protein family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0660"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73148"
FT                   /db_xref="GOA:A1VYZ2"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYZ2"
FT                   /protein_id="EAQ73148.1"
FT                   /translation="MAITVYYDKDCDLNLIKSKKVAIIGFGSQGHAHAMNLRDNGVNVI
FT                   IGLREGSVSAVKAKNAGFEVMSVSEASKTADVVMILAPDEIQADIFNVEIKPNLSEGKA
FT                   IAFAHGFNIHYGQIVAPKGIDVIMIAPKAPGHTVRNEFTLGGGTPCLIAIHQDESKNAK
FT                   NLALSYASAIGGGRTGIIETTFKAETETDLFGEQAVLCGGLSALIQAGFETLVEAGYEP
FT                   EMAYFECLHEMKLIVDLIYQGGIADMRYSISNTAEYGDYITGPKIVTEETKKAMKGVLK
FT                   DIQNGVFAKDFILERRAGFARMHAERKNMNDSLIEKTGRNLRAMMPWISAKKLVDKDKN
FT                   "
FT   gene            589470..590552
FT                   /locus_tag="CJJ81176_0661"
FT   CDS_pept        589470..590552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0661"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04748"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0661"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73227"
FT                   /db_xref="GOA:A0A0H3PEQ4"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEQ4"
FT                   /protein_id="EAQ73227.1"
FT                   /translation="MSKKKLVQIQRYLIIAILFLLCIALALGILVKYQNSQDVFSVKPD
FT                   YFIDKQEDLISSNKDHYEIGIFQENEFDNNKSVSILEQKIQEIDDLNTSLNEQNLSSVE
FT                   QNLSLEQNQSLEQNFIPKDTNLTQDQNLTFDEDIHLNKISKKPKLAIIIDDMANASQVR
FT                   GLKALNLKLNPSFFPPDKNHSETPKLALKFDFYMVHLPLAAINYNKPEIDTLNPNDSKE
FT                   RIFKKIKQIKKDFKDLRYINNHTGSLFTSNEEAMRKLYEALKNQNIFFVDSKTIGNSKA
FT                   NKIAKELSMPYIQRDVFLDNEDDVNYVKKQLESAVKLAQKKGFVIAIGHPRKNTFKALE
FT                   QSKDLLKGVDLVYLSEIYGK"
FT   gene            590542..591315
FT                   /gene="dprA"
FT                   /locus_tag="CJJ81176_0662"
FT   CDS_pept        590542..591315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="CJJ81176_0662"
FT                   /product="DNA processing protein A"
FT                   /note="identified by match to protein family HMM PF02481"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0662"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73408"
FT                   /db_xref="GOA:A0A0H3PC25"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PC25"
FT                   /protein_id="EAQ73408.1"
FT                   /translation="MASEILPDEFLELFKDLKKPPKKLHYKGNLSLLKQDKIAIIGSRR
FT                   MSVYTKNCVFSLASMLKNAHLCVVSGGALGVDITASIAAMPNTIGIFANGLDQIYPRTN
FT                   EKIIKQIYENALALSEYEDDYLPKNYDFLLRNRLVIALSKAVVVAQADIKSGSMQSAKL
FT                   ALELNKPLYVLPQRLGESTGTNLLLKENKAKLICDFKEFVSEFASIDTNQDEFLEFCKK
FT                   GVSVDEALKIYGQKVYEYELEGKISIEGLFIRVLV"
FT   gene            591312..591695
FT                   /locus_tag="CJJ81176_0663"
FT   CDS_pept        591312..591695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0663"
FT                   /product="conserved hypothetical protein TIGR00250"
FT                   /note="identified by match to protein family HMM PF03652;
FT                   match to protein family HMM TIGR00250"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0663"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73438"
FT                   /db_xref="GOA:A1VYZ5"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYZ5"
FT                   /protein_id="EAQ73438.1"
FT                   /translation="MRALALDVGLKRIGVALCVDKKIALPLDAVLRKNRNQAANEIKNL
FT                   LKIHEISLLIVGIPKGGSREEEMTRRIKHFVSLLEFDKEICFVDESGTSKEALGYGVAN
FT                   TRKKDGKLDSLSAFIMIKDYFAL"
FT   gene            591724..592563
FT                   /locus_tag="CJJ81176_0664"
FT   CDS_pept        591724..592563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0664"
FT                   /product="NOL1/NOP2/sun family protein"
FT                   /note="identified by match to protein family HMM PF01189"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0664"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72967"
FT                   /db_xref="GOA:A0A0H3PA91"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PA91"
FT                   /protein_id="EAQ72967.2"
FT                   /translation="MQNILSSFAQEKNVCVFANTLKTSIEELEKEFLKQNLKFKKINAY
FT                   CYLFDAKDKAILSSMKAFNEAHFYIQNYSSYLCALNLEVKAGQSVLDMCAAPGGKSINL
FT                   ANFMQNTGYLACNEMSRDRFFILQKNLKNYGVNAKVFMKDGKNIGNLCPLKFDKILLDA
FT                   PCSTFAKIGFDLEKSYKEIKNIAKTQKKLLHSALKALKIGGELVYSTCTFTKEENEEVI
FT                   ENALKSEFKLELLDIDLENVEAKAGQSEEFAEISKCRRILPSLDYDGFFIAKLRKLC"
FT   gene            complement(592739..593236)
FT                   /gene="msrA"
FT                   /locus_tag="CJJ81176_0665"
FT   CDS_pept        complement(592739..593236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="CJJ81176_0665"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="identified by match to protein family HMM PF01625;
FT                   match to protein family HMM TIGR00401"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0665"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73147"
FT                   /db_xref="GOA:A1VYZ7"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYZ7"
FT                   /protein_id="EAQ73147.1"
FT                   /translation="MKNIVLGGGCFWCVEAVFERLKGVIDTEVGYSGGNPNPSYESVCN
FT                   GDGNIEVVKINYDEKQISLLEILTLFFKIHDPTSIDKQGGDIGIQYRSIIFYENEEDKI
FT                   LAQNFIEEQQKIFSKKIVTKISRLQTYYKAENYHQHYFINNPNQGYCQAVIAPKLQKIQ
FT                   SD"
FT   gene            complement(593277..593795)
FT                   /gene="ppa"
FT                   /locus_tag="CJJ81176_0666"
FT   CDS_pept        complement(593277..593795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppa"
FT                   /locus_tag="CJJ81176_0666"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="identified by match to protein family HMM PF00719"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0666"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73104"
FT                   /db_xref="GOA:A0A0H3PEH9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEH9"
FT                   /protein_id="EAQ73104.1"
FT                   /translation="MDLSKIKIGDIPNKINAVIEIPYGSSIKYEIDKDSGAIMVDRVMA
FT                   SAMFYPANYGFIANTLADDGDPVDILVLNEYPIQAGAVIPCRLIGVLIMEDESGMDEKL
FT                   LAVPNSKIDARYDNIKTYTDLPQATLNKIKNFFETYKILEPNKWVKVQDFKDEKAAIEI
FT                   LEKAIKNYK"
FT   gene            complement(593805..594383)
FT                   /gene="adk"
FT                   /locus_tag="CJJ81176_0667"
FT   CDS_pept        complement(593805..594383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="CJJ81176_0667"
FT                   /product="adenylate kinase"
FT                   /note="identified by match to protein family HMM PF00406"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0667"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73369"
FT                   /db_xref="GOA:A1VYZ9"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VYZ9"
FT                   /protein_id="EAQ73369.1"
FT                   /translation="MKELFLIIGAPGSGKTTDASLIAQADATNITHYSTGDLLRAEVAS
FT                   GSELGKTIDSFISKGNLVPLDVVVNTIVCALKAAPTKTIIIDGYPRSVEQMMEFDKVLS
FT                   EQNEICLKGVIEVRVSEEVAKERVLGRNRGADDNEEVFYNRMKVYTEPLNEILDFYQKK
FT                   KLHFIIDGERTIEPIVADMKELIKKIQSI"
FT   gene            complement(594380..596131)
FT                   /gene="aspS"
FT                   /locus_tag="CJJ81176_0668"
FT   CDS_pept        complement(594380..596131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="CJJ81176_0668"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="identified by match to protein family HMM PF00152;
FT                   match to protein family HMM PF00587; match to protein
FT                   family HMM PF01336; match to protein family HMM PF02938;
FT                   match to protein family HMM TIGR00459"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0668"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73241"
FT                   /db_xref="GOA:A1VZ00"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VZ00"
FT                   /protein_id="EAQ73241.1"
FT                   /translation="MRSHYNTDLGISHVGQSVKLCGWVNSYRDHGGVIFIDLRDRSGII
FT                   QLVCDPNDSKEAHEIASNARNEFVLIAEGAIRPRGEGLVNPKLKTGEIEVVVSKLTIEN
FT                   ESAVPPFTIADESVNEELRLKYRFLDLRNPKLYENFALRSKACIAARNSLANMGFLEVE
FT                   TPILTKATPEGARDYLVPSRVHQGEFYALPQSPQLFKQLLMCSGFDRYFQIAKCFRDED
FT                   LRADRQPEFTQIDVEMSFCEQKDVINVAETFLKDIFKACGKEIQTPFRQMQYKDAMENY
FT                   GSDKPDLRFDLKFIDVIDIFAKSNNEIFANIAKDTKKNRIKAIRVPKGDTIFSKRQMQR
FT                   FEEFVRKFGAQGLAFIQVKEDGLKGPLCKFFSEEDLNELSKRCELEVGDVVFFGAGAKK
FT                   TVLDYMGRFRIFLANELNLIDPNALEFLWVVDFPMFEQNDDGSYSAMHHPFTMPKNIDE
FT                   TDLEEISSIAYDVVLNGVELGGGSIRIHKNDIQQKVFKLLNIDEEQQKEKFGFLLDALS
FT                   FGAPPHGGIAIGLDRLIMLVTGANSIREVIAFPKTQRAQCLMTDAPSPASNEAMRELGI
FT                   KLRENIK"
FT   gene            596222..597082
FT                   /locus_tag="CJJ81176_0669"
FT   CDS_pept        596222..597082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0669"
FT                   /product="ATP-NAD kinase, putative"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0669"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72980"
FT                   /db_xref="GOA:A1VZ01"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1VZ01"
FT                   /protein_id="EAQ72980.1"
FT                   /translation="MQNKIDHKNIKTIGLVTRPNVSLDKEILKLQSILSIYKVELVLFK
FT                   ESSEILDLPKYGLDDLFKISDFVISLGGDGTLISLCRKACEYDKAVLGIHAGHLGFLTD
FT                   FKVDEAENFFQAFFQGEFRIEKPYLLSVFLEDKQGKILEKLAFNDVVISKNNQASMAHI
FT                   EVFRKEKKFNEYFGDGLIVATPAGSTAYNLSANGPIVYTLAQAFILTPVCSHSLTQRPI
FT                   VLPKGFEIEIMAKDCILCIDGQENYKMNDFKSIKVGLSDKNVALIHPKNRDYFQILKEK
FT                   LHWGN"
FT   gene            597082..598605
FT                   /gene="recN"
FT                   /locus_tag="CJJ81176_0670"
FT   CDS_pept        597082..598605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="CJJ81176_0670"
FT                   /product="DNA repair protein RecN"
FT                   /note="identified by match to protein family HMM PF02463"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0670"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73417"
FT                   /db_xref="GOA:A0A0H3PJI4"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJI4"
FT                   /protein_id="EAQ73417.1"
FT                   /translation="MINRIFMKENLGFKKAELEISKGLTVFTGLSGAGKSVLFKGILSA
FT                   FSLSESEAKIVEIELDDKLDLESFGIESEEENVFKLLKEKNTKYFINNQSIAKKSLQNL
FT                   SKTFIKYLSAKENNEFGNEKFLNLLDALEMQENTNFISFLEDFKKDFNAYSQISNELNA
FT                   ILEEEKKVEELKELARVQIEKISSINPKIGEYEELLILKKKLSKKDKLEEAWSKAERIF
FT                   ELEKVVIEALNLSEVDASFFSECLNELRVICENQKMEDLDFDVETLLDRIENLSYLIKR
FT                   YESIENALEVLKQKKHELEHYENLSFEKKELEKKFQELKQKLEEKAQILTQTRKKNLKK
FT                   LEKCLNNYLKDLYMKDASLTLKENEKISILGKDEMMLDINLAHLKNLSSGELNRLRLAF
FT                   IATECKILNAGKGILFLDEIDANLSGKEAMSIAKVLEELSKFYQIFAISHLPQLSSKAH
FT                   NHFLVEKNGEESKVKKLDQEERIKELARMVSGELVSDEAIEFAKTLFKD"
FT   gene            598708..599952
FT                   /locus_tag="CJJ81176_0671"
FT   CDS_pept        598708..599952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0671"
FT                   /product="response regulator/GGDEF domain protein"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0671"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73194"
FT                   /db_xref="GOA:A0A0H3PJ41"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PJ41"
FT                   /protein_id="EAQ73194.1"
FT                   /translation="MNKKILIIDDNKMLGKLLAKKIQMTLDYEVDIAFGFAEAKELMNN
FT                   DYFLAFVDLCLPDAPNGEVVDYVIEKKIPAIVLTASGDKATKEKFMDKDILDYIFKESE
FT                   TCIDEIISSIVKLNQYAKTKVILAMSKLPERNEIKKILTQRQFNVLAAAHGEEAMSYLN
FT                   DNNDVKLIIADVNMPVISGFELLTQVRERFSDDELGVILLGDHNDSFEANSFKNGVNEY
FT                   LFKPLSKESFNCRLDRCLSYMDDKKFLSTYNVLDPVSGVKNYNALIDGIDDYFNEIATK
FT                   DEEFAFAFLDIDNLQMINDEYGREVGDEVIKICANEIVNETKGRDLVGRYSAEKICILL
FT                   KNISQERAIKIFSRIRVNIKKAGVLVNLDEVFFTASIGVVFGKSGDKIDSLVDKASKIL
FT                   SQAKDNGKDRVEVCS"
FT   gene            599943..600758
FT                   /locus_tag="CJJ81176_0672"
FT   CDS_pept        599943..600758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0672"
FT                   /product="hydrolase, TatD family"
FT                   /note="identified by match to protein family HMM PF01026;
FT                   match to protein family HMM TIGR00010"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0672"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73143"
FT                   /db_xref="GOA:A0A0H3PAG9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAG9"
FT                   /protein_id="EAQ73143.1"
FT                   /translation="MFLNLDFQDGLRIVDTHCHLDSEAFKDDLDETLNRAFKNGIEKII
FT                   IPGADIKDLPYAATIAHKYKNIFFAAGVHPYEIDNYDEKILRQYLCDEKCVAVGECGLD
FT                   YFRFKSDLAEEIQKEKENQKKIFIAQLELAIEFKKPVIIHSREANHDTYEILHGYSKDL
FT                   VGGVLHCFNASEHLLTLFEEGFYFGIGGVLTFKNAKKLVEILPKIPKDKLLLETDAPYL
FT                   TPEPYRGKRNEPLLTQFVANKMCEVLNLSRKELLEICFNNSEKLFFKGY"
FT   gene            600758..601876
FT                   /locus_tag="CJJ81176_0673"
FT   CDS_pept        600758..601876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0673"
FT                   /product="membrane-bound lytic murein transglycosylase D,
FT                   putative"
FT                   /note="identified by match to protein family HMM PF01464;
FT                   match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0673"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73142"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBR2"
FT                   /protein_id="EAQ73142.1"
FT                   /translation="MKKILLCFLICFNFLFAQINTPEFYERQMNVLRNLDINPSFISDL
FT                   IFVQTQQDIKSKHAQTLIDSMQNFSKVTPMIRKILAQQEVPDEILYLAMVESGLKTHSV
FT                   SNAKAVGVWQFMQPTARNLGLRIDAYVDERRDPVKSTYAATNYLKELKEEFGKWYLALL
FT                   AYNCGNGKLRQVIKQAGSDDLSVLLNPDKKYLSLETRNFIRKILTLAFLANDRDFLLDK
FT                   DASLMNYALSNEFAKVDVPSSASLKEIAKNLNMDLATFKKYNPQFKHNFTPPGKGYYMY
FT                   IPLNKVAFFDKNFKAEKLAKVDTTIPMTRTYTVKSGDSLYKIAKNYNISVDEIREFNKI
FT                   AKNHLSINQKLIIPIKENKNANKNNYTKVVSR"
FT   gene            601863..602663
FT                   /gene="rlpA"
FT                   /locus_tag="CJJ81176_0674"
FT   CDS_pept        601863..602663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="CJJ81176_0674"
FT                   /product="rare lipoprotein A"
FT                   /note="identified by match to protein family HMM PF03330;
FT                   match to protein family HMM PF05036; match to protein
FT                   family HMM TIGR00413"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0674"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73111"
FT                   /db_xref="GOA:A0A0H3PEI3"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PEI3"
FT                   /protein_id="EAQ73111.2"
FT                   /translation="MSAVSLGALFFSGCLGTSFFSSLDNAQVYYPSNDFKSSPSSSGTK
FT                   GTMKPYTINGKTYYPTVVAVGETADGIASWYGPGFHGKKTSNGETYNQNALTAAHKTLP
FT                   MNTILKVTNLNNNRQVTVRVNDRGPFVNNRIIDLSKGAASQIDMIASGTAPVRLEVIGF
FT                   GSSNSGNNIVHSNVNYGNSGEIANNGQIYEGGNFMVQIGAFKNPAGAQTIAARYKTYRT
FT                   YSSTIRTSSVDGLNRVFLTGFRSEDEARDFAASGAFAGAFVVRE"
FT   gene            602669..603157
FT                   /locus_tag="CJJ81176_0675"
FT   CDS_pept        602669..603157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0675"
FT                   /product="phosphatase, YrbI family"
FT                   /EC_number="3.1.3.-"
FT                   /note="identified by match to protein family HMM TIGR01662;
FT                   match to protein family HMM TIGR01670"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0675"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73049"
FT                   /db_xref="GOA:A0A0H3PAC8"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PAC8"
FT                   /protein_id="EAQ73049.1"
FT                   /translation="MTELIFLDVDGCLTDGKIIYTSNGEFIKEFDVKDGAAIEAWLKLG
FT                   KKIAIITGRNCPCVEKRAKDLKIKILYQGIKDKLACAKEILQKLNLDFSQCAAIGDYFN
FT                   DKALLESVGLSFKPKDGHKDLNVDIVLSKKGGKAAVAQMIEILVEKNHLEEEWNKLWL"
FT   gene            603211..603663
FT                   /locus_tag="CJJ81176_0676"
FT   CDS_pept        603211..603663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0676"
FT                   /product="hypothetical protein"
FT                   /note="identified by match to protein family HMM PF06835"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0676"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ72977"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3PBK2"
FT                   /protein_id="EAQ72977.2"
FT                   /translation="MQDPYSLNLQTNALNFKNIEAKNLKAYESNTSIIKAYYKANSWVR
FT                   YADRDEFNDFITLNLDFNLSANRLEFFNKDMSKVLFEGNVTYIGSNNVKIISQEVEYQP
FT                   KDKILHTNTNFKALINGSIINGNTLNYDVKNKILNIQGVNAWLQDK"
FT   gene            603645..604106
FT                   /locus_tag="CJJ81176_0677"
FT   CDS_pept        603645..604106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CJJ81176_0677"
FT                   /product="OstA family protein"
FT                   /note="identified by match to protein family HMM PF03968"
FT                   /db_xref="EnsemblGenomes-Gn:CJJ81176_0677"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ73449"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniPr